BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25904_g3_i4 len=2088 path=[9105:0-283 9389:284-312 7401:313-336
7425:337-385 4068:386-387 7475:388-498 10796:499-541 3322:542-558
3339:559-585 7666:586-612 4530:613-628 4546:629-830 12471:831-844
3161:845-868 12500:869-954 12561:955-963 8034:964-978 1560:979-994
12583:995-1004 12593:1005-1021 12610:1022-1051 10536:1052-1125
8182:1126-1159 12660:1160-1171 12672:1172-1174 8230:1175-1244
8300:1245-1274 4994:1275-1283 8338:1284-1413 12721:1414-1432
12740:1433-1527 12794:1528-1560 3496:1561-1562 3498:1563-1596
12856:1597-1617 8663:1618-1618 2991:1619-1624 4792:1625-1658
12900:1659-1664 8706:1665-1688 8730:1689-1991 2154:1992-2087]

Length=2088
                                                                      Score     E

ref|XP_009795659.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       570   0.0      
ref|XP_009615005.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       569   0.0      
ref|XP_011017699.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       513   2e-172   
emb|CDP01584.1|  unnamed protein product                                510   4e-171   
ref|XP_009768273.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       504   1e-168   
gb|KDP29778.1|  hypothetical protein JCGZ_18713                         503   4e-168   
ref|XP_009803298.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       503   7e-168   
ref|XP_009623238.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       502   1e-167   
ref|XP_009623233.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       498   8e-166   
ref|XP_003635105.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       497   1e-165   
ref|XP_007047762.1|  UDP-Glycosyltransferase superfamily protein,...    498   3e-165   
ref|XP_006466331.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       494   8e-165   
ref|XP_002270260.1|  PREDICTED: UDP-glycosyltransferase 91A1            492   8e-164   Vitis vinifera
gb|KDO60536.1|  hypothetical protein CISIN_1g011765mg                   491   3e-163   
ref|XP_006426251.1|  hypothetical protein CICLE_v10025508mg             490   5e-163   
ref|XP_002297733.1|  glycosyltransferase family protein                 489   1e-162   Populus trichocarpa [western balsam poplar]
ref|XP_002532392.1|  UDP-glucosyltransferase, putative                  485   3e-161   Ricinus communis
ref|XP_004250158.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       485   4e-161   
ref|XP_006353157.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       485   5e-161   
ref|XP_002270294.1|  PREDICTED: UDP-glycosyltransferase 91A1            483   3e-160   Vitis vinifera
ref|XP_006353155.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       481   1e-159   
gb|AFK35814.1|  unknown                                                 481   1e-159   
ref|XP_011000621.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       481   2e-159   
ref|XP_010023429.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       481   3e-159   
ref|XP_002318358.2|  hypothetical protein POPTR_0012s01130g             479   7e-159   Populus trichocarpa [western balsam poplar]
gb|AAM12787.1|  putative anthocyanidine rhamnosyl-transferase           476   8e-158   Capsicum annuum
dbj|BAO45905.1|  UDP-glycosyltransferase                                476   8e-158   
gb|KCW59683.1|  hypothetical protein EUGRSUZ_H02441                     476   9e-158   
ref|XP_010023433.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       475   3e-157   
ref|XP_006353158.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       474   5e-157   
ref|XP_006353156.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       473   3e-156   
ref|XP_010023432.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       471   2e-155   
ref|XP_007156463.1|  hypothetical protein PHAVU_003G288100g             470   3e-155   
ref|XP_002533517.1|  UDP-glucosyltransferase, putative                  466   1e-154   Ricinus communis
ref|XP_004253507.2|  PREDICTED: UDP-glycosyltransferase 91A1-like       466   2e-153   
gb|KEH20104.1|  UDP-glucosyltransferase family protein                  464   6e-153   
ref|XP_010023430.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       461   7e-152   
ref|XP_004143439.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       460   2e-151   
ref|XP_002315125.2|  hypothetical protein POPTR_0010s18980g             460   2e-151   Populus trichocarpa [western balsam poplar]
ref|XP_007156464.1|  hypothetical protein PHAVU_003G288200g             459   4e-151   
gb|KHN06911.1|  UDP-glycosyltransferase 91A1                            459   7e-151   
gb|KCW59684.1|  hypothetical protein EUGRSUZ_H02443                     458   9e-151   
ref|XP_003551309.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       457   2e-150   
gb|KGN48689.1|  hypothetical protein Csa_6G497390                       457   3e-150   
ref|XP_007208586.1|  hypothetical protein PRUPE_ppa023071mg             456   5e-150   
ref|XP_003552084.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       456   1e-149   
gb|KEH20103.1|  UDP-glucosyltransferase family protein                  452   2e-148   
ref|XP_004250160.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       452   3e-148   
ref|XP_004143545.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       451   4e-148   
ref|XP_011015214.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    449   5e-147   
ref|XP_008440525.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       448   9e-147   
ref|XP_004143546.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       447   2e-146   
ref|XP_010312900.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       445   1e-145   
ref|XP_002533518.1|  UDP-glucosyltransferase, putative                  445   1e-145   Ricinus communis
ref|XP_011015202.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    443   8e-145   
ref|XP_004160942.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    443   8e-145   
ref|XP_010254573.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       443   1e-144   
ref|XP_004289539.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       442   1e-144   
ref|XP_008440527.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       441   6e-144   
ref|XP_004288529.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       441   8e-144   
ref|XP_004287868.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    441   9e-144   
ref|XP_008440526.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       439   2e-143   
gb|KDP29783.1|  hypothetical protein JCGZ_18718                         439   2e-143   
gb|KDP29780.1|  hypothetical protein JCGZ_18715                         439   3e-143   
ref|XP_010277529.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    438   6e-143   
gb|KDP29779.1|  hypothetical protein JCGZ_18714                         437   8e-143   
sp|Q66PF2.1|URT1_FRAAN  RecName: Full=Putative UDP-rhamnose:rhamn...    435   1e-141   Fragaria x ananassa
gb|KDP29785.1|  hypothetical protein JCGZ_18720                         434   1e-141   
ref|XP_004143544.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       434   3e-141   
ref|XP_002325254.2|  hypothetical protein POPTR_0018s13720g             431   5e-141   Populus trichocarpa [western balsam poplar]
gb|EYU30925.1|  hypothetical protein MIMGU_mgv1a005472mg                433   8e-141   
ref|XP_004151488.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       431   6e-140   
gb|KCW59686.1|  hypothetical protein EUGRSUZ_H02446                     429   1e-139   
gb|KDP29791.1|  hypothetical protein JCGZ_18726                         428   4e-139   
ref|XP_008236324.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       428   4e-139   
ref|XP_004240255.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    428   6e-139   
gb|KDP29789.1|  hypothetical protein JCGZ_18724                         428   8e-139   
ref|XP_002270331.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    425   1e-137   Vitis vinifera
ref|XP_002532389.1|  UDP-glucosyltransferase, putative                  423   1e-137   Ricinus communis
ref|XP_007205156.1|  hypothetical protein PRUPE_ppa005394mg             424   1e-137   
ref|XP_009364807.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    424   1e-137   
ref|XP_004288503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    424   2e-137   
ref|XP_008236334.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    423   4e-137   
emb|CAN80742.1|  hypothetical protein VITISV_015059                     424   4e-137   Vitis vinifera
ref|XP_010646446.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    423   4e-137   
ref|XP_004288528.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       423   5e-137   
ref|XP_004289519.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    422   2e-136   
ref|XP_009801322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    419   1e-135   
ref|XP_008338469.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    419   1e-135   
ref|NP_565540.4|  UDP-glycosyltransferase 91A1                          419   3e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006360400.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    418   5e-135   
ref|XP_009623232.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    418   5e-135   
ref|XP_009800982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    418   6e-135   
emb|CDP01583.1|  unnamed protein product                                417   7e-135   
gb|AAD15567.1|  putative anthocyanidin-3-glucoside rhamnosyltrans...    416   2e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270369.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    415   4e-134   Vitis vinifera
ref|XP_010419269.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       415   5e-134   
emb|CDP01582.1|  unnamed protein product                                414   7e-134   
emb|CAN70983.1|  hypothetical protein VITISV_027120                     419   8e-134   Vitis vinifera
ref|XP_006294142.1|  hypothetical protein CARUB_v10023135mg             415   8e-134   
ref|XP_011084238.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    414   2e-133   
emb|CDP04856.1|  unnamed protein product                                412   4e-133   
ref|XP_004250157.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    413   4e-133   
emb|CDP21084.1|  unnamed protein product                                410   4e-132   
ref|XP_010417017.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       410   8e-132   
ref|XP_010431575.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       409   9e-132   
emb|CDP21820.1|  unnamed protein product                                408   1e-131   
emb|CDP21083.1|  unnamed protein product                                408   2e-131   
ref|XP_010472246.1|  PREDICTED: UDP-glycosyltransferase 91A1            409   2e-131   
ref|XP_011073572.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    407   6e-131   
emb|CAN80741.1|  hypothetical protein VITISV_015058                     406   1e-130   Vitis vinifera
ref|XP_006404721.1|  hypothetical protein EUTSA_v10000154mg             404   1e-129   
ref|XP_010934404.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    403   5e-129   
ref|XP_002865752.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    402   4e-128   
ref|XP_006353004.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       400   6e-128   
ref|XP_006292848.1|  hypothetical protein CARUB_v10019108mg             399   1e-127   
ref|XP_009623131.1|  PREDICTED: UDP-glycosyltransferase 91C1            399   2e-127   
ref|XP_004250156.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    399   2e-127   
ref|XP_010680364.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    398   2e-127   
ref|XP_011099970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    399   3e-127   
ref|XP_006353159.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    397   5e-127   
gb|AFJ53032.1|  UDP-glycosyltransferase 1                               396   6e-127   
ref|XP_007018258.1|  UDP-Glycosyltransferase superfamily protein        397   7e-127   
ref|NP_199780.1|  UDP-glycosyltransferase 91C1                          395   3e-126   Arabidopsis thaliana [mouse-ear cress]
gb|AFJ53033.1|  UDP-glycosyltransferase 1                               395   3e-126   
emb|CDP00928.1|  unnamed protein product                                393   3e-125   
ref|XP_011020572.1|  PREDICTED: UDP-glycosyltransferase 91C1            392   4e-125   
ref|XP_006282295.1|  hypothetical protein CARUB_v10028581mg             391   6e-125   
ref|XP_009774870.1|  PREDICTED: UDP-glycosyltransferase 91C1            392   6e-125   
ref|XP_010518639.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       392   6e-125   
ref|XP_010506987.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       392   7e-125   
ref|XP_009623239.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    390   9e-125   
ref|XP_008779257.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    389   1e-124   
gb|KGN48693.1|  hypothetical protein Csa_6G498410                       389   2e-124   
ref|XP_011001966.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       388   4e-124   
ref|XP_004287416.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       389   5e-124   
ref|XP_010506988.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       388   2e-123   
ref|XP_002303861.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    388   2e-123   Populus trichocarpa [western balsam poplar]
ref|XP_010535333.1|  PREDICTED: UDP-glycosyltransferase 91C1            385   1e-122   
gb|KFK32801.1|  hypothetical protein AALP_AA6G289900                    386   1e-122   
ref|XP_009112190.1|  PREDICTED: UDP-glycosyltransferase 91B1            385   1e-122   
gb|AFJ53031.1|  UDP-glycosyltransferase 1                               385   3e-122   
ref|XP_010934416.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    384   6e-122   
ref|XP_010910495.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    384   7e-122   
ref|XP_009408288.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       383   2e-121   
gb|KDP41496.1|  hypothetical protein JCGZ_15903                         383   3e-121   
gb|AAR06918.1|  UDP-glycosyltransferase 91D1                            383   3e-121   Stevia rebaudiana
ref|XP_004233155.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       382   3e-121   
gb|AAM53963.1|AF515727_1  UDP-glucosyltransferase                       382   4e-121   Stevia rebaudiana
ref|XP_010442438.1|  PREDICTED: UDP-glycosyltransferase 91C1            381   6e-121   
gb|AHL38585.1|  glycosyltransferase                                     395   6e-121   
gb|ACE87855.1|  UDP-glucosyltransferase                                 380   2e-120   Stevia rebaudiana
emb|CAN73977.1|  hypothetical protein VITISV_022298                     379   2e-120   Vitis vinifera
ref|XP_007222833.1|  hypothetical protein PRUPE_ppa005106mg             380   2e-120   
ref|XP_007206476.1|  hypothetical protein PRUPE_ppa019000mg             376   3e-120   
ref|XP_010440988.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       380   3e-120   
ref|XP_008219240.1|  PREDICTED: UDP-glycosyltransferase 91C1            377   3e-119   
ref|XP_010482257.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    376   4e-119   
emb|CDP00929.1|  unnamed protein product                                377   4e-119   
ref|XP_010060107.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    377   5e-119   
ref|XP_006396998.1|  hypothetical protein EUTSA_v10028640mg             376   8e-119   
ref|XP_002527371.1|  UDP-glucosyltransferase, putative                  376   9e-119   Ricinus communis
ref|XP_002532391.1|  UDP-glucosyltransferase, putative                  375   1e-118   Ricinus communis
gb|AIE12480.1|  UGT3                                                    375   1e-118   
ref|XP_009415710.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    375   2e-118   
ref|XP_007148435.1|  hypothetical protein PHAVU_006G208400g             375   3e-118   
ref|XP_002275824.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    374   5e-118   Vitis vinifera
ref|XP_010547586.1|  PREDICTED: UDP-glycosyltransferase 91B1            373   7e-118   
ref|XP_010492649.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       373   8e-118   
ref|XP_010502543.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       372   2e-117   
ref|XP_011036928.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    372   2e-117   
ref|NP_201358.1|  UDP-glycosyltransferase 91B1                          372   3e-117   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43110.1|  putative anthocyanidin-3-glucoside rhamnosyltran...    371   4e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108218.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       370   2e-116   
ref|XP_008788945.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    369   2e-116   
ref|XP_006415140.1|  hypothetical protein EUTSA_v10007607mg             368   4e-116   
ref|XP_002275850.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    369   4e-116   Vitis vinifera
ref|XP_008378603.1|  PREDICTED: UDP-glycosyltransferase 91C1            369   5e-116   
ref|XP_007148436.1|  hypothetical protein PHAVU_006G208500g             368   1e-115   
ref|XP_002320817.1|  hypothetical protein POPTR_0014s08440g             365   7e-115   Populus trichocarpa [western balsam poplar]
gb|KFK29804.1|  hypothetical protein AALP_AA7G181400                    364   2e-114   
ref|XP_007134322.1|  hypothetical protein PHAVU_010G037600g             363   4e-114   
ref|XP_011084237.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       363   4e-114   
ref|XP_007134314.1|  hypothetical protein PHAVU_010G036800g             362   1e-113   
ref|XP_010938322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    362   1e-113   
ref|XP_002302598.1|  hypothetical protein POPTR_0002s16380g             362   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_008789644.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    362   2e-113   
ref|XP_004972263.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    362   3e-113   
ref|XP_008788932.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    362   4e-113   
ref|XP_010938324.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    361   5e-113   
gb|EYU37211.1|  hypothetical protein MIMGU_mgv1a018729mg                360   9e-113   
ref|XP_011023290.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    359   1e-112   
ref|XP_010661830.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    359   2e-112   
ref|XP_006852904.1|  hypothetical protein AMTR_s00033p00224400          359   3e-112   
gb|EPS70335.1|  hypothetical protein M569_04423                         357   2e-111   
ref|XP_010430764.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       355   2e-111   
ref|XP_007134315.1|  hypothetical protein PHAVU_010G036900g             355   3e-111   
ref|XP_004485550.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    357   3e-111   
ref|XP_007051734.1|  UDP-Glycosyltransferase superfamily protein,...    356   4e-111   
ref|XP_007148434.1|  hypothetical protein PHAVU_006G208300g             355   8e-111   
ref|XP_003593142.1|  Glucosyltransferase                                355   1e-110   
ref|XP_009151459.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       351   2e-109   
gb|KHN33503.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            352   2e-109   
ref|XP_008811282.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    351   2e-109   
ref|XP_003547595.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    352   2e-109   
ref|XP_002878624.1|  At2g22590/T9I22.3                                  350   2e-109   
ref|XP_011092703.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    351   3e-109   
ref|XP_007134316.1|  hypothetical protein PHAVU_010G037000g             349   6e-109   
emb|CDY54711.1|  BnaA09g52430D                                          349   7e-109   
ref|XP_004161742.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       349   1e-108   
ref|XP_004489092.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    348   1e-108   
ref|NP_001240857.1|  soyasaponin III rhamnosyltransferase               349   2e-108   
gb|KCW66654.1|  hypothetical protein EUGRSUZ_F00432                     348   2e-108   
ref|XP_002458815.1|  hypothetical protein SORBIDRAFT_03g040830          349   2e-108   Sorghum bicolor [broomcorn]
dbj|BAJ84800.1|  predicted protein                                      349   2e-108   
dbj|BAJ99561.1|  predicted protein                                      348   3e-108   
ref|XP_010277530.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       349   3e-108   
ref|XP_004485549.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    348   3e-108   
ref|XP_003593144.1|  Glucosyltransferase                                348   4e-108   
ref|XP_006852901.1|  hypothetical protein AMTR_s00033p00222830          348   4e-108   
ref|XP_007012761.1|  UDP-Glycosyltransferase superfamily protein        350   8e-108   
ref|XP_008378602.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       347   1e-107   
ref|XP_006451091.1|  hypothetical protein CICLE_v10010307mg             346   2e-107   
ref|XP_003564684.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    347   2e-107   
ref|XP_010030919.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       346   2e-107   
ref|XP_010061561.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       347   3e-107   
ref|XP_010942592.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    345   4e-107   
ref|XP_004489091.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    345   5e-107   
ref|XP_008466142.1|  PREDICTED: UDP-glycosyltransferase 91C1            345   7e-107   
ref|NP_001044898.1|  Os01g0865400                                       345   7e-107   Oryza sativa Japonica Group [Japonica rice]
gb|AFK37289.1|  unknown                                                 345   7e-107   
ref|NP_001150609.1|  anthocyanidin 3-O-glucosyltransferase              344   1e-106   Zea mays [maize]
gb|EEE55719.1|  hypothetical protein OsJ_04191                          344   1e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007012764.1|  UDP-Glycosyltransferase superfamily protein        343   2e-106   
ref|NP_001147674.1|  anthocyanidin 3-O-glucosyltransferase              343   3e-106   Zea mays [maize]
tpg|DAA56691.1|  TPA: anthocyanidin 3-O-glucosyltransferase             344   3e-106   
gb|AES79436.2|  UDP-glucosyltransferase family protein                  340   1e-105   
ref|XP_003548650.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    342   1e-105   
ref|XP_008807755.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    342   1e-105   
ref|XP_010051441.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       341   1e-105   
gb|KHN46708.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            341   2e-105   
gb|KCW82044.1|  hypothetical protein EUGRSUZ_C03414                     340   2e-105   
ref|XP_010047533.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       340   3e-105   
ref|XP_004970691.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    340   3e-105   
ref|XP_002458816.1|  hypothetical protein SORBIDRAFT_03g040840          340   4e-105   Sorghum bicolor [broomcorn]
ref|XP_010905696.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    340   5e-105   
tpg|DAA56689.1|  TPA: anthocyanidin 3-O-glucosyltransferase             340   6e-105   
ref|XP_010049450.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       339   9e-105   
ref|XP_009376199.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    338   2e-104   
ref|XP_010047534.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       337   5e-104   
gb|KCW79477.1|  hypothetical protein EUGRSUZ_C00864                     337   5e-104   
emb|CDP01580.1|  unnamed protein product                                351   7e-104   
ref|XP_003623218.1|  Anthocyanidin 3-O-glucosyltransferase              339   9e-104   
ref|XP_003593143.1|  UDP-glucosyltransferase                            337   1e-103   
ref|XP_010051440.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       336   1e-103   
emb|CDX81291.1|  BnaC09g07020D                                          335   2e-103   
ref|XP_008674785.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    336   2e-103   
ref|XP_010047531.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       335   3e-103   
gb|KEH32398.1|  UDP-glucosyltransferase family protein                  335   4e-103   
emb|CDX73276.1|  BnaC05g28300D                                          333   5e-103   
ref|XP_003619079.1|  Anthocyanidin 3-O-glucosyltransferase              335   6e-103   
emb|CBI40856.3|  unnamed protein product                                354   6e-103   
ref|XP_009624393.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    334   7e-103   
ref|XP_008242383.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       334   7e-103   
gb|KCW82042.1|  hypothetical protein EUGRSUZ_C03411                     333   1e-102   
dbj|BAJ89368.1|  predicted protein                                      333   2e-102   
gb|KCW79472.1|  hypothetical protein EUGRSUZ_C00857                     333   2e-102   
ref|XP_008242170.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       333   2e-102   
emb|CDO97382.1|  unnamed protein product                                332   4e-102   
ref|XP_010047532.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       332   6e-102   
ref|XP_003535899.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    332   7e-102   
gb|KHN27169.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            332   7e-102   
gb|KHN26939.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            330   1e-101   
ref|XP_002511902.1|  UDP-glucosyltransferase, putative                  331   2e-101   Ricinus communis
ref|XP_010050451.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       334   2e-101   
ref|XP_011093243.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    330   2e-101   
dbj|BAK04512.1|  predicted protein                                      330   4e-101   
gb|KEH23150.1|  UDP-glucosyltransferase family protein                  328   4e-101   
ref|XP_002323718.1|  hypothetical protein POPTR_0017s07030g             329   5e-101   Populus trichocarpa [western balsam poplar]
ref|XP_009361645.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       329   7e-101   
ref|XP_010671540.1|  PREDICTED: UDP-glycosyltransferase 91C1            328   1e-100   
ref|XP_008362977.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    328   1e-100   
ref|XP_010927293.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    328   2e-100   
ref|XP_004306714.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    328   2e-100   
ref|XP_003570831.2|  PREDICTED: UDP-glycosyltransferase 91C1-like       328   3e-100   
ref|XP_009768930.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       327   3e-100   
gb|AGU14093.1|  UDP-glycosyltransferase                                 327   4e-100   
ref|XP_004136252.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    327   4e-100   
ref|XP_009351089.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       326   4e-100   
emb|CDY67034.1|  BnaCnng53280D                                          325   7e-100   
ref|XP_009351087.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       326   1e-99    
ref|XP_008362978.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    326   1e-99    
ref|XP_006645072.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    326   1e-99    
ref|XP_009788298.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    326   1e-99    
ref|XP_009361641.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       325   2e-99    
gb|KHN26938.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            325   2e-99    
ref|XP_004287583.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       327   2e-99    
ref|XP_009767882.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    324   4e-99    
gb|KHN26940.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            325   4e-99    
gb|AFJ53030.1|  UDP-glycosyltransferase 1                               324   5e-99    
emb|CDP20375.1|  unnamed protein product                                325   5e-99    
ref|XP_011093242.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    324   6e-99    
ref|XP_011043118.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    323   1e-98    
gb|KHN26937.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            322   2e-98    
ref|XP_008342850.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       322   3e-98    
gb|KEH17945.1|  UDP-glucosyltransferase family protein                  322   3e-98    
ref|XP_010049449.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       321   3e-98    
gb|KDO86267.1|  hypothetical protein CISIN_1g036520mg                   322   5e-98    
dbj|BAJ86656.1|  predicted protein                                      322   6e-98    
gb|KEH17952.1|  UDP-glucosyltransferase family protein                  322   6e-98    
gb|KEH37740.1|  UDP-glucosyltransferase family protein                  321   6e-98    
ref|XP_007220939.1|  hypothetical protein PRUPE_ppa025376mg             322   6e-98    
ref|XP_003619124.1|  Anthocyanidin 3-O-glucosyltransferase              321   7e-98    
ref|XP_008346201.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    321   1e-97    
ref|XP_002460289.1|  hypothetical protein SORBIDRAFT_02g026040          322   1e-97    
ref|XP_007012766.1|  UDP-Glycosyltransferase superfamily protein        321   2e-97    
ref|XP_008388229.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       320   2e-97    
ref|XP_008362434.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       320   2e-97    
ref|XP_006339794.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    320   2e-97    
dbj|BAJ97320.1|  predicted protein                                      320   2e-97    
ref|XP_009366540.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    320   3e-97    
ref|XP_007217954.1|  hypothetical protein PRUPE_ppa005180mg             320   4e-97    
ref|XP_006444980.1|  hypothetical protein CICLE_v10019998mg             320   4e-97    
ref|XP_010099555.1|  UDP-glycosyltransferase 91C1                       318   5e-97    
gb|EEC81695.1|  hypothetical protein OsI_25291                          326   6e-97    
ref|XP_008388212.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       318   7e-97    
gb|KCW79469.1|  hypothetical protein EUGRSUZ_C00854                     318   9e-97    
ref|XP_002459516.1|  hypothetical protein SORBIDRAFT_02g005940          318   1e-96    
ref|XP_009587012.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    318   2e-96    
ref|XP_009606311.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    317   2e-96    
ref|XP_008386125.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    317   2e-96    
ref|XP_009343124.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    317   2e-96    
ref|XP_008337731.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       317   2e-96    
dbj|BAK03755.1|  predicted protein                                      318   3e-96    
ref|XP_008354446.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       317   3e-96    
ref|XP_008232998.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    317   4e-96    
ref|XP_011092852.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       317   6e-96    
ref|XP_008346533.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    317   6e-96    
ref|XP_009767381.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    316   9e-96    
emb|CBI40428.3|  unnamed protein product                                314   1e-95    
ref|XP_008233032.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    314   1e-95    
ref|XP_008346552.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    316   2e-95    
ref|XP_004306716.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    314   3e-95    
gb|KDP28588.1|  hypothetical protein JCGZ_14359                         312   6e-95    
gb|EAZ03129.1|  hypothetical protein OsI_25275                          314   9e-95    
ref|XP_004981372.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    313   1e-94    
gb|EAZ03128.1|  hypothetical protein OsI_25274                          313   4e-94    
ref|XP_010928970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    308   5e-94    
gb|EPS66584.1|  hypothetical protein M569_08191                         309   1e-93    
ref|NP_001051624.1|  Os03g0804900                                       311   1e-93    
ref|XP_004955982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    308   6e-93    
ref|XP_010271397.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       307   2e-92    
gb|ACU23401.1|  unknown                                                 304   2e-92    
ref|XP_006353274.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       300   2e-92    
ref|XP_003560669.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    304   2e-91    
ref|XP_008352352.1|  PREDICTED: soyasaponin III rhamnosyltransfer...    304   3e-91    
gb|EMT01232.1|  Anthocyanidin 3-O-glucosyltransferase                   302   8e-91    
dbj|BAJ89506.1|  predicted protein                                      303   9e-91    
dbj|BAJ92561.1|  predicted protein                                      303   1e-90    
ref|XP_002463702.1|  hypothetical protein SORBIDRAFT_01g004560          303   1e-90    
emb|CDP01581.1|  unnamed protein product                                299   1e-90    
gb|EYU23564.1|  hypothetical protein MIMGU_mgv1a026446mg                301   3e-90    
ref|XP_004306715.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    300   5e-90    
ref|XP_004955936.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    301   6e-90    
ref|XP_003607432.1|  Anthocyanidin 3-O-glucosyltransferase              299   9e-90    
ref|XP_003559278.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    300   1e-89    
ref|XP_003564213.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       299   2e-89    
ref|XP_004955765.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    298   5e-89    
ref|XP_006658379.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    299   9e-89    
ref|NP_001059133.1|  Os07g0201500                                       298   2e-88    
gb|KGN48692.1|  hypothetical protein Csa_6G498400                       290   3e-88    
dbj|BAJ98242.1|  predicted protein                                      295   4e-88    
ref|XP_008237180.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    290   8e-88    
gb|EAZ03144.1|  hypothetical protein OsI_25293                          295   8e-88    
ref|XP_006852898.1|  hypothetical protein AMTR_s00033p00222540          293   2e-87    
ref|XP_008438010.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       294   3e-87    
gb|AAS07237.1|  putative UDP-glucoronosyl and UDP-glucosyl transf...    294   3e-87    
ref|XP_010230871.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       293   3e-87    
ref|XP_003560664.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       293   4e-87    
ref|XP_006657538.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    294   4e-87    
ref|XP_007051735.1|  UDP-Glycosyltransferase superfamily protein,...    292   4e-87    
ref|XP_004955767.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    293   7e-87    
ref|XP_002273963.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    286   7e-87    
ref|XP_002463705.1|  hypothetical protein SORBIDRAFT_01g004570          293   7e-87    
ref|XP_004171403.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    290   8e-87    
ref|XP_010026589.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       286   8e-87    
ref|XP_004955768.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    293   9e-87    
ref|XP_010227258.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       291   1e-86    
ref|NP_001051007.2|  Os03g0702000                                       291   2e-86    
ref|NP_001059134.1|  Os07g0202000                                       292   2e-86    
ref|XP_006650454.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       291   3e-86    
ref|XP_007205575.1|  hypothetical protein PRUPE_ppa008811mg             285   4e-86    
dbj|BAJ91449.1|  predicted protein                                      290   4e-86    
ref|XP_006650455.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       290   5e-86    
ref|XP_010938196.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    290   5e-86    
dbj|BAJ94055.1|  predicted protein                                      289   1e-85    
gb|EAZ28971.1|  hypothetical protein OsJ_13015                          289   2e-85    
ref|XP_004134320.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       288   2e-85    
ref|XP_003559503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    287   3e-85    
ref|XP_008793359.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    287   5e-85    
dbj|BAC83826.1|  putative UDP-glucosyltransferase                       288   8e-85    
ref|NP_001175095.1|  Os07g0201200                                       287   1e-84    
ref|NP_001051010.1|  Os03g0702500                                       285   3e-84    
gb|EAY91547.1|  hypothetical protein OsI_13181                          285   6e-84    
ref|XP_006378647.1|  hypothetical protein POPTR_0010s18990g             279   6e-84    
ref|XP_003615305.1|  Anthocyanidin 3-O-glucosyltransferase              283   8e-84    
gb|ACU24590.1|  unknown                                                 283   1e-83    
ref|NP_001140739.1|  uncharacterized protein LOC100272814               283   2e-83    
gb|AAS07253.1|  putative UDP-glucoronosyl and UDP-glucosyl transf...    291   2e-83    
dbj|BAJ99464.1|  predicted protein                                      282   4e-83    
gb|KCW79473.1|  hypothetical protein EUGRSUZ_C00858                     280   5e-83    
ref|XP_004955764.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    280   3e-82    
ref|XP_004171402.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       274   4e-82    
ref|XP_008237191.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    272   2e-81    
ref|XP_006292348.1|  hypothetical protein CARUB_v10018560mg             273   2e-81    
ref|XP_009408752.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    273   1e-80    
gb|EEC76369.1|  hypothetical protein OsI_13968                          275   2e-80    
gb|EMT10636.1|  Anthocyanidin 3-O-glucosyltransferase                   274   2e-80    
gb|KFK28226.1|  hypothetical protein AALP_AA8G488700                    271   4e-80    
ref|XP_004982379.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       273   5e-80    
ref|XP_002466606.1|  hypothetical protein SORBIDRAFT_01g010900          274   5e-80    
dbj|BAJ96765.1|  predicted protein                                      274   1e-79    
ref|XP_008804284.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    270   1e-78    
dbj|BAJ93155.1|  predicted protein                                      268   2e-77    
ref|XP_008391056.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       268   2e-77    
ref|XP_007012763.1|  UDP-Glycosyltransferase superfamily protein        264   1e-76    
ref|XP_007217920.1|  hypothetical protein PRUPE_ppa022969mg             261   1e-76    
gb|ABR18376.1|  unknown                                                 265   2e-76    
gb|ABR16160.1|  unknown                                                 264   3e-76    
emb|CBI40857.3|  unnamed protein product                                259   3e-76    
ref|XP_003635104.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    257   2e-75    
ref|XP_003571408.2|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    261   3e-75    
ref|XP_004982059.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       259   5e-75    
emb|CBI40427.3|  unnamed protein product                                268   6e-75    
dbj|BAJ88830.1|  predicted protein                                      259   2e-74    
ref|NP_001064066.1|  Os10g0122000                                       259   2e-74    
gb|KDP29784.1|  hypothetical protein JCGZ_18719                         259   2e-73    
ref|XP_006836292.1|  hypothetical protein AMTR_s00092p00015830          256   4e-73    
gb|EEE66752.1|  hypothetical protein OsJ_23460                          256   8e-73    
emb|CDP21723.1|  unnamed protein product                                250   9e-73    
ref|XP_008804286.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    253   1e-72    
gb|KCW59685.1|  hypothetical protein EUGRSUZ_H02445                     245   2e-72    
ref|XP_004982120.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    254   3e-72    
gb|AEQ33588.2|  putative UDP-glucose:flavonoid glucosyltransferase      253   7e-72    
gb|KDP29787.1|  hypothetical protein JCGZ_18722                         245   1e-71    
gb|EEE66761.1|  hypothetical protein OsJ_23476                          252   1e-71    
ref|XP_003568849.1|  PREDICTED: UDP-glycosyltransferase 91B1-like       251   1e-71    
gb|EAZ00153.1|  hypothetical protein OsI_22159                          251   2e-71    
gb|ABR18123.1|  unknown                                                 251   3e-71    
gb|EMS63353.1|  UDP-glycosyltransferase 91C1                            250   3e-71    
tpg|DAA41232.1|  TPA: transferase                                       250   3e-71    
ref|XP_004979741.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    251   4e-71    
ref|XP_008667488.1|  PREDICTED: hypothetical protein isoform X1         249   4e-71    
ref|NP_001150595.1|  transferase, transferring glycosyl groups          250   4e-71    
ref|NP_001047279.2|  Os02g0589400                                       249   4e-71    
dbj|BAD17459.1|  putative UDP-glucosyltransferase                       249   5e-71    
gb|EAY86485.1|  hypothetical protein OsI_07863                          249   5e-71    
ref|XP_004979736.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    250   7e-71    
ref|XP_004980756.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    248   5e-70    
gb|EMT03457.1|  Anthocyanidin 3-O-glucosyltransferase                   245   8e-70    
gb|KDO54147.1|  hypothetical protein CISIN_1g019759mg                   242   1e-69    
gb|EYU25693.1|  hypothetical protein MIMGU_mgv1a026946mg                236   2e-68    
gb|KCW79471.1|  hypothetical protein EUGRSUZ_C00856                     233   4e-66    
ref|XP_009629528.1|  PREDICTED: crocetin glucoside glucosyltransf...    236   5e-66    
ref|XP_006846035.1|  hypothetical protein AMTR_s00155p00094050          236   6e-66    
ref|XP_009767885.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    234   7e-66    
gb|AHK12770.1|  flavanone-O-glucoside 2''-O-beta-L-rhamnosyltrans...    235   1e-65    
ref|XP_004979742.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    236   1e-65    
gb|ABR16053.1|  unknown                                                 236   2e-65    
ref|XP_007219269.1|  hypothetical protein PRUPE_ppa018245mg             235   2e-65    
ref|XP_006361439.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    233   7e-65    
gb|KDP29782.1|  hypothetical protein JCGZ_18717                         222   4e-63    
gb|EMT28296.1|  Anthocyanidin 3-O-glucosyltransferase                   225   7e-63    
ref|XP_010277785.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    226   3e-62    
gb|EMS61554.1|  UDP-glycosyltransferase 91C1                            224   1e-61    
ref|XP_008391093.1|  PREDICTED: uncharacterized protein LOC103453328    235   1e-61    
gb|ADJ67198.1|  hypothetical protein                                    216   3e-61    
ref|XP_007047760.1|  UDP-Glycosyltransferase superfamily protein,...    220   3e-61    
gb|AFK79036.1|  glycosyltransferase UGT4                                223   4e-61    
ref|XP_004250486.1|  PREDICTED: crocetin glucoside glucosyltransf...    222   5e-61    
emb|CBI40855.3|  unnamed protein product                                216   6e-61    
gb|AHZ30598.1|  ufgt                                                    221   7e-61    
ref|XP_006355167.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    221   2e-60    
ref|XP_007204467.1|  hypothetical protein PRUPE_ppa023177mg             217   2e-60    
ref|XP_009770958.1|  PREDICTED: crocetin glucoside glucosyltransf...    220   2e-60    
ref|XP_011089649.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    221   3e-60    
gb|ABO21828.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    220   3e-60    
ref|XP_006342776.1|  PREDICTED: flavanone 7-O-glucoside 2''-O-bet...    220   4e-60    
gb|KCW51492.1|  hypothetical protein EUGRSUZ_J01008                     219   4e-60    
ref|XP_008231983.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    220   5e-60    
ref|XP_004247056.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    220   5e-60    
ref|XP_004250482.1|  PREDICTED: crocetin glucoside glucosyltransf...    219   5e-60    
dbj|BAH80313.1|  UDP-glucose:flavonoid glucoside 1,6-glucosyltran...    220   5e-60    
ref|XP_008231995.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    219   6e-60    
ref|XP_007206642.1|  hypothetical protein PRUPE_ppa021249mg             213   6e-60    
ref|XP_008375610.1|  PREDICTED: cyanidin-3-O-glucoside 2-O-glucur...    219   6e-60    
ref|XP_010032098.1|  PREDICTED: crocetin glucoside glucosyltransf...    219   1e-59    
gb|ABA98944.1|  UDP-glucoronosyl and UDP-glucosyl transferase fam...    219   1e-59    
dbj|BAC10994.1|  rhamnosyl transferase                                  218   2e-59    
ref|XP_009775013.1|  PREDICTED: crocetin glucoside glucosyltransf...    218   2e-59    



>ref|XP_009795659.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana sylvestris]
Length=472

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/463 (62%), Positives = 359/463 (78%), Gaps = 2/463 (0%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             S+    H  M PWLAFGH+IPYLELAKLLA++G+KI F STP+NIQRLPKL P+L P I+
Sbjct  2     SDVKNFHFFMFPWLAFGHMIPYLELAKLLAKKGHKISFFSTPKNIQRLPKLPPNLKPKIE  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              I L LP VENLPE+AE+T+DLPY+KVRYLKIAFD+LQ+SM   ++TLSPD+VI DFAS+
Sbjct  62    FITLQLPHVENLPENAEATIDLPYNKVRYLKIAFDKLQESMPKLIETLSPDFVIQDFASY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              LVPI +K   P++YFSIF A+  ++    S++I G D  V+P+  T KPKWVPFET + 
Sbjct  122   WLVPITKKSQTPTIYFSIFPATGLSMGGDPSSIIIGDDDRVKPEDFTVKPKWVPFETNVR  181

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
             P  ++++R+FND  IDGGNVSD+YRL VTVKG   V +RSCYE E EWLQ+ E +  K  
Sbjct  182   PSFYQIQRMFNDLVIDGGNVSDIYRLAVTVKGVDVVAIRSCYEFEGEWLQVIENLYEKEI  241

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IP+GLLPTT+Y D+ +DD    WLE+K WLD Q+KGSVVY+AFGSETKP+Q+E+  IALG
Sbjct  242   IPIGLLPTTSY-DDGEDDNNETWLEMKAWLDMQQKGSVVYIAFGSETKPSQDELTIIALG  300

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS LPFFWV+R+QRG AD+EV +LPE FEERT GRG ICTSWAPQLKIL+H+S+GGFL
Sbjct  301   LELSNLPFFWVFRQQRGCADSEVIELPEQFEERTNGRGFICTSWAPQLKILNHESIGGFL  360

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             THSGWSSV+EA++FEK LI+ PFL DQG+I   L EK++GY I R+E DGSF+++ VAES
Sbjct  361   THSGWSSVIEAVQFEKPLILLPFLADQGMICSHLTEKKLGYPIFRNELDGSFTKECVAES  420

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             LR+V+VEE G     +  K   +   K+ Q  +V+ LLDYL +
Sbjct  421   LRLVIVEEKG-KIYRQNVKEMKESCSKDVQQRFVDNLLDYLQS  462



>ref|XP_009615005.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana tomentosiformis]
Length=472

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/463 (61%), Positives = 360/463 (78%), Gaps = 2/463 (0%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             S+    H  M PWLAFGH+IPY+ELAKLLAE+G+KI F STP+NIQRLPKL P+L P+I+
Sbjct  2     SDVKNFHFFMFPWLAFGHMIPYVELAKLLAEKGHKISFFSTPKNIQRLPKLPPNLKPHIE  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              I L LP VENLPE+AE+T DLPY+KVRYLKIAFD LQ+SM   ++++ PD+VI DFAS+
Sbjct  62    FITLQLPHVENLPENAEATSDLPYNKVRYLKIAFDRLQESMPKLIESIYPDFVIQDFASY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              LVPI EKL IP++YFSIF A+  ++    S++I+G +  V+P+  T KPKWV FET + 
Sbjct  122   WLVPITEKLQIPTIYFSIFPATCLSLGGIPSSIINGDNDRVKPEDFTVKPKWVTFETNVR  181

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
             P  ++++R+FND  IDGGNVSD+YRL VTVKG   V +RSCYE E EWLQ+ E +  KP 
Sbjct  182   PSFYQIQRMFNDLVIDGGNVSDIYRLAVTVKGVDVVAIRSCYEFEGEWLQVIENIYEKPI  241

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IP+GLLPTT+Y D+ ++D    WLE+K WLD Q+KGSVVY+AFGSETKP+Q+E+  IALG
Sbjct  242   IPIGLLPTTSY-DDGEEDNNETWLEMKAWLDMQQKGSVVYIAFGSETKPSQDELTIIALG  300

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS LPFFWV+RKQRG AD++V +LPE FEERT+GRG ICTSWAPQLK+L+H+S+GGFL
Sbjct  301   LELSNLPFFWVFRKQRGCADSKVIELPEQFEERTKGRGFICTSWAPQLKLLNHESIGGFL  360

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             THSGWSSV+EA++FEK LI+ PFL DQG+I   L EK++GY I R+E DGSF+++ VA+S
Sbjct  361   THSGWSSVIEAVQFEKPLILLPFLGDQGMICSHLTEKKLGYPIFRNELDGSFTKECVAKS  420

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             LR+VMVEE G     +  K   +   K+ Q  +V+ LL YL +
Sbjct  421   LRLVMVEEKG-KIYSQNVKEMKESCSKDVQQRFVDNLLAYLQS  462



>ref|XP_011017699.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Populus euphratica]
Length=468

 Score =   513 bits (1322),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 273/462 (59%), Positives = 346/462 (75%), Gaps = 9/462 (2%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             SS LHI M PWLAFGH+IPYLELAKL+A++G+KI F+STPRN  RLPKLHP + P I  +
Sbjct  4     SSKLHIAMFPWLAFGHMIPYLELAKLVAQKGHKISFISTPRNTDRLPKLHPSISPLITFV  63

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP-DWVIHDFASFR  1310
              L LPQVENLP+ AE+T D+PYDKV+YLK A D+L++ ++ FLQT    D ++ DFA + 
Sbjct  64    RLSLPQVENLPKGAEATTDVPYDKVQYLKQACDDLKEPLSKFLQTCDDLDCILFDFAPYW  123

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L  I     IPSV+FSIFTA++ +   P S    G+D   +P+  T  PKWVPF T ++ 
Sbjct  124   LPDIAMSFGIPSVFFSIFTAAMLSYVKPAS----GIDDRSKPEDFTVPPKWVPFPTNVVF  179

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R FE+ R+F  + + G  VSDLYR    +KG   + VRSC E EPEWLQL EE+ GKP I
Sbjct  180   RLFEVLRIFYQS-LAGNVVSDLYRTQEGIKGCDMIAVRSCMEFEPEWLQLLEEIHGKPVI  238

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             PVG+L TT YD   +D+    W  IK+WLDKQ++GSVVY+AFGSE KP+Q E+ EIALGL
Sbjct  239   PVGVLATTVYDTGVEDEA---WRSIKDWLDKQKQGSVVYIAFGSEAKPSQVELTEIALGL  295

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             ELS LPFFWV RK RGSAD E+ KLPEGFEERTR +G++ TSWAPQLKIL+HDSVGGFLT
Sbjct  296   ELSGLPFFWVLRKHRGSADTELIKLPEGFEERTRAQGLVWTSWAPQLKILAHDSVGGFLT  355

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             HSGWSSVVEAL+  + LI+  FL DQGI  R+L +K+MGY+I R+E +G F+RDSVAESL
Sbjct  356   HSGWSSVVEALQHARSLILLTFLADQGINARVLEDKKMGYSIPRNEKNGYFTRDSVAESL  415

Query  409   RVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             R+VM +E GK++ +KVK+MK    +K++QD YV+KL+D+L +
Sbjct  416   RLVMEKEEGKIYRDKVKEMKPLFADKDRQDKYVDKLVDHLRS  457



>emb|CDP01584.1| unnamed protein product [Coffea canephora]
Length=471

 Score =   510 bits (1314),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 260/463 (56%), Positives = 340/463 (73%), Gaps = 1/463 (0%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +E   LHIVM PWLAFGH+IPYLEL+KL+A++G+K+ F+STPRNI RLPK  P+L  ++ 
Sbjct  2     AEDGKLHIVMFPWLAFGHMIPYLELSKLIAKKGHKVSFLSTPRNIDRLPKPPPNLTRHLK  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              + +PLP +ENLPE+AE+T DLPY+KV+YLK+A D LQ  ++ FL+   PDWV+ DFA +
Sbjct  62    FVKIPLPHIENLPENAEATTDLPYNKVKYLKLACDGLQQPISEFLRQTCPDWVLFDFAPY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              +  +  KL+I + +FSIFTA       P   +    +    P+  T KPKWVPFET + 
Sbjct  122   WIPSVASKLNIRTAFFSIFTAPFLGFCGPVEVMKGNGEDRKTPQDFTVKPKWVPFETNVA  181

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              + FE+ R+ +    D   +SD++R G +++    + VRSC E EPEWLQL EE+  KP 
Sbjct  182   FKLFEILRLVDSLIGDEEPISDIFRGGSSIENCDFLAVRSCSEFEPEWLQLMEEIYQKPV  241

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IPVG LPTT  +++ D  K  AW  IKEWLDKQE+GSVVYVAFGSE KP+Q EV EI+LG
Sbjct  242   IPVGQLPTTG-NNDADGGKDEAWRPIKEWLDKQERGSVVYVAFGSEAKPSQAEVNEISLG  300

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS LPFFWV R +RG  D EV +LPEGFE+RT+ RGV+C SWAPQLKILSHDSVGGFL
Sbjct  301   LELSGLPFFWVLRTKRGGEDTEVIELPEGFEDRTKDRGVVCASWAPQLKILSHDSVGGFL  360

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             THSGWSSVVEA++FEK LI+   L DQGI  R+L EK+MGY I RD++DGSF+RDSVAES
Sbjct  361   THSGWSSVVEAIQFEKALILLTMLADQGINARVLGEKKMGYPIPRDDSDGSFTRDSVAES  420

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             LR+VM+E+ GK++ +K K+M+    ++ +QD Y+  LL++L +
Sbjct  421   LRLVMIEDEGKIYRDKSKEMRRLFCDESRQDGYIENLLNFLQS  463



>ref|XP_009768273.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana sylvestris]
Length=468

 Score =   504 bits (1298),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 255/466 (55%), Positives = 341/466 (73%), Gaps = 5/466 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA  S  LHI + PWLAFGH+IPYLEL+KL+A++G+K+ F+STPRNI RLPKL P+LVP 
Sbjct  1     MAENSKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKVSFISTPRNIDRLPKLPPNLVPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             ++    P+P++E LP++AE+T+D+PY++V+YLK+A D LQ+SMA FL+  +PD+++ DF 
Sbjct  61    LNFFKFPVPKIEKLPKNAEATIDVPYEQVKYLKLAQDGLQESMAKFLEDSAPDFILFDFT  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S+ +  + +K  IP+ YFSIF A+      P   + +  +    P+  T  P WVP ETT
Sbjct  121   SYWVPSVAKKFDIPTAYFSIFIAAFLGFVGPVPGLNNDYEIRTTPEEYTVPPAWVPIETT  180

Query  1138  IMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             +  + FE+ R+F DA ++G   NV D++R+  T++    +FVRSC E EPEWL++ E++ 
Sbjct  181   VCWKLFEVLRIF-DASMEGDEENVPDIFRMYKTLEDCDILFVRSCSEFEPEWLKVLEDIH  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              KP  PVG LPTT+Y+D+        W  IK WLD QEKG VVYVAFGSE KP+Q E+ E
Sbjct  240   RKPVFPVGQLPTTSYEDDSSTIDA--WKSIKLWLDMQEKGKVVYVAFGSEAKPSQNELTE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             I+LGLE S LPFFWV R +RG +D E+ +LPEGFEERT+GRG++CTSWAPQLKILS DSV
Sbjct  298   ISLGLEKSGLPFFWVLRTKRGESDDELIRLPEGFEERTKGRGIVCTSWAPQLKILSDDSV  357

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTHSGWSSVVEA++FEK L++  FL DQGI  RLL EK+M Y++ RD+ DGSF+RDS
Sbjct  358   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLAEKKMAYSVPRDDRDGSFTRDS  417

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             VAESL +V+VEE GK++ EKVK+ K    +K +QD+YV   L Y  
Sbjct  418   VAESLSLVLVEEKGKIYREKVKEAKTLFCDKGRQDSYVENFLSYFQ  463



>gb|KDP29778.1| hypothetical protein JCGZ_18713 [Jatropha curcas]
Length=466

 Score =   503 bits (1294),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 261/465 (56%), Positives = 341/465 (73%), Gaps = 6/465 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA  +S LHI + PWLAFGH IPYLELAKL+A++G+KI F+STP+NI RLPKL P+L  +
Sbjct  1     MAEYNSKLHIALFPWLAFGHFIPYLELAKLIAQKGHKISFLSTPQNIHRLPKLPPNLSSS  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  I LPLP V+ LPE+AE+T D+P DKV+YLK AFD L+  + +FLQ   PDW+I+DFA
Sbjct  61    ITFIKLPLPSVDGLPENAEATADVPLDKVQYLKKAFDGLKQPITSFLQISKPDWLIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              + L  +   L I   +FSIF  ++  I  P+S +    D  V+P+  T  P+W+ F T 
Sbjct  121   PYWLPTVASNLCISHGFFSIFLGALLGIAKPKSVI---NDDRVKPEDFTVPPQWITFPTN  177

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R+FE+ ++F     D   VSD++RL   + G   + VRSC + EPEWL L +++  K
Sbjct  178   VAFRHFEIVKIFESVTGDASEVSDMFRLEEVLNGCEMISVRSCSDFEPEWLNLLQDIHRK  237

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P IPVG+LPTT Y++E++ D    W  IKEWLDKQ+KG VVYVAFGSE KP+Q E+ EIA
Sbjct  238   PCIPVGMLPTTQYENEDETDT---WRTIKEWLDKQKKGYVVYVAFGSEAKPSQVEINEIA  294

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLELS+LPFFWV RK+RG  D EV +LP+GFEERT+ RG++CTSWAPQLKIL+HDSVGG
Sbjct  295   LGLELSELPFFWVLRKRRGLTDTEVVELPDGFEERTKDRGLVCTSWAPQLKILAHDSVGG  354

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTHSGWSSVVEA + E+ LI+  FL DQGI  R+L  K+MGY I R+E DGSF+RDSVA
Sbjct  355   FLTHSGWSSVVEASQNERPLILLTFLADQGINARVLEGKKMGYPIPRNELDGSFTRDSVA  414

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             ESLR+V+V+E G+V+ EK K+M+    ++ KQ+ Y++K LD+LHA
Sbjct  415   ESLRLVIVKEEGEVYREKAKEMRILFGDRSKQERYLDKFLDFLHA  459



>ref|XP_009803298.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana sylvestris]
Length=483

 Score =   503 bits (1294),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 260/475 (55%), Positives = 333/475 (70%), Gaps = 1/475 (0%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA+E+  LHI MLPWLAFGHI+PYLELAK +A +G+KI F+STPRNI RLPKL  H+ P 
Sbjct  1     MATENRKLHIAMLPWLAFGHILPYLELAKHIALKGHKISFISTPRNIDRLPKLPSHISPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + +PL  VENLP+DAE+T DLPYDKV+YLKIA+D ++DS+  FLQT  PDW+  DFA
Sbjct  61    IRFVKIPLQPVENLPKDAEATTDLPYDKVQYLKIAYDAMRDSIHHFLQTNKPDWIFFDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             ++   PI  +L+I S +FSI  A++     P   +I G  +  EP+  T+ PKWV F TT
Sbjct  121   AYWAGPIATELNISSAFFSIMIAAVLGFLGPAPVLISGYGTLDEPEVLTASPKWVNFPTT  180

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R +E+ R+ +    +    SD+YR G  +K    + +RSC E EPEWL L EE+  K
Sbjct  181   VAFRLYEVLRMKDSFTGNMSEASDIYRFGAGIKSCDVLLIRSCSEFEPEWLHLVEEIHQK  240

Query  958   PTIPVGLL-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
                PVG L P T  + +++ +       IK+WLD QEKGSV+YVAFGSE KP+QEE+ EI
Sbjct  241   LVFPVGQLSPLTIDNCDDESNGAWTGGSIKQWLDSQEKGSVIYVAFGSEAKPSQEELTEI  300

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             A GLELS LPFFWV RKQRG  D ++ +LP+GFE+RT+ RGV+C  WAPQLKILSHDSVG
Sbjct  301   AHGLELSGLPFFWVLRKQRGEFDTDLNELPKGFEQRTKDRGVVCMGWAPQLKILSHDSVG  360

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTHSGWSSVVEA+ +EK LI+ PFL DQG+  RLL EK+M Y+I RDE +G+F+RDSV
Sbjct  361   GFLTHSGWSSVVEAISYEKALILLPFLADQGLNARLLEEKKMAYSIPRDEREGTFTRDSV  420

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPSG  257
             A SL +VM+EE GKV+ E  K M+    +K KQ+ YV  L+ YL     I   +G
Sbjct  421   ANSLSLVMLEEGGKVYRENAKNMRELFADKRKQEKYVENLMKYLQKHREIQKENG  475



>ref|XP_009623238.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana tomentosiformis]
Length=468

 Score =   502 bits (1292),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 257/466 (55%), Positives = 342/466 (73%), Gaps = 5/466 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA  S  LHI + PWLAFGH+IPYLEL+KL+A++G+KI F+STPRNI RLPKL P+LVP 
Sbjct  1     MAENSKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPNLVPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             ++ +  P+P++E LP++AE+T+D+PY++V+YLK+A DELQ SMA FL+  +PD+++ DF 
Sbjct  61    LNFVKFPMPKIEKLPKNAEATIDVPYEQVKYLKLAQDELQQSMAKFLEDSAPDFILFDFT  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S  +  + +  +IP+ YFSIF A+      P   + +  +    P+     PKWVPFETT
Sbjct  121   SHWVPSVAKNFNIPTAYFSIFIAAFLGFAGPVPGLNNDYEIRKTPEEYCVPPKWVPFETT  180

Query  1138  IMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             +  + FE+ R+F DA ++G   NV D++RL  T++    + VRSC E EPEWL++ E + 
Sbjct  181   VCWKLFEVLRIF-DASMEGDEENVPDIFRLYKTLEDCDILVVRSCSEFEPEWLKVLENIH  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              KP  PVG LPTT+Y+D+        W  IK WLD QEKG VVYVAFGSE KP+Q E+ E
Sbjct  240   QKPVFPVGQLPTTSYEDDSTTMDA--WRSIKLWLDMQEKGKVVYVAFGSEAKPSQNELTE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             I+LGLE S LPFFWV R +RG +D E+ +LPEGFEERT+ RG++CTSWAPQLKILS+DSV
Sbjct  298   ISLGLEKSGLPFFWVLRTKRGESDDELIRLPEGFEERTKERGIVCTSWAPQLKILSNDSV  357

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTHSGWSSVVEA++FEK L++  FL DQGI  RLL EK+M Y++ RD+ DGSF+R+S
Sbjct  358   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLEEKKMAYSVPRDDRDGSFTRES  417

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             VAESL +V+VEE GK++ EKVK++K    +K +QD YV  LL YL 
Sbjct  418   VAESLSLVLVEEEGKIYREKVKEVKNLFCDKRRQDGYVENLLSYLQ  463



>ref|XP_009623233.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Nicotiana tomentosiformis]
Length=484

 Score =   498 bits (1281),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 264/478 (55%), Positives = 334/478 (70%), Gaps = 6/478 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA+E+  LHI M+PWLAFGH++PYLELAK +A +G+KI F+STPRNI RLPKL P++ P 
Sbjct  1     MATENKKLHIAMVPWLAFGHMLPYLELAKHIALKGHKISFISTPRNIDRLPKLPPNISPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + +PL  VENLP+DAE+T DLPY+KV+YLKIA+D L+DS+  FLQT  PDW+  DFA
Sbjct  61    IRFVKIPLQPVENLPKDAEATTDLPYEKVQYLKIAYDALRDSIRHFLQTNKPDWIFFDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             ++   PI  +L+I S +FSI  A++     P   ++ G  +  E K  T+ PKWV F TT
Sbjct  121   AYWAGPIATELNISSAFFSIMIAAVLGFLGPAPVLMSGYGTLDELKVLTASPKWVNFPTT  180

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R +E+ R+ +    +    SD+YR G  +K    +  RSC E EPEWL L E++  K
Sbjct  181   VAFRLYEVLRMKDSFTGNMSEASDIYRFGAGIKSCDVLLNRSCSEFEPEWLHLVEQIHRK  240

Query  958   PTIPVGLL-PTTAYddeedddkkaAWL---EIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             P  PVG L P T   D  DD+    W     IK+WLD QEKGSV+YVAFGSE KP+QEE+
Sbjct  241   PVFPVGQLSPLT--IDNCDDESNGVWTGGSTIKQWLDSQEKGSVIYVAFGSEAKPSQEEL  298

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              EIA GLELS LPFFWV RKQRG  D ++ +LPEGFEERT  RG++CT WAPQLKILSHD
Sbjct  299   TEIAHGLELSGLPFFWVLRKQRGEFDTDLIELPEGFEERTNDRGMVCTGWAPQLKILSHD  358

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             SVGGFLTHSGWSSVVEAL +EK LI+ PFL DQG+  RLL EK+M Y+I RDE +G+F+R
Sbjct  359   SVGGFLTHSGWSSVVEALSYEKALILLPFLSDQGLNARLLEEKKMAYSIPRDEREGTFTR  418

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPSG  257
             DSVA SL +VM+EE GKV+ E  K M+    +K KQ+ YV+ L+ YL     I   +G
Sbjct  419   DSVANSLSLVMLEEGGKVYRENAKNMRELFADKGKQEKYVDNLMKYLQKHREIEKENG  476



>ref|XP_003635105.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Vitis vinifera]
Length=480

 Score =   497 bits (1279),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 262/467 (56%), Positives = 332/467 (71%), Gaps = 6/467 (1%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             + LH+VM PWLAFGH+IPYLELAKL+A+ GN + FVSTPRNI RLPKL P+L P I  + 
Sbjct  13    AQLHVVMFPWLAFGHMIPYLELAKLIAQSGNHVSFVSTPRNIDRLPKLPPNLAPFITFVK  72

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             LPLP V NL E+AE+T DLP DKV++LK+A+D LQ  MA FL    PDWVIHDFA + L 
Sbjct  73    LPLPHVPNLLENAEATADLPNDKVQFLKVAYDLLQQPMARFLDAADPDWVIHDFAPYWLG  132

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
             PI  KL I   +FSIF AS  + F P     D ++   EP H T  PKWVPF++ +  R 
Sbjct  133   PIATKLGISCAFFSIFNASCVSFFTPG----DQLEYRSEPDHFTVPPKWVPFQSKVAFRY  188

Query  1123  FEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
             FE++++ ++    D   +S  YRL  +++G   + VRSC+ELEPEWL+L E++  KP IP
Sbjct  189   FEIKKIISEGLSGDASGISFKYRLTESIEGCDLLAVRSCFELEPEWLRLLEQLNRKPVIP  248

Query  946   VGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLE  767
             VG L     DD  DD K   W +IKEWLDK  +GSVVYVAFGSE KPNQ E+ EIALGLE
Sbjct  249   VGQL-APELDDRGDDGKDETWQQIKEWLDKLARGSVVYVAFGSEAKPNQTEITEIALGLE  307

Query  766   LSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
              S+LPFFWV +   G +D E+ KLPEGFEERT+GRGV+CTSWAPQLKILSHDS+GGFL+H
Sbjct  308   QSELPFFWVLKMSLGPSDTEMVKLPEGFEERTKGRGVVCTSWAPQLKILSHDSIGGFLSH  367

Query  586   SGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLR  407
             SGWSSVVEAL  E+ LI+  F  DQG+    L EK+MGY I R+  DGSF+R++VA+SLR
Sbjct  368   SGWSSVVEALSLERPLILLTFFADQGLNASFLQEKKMGYLIPRNGGDGSFTREAVAQSLR  427

Query  406   VVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             +VMVEE GK++ +K K+M     +++KQ +Y++  + YL A   I +
Sbjct  428   LVMVEEGGKIYRDKAKEMSGLFRDRDKQKHYMDNFVSYLKAYRRIKN  474



>ref|XP_007047762.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOX91919.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=535

 Score =   498 bits (1282),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 259/467 (55%), Positives = 335/467 (72%), Gaps = 3/467 (1%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             S LHI M PWLAFGH+IP+LE AKL+AE+G+KI F STP+NI RLPKL PHL   I  I 
Sbjct  64    SKLHIAMFPWLAFGHMIPFLEFAKLVAEKGHKISFSSTPKNIDRLPKLPPHLASLIYFIK  123

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             LPLPQ+ +LP++AE+T+D+P D V Y K A+D LQ  MA  LQ+LSPDW++ DFA++ L 
Sbjct  124   LPLPQINHLPQNAEATIDVPLDDVWYFKKAYDGLQQPMAQLLQSLSPDWLLLDFAAYWLP  183

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
              I   L+IP+ +FSI TA+      P S ++ G +   +P+     PKWV F +T+  + 
Sbjct  184   SIARSLNIPNAFFSIVTAACLGYLGPPSFLMHGDEDHKKPEDYAVLPKWVTFPSTVRLKL  243

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPV  944
             +E+ +++N    D  N SD YR G T+K    V VRSC ELEPEWL+L E++  KP IPV
Sbjct  244   YEVLKIYNGITGDKTNTSDFYRFGATLKDCDMVAVRSCMELEPEWLKLLEQLYEKPVIPV  303

Query  943   GLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLEL  764
             G LPTT Y    + ++   W  +KEWLDKQEKGSVVY+AFGSE KP+QEE+ EIA GLE 
Sbjct  304   GELPTTDY---NNSEETEGWKSMKEWLDKQEKGSVVYIAFGSEAKPSQEELNEIAQGLEF  360

Query  763   SQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHS  584
             S LPF WV RK RGS DAE  KLPEGFEERT+ RGV+ T+WAPQLKIL+HDS+GGFLTH+
Sbjct  361   SGLPFLWVLRKSRGSTDAEPIKLPEGFEERTKERGVVLTTWAPQLKILAHDSIGGFLTHT  420

Query  583   GWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRV  404
             GWSSVVEA +F + LI+  FL DQGI  RLL EK++GY+I R E DGSF+R+SVAESLR+
Sbjct  421   GWSSVVEAPQFLRPLILFTFLADQGINARLLEEKKIGYSIPRKEQDGSFTRNSVAESLRL  480

Query  403   VMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHP  263
             V+VE+ GK++ +K K+MK    +++KQ+ Y++  L YL     + +P
Sbjct  481   VVVEDEGKIYRDKAKEMKRVFGDRDKQNWYLDNFLGYLENHRRLKNP  527



>ref|XP_006466331.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Citrus sinensis]
Length=478

 Score =   494 bits (1273),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 262/462 (57%), Positives = 339/462 (73%), Gaps = 2/462 (0%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +++S L I M PWLAFGH+IP+LELAKL+A++G+KI+F+STPRNI RLP+L  +L   I 
Sbjct  2     ADNSKLQIAMFPWLAFGHMIPWLELAKLIAQKGHKIFFISTPRNIDRLPRLPQNLASMIQ  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              + + LP V+NL E+AE+T+DLPYD+V+YLK +FD L++ MA  LQ+L+PDW++ DFA++
Sbjct  62    FVKISLPHVDNLRENAEATIDLPYDEVKYLKQSFDCLEEPMAKLLQSLAPDWLLFDFAAY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVI-DGVDSPVEPKHTTSKPKWVPFETTI  1136
              L     +L IPS +FSIFTA+    F P S +I D  D    P+  T  P WV F TTI
Sbjct  122   WLPARARELGIPSGFFSIFTAATLGYFGPSSVLINDSGDHLKTPEDYTRVPNWVSFPTTI  181

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R FE  +VF+    D  NVS  YR G ++KG   V VRSC E EPEWL+L E++  KP
Sbjct  182   SYRLFEARKVFDILISDESNVSHGYRFGQSLKGCDIVAVRSCMEFEPEWLKLLEQLHRKP  241

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVG LPTT   D + D +   W  IKEWLD+QEKGSVVYVAFGSE KP+QEE+ EIAL
Sbjct  242   VIPVGQLPTTT-GDGDSDAETDTWRSIKEWLDEQEKGSVVYVAFGSEAKPSQEELTEIAL  300

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS+LPFFWV +K+ G AD E  +LP+GFEERTRGRGV+ TSWAPQL IL+HDSVGGF
Sbjct  301   GLELSKLPFFWVLKKRLGQADTEPIELPDGFEERTRGRGVVYTSWAPQLAILAHDSVGGF  360

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH+GWSSVVEAL+F   LI+     DQG+  +LL EK++   I RDE DGSF+R+SVAE
Sbjct  361   LTHAGWSSVVEALQFGMPLIVLTCYADQGLNAKLLEEKQIVELIPRDEGDGSFTRNSVAE  420

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             SLR+V+VEE G+++ +K+K+MK    ++ +QD+YV+  L+YL
Sbjct  421   SLRLVLVEEKGQIYRDKLKEMKELFGDRGRQDHYVDNFLNYL  462



>ref|XP_002270260.1| PREDICTED: UDP-glycosyltransferase 91A1 [Vitis vinifera]
Length=479

 Score =   492 bits (1267),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 254/468 (54%), Positives = 334/468 (71%), Gaps = 7/468 (1%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             + + LHIV+ PWLAFGH+IPYLELAKL+A+RG+ + FVSTPRNI RLPKL P+L P I  
Sbjct  11    DDAKLHIVLFPWLAFGHMIPYLELAKLVAQRGHHVSFVSTPRNIDRLPKLPPNLTPFISF  70

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + +PLP V NLPE+AE+T DLP +KV++LK A++ L++ +  FL   +PDWV+HDF ++ 
Sbjct  71    VKIPLPHVPNLPENAEATTDLPENKVQFLKQAYNLLEEGITGFLDAAAPDWVLHDFTAYW  130

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             LVPI  KL I   + SIFTAS+   F P      G D   EP+  T  PKWVPF + +  
Sbjct  131   LVPIATKLGIACGFLSIFTASVLCFFNPS-----GQDHRTEPEDFTVAPKWVPFPSRVAF  185

Query  1129  RNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
             R FE+ ++FN+A   D    SD++R    ++G   + VRSC ELEPEWL+L E++  KP 
Sbjct  186   RYFEVVKIFNNAIAGDASGTSDMHRFEACIRGCDLLAVRSCTELEPEWLRLLEQLYQKPV  245

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             +PVG LP     +  DDD+   WLEIK WLDKQ  GSVVYVAFGSE KPNQ E+ EIALG
Sbjct  246   VPVGQLPPI-LPNGGDDDEDETWLEIKCWLDKQAGGSVVYVAFGSEAKPNQTELTEIALG  304

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LE S+LPFFW  + +RG  D EV +LPEGF+ERT+GRGV+CTSWAPQLKILSH S+ GFL
Sbjct  305   LEQSELPFFWALKLKRGPCDTEVIQLPEGFKERTKGRGVVCTSWAPQLKILSHPSICGFL  364

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             +HSGW+SVVEAL+ E+ LI+  FL DQG+    L EK+MG  I R+E DGSF+R++VA+S
Sbjct  365   SHSGWTSVVEALQLERPLILLTFLADQGLNASFLREKKMGCLIPRNEEDGSFTREAVAQS  424

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIH  269
             LR+V+VEE GK++ +K K+M+    ++++Q+ YV+ L+  L     IH
Sbjct  425   LRLVVVEEGGKIYRDKAKEMRGVFGDRDRQNQYVDTLVSCLKEHRHIH  472



>gb|KDO60536.1| hypothetical protein CISIN_1g011765mg [Citrus sinensis]
Length=478

 Score =   491 bits (1263),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 261/462 (56%), Positives = 335/462 (73%), Gaps = 2/462 (0%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +++S L I M PWLAFGH+IP+LELAKL+A++G+KI+F+STPRNI RLP+L  +L   I 
Sbjct  2     ADNSKLQIAMFPWLAFGHMIPWLELAKLIAQKGHKIFFISTPRNIDRLPRLPQNLASMIQ  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              + + LP V+NL E+AE+T+DLPYD+V+YLK +FD L++ MA  LQ+L+PDW++ DFA++
Sbjct  62    FVKISLPHVDNLRENAEATIDLPYDEVKYLKQSFDCLEEPMAKLLQSLAPDWLLFDFAAY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVI-DGVDSPVEPKHTTSKPKWVPFETTI  1136
              L     +L IPS +FSIFTA+    F P S +I D  D    P+  T  P WV F TTI
Sbjct  122   WLPARARELGIPSGFFSIFTAATLGYFGPSSVLINDSGDHLKTPEDYTRVPNWVSFPTTI  181

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R FE  +VF+    D  NVS  YR G ++KG   V VRSC E EPEWL+L E++  KP
Sbjct  182   SYRLFEARKVFDILISDESNVSHGYRFGQSLKGCDIVAVRSCMEFEPEWLKLLEQLHRKP  241

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVG LPTT   D + D +   W  IKEWLD+QEKGSVVYVAFGSE KP+QEE+ EIAL
Sbjct  242   VIPVGQLPTTT-GDGDSDAETDTWRSIKEWLDEQEKGSVVYVAFGSEAKPSQEELTEIAL  300

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS+LPFFWV +K+ G AD E  +LP+GFEERTRGRGV+ TSWAPQL IL+HDSVGGF
Sbjct  301   GLELSKLPFFWVLKKRLGQADTEPIELPDGFEERTRGRGVVYTSWAPQLAILAHDSVGGF  360

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH+GWSSVVEAL+F   LI+     DQG+  +LL EK++   I RDE DG F+R+SVAE
Sbjct  361   LTHAGWSSVVEALQFGMPLIVLTCYADQGLNAKLLEEKQIVELIPRDEGDGFFTRNSVAE  420

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             SLR+V+VEE G+++ +K K+MK    +K + D YV+  L+YL
Sbjct  421   SLRLVLVEEKGQIYRDKAKEMKGLFGDKGRHDRYVDNFLNYL  462



>ref|XP_006426251.1| hypothetical protein CICLE_v10025508mg [Citrus clementina]
 gb|ESR39491.1| hypothetical protein CICLE_v10025508mg [Citrus clementina]
Length=478

 Score =   490 bits (1261),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 261/462 (56%), Positives = 335/462 (73%), Gaps = 2/462 (0%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +++S L I M PWLAFGH+IP+LELAKL+A++G+KI+F+STPRNI RLP+L  +L   I 
Sbjct  2     ADNSKLQIAMFPWLAFGHMIPWLELAKLIAQKGHKIFFISTPRNIDRLPRLPQNLASMIQ  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              + + LP V+NL E+AE+T+DLPYD+V+YLK +FD L++ MA  LQ+L+PDW++ DFA++
Sbjct  62    FVKISLPHVDNLRENAEATIDLPYDEVKYLKQSFDCLEEPMAKLLQSLAPDWLLFDFAAY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVI-DGVDSPVEPKHTTSKPKWVPFETTI  1136
              L     +L IPS +FSIFTA+    F P S +I D  D    P+  T  P WV F TTI
Sbjct  122   WLPARARELDIPSGFFSIFTAATLGYFGPSSVLINDSGDHLKTPEDYTRVPSWVSFPTTI  181

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R FE  +VF+    D  NVS  YR G ++KG   V VRSC E EPEWL+L E++  KP
Sbjct  182   SYRLFEARKVFDILISDESNVSHGYRFGQSLKGCDIVAVRSCMEFEPEWLKLLEQLHRKP  241

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVG LPTT   D + D +   W  IKEWLD+QEKGSVVYVAFGSE KP+QEE+ EIAL
Sbjct  242   VIPVGQLPTTT-GDGDSDAETDTWRSIKEWLDEQEKGSVVYVAFGSEAKPSQEELTEIAL  300

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS+LPFFWV +K+ G AD E  +LP+GFEERTRGRGV+ TSWAPQL IL+HDSVGGF
Sbjct  301   GLELSKLPFFWVLKKRLGQADTEPIELPDGFEERTRGRGVVYTSWAPQLAILAHDSVGGF  360

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH+GWSSVVEAL+F   LI+     DQG+  +LL EK++   I RDE DG F+R+SVAE
Sbjct  361   LTHAGWSSVVEALQFGMPLIVLTCYADQGLNAKLLEEKQIVELIPRDEGDGFFTRNSVAE  420

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             SLR+V+VEE G+++ +K K+MK    +K + D YV+  L+YL
Sbjct  421   SLRLVLVEEKGQIYRDKAKEMKGLFGDKGRHDRYVDNFLNYL  462



>ref|XP_002297733.1| glycosyltransferase family protein [Populus trichocarpa]
 gb|EEE82538.1| glycosyltransferase family protein [Populus trichocarpa]
Length=475

 Score =   489 bits (1259),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 261/462 (56%), Positives = 331/462 (72%), Gaps = 6/462 (1%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             ++ S LHI M PWLAFGH+IPYLELAKL+A++G+KI F+STPRNI RLPKL P+L P I+
Sbjct  2     ADDSKLHIAMFPWLAFGHMIPYLELAKLIAQKGHKITFISTPRNIDRLPKLPPYLSPLIN  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP-DWVIHDFAS  1316
              + LPLP   +L E  E+T D+PY+KV+YLK+AFD L++ M  FL T    D++++DFA 
Sbjct  62    FVKLPLPHAAHLLEGDEATTDVPYNKVQYLKVAFDGLKEPMTRFLATSHDIDYLLYDFAP  121

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
             + L  I   L IP+ +FSIF  +      P S + D      EP+H T  PK +PF TT+
Sbjct  122   YWLPEIATGLGIPNAFFSIFLGAAVCFLKPASLIEDRT----EPEHFTVPPKSIPFPTTV  177

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               + FE+ R+F     D  +VSD+YRL   ++    V +RSC E EPEWL L +E++GKP
Sbjct  178   RFKLFEILRIFESVTGDASDVSDIYRLQEVLRCCQMVAIRSCMEFEPEWLHLFQELIGKP  237

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVGLL  T  DD   D+    W  +K+WLDKQEKGSVVYVAFGSE KP+Q E+ EIAL
Sbjct  238   VIPVGLLAPTE-DDAVRDEGSGMWKSMKDWLDKQEKGSVVYVAFGSEAKPSQVELTEIAL  296

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS LPFFWV R +RG  D EV KLPEGFE+RTRGRG++ TSW PQLKIL+HDSVGGF
Sbjct  297   GLELSGLPFFWVLRTRRGLTDNEVIKLPEGFEDRTRGRGLVFTSWVPQLKILAHDSVGGF  356

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTHSGWSSVVEAL+ E+ LI+  FL +QG+ +R+  EK++GY I RDE+DGSF+RDSVAE
Sbjct  357   LTHSGWSSVVEALQHERALILLSFLAEQGLNSRVFEEKKIGYPIPRDESDGSFTRDSVAE  416

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             SLR+VMV+E GK++ EK K+MK     K+ QD YV   L Y+
Sbjct  417   SLRLVMVKEEGKIYREKAKEMKGLFGNKDIQDQYVVNFLRYI  458



>ref|XP_002532392.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30004.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=471

 Score =   485 bits (1249),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 262/463 (57%), Positives = 339/463 (73%), Gaps = 6/463 (1%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             ++ S LHIVM PWLAFGH+IPYLELAK +A++G+K+ FVS+PRNI RLPKL P+L P I 
Sbjct  2     ADHSELHIVMFPWLAFGHMIPYLELAKHIAQKGHKVSFVSSPRNIDRLPKLPPNLSPYIK  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              + L LP V  LP+DAE+T D+PYDKV+YLK A+D L++ +  FL+T  P W+++DFA +
Sbjct  62    FVKLRLPHVAGLPQDAEATTDVPYDKVQYLKKAYDGLKEPLTKFLETSDPHWLLYDFAPY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              L  + + L I + +FSIF A+  +   P S     ++   +P+  T  PKWV F + + 
Sbjct  122   WLPDVAKNLGISNAFFSIFLAASLSFVKPHS----WIEYRSKPEDFTVPPKWVSFPSKVT  177

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R  E+ R+F+    D  +VSD+YR+   VKG   V VRSC E EPEWL L EE  GKP+
Sbjct  178   FRLHEILRIFDVVTGDESDVSDIYRMEEVVKGCDVVVVRSCVEFEPEWLHLLEENHGKPS  237

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IPVG+L TT Y+ E+++ +   W  IKEWLDKQEKGSVVYVAFGSE KP Q E+ EIA G
Sbjct  238   IPVGMLATTEYNSEDEEPEA--WRSIKEWLDKQEKGSVVYVAFGSEAKPTQVELNEIAFG  295

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LE S LPFFWV +K+RG AD EV +LP+GFEERT+ RG++CTSWAPQLKIL+H S+GGFL
Sbjct  296   LEFSGLPFFWVLKKRRGIADTEVIELPDGFEERTKERGMVCTSWAPQLKILAHGSIGGFL  355

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             THSGWSSVVEA+++E+ LI+  FL DQ    RLL EK+MGY I R+E DGSF+RDSVAES
Sbjct  356   THSGWSSVVEAIQYERALILLTFLADQSFNARLLEEKKMGYPIPRNEIDGSFNRDSVAES  415

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             LR+VMV+E G ++ EKVK+MK    ++EKQ +YV+  LDYLH+
Sbjct  416   LRLVMVKEEGNIYREKVKEMKGLFADREKQGSYVDNFLDYLHS  458



>ref|XP_004250158.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=470

 Score =   485 bits (1248),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 257/471 (55%), Positives = 344/471 (73%), Gaps = 5/471 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LHI + PWLAFGH+IPYLEL+KL+A++G+KI F+STPRNI RLPKL P+L P 
Sbjct  1     MAENGKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPNLTPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             ++ + LP+P VE LPE+AE+T+DLPY++V+YLK+A D LQ+SM+ F++    D+++ DF 
Sbjct  61    LNFVKLPMPHVEKLPENAEATIDLPYEQVKYLKLAQDALQESMSKFIEDSDIDFILFDFT  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S+ +  I  K +IPS YFSIF A+      P   + +  +  + P+  T  PKWVPFETT
Sbjct  121   SYWVPSIASKFNIPSGYFSIFIAAFLGFTGPVPGLNNDYEIRMTPEEYTVTPKWVPFETT  180

Query  1138  IMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             +  + FE+ R+F +A + G   N++D+ R   +V+    + VRSC E EPEWL++  ++ 
Sbjct  181   VAFKLFEVSRIF-EASMKGEEENIADIVRYYRSVENCDFLLVRSCSEFEPEWLKVVGDIH  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              KP  PVG LPTT Y+D+        W EIK WLDKQEKG V+YVAFGSE KP+Q E+ E
Sbjct  240   RKPVFPVGQLPTTPYEDDSTKIDA--WREIKLWLDKQEKGKVIYVAFGSEAKPSQNELTE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             ++LGLELS LPFFWV R +RG +D E+ +LPEGFEERT+GRG++CTSWAPQLKILSHDSV
Sbjct  298   LSLGLELSGLPFFWVLRIKRGESDDELIQLPEGFEERTKGRGIVCTSWAPQLKILSHDSV  357

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTHSGWSSVVEA++FEK L++  FL DQGI  RLL EK+M Y+I R++ DGSF+RDS
Sbjct  358   GGFLTHSGWSSVVEAIQFEKSLVLLTFLADQGINARLLEEKKMAYSIPRNDQDGSFTRDS  417

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTI  272
             VAESL +V+V+E G ++ EK+K+MK    +K++Q+NYV  LL +L     I
Sbjct  418   VAESLNLVLVKEEGFIYREKIKEMKDLFCDKKRQNNYVENLLSFLQDYEKI  468



>ref|XP_006353157.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=483

 Score =   485 bits (1249),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 258/473 (55%), Positives = 343/473 (73%), Gaps = 5/473 (1%)
 Frame = -3

Query  1684  SAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLV  1505
             + MA     LHI + PWLAFGH+IPYLEL+KL+A++G+KI F+STPRNI RLPKL  +L 
Sbjct  12    TKMAENGKKLHIALFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPSNLT  71

Query  1504  PNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
             P  + + LP+P VE LPE+AE+T+DLPY++V+YLK+A D L++SMA FL+    D+++ D
Sbjct  72    PFFNFVKLPMPHVEKLPENAEATIDLPYEQVKYLKLAQDALEESMAKFLEDSDIDFILFD  131

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFE  1145
             F S+ +  I  K +IPS YFSIF A+      P   + +  +  + P+  T  PKWVPFE
Sbjct  132   FTSYWVPSIASKFNIPSGYFSIFIAAFLGFTGPVPGLNNDYEIRMTPEEYTVTPKWVPFE  191

Query  1144  TTIMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             TT+  + FE+ R+F +A + G   N++D+ R   +V+    + VRSC E EPEWL++  +
Sbjct  192   TTVAFKFFEVSRIF-EASMKGEEENIADIIRYYKSVENCDFLLVRSCSEFEPEWLKVVGD  250

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP IPVG LPTT Y+D+        W EIK WLDKQEKG V+YVAFGSE KP+Q E+
Sbjct  251   IHRKPVIPVGQLPTTPYEDDSTKIDA--WREIKLWLDKQEKGKVIYVAFGSEAKPSQNEL  308

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              E++LGLELS LPFFWV R +RG +D E+ +LPEGFEERT+GRG++CTSWAPQLKILSHD
Sbjct  309   TELSLGLELSGLPFFWVLRTKRGESDDELIQLPEGFEERTKGRGIVCTSWAPQLKILSHD  368

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             SVGGFLTHSGWSSVVEA++FEK L++  FL DQGI  RLL EKEM Y+I R++ DGSF+R
Sbjct  369   SVGGFLTHSGWSSVVEAIQFEKSLVLLTFLADQGINARLLEEKEMAYSIPRNDQDGSFTR  428

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTI  272
             DSVAESL +V+V++ G ++ EK+K+MK    +KE+Q+NYV   L +L     I
Sbjct  429   DSVAESLNLVLVKKEGFIYREKIKEMKDLFCDKERQNNYVENFLSFLQNYEKI  481



>ref|XP_002270294.1| PREDICTED: UDP-glycosyltransferase 91A1 [Vitis vinifera]
Length=479

 Score =   483 bits (1243),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 253/461 (55%), Positives = 327/461 (71%), Gaps = 7/461 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             + + LHIV+ PWLAFGH+IPYLELAKL+A+RG+ + FVSTPRNI RLPKL P+L P I  
Sbjct  11    DDAKLHIVLFPWLAFGHMIPYLELAKLVAQRGHHVSFVSTPRNIDRLPKLPPNLTPFISF  70

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + +PLP V NLPE+AE+T DLP +KV +LK A++ L++ +  FL   +PDWV+HDF ++ 
Sbjct  71    VKIPLPHVPNLPENAEATTDLPENKVPFLKQAYNLLEEGITGFLDAAAPDWVLHDFTAYW  130

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             LVPI  KL I   + SIFTAS    F P      G D   EP+  T  PKWVPF + +  
Sbjct  131   LVPIATKLGIACGFLSIFTASALCFFNPS-----GQDHRTEPEDFTVAPKWVPFPSRVAF  185

Query  1129  RNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
             R FE+ ++FN+A   D    SD++R    ++G   + VRSC ELEPEWL+L E++  KP 
Sbjct  186   RYFEVVKIFNNAIAGDASGTSDMHRFEACLRGCDLLAVRSCTELEPEWLRLLEQLYQKPV  245

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             +PVG LP        DDD+   WLEIK WLDKQ  GSVVYVAFGSE KPNQ E+ EIALG
Sbjct  246   VPVGQLPPI-LPHGGDDDEDETWLEIKGWLDKQAGGSVVYVAFGSEAKPNQTELTEIALG  304

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LE S+LPFFW  + +RG  D EV +LPEGFEERT+GRGV+CTSWAPQLKILSH S+ GFL
Sbjct  305   LEQSELPFFWALKLKRGPCDIEVIQLPEGFEERTKGRGVVCTSWAPQLKILSHPSICGFL  364

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             +HSGW+SVVEAL+ E+ LI+  FL DQG+    L EK+MG  I R+E DGSF+R++VA S
Sbjct  365   SHSGWTSVVEALQLERPLILLTFLADQGLNASFLREKKMGCLIPRNEEDGSFTREAVARS  424

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             LR+V+VEE  K + +K K+M+A   ++++Q+ YV+ L+  L
Sbjct  425   LRLVVVEEGDKFYRDKAKEMRAVFGDRDRQNQYVDTLVSCL  465



>ref|XP_006353155.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=470

 Score =   481 bits (1238),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 256/466 (55%), Positives = 347/466 (74%), Gaps = 5/466 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA  S  LHI + PWLAFGH+IPYLEL+KL+A++G++I F+STPRNI RLPKL P+L+P 
Sbjct  1     MAENSKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHRISFISTPRNIDRLPKLPPNLIPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             ++ + LP+P VE LPE+AE+T+D+PY++V+YLK+A D L++SMA FL+    D+++ DF 
Sbjct  61    LNFVKLPMPHVERLPENAEATIDVPYEQVKYLKLAQDGLEESMAKFLEDSDLDFILFDFT  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S+ +  I  K +IPS +FSIF A+      P   + +  +    P+  T  PKWVPFETT
Sbjct  121   SYWVPSIASKFNIPSGHFSIFIAAFLGFTGPVPGLNNDYEIRTTPEEYTVPPKWVPFETT  180

Query  1138  IMPRNFEMERVFNDAYIDG--GNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             +  + FE+ R+F +A + G   N++D+ R   +V+    + VRSC ELEPEWL++  ++ 
Sbjct  181   VAFKLFEVLRIF-EATMKGEEDNIADITRYCKSVENCDFLLVRSCSELEPEWLKVVGDIH  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              KP  PVG LPTT Y+D+  +     W EIK WLDKQEKG V+YVAFGSETKP+Q E+ E
Sbjct  240   RKPVFPVGQLPTTPYEDDSTEMDA--WKEIKLWLDKQEKGKVIYVAFGSETKPSQNELTE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             ++LGLELS LPFFWV R +RG +D E+T+LPEGFE+RT+GRG++CTSWAPQLKILSHDSV
Sbjct  298   LSLGLELSGLPFFWVLRTKRGESDDELTQLPEGFEDRTKGRGIVCTSWAPQLKILSHDSV  357

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTHSGWSSVVEA++FEK L++  F  DQGI  RLL EK++ Y+I RD+ DGSF+ +S
Sbjct  358   GGFLTHSGWSSVVEAIQFEKSLVLLTFSADQGINARLLEEKKIAYSIPRDDCDGSFTHES  417

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             +AESL +V+V+  G+++ EKVK+MK+   +KE+QDNYV  LL YL 
Sbjct  418   IAESLNLVLVKREGEIYREKVKEMKSLFCDKERQDNYVENLLRYLQ  463



>gb|AFK35814.1| unknown [Medicago truncatula]
 gb|KEH20105.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=469

 Score =   481 bits (1238),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 242/464 (52%), Positives = 321/464 (69%), Gaps = 3/464 (1%)
 Frame = -3

Query  1681  AMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
              +  E   LHIVM PWLAFGH+IPYLELAKL+A++G+K+ +VSTPRNIQRLPKL P++ P
Sbjct  3     TIRDEEKALHIVMFPWLAFGHMIPYLELAKLIAQKGHKVSYVSTPRNIQRLPKLPPNVAP  62

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
              I  + LPLP+V+NLPE+AE+T D+PYD V YLK AFD+L+     FL+T +  W+ HDF
Sbjct  63    LIKFVNLPLPKVDNLPENAEATTDIPYDVVPYLKNAFDKLEKPFTHFLETSNAGWIFHDF  122

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             A+F + P   +L I   +FSIFTA       P S ++       +P+  T  P WVPF+T
Sbjct  123   ANFWIAPTASQLGIKCAFFSIFTAPTMGFLGPVSVILGDEPGRTKPEDFTVAPPWVPFQT  182

Query  1141  TIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
             T+  R FE+ +  +         SDL+R G++++ +  + +R C E EPEW Q+ + +  
Sbjct  183   TVAYRYFEIIKTADILSDKILGTSDLHRYGLSIQNSDFILIRGCTEFEPEWFQVIQNIHQ  242

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             K  +P G LP T +D   ++D    W  IKEWLDKQ  G+VVYVAFGSE KP+QEEV EI
Sbjct  243   KTVLPAGQLPNTEFDSGHENDS---WPRIKEWLDKQPHGTVVYVAFGSEAKPSQEEVNEI  299

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLE S LPFFWV + +RG  D  V +LPEGFEERT+GRGV+CT W PQ+KIL H +VG
Sbjct  300   ALGLEKSNLPFFWVLKVRRGPTDKVVLQLPEGFEERTKGRGVVCTDWVPQMKILGHMAVG  359

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH+GW+SVVEA++ EK L++  +L DQGI  R+L EK+MGY++ RDE DGSF+ DSV
Sbjct  360   GFLTHAGWTSVVEAVQHEKPLVLLTYLSDQGINARVLEEKKMGYSVPRDERDGSFTSDSV  419

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             A S+R+++VEE G ++ E +K MK      E+QD YVN LL +L
Sbjct  420   AHSIRLIVVEEEGMIYRENIKNMKDLFVNIERQDKYVNNLLSHL  463



>ref|XP_011000621.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Populus euphratica]
Length=472

 Score =   481 bits (1237),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 258/462 (56%), Positives = 327/462 (71%), Gaps = 6/462 (1%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             ++ S LHI M PWLAFGH+IPYLELAKL+A++G+KI F+STPRNI RLPKL P+L P I+
Sbjct  2     ADDSKLHIAMFPWLAFGHMIPYLELAKLIAQKGHKITFISTPRNIDRLPKLPPYLSPLIN  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP-DWVIHDFAS  1316
              + LPLP   +L E  E+T D+PY+KV++LK+AFD L++ M  FL T    D++++DFA 
Sbjct  62    FVKLPLPHAAHLLEGDEATTDVPYNKVQHLKVAFDGLKEPMTRFLATSHDIDYLLYDFAP  121

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
             + L  I   L IP+ +FSIF  +      P S + D      EP+H T  PK +PF TT+
Sbjct  122   YWLPEIATGLGIPNAFFSIFLGAAVCFLKPASLIEDRT----EPEHFTVPPKSIPFPTTV  177

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               + FE+ R+F     D  +VSD YRL   ++    V +RSC E EPEWL L +E++GKP
Sbjct  178   RFKLFEILRIFESITGDASDVSDSYRLQEVLRCCQMVAIRSCMEFEPEWLHLFQELIGKP  237

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVGLL  T  DD   D+    W  +K+WLDKQEKGSVVYVAFGSE KP+Q E+ EIAL
Sbjct  238   VIPVGLLAPTE-DDAVRDEGSGMWKSMKDWLDKQEKGSVVYVAFGSEAKPSQVELTEIAL  296

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS LPFFW  R +RG  D E  KLPEGFE+RTRGRG++ TSW PQLKIL+HDSVGGF
Sbjct  297   GLELSGLPFFWALRTRRGLTDNEAIKLPEGFEDRTRGRGLVFTSWVPQLKILAHDSVGGF  356

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTHSGWSSVVEAL+ E+ LI+  FL +QG+ +R+  EK++GY I RDE DGSF+RDSVAE
Sbjct  357   LTHSGWSSVVEALQHERALILLSFLAEQGLNSRVFEEKKIGYPIPRDEFDGSFTRDSVAE  416

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             SLR+VMV+E GK++ EK K+MK     K+ QD YV   L Y+
Sbjct  417   SLRLVMVKEEGKIYREKAKEMKGLFGNKDIQDQYVVNFLRYI  458



>ref|XP_010023429.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=494

 Score =   481 bits (1238),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 251/475 (53%), Positives = 330/475 (69%), Gaps = 4/475 (1%)
 Frame = -3

Query  1687  FSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHL  1508
             +SAMA     LHIVMLPWLAFGH+ PYLELAKL+A +G++I F+S PRNI RLPK  P L
Sbjct  17    YSAMADTHDNLHIVMLPWLAFGHMTPYLELAKLMAGKGHRISFLSAPRNIDRLPKPTPDL  76

Query  1507  VPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIH  1328
              P I  + LPLP +E+LPE AE+T DLPYDK++YLK A+D LQ+ +A FL++  PDW+++
Sbjct  77    TPLISFVKLPLPAIEHLPEGAEATSDLPYDKIQYLKKAYDMLQEPVARFLESSDPDWIMY  136

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPF  1148
             DFA +    I  +L I SV+F+I   +      P S    G D    P+  T  PKWVPF
Sbjct  137   DFAPYWAGSIASRLGIRSVFFTILIGAGLGFIGP-SQDSKGGDYRKTPEDFTRPPKWVPF  195

Query  1147  ETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
              T +   +FE++++F+    +   V+DLYRL  + +    + +RS YE+EPEWL L ++V
Sbjct  196   PTKVAFHHFEIKKIFDSVTGNASGVTDLYRLKASQENCDIIALRSSYEVEPEWLTLLKDV  255

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP  PVG LP     D +   +   W  IKEWLD Q+ G+VVYVAFGSE+KP Q E+ 
Sbjct  256   YAKPVFPVGQLPPG---DPDSRGETETWRLIKEWLDAQKNGTVVYVAFGSESKPTQTELT  312

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             EIALGLELS LPFFWV + + GSAD+E+  LP+GFEER +GRGV+  SW PQLKIL+H+S
Sbjct  313   EIALGLELSGLPFFWVLKTRLGSADSELIMLPDGFEERVKGRGVVWDSWVPQLKILAHNS  372

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VGGFLTH GW+S VEAL FE+ LI+  FL DQG+  RLL E+++GY+I R+E+DGS +R 
Sbjct  373   VGGFLTHGGWNSAVEALSFERALILFTFLADQGLNARLLEERQIGYSIPRNESDGSVTRQ  432

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHP  263
             SVAESLR+VMVEE G+V+ EK K+M+    +K+ Q+ YVN LL+YL     + HP
Sbjct  433   SVAESLRMVMVEEKGRVYREKAKEMRPIFEDKDIQERYVNNLLNYLKDHRPVKHP  487



>ref|XP_002318358.2| hypothetical protein POPTR_0012s01130g [Populus trichocarpa]
 gb|EEE96578.2| hypothetical protein POPTR_0012s01130g [Populus trichocarpa]
Length=475

 Score =   479 bits (1234),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 246/478 (51%), Positives = 331/478 (69%), Gaps = 6/478 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     +H+ M PWLAFGH++P+LELAKL A +G+KI F+STPRNI RLPK    +   
Sbjct  1     MADSDDKIHVAMFPWLAFGHMMPWLELAKLFAAKGHKISFISTPRNIDRLPKPPADVSST  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             +  + LPLPQVE LP DAE+T+DLP +KV+YLKIA D++Q+  A  L++L+PDW+ +DFA
Sbjct  61    LHFVKLPLPQVEGLPPDAEATIDLPANKVQYLKIALDKVQEPFAKVLESLNPDWIFYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              +   PI  +L I S YFSI  A++ A   P S +IDG D   +P+  T  PKWV F+TT
Sbjct  121   QYWTGPIAAQLGIKSTYFSICIAAMVAFLGPPSPLIDGDDYRKKPEDFTIPPKWVSFQTT  180

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  + +++   F+    D   V+DL R G+ ++    + VRS +E+EPEWLQ+ E +  K
Sbjct  181   VAYKYYDIMNTFDCVEDDASGVNDLKRWGLCLQSCDFIAVRSSFEIEPEWLQVLETIHEK  240

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P  PVG LP   Y  E ++    AW  +K+W D QEK SVVYVAFGSE KP+Q ++ E+A
Sbjct  241   PVFPVGQLPPVEY--ELEEKNSDAWSSMKKWFDMQEKSSVVYVAFGSEAKPSQAQLTELA  298

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLELS LPFFWV R +RG  D ++ +LP GFEERT+G+GV+CT+WAPQL IL+H+S+ G
Sbjct  299   LGLELSGLPFFWVLRTRRGITDTDLIELPPGFEERTKGQGVVCTTWAPQLMILAHESIAG  358

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTHSGWSSVVEAL F+K LI+  F  DQGI  R+L EK++GY+I R+E DGSF+RDSVA
Sbjct  359   FLTHSGWSSVVEALTFQKALILLTFYSDQGINARVLEEKKIGYSIPRNELDGSFTRDSVA  418

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPSGSHKN  245
             ESLR+VMV E GK++ +K K+M     ++++QD YV+ +L YL +    H P    K 
Sbjct  419   ESLRLVMVSEEGKMYRDKAKEMSGLFGDRDRQDKYVDNILIYLKS----HRPVKKAKR  472



>gb|AAM12787.1| putative anthocyanidine rhamnosyl-transferase [Capsicum annuum]
Length=470

 Score =   476 bits (1226),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 250/466 (54%), Positives = 339/466 (73%), Gaps = 5/466 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LHI + PWLAFGH+IPYLEL+KL+A +G+ + F+STPRNI RLPKL P+L   
Sbjct  1     MAENGKKLHIAVFPWLAFGHMIPYLELSKLIARKGHTVSFISTPRNIDRLPKLPPNLSQF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             +  + LP+P VE LPE+AE+T+D+P+++V+YLK+A D L++SMA FL+  +PD++  DF 
Sbjct  61    LKFVKLPMPHVEKLPENAEATIDVPFEQVKYLKLAQDGLEESMAKFLEDSAPDFIFFDFT  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S+ +  +  K +IP+ YFSIF A+      P   + +  +    P+  T  PKWV FETT
Sbjct  121   SYWVPSVASKFNIPTAYFSIFIAAFLGFAGPVPGLNNDYEIRKTPEEYTVPPKWVSFETT  180

Query  1138  IMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             +  + FE+ R+F +A ++G   N++D+ R   +V+      VRSC E EPEWL++ +++ 
Sbjct  181   VAWKLFEVSRIF-EASMEGDEENIADITRFYKSVENCDFFLVRSCSEFEPEWLKVIQDIH  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              KP  PVG LPTT Y+DE        W EIK WLDKQEKG V+YVAFGSE KP+Q E+ E
Sbjct  240   RKPVFPVGQLPTTTYEDETTKINA--WREIKFWLDKQEKGRVIYVAFGSEAKPSQNELTE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             ++LGLELS LPFFWV R +RG +D E+  LPEGFEERT+GRG++CTSWAPQLKILSHDS+
Sbjct  298   LSLGLELSGLPFFWVLRTKRGESDDELICLPEGFEERTKGRGIVCTSWAPQLKILSHDSI  357

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTHSGWSSVVEA++FEK L++  FL DQGI  RLL EK+M Y+I R++ DGSF+RDS
Sbjct  358   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLEEKKMAYSIPRNDRDGSFTRDS  417

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             VAES+ +V+V+E G+++ +KVK++K    +K++QDNYV  LL YL 
Sbjct  418   VAESVSMVLVKEEGEIYRKKVKEVKYLFCDKKRQDNYVKNLLSYLQ  463



>dbj|BAO45905.1| UDP-glycosyltransferase [Acacia mangium]
Length=468

 Score =   476 bits (1226),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 249/458 (54%), Positives = 330/458 (72%), Gaps = 6/458 (1%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHIVM PWLAFGHIIPYLELAKL+AE+G+ + FVS PRNI RLPKL PHL P I L+ LP
Sbjct  7     LHIVMFPWLAFGHIIPYLELAKLIAEKGHHVSFVSAPRNIDRLPKLPPHLSPLIKLVKLP  66

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP+V +LP DAE+T+D+PY+ V++LK A+DE Q  M  FL++  PDW+++DFA + +  I
Sbjct  67    LPKVHDLPHDAEATVDVPYNVVQHLKKAYDEFQQPMTLFLESSKPDWILYDFAPYWIGSI  126

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVD--SPVEPKHTTSKPKWVPFETTIMPRN  1124
               KL I + +F IF A ++  F   S  + G D  S    +     P WVPF TT+  R 
Sbjct  127   ASKLGIKTAFFCIFMA-MSMGFMGSSLTLMGTDDNSRKTLQDYLVPPPWVPFPTTVAFRY  185

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPV  944
             FE+ ++ +    +   VSD YRL ++++    V VRSC+E E EW+QL E +  KP +PV
Sbjct  186   FEIMKISDSFSNNNSGVSDTYRLALSIQNCDIVLVRSCFEFEAEWIQLLEHLYKKPVVPV  245

Query  943   GLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLEL  764
             GLLP+T YDD ++++    W  + EWLD+Q KG+VVYVAFGSE KP+QEEV EIALGLE 
Sbjct  246   GLLPSTTYDDGKENET---WRWMNEWLDRQRKGTVVYVAFGSEAKPSQEEVREIALGLEK  302

Query  763   SQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHS  584
             S+LPF W  R QRG  D E+ +LPEGFEERTRGRGV+C+ W PQLKIL H+SVGGFL+HS
Sbjct  303   SELPFLWALRVQRGPTDPEILQLPEGFEERTRGRGVVCSYWVPQLKILGHESVGGFLSHS  362

Query  583   GWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRV  404
             G SSVVEA++ EK L+    L DQG+I+R+L EK++GY+I RD+ DGSF+ +SVA++LR+
Sbjct  363   GCSSVVEAIQNEKPLVFLALLADQGLISRVLEEKKIGYSIPRDDRDGSFTSESVADALRM  422

Query  403   VMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             V+VEE G++F EK+K++K     +E+Q+ YV KLL  L
Sbjct  423   VVVEERGRIFREKMKEIKGIFVNRERQEEYVRKLLSCL  460



>gb|KCW59683.1| hypothetical protein EUGRSUZ_H02441 [Eucalyptus grandis]
Length=475

 Score =   476 bits (1226),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 249/472 (53%), Positives = 327/472 (69%), Gaps = 4/472 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LHIVMLPWLAFGH+ PYLELAKL+A +G++I F+S PRNI RLPK  P L P 
Sbjct  1     MADTHDNLHIVMLPWLAFGHMTPYLELAKLMAGKGHRISFLSAPRNIDRLPKPTPDLTPL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + LPLP +E+LPE AE+T DLPYDK++YLK A+D LQ+ +A FL++  PDW+++DFA
Sbjct  61    ISFVKLPLPAIEHLPEGAEATSDLPYDKIQYLKKAYDMLQEPVARFLESSDPDWIMYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              +    I  +L I SV+F+I   +      P S    G D    P+  T  PKWVPF T 
Sbjct  121   PYWAGSIASRLGIRSVFFTILIGAGLGFIGP-SQDSKGGDYRKTPEDFTRPPKWVPFPTK  179

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +   +FE++++F+    +   V+DLYRL  + +    + +RS YE+EPEWL L ++V  K
Sbjct  180   VAFHHFEIKKIFDSVTGNASGVTDLYRLKASQENCDIIALRSSYEVEPEWLTLLKDVYAK  239

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P  PVG LP     D +   +   W  IKEWLD Q+ G+VVYVAFGSE+KP Q E+ EIA
Sbjct  240   PVFPVGQLPPG---DPDSRGETETWRLIKEWLDAQKNGTVVYVAFGSESKPTQTELTEIA  296

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLELS LPFFWV + + GSAD+E+  LP+GFEER +GRGV+  SW PQLKIL+H+SVGG
Sbjct  297   LGLELSGLPFFWVLKTRLGSADSELIMLPDGFEERVKGRGVVWDSWVPQLKILAHNSVGG  356

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH GW+S VEAL FE+ LI+  FL DQG+  RLL E+++GY+I R+E+DGS +R SVA
Sbjct  357   FLTHGGWNSAVEALSFERALILFTFLADQGLNARLLEERQIGYSIPRNESDGSVTRQSVA  416

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHP  263
             ESLR+VMVEE G+V+ EK K+M+    +K+ Q+ YVN LL+YL     + HP
Sbjct  417   ESLRMVMVEEKGRVYREKAKEMRPIFEDKDIQERYVNNLLNYLKDHRPVKHP  468



>ref|XP_010023433.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=475

 Score =   475 bits (1223),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 251/471 (53%), Positives = 325/471 (69%), Gaps = 4/471 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LH+ MLPWLAFGH++PYLELAKL+A +G++I F+S P NI RLPK  P L P 
Sbjct  1     MADPHENLHMAMLPWLAFGHMMPYLELAKLMAGKGHRISFLSVPGNIDRLPKPPPDLAPL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + LPLP VE+LPE A +T DLPYDK+++LK A+D LQ+ +A FL++  PDW+++DFA
Sbjct  61    ISFVNLPLPTVEHLPEGAGATSDLPYDKIQFLKKAYDMLQEPVARFLESSDPDWIMYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              +   PI  +L I SV+FSI TA+    F P  A + G D    P+  T +P WVPF T 
Sbjct  121   PYWAGPIASRLGIRSVFFSITTAASLGFFGPIWA-LKGGDYRKTPEDFTKRPNWVPFPTK  179

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R+FE++++F+    +   V+DLYR G   +    +  RS YE+EPEWL L +++  K
Sbjct  180   VAFRHFEIKKIFDAVIGNASGVTDLYRFGAGQESCDIIAARSSYEVEPEWLSLLKDIHTK  239

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P  PVG LP     D E   +  +W  IKEWLD Q+KG+VVYVAFGSE KP+Q E+ EIA
Sbjct  240   PIFPVGQLPPR---DPETRGEIDSWRSIKEWLDSQKKGTVVYVAFGSEAKPSQIELTEIA  296

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLELS LPFFWV + + GS+D E   LP GFEER +GRGV+  SW PQLKIL HDSVGG
Sbjct  297   LGLELSGLPFFWVLKTRLGSSDTESVVLPNGFEERVKGRGVVWDSWVPQLKILEHDSVGG  356

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH+GWSSVVEAL FE+ LI+  FL DQG+  R L E+++GY I R+E+DGS +R SVA
Sbjct  357   FLTHAGWSSVVEALSFERALILFTFLADQGLNARFLEERQIGYPIPRNESDGSVTRQSVA  416

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             ESLR+VMVEE G+V+ EK K+M+    +K  Q+ YVN LL+YL     + H
Sbjct  417   ESLRLVMVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLKEHRPVKH  467



>ref|XP_006353158.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=468

 Score =   474 bits (1221),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 249/466 (53%), Positives = 341/466 (73%), Gaps = 5/466 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M   S  LHI + PWLAFGH+IPYLEL+KL+A +G+KI F+STP+NI RLPKL P+  P 
Sbjct  1     MTENSKKLHIAVFPWLAFGHMIPYLELSKLIARKGHKISFISTPKNIDRLPKLPPNFAPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I+ + +PLP VE LP++AE+T+DLPY++V+YLKIA D L++ +A FL+  +PD++I DFA
Sbjct  61    INFVKIPLPHVEKLPKNAEATIDLPYEQVKYLKIAQDGLKEPIAKFLEDSAPDFIIFDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S+ +  I  K +IP+ YFSIF A++     P+  + +  +    P+  T  PKWVPFETT
Sbjct  121   SYWIPSIASKFNIPTGYFSIFIAAVLGFTGPEPGLNNDYEIRKTPEEYTVPPKWVPFETT  180

Query  1138  IMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             +  + FE+ R+F +A + G   NVSD+ R   +V+    + VRSC E EPEWL++  ++ 
Sbjct  181   VAFKLFEVLRIF-EASMKGEEENVSDIIRYYKSVENCDFLLVRSCSEFEPEWLKVVGDIH  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              K   PVG LPTT Y+D+        W EIK WLD+QEKG V+YVAFGSE KP+Q E+ E
Sbjct  240   RKLVFPVGQLPTTPYEDDSTKIDA--WREIKLWLDEQEKGKVIYVAFGSEAKPSQNELTE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             ++LGLELS LPFFWV R +RG +D E+ +LPEGF++RT+GRG++CTSW PQLKILSH SV
Sbjct  298   LSLGLELSGLPFFWVLRTKRGESDDELIQLPEGFKDRTKGRGIVCTSWVPQLKILSHHSV  357

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTHSGWSSVVEA++FEK L++  FL DQGI  RLL EK+M Y+I RD+ DGSF+RDS
Sbjct  358   GGFLTHSGWSSVVEAIQFEKPLVLLTFLADQGINARLLEEKKMAYSIPRDDRDGSFTRDS  417

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             VAESL +V++E+ G+++ +K+K+ K    ++ +Q++YV  LL+YL 
Sbjct  418   VAESLNLVLIEKKGEIYRKKIKEAKNLFCDERRQNDYVESLLNYLQ  463



>ref|XP_006353156.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum tuberosum]
Length=470

 Score =   473 bits (1216),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 251/471 (53%), Positives = 343/471 (73%), Gaps = 5/471 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA  S  LHI + PWLAFGH+IPYLEL+KL+A++G+KI F+STPRNI RLPKL P+L P 
Sbjct  1     MAENSKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPNLTPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             ++ + LP+P VE LPE+AE+T+DLPY++V+YLK+A D L++SMA FL+    D+++ DFA
Sbjct  61    LNFVKLPMPHVEKLPENAEATIDLPYEQVKYLKLAHDALKESMAKFLEDSDIDFILFDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S+ +  I  K +IP+ YFSIF A+      P   + +     +  +  T  PKWVPFET 
Sbjct  121   SYWIPSIASKFNIPTGYFSIFIAAYLGFTGPVPGLNNNYGIRMTMEELTVSPKWVPFETA  180

Query  1138  IMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             +  + FE+ R++ +   DG   N+ D+ R+  T +    + VRSC E EPEWL++ E++ 
Sbjct  181   VAFKEFELLRIY-EGCKDGEEENIYDISRMYKTFENCDFLLVRSCLEFEPEWLKVVEDIH  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              KP IPVG LPTT+Y+D++ +     W EIK+WLDKQEKG V+YVAFGSETK +Q E+ E
Sbjct  240   LKPVIPVGQLPTTSYEDDDTNIDA--WREIKQWLDKQEKGKVIYVAFGSETKLSQNELTE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             ++LGLELS LPFFWV R +RG +D E+ +LPEGFEERT+GRG++ TSW PQLKILSHDSV
Sbjct  298   LSLGLELSGLPFFWVLRTKRGESDDELIQLPEGFEERTKGRGIVYTSWVPQLKILSHDSV  357

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFL H+GWSSVVEA++FEK LI+  FL DQGI  RLL EK++ Y I R++ DGSF+RD+
Sbjct  358   GGFLNHAGWSSVVEAIQFEKPLILLTFLADQGIDARLLEEKKVAYLIPRNDLDGSFTRDA  417

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTI  272
             V ESL +V+VE+ G+++ +K+K++K    +K++QDNYV  LL +L     I
Sbjct  418   VVESLSLVLVEKEGEIYRQKIKEVKNLCCDKKRQDNYVENLLRFLQNYKKI  468



>ref|XP_010023432.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=475

 Score =   471 bits (1211),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 248/471 (53%), Positives = 326/471 (69%), Gaps = 4/471 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA    +LHIVMLPWLAFGH++PYL+LAKL+A +G++I F+S PRNI R+PK    L   
Sbjct  1     MAETRDSLHIVMLPWLAFGHMMPYLKLAKLMAGKGHRISFLSAPRNIDRIPKPPSDLASL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + LPLP VE+LPE AE+T DLPY+K++YLK ++D LQ+ +A FL++  PDW+++DFA
Sbjct  61    ISFVKLPLPAVEHLPEGAEATSDLPYNKIQYLKKSYDMLQEPVAQFLESSDPDWIMYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              +    I  +L I SV+FSI T +      P  A + G D    P+  T +P WVPF T 
Sbjct  121   PYWAGSIASRLGIRSVFFSIMTGACLGFLGPVWA-LKGGDYRKTPEDFTKRPNWVPFPTR  179

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R+FE++++F+    +   V+DLYR G   +    + +RS YE+EPEWL L  ++  K
Sbjct  180   VAFRHFEIKKIFDAVIGNASGVTDLYRFGAGQESCDIIALRSSYEVEPEWLSLLRDIHTK  239

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P  PVGLLP     D E   +  +W  IKEWLD Q+KG+VVYVAFGSE KP+Q E+ EIA
Sbjct  240   PIFPVGLLPPR---DPETRGEMDSWRSIKEWLDSQKKGTVVYVAFGSEAKPSQIELTEIA  296

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLELS LPFFWV + + GS+D E   LP GFEER +G GV+  SW PQLKIL+HDSVGG
Sbjct  297   LGLELSGLPFFWVLKTRLGSSDTESVVLPNGFEERVKGHGVVWDSWVPQLKILAHDSVGG  356

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH+GWSSVVEAL FE+ LI+  FL DQG+  R L E+++GY I R+E+DGS +R SVA
Sbjct  357   FLTHAGWSSVVEALSFERALILFTFLADQGLNARFLEERQIGYPIPRNESDGSVTRQSVA  416

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             ESLR+VMVEE G+V+ EK K+M+    +KE Q+ YVN LL+YL     + H
Sbjct  417   ESLRLVMVEEKGRVYREKAKEMRPIFGDKEIQERYVNNLLNYLKEHRPVKH  467



>ref|XP_007156463.1| hypothetical protein PHAVU_003G288100g [Phaseolus vulgaris]
 gb|ESW28457.1| hypothetical protein PHAVU_003G288100g [Phaseolus vulgaris]
Length=469

 Score =   470 bits (1209),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 244/466 (52%), Positives = 321/466 (69%), Gaps = 9/466 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             + S LHIVM PWLAFGH+IP LELAKL+AE+G+++ FVSTPRNI RLPKL P L   I+ 
Sbjct  5     KESVLHIVMFPWLAFGHMIPNLELAKLIAEKGHRVSFVSTPRNIDRLPKLSPTL---INF  61

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + LPLP+++NLPE+AE+T D+PYD V+YLK A+D L+     FL++   DW+ +DF  F 
Sbjct  62    VKLPLPKLQNLPENAEATTDVPYDAVQYLKKAYDALEQPFTRFLESSKADWLFYDFVPFW  121

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVE-PKHTTSKPKWVPFETTIM  1133
                +  KL I + ++SIFTAS+     P S  +   DSP + P+     P WV F TT+ 
Sbjct  122   AASVASKLGIKTAFYSIFTASVLGFIGPPS-YLTANDSPRQKPEEYIVVPPWVTFPTTVA  180

Query  1132  PRNFEMERVFND-AYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
              R +E+ R+ +  +  +   VSD YR G +++      VR C E EPEW  L E + GKP
Sbjct  181   YRYYEIMRIVDSLSAQNNTGVSDTYRFGASIQNCDIAVVRGCTEFEPEWFHLLENIYGKP  240

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +P G LP+TA       +    W  +KEWLDKQ +G VVYVAFGSE KP QEEV EIAL
Sbjct  241   VLPAGQLPSTA---PVGSEDNETWRWMKEWLDKQARGRVVYVAFGSEAKPTQEEVTEIAL  297

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLE S+LPF WV R QRG +D +V +LPEGFEERT+ RGV+C SWAPQLKIL H +VGGF
Sbjct  298   GLEKSELPFLWVLRVQRGPSDPDVLRLPEGFEERTKARGVVCRSWAPQLKILEHVAVGGF  357

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTHSGW+SVVE ++ EK L++  FL DQGI  R+L EK+MGY++ RDE DGSFS DSVAE
Sbjct  358   LTHSGWTSVVEGIQNEKALVLLTFLSDQGINARVLEEKKMGYSVPRDEEDGSFSSDSVAE  417

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAAS  278
             SL++V+VEE GK++ E++K+MK     +++Q+ Y++ L+  L   S
Sbjct  418   SLKLVVVEEEGKIYRERIKEMKDLFVNEDRQNRYIDNLIHNLKTFS  463



>ref|XP_002533517.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF28861.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=415

 Score =   466 bits (1200),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 230/418 (55%), Positives = 307/418 (73%), Gaps = 8/418 (2%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             S LHI + PWLAFGH+IPYLELAKL+A++G+KI ++STPRNI RLP+L P+L   I+ + 
Sbjct  5     SKLHIALFPWLAFGHMIPYLELAKLIAQKGHKISYISTPRNIDRLPELPPNLSSFINFVK  64

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             +PLP+ ++LP+DAE+T D+P++KV+YLK ++D L++ +  FL+    DW+++DFA++ L 
Sbjct  65    IPLPRSDDLPQDAEATTDVPFNKVQYLKKSYDRLKEPLTVFLENSDIDWILYDFAAYWLP  124

Query  1303  PIMEKLSIPSVYFSIF-TASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPR  1127
              +   L I   +F IF  A++  I  P S      D   +P+  T  PKWV F T +  +
Sbjct  125   DLANSLGISHAFFGIFLGATMGVIVKPASLT----DDRTKPEQFTVPPKWVNFPTKVAYK  180

Query  1126  NFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
              FE+ R+F     D   VSDL R    +KG   + +RSC E EPEWL L EE+ GKP IP
Sbjct  181   LFEILRIFESVEGDASGVSDLSRAAEVLKGCEIIAIRSCIEFEPEWLNLLEEIHGKPCIP  240

Query  946   VGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLE  767
             VG+LPTT Y++ ++ ++   W +IK+WLDKQ+K SVVYVAFGSE KP+Q E+ EIALGLE
Sbjct  241   VGMLPTTGYENGKETNE---WRKIKQWLDKQDKASVVYVAFGSEGKPSQLELNEIALGLE  297

Query  766   LSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
             LS LPFFWV RK+RGS DAEV +LP+GFEERT+GRGV+ T WAPQLKIL+HDS+GGFLTH
Sbjct  298   LSGLPFFWVLRKRRGSTDAEVIELPDGFEERTKGRGVVSTGWAPQLKILAHDSIGGFLTH  357

Query  586   SGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             SGWSSVVEA ++E+ LI+  FL DQGI  R+L EK+MGY++ R+E DGSF+ +SVAES
Sbjct  358   SGWSSVVEASQYERPLILLTFLADQGINARILEEKKMGYSVPRNEFDGSFTSESVAES  415



>ref|XP_004253507.2| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=483

 Score =   466 bits (1198),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 250/468 (53%), Positives = 345/468 (74%), Gaps = 5/468 (1%)
 Frame = -3

Query  1684  SAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLV  1505
             + MA  S  LHI + PWLAFGH+IPYLEL+KL+A++G+KI F+STPRNI RLPKL P+L 
Sbjct  12    TKMAKNSKMLHIGVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLSPNLT  71

Query  1504  PNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
             P ++ + LP+P VENLPE+AE+T D+ Y++V+YLK+A D L++SMA FL+    D+++ D
Sbjct  72    PFLNFVKLPMPYVENLPENAEATTDVTYEQVKYLKLAQDGLEESMAKFLEDSDLDFILFD  131

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFE  1145
             F S+ +  I  K +I S +FSI+ A+      P   + +  +    P+  T  PKWVPFE
Sbjct  132   FTSYWVPSIASKFNIRSGHFSIYIAAFLGFTGPVPGLNNDYEIRTTPEEYTVPPKWVPFE  191

Query  1144  TTIMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             TT+  + FE+ R+F +A + G   N++D+ R   +V+    +FVRSC ELEPEWL++  +
Sbjct  192   TTVAFKLFEVLRIF-EATMKGEEENIADITRYYKSVENCDFLFVRSCSELEPEWLKVLGD  250

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP +PVG LPTT Y+D+        W+EIK WLDK+EKG V+YVAFGSE K +Q E+
Sbjct  251   IHRKPVLPVGQLPTTPYEDDSTKIDA--WIEIKLWLDKREKGKVIYVAFGSEAKSSQNEL  308

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
             +E++LGLELS L F WV R +RG +D E+ +LPEGFE+R +GRG++CTSWAPQLKILSHD
Sbjct  309   IELSLGLELSGLSFLWVLRTKRGESDDELVQLPEGFEDRMKGRGIVCTSWAPQLKILSHD  368

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             SVGGFLTHSGWSSVVEA+++EK L++  F  DQGI  RLL EK++ Y+I RD+ DGSF+R
Sbjct  369   SVGGFLTHSGWSSVVEAIQYEKPLVLLTFSADQGINARLLEEKKIAYSIPRDDCDGSFTR  428

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             DSVA+SL +V++E+ G+++ EKVK+MK+   +KE+QDNYV+ LL YL 
Sbjct  429   DSVAKSLNLVLIEKEGEIYREKVKQMKSLFCDKERQDNYVDNLLCYLQ  476



>gb|KEH20104.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=468

 Score =   464 bits (1193),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 238/466 (51%), Positives = 322/466 (69%), Gaps = 6/466 (1%)
 Frame = -3

Query  1681  AMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
              +  E   LHIVM PWLAFGH+IPYLELAKL+A++G+++ +VSTPRNIQRLPKL P++ P
Sbjct  3     TIRDEEKALHIVMFPWLAFGHMIPYLELAKLIAQKGHQVSYVSTPRNIQRLPKLPPNVAP  62

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
              I  + LPLP+V+NLPE+AE+T D+PYD V +LK AFD+L+  +  FLQ+ + DW++HDF
Sbjct  63    LIKFVSLPLPKVDNLPENAEATTDIPYDVVPHLKNAFDKLEQPLTHFLQSSNADWILHDF  122

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
               F L  +  +L I  V+FSIFT        P S ++       +P+     P WVPF+T
Sbjct  123   VPFWLGSVAPQLGIKCVFFSIFTPPFMGFMGPGSVLLGNDPVRTKPEDFLVSPSWVPFKT  182

Query  1141  TIMPRNFEMERVFNDAYIDGGN--VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
             T+  R FE+ ++  D   D  +   SD YR   ++K +  + +R C E EPEW Q+ + +
Sbjct  183   TVAYRYFEIIKIM-DILSDNNDSGFSDAYRFCSSIKNSEFILIRGCTEFEPEWFQVIQNI  241

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               K  +P G L +T ++  ++++    W  +KEWLDK+  G+VVYVAFGSE KP+QEEV 
Sbjct  242   HNKLVLPAGQLLSTEFEGGDENNT---WWWMKEWLDKKPNGTVVYVAFGSEAKPSQEEVN  298

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             EIALGLE S LPFFWV R +RG  D  V +LPEGFEERT+ RGV+CT WAPQ+KILSH +
Sbjct  299   EIALGLEKSNLPFFWVLRVRRGPTDKVVLQLPEGFEERTKVRGVVCTEWAPQMKILSHVA  358

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VGGFLTH+GW+SVVEA++ EK L++   L DQGI  R+L EK+MGY++ RDE DGSF+ D
Sbjct  359   VGGFLTHAGWTSVVEAVQHEKPLVLLTCLADQGINARMLEEKKMGYSVPRDERDGSFTSD  418

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              VA S+R+VMVEE G+++ + +K MK      E+QD YV  LLD+L
Sbjct  419   MVAHSIRLVMVEEEGRIYRDNIKNMKDLFVNPERQDRYVTSLLDHL  464



>ref|XP_010023430.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Eucalyptus grandis]
Length=475

 Score =   461 bits (1187),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 245/471 (52%), Positives = 324/471 (69%), Gaps = 4/471 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA    +LH+VMLPWLAFGH++PYLELAKL+A +G++I F+ +P NI RLPK    L   
Sbjct  1     MAETHDSLHVVMLPWLAFGHMMPYLELAKLMAGKGHRISFLLSPGNIDRLPKPPSDLASL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + LPLP VE LPE A +T DLPYDK+++LK A+D LQ+ +A FL++  PDW+++DFA
Sbjct  61    ISFVKLPLPAVEQLPEGAGATSDLPYDKIQFLKKAYDMLQEPVARFLESSDPDWIMYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              +   PI  +L I SV+FSI TA+      P  A   G D    P+  T +P WVPF T+
Sbjct  121   PYWAGPISSRLGIRSVFFSITTAASLGFLGPTWAS-KGGDYRKTPEDFTKRPNWVPFPTS  179

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R+FE+E++F+    +   V+DLYR G   +    + VRS YE+EPEWL L ++++ K
Sbjct  180   VAYRHFEIEKIFDAVSRNASGVTDLYRWGAGRECCDIIAVRSSYEVEPEWLSLLKDILAK  239

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P  PVG LP +   + E   +  +W  IKEWLD Q+K +VVYVAFGSE KP+Q E+ +IA
Sbjct  240   PIFPVGQLPPS---NPEMRGETDSWRSIKEWLDVQKKCTVVYVAFGSEAKPSQTELTDIA  296

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLELS LPFFWV + Q GSAD E   LP+GFEER RGR ++  SW PQLKIL+HDSVG 
Sbjct  297   LGLELSGLPFFWVLKTQLGSADTESVVLPDGFEERVRGRVMVWDSWVPQLKILAHDSVGW  356

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH+GWSSVVEAL F + LI+  FL DQG+  RLL E+++GY I R+E+DGS +R SV+
Sbjct  357   FLTHAGWSSVVEALSFGRALILFTFLADQGLNARLLEERQIGYPIPRNESDGSVTRQSVS  416

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             ESL +VMVEE G+V+ EK K+M+    +K  Q+ YVN LL+YL     + H
Sbjct  417   ESLSLVMVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLKEHRPVKH  467



>ref|XP_004143439.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
 gb|KGN48691.1| hypothetical protein Csa_6G497900 [Cucumis sativus]
Length=468

 Score =   460 bits (1183),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 237/432 (55%), Positives = 311/432 (72%), Gaps = 10/432 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNI  1496
             S    LHIVM PWLAFGH+IPYLEL+KL+A++G+++ FVSTP+NI RLP +L PHL P +
Sbjct  2     SVDKNLHIVMFPWLAFGHMIPYLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFL  61

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
               + +PLPQ+ NLP DAE+T DLPYDKV++LK AFD L+  ++ FLQT   DW+++DFA 
Sbjct  62    SFVKIPLPQLHNLPPDAEATSDLPYDKVQFLKKAFDALKQPLSDFLQTSDADWILYDFAP  121

Query  1315  FRL-VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             + +   I   L I + +F+IF     A   P S      DS ++ +  T  P W+PF TT
Sbjct  122   YWVGQEIGPNLRIKTAFFTIFILQSLAFVGPMSG-----DSRMKLEDFTVPPDWIPFPTT  176

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R+FE++++F+    +   V+D+ RL ++   +  V VR+  E EPEW+QL E++  K
Sbjct  177   VAFRHFEIKKLFDFVAGNTTGVTDIDRLKMSAHYSDLVVVRAFPEFEPEWIQLLEDIHHK  236

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
               +PVG LPT+ YD +ED+     W  IKEWLDKQ KGSVVYVAFGSE KPNQ E+ EIA
Sbjct  237   TVLPVGQLPTSEYDLKEDNPT---WQSIKEWLDKQAKGSVVYVAFGSEAKPNQHELTEIA  293

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLE S+  FFWV R + G +D E  +LPEGFEERT+GRGV+CT+WAPQLKIL H+SVGG
Sbjct  294   LGLEQSRFSFFWVLRTRLGLSDPEPIELPEGFEERTKGRGVVCTTWAPQLKILGHESVGG  353

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTHSGWSSVVEA++ E+ L++  F+ DQGII R+L EK+MGY + R E DGSF+RDSVA
Sbjct  354   FLTHSGWSSVVEAIQSERALVLLSFVADQGIIARVLEEKKMGYCVPRSELDGSFTRDSVA  413

Query  418   ESLRVVMVEEHG  383
             ESL++VMVEE G
Sbjct  414   ESLKLVMVEEEG  425



>ref|XP_002315125.2| hypothetical protein POPTR_0010s18980g [Populus trichocarpa]
 gb|EEF01296.2| hypothetical protein POPTR_0010s18980g [Populus trichocarpa]
Length=477

 Score =   460 bits (1184),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 234/430 (54%), Positives = 299/430 (70%), Gaps = 8/430 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   LHI M PWLAFGHIIP+LELAKL+A+RG+KI F+STPRNIQRLP + P+L P I+L
Sbjct  3     EPHELHIAMFPWLAFGHIIPFLELAKLIAQRGHKISFISTPRNIQRLPTIPPNLTPRINL  62

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + L LP VENLP +AE+T DLP+DK+ YLKIA+D LQDS+  FL + SPDW+I DFAS+ 
Sbjct  63    VSLALPHVENLPNNAEATADLPFDKIPYLKIAYDRLQDSLFHFLHSSSPDWIIFDFASYW  122

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQ-SAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
             L  I  KL I  V FSIF A   +   P  SA+++G D   EP+H T  PKWV F + + 
Sbjct  123   LPEIATKLGISGVLFSIFGAWTLSFAGPSYSAILNGDDPRTEPQHFTVPPKWVTFPSKVA  182

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R  E +R       +   V+D++R G  + G   + VRSC ELE ++L+L E++  KP 
Sbjct  183   FRIHEAKRFLVQIEANSSGVTDIFRWGSVLAGCDVIAVRSCLELEADFLRLVEDLHCKPV  242

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IPVGLLP  A     +      W+ I EWLDKQ +GSVVY+AFGSE   NQ+E+ E+ALG
Sbjct  243   IPVGLLPPPA--QCSEGGVDEKWVTISEWLDKQTQGSVVYIAFGSELTINQDEITELALG  300

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS LPFFW  R Q  S      +LP+GF+ER +GRGV+ TSWAPQL+I++H+SVGGFL
Sbjct  301   LELSGLPFFWALRNQDDS-----VRLPDGFDERVKGRGVVWTSWAPQLRIMAHESVGGFL  355

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH G+SSV+EAL F   LIM PF  DQG+I R+   K++G  + RDE DGSF+R+SVAES
Sbjct  356   THCGYSSVIEALSFGLALIMLPFAIDQGLIARVFEGKKVGIEVPRDEQDGSFTRNSVAES  415

Query  412   LRVVMVEEHG  383
             LR+V+V+  G
Sbjct  416   LRLVIVDREG  425



>ref|XP_007156464.1| hypothetical protein PHAVU_003G288200g [Phaseolus vulgaris]
 gb|ESW28458.1| hypothetical protein PHAVU_003G288200g [Phaseolus vulgaris]
Length=465

 Score =   459 bits (1181),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 242/469 (52%), Positives = 315/469 (67%), Gaps = 9/469 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             +  + S LHIVM PWLAFGH+IP LELAKL+AE+G+++ FVSTPRNI RLPKL P L   
Sbjct  2     VQDKESVLHIVMFPWLAFGHMIPNLELAKLIAEKGHRVSFVSTPRNIDRLPKLSPTL---  58

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I+ + LPLP V+NLPE+AE+T D+PYD V+YLK A+D L+  +  FL++   DW+ +DF 
Sbjct  59    INFVKLPLPNVQNLPENAEATTDVPYDAVQYLKKAYDALEQPLTRFLESSKADWLFYDFV  118

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              F    +  KL I + ++SIFT        P S + D      +P+     P WV F TT
Sbjct  119   PFWAASVASKLGIKTAFYSIFTPPFLGFIGPPSYLTDNNSPRHKPEEYIVVPPWVTFPTT  178

Query  1138  IMPRNFEMERVFNDAYIDGGN--VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             +  R +E+ R+  D   D  N   SD YR G  ++    V VR C E + EW  L E + 
Sbjct  179   VAFRYYEIMRIV-DILSDQNNSGFSDTYRHGAGIQNCDIVVVRGCTEFDAEWFPLLENIY  237

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
             GKP +P G LP+TA       +    W  +KEWLDKQ +G VVYVAFGSE KP QEEV E
Sbjct  238   GKPVLPAGQLPSTA---PVGSEDNETWRWMKEWLDKQARGRVVYVAFGSEAKPTQEEVTE  294

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             IALGLE S+LPF WV R QRG +D +V +LPEGFEERT+ RGV+C SWAPQLKIL H +V
Sbjct  295   IALGLEKSELPFLWVLRVQRGPSDPDVLRLPEGFEERTKARGVVCRSWAPQLKILEHVAV  354

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTHSGW+SVVE ++ EK L++  FL DQGI  R+L EK+MGY++ RDE DGSFS DS
Sbjct  355   GGFLTHSGWTSVVEGIQNEKALVLLTFLSDQGINARVLEEKKMGYSVPRDEEDGSFSSDS  414

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAAS  278
             VAESL++V+VEE GK++ E++K+MK     +++Q+ Y++ L+  L   S
Sbjct  415   VAESLKLVVVEEEGKIYRERIKEMKDLFVNEDRQNRYIDNLIHNLKTFS  463



>gb|KHN06911.1| UDP-glycosyltransferase 91A1 [Glycine soja]
Length=468

 Score =   459 bits (1180),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 236/463 (51%), Positives = 318/463 (69%), Gaps = 2/463 (0%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LHIVM PWLAFGH+IP LELAKL+A++G+ I FVSTPRNI+RLPKL P+L   
Sbjct  1     MARTEEKLHIVMFPWLAFGHLIPNLELAKLIAQKGHNISFVSTPRNIERLPKLSPNLASF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + LPLP+V+ LPE+AE+T D+PYD V+YLK A+D+L++ +  FL++   DW+ +D  
Sbjct  61    IKFVKLPLPKVDKLPENAEATTDVPYDVVQYLKKAYDDLEEPLTRFLESSKVDWLFYDLI  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              F    +  KL I S ++SI T        P S ++       + K  T  P W+ F TT
Sbjct  121   PFWAGTVASKLGIKSAFYSICTPPCMGFLGPPSVLMGEDPYRTKLKDFTVTPPWISFPTT  180

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R FEM R  +    +   +SD+YR G  +K    V +R C E EPEW Q+ E +  K
Sbjct  181   VAYRYFEMMRNSDAVSDNDSGISDMYRFGAVIKNCDIVVIRGCTEFEPEWFQVLENIYQK  240

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P +PVG L    ++ +ED+     W+  K+WLDKQ  GSVVYVAFGSE KP+Q+EV +IA
Sbjct  241   PVLPVGQLINREFEGDEDNITTWQWM--KDWLDKQPCGSVVYVAFGSEAKPSQDEVTQIA  298

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLE S++ FFWV R QRG  D +V +LPEGFEERT+GRG++CTSWAPQLKILSH +VGG
Sbjct  299   LGLEESKIRFFWVLRVQRGPWDPDVLRLPEGFEERTKGRGIVCTSWAPQLKILSHVAVGG  358

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTHSGW+SVVEA++ EK LI+  FL DQG+  R+L EK+MGY++ RDE DGS + D++A
Sbjct  359   FLTHSGWTSVVEAVQNEKPLILLAFLADQGLNARVLEEKKMGYSVPRDERDGSITSDAIA  418

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              S+R+VMVE+ G+V+ EK+K++K       +Q+ Y+++LL YL
Sbjct  419   NSIRLVMVEDEGRVYREKIKEVKDLFVNTVRQEKYIDELLHYL  461



>gb|KCW59684.1| hypothetical protein EUGRSUZ_H02443, partial [Eucalyptus grandis]
Length=464

 Score =   458 bits (1178),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 244/463 (53%), Positives = 322/463 (70%), Gaps = 4/463 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA    +LH+VMLPWLAFGH++PYLELAKL+A +G++I F+ +P NI RLPK    L   
Sbjct  1     MAETHDSLHVVMLPWLAFGHMMPYLELAKLMAGKGHRISFLLSPGNIDRLPKPPSDLASL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + LPLP VE LPE A +T DLPYDK+++LK A+D LQ+ +A FL++  PDW+++DFA
Sbjct  61    ISFVKLPLPAVEQLPEGAGATSDLPYDKIQFLKKAYDMLQEPVARFLESSDPDWIMYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              +   PI  +L I SV+FSI TA+      P  A   G D    P+  T +P WVPF T+
Sbjct  121   PYWAGPISSRLGIRSVFFSITTAASLGFLGPTWAS-KGGDYRKTPEDFTKRPNWVPFPTS  179

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R+FE+E++F+    +   V+DLYR G   +    + VRS YE+EPEWL L ++++ K
Sbjct  180   VAYRHFEIEKIFDAVSRNASGVTDLYRWGAGRECCDIIAVRSSYEVEPEWLSLLKDILAK  239

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P  PVG LP +   + E   +  +W  IKEWLD Q+K +VVYVAFGSE KP+Q E+ +IA
Sbjct  240   PIFPVGQLPPS---NPEMRGETDSWRSIKEWLDVQKKCTVVYVAFGSEAKPSQTELTDIA  296

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLELS LPFFWV + Q GSAD E   LP+GFEER RGR ++  SW PQLKIL+HDSVG 
Sbjct  297   LGLELSGLPFFWVLKTQLGSADTESVVLPDGFEERVRGRVMVWDSWVPQLKILAHDSVGW  356

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH+GWSSVVEAL F + LI+  FL DQG+  RLL E+++GY I R+E+DGS +R SV+
Sbjct  357   FLTHAGWSSVVEALSFGRALILFTFLADQGLNARLLEERQIGYPIPRNESDGSVTRQSVS  416

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             ESL +VMVEE G+V+ EK K+M+    +K  Q+ YVN LL+YL
Sbjct  417   ESLSLVMVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYL  459



>ref|XP_003551309.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Glycine max]
Length=468

 Score =   457 bits (1176),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 236/463 (51%), Positives = 317/463 (68%), Gaps = 2/463 (0%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LHIVM PWLAFGH+IP LELAKL+A++G+ I FVSTPRNI+RLPKL P+L   
Sbjct  1     MARTEEKLHIVMFPWLAFGHLIPNLELAKLIAQKGHNISFVSTPRNIERLPKLSPNLASF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + LPLP+V+ LPE+AE+T D+PYD V+YLK A+D+L++ +  FL++   DW+ +D  
Sbjct  61    IKFVKLPLPKVDKLPENAEATTDVPYDVVQYLKKAYDDLEEPLTRFLESSKVDWLFYDLI  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              F    +  KL I S ++SI T        P S ++       + K  T  P W+ F TT
Sbjct  121   PFWAGTVASKLGIKSAFYSICTPPCMGFLGPPSVLMGEDPVRTKLKGFTVTPPWISFPTT  180

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R FEM R  +    +   +SD+YR G  +K    V +R C E EPEW Q+ E +  K
Sbjct  181   VAYRYFEMMRNSDAVSDNDSGISDMYRFGAVIKNCDIVVIRGCTEFEPEWFQVLENIYQK  240

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P +PVG L    ++ +ED+     W+  K+WLDKQ  GSVVYVAFGSE KP+Q+EV +IA
Sbjct  241   PVLPVGQLINREFEGDEDNITTWQWM--KDWLDKQPCGSVVYVAFGSEAKPSQDEVTQIA  298

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLE S+  FFWV R QRG  D +V +LPEGFEERT+GRG++CTSWAPQLKILSH +VGG
Sbjct  299   LGLEESKTRFFWVLRVQRGPWDPDVLRLPEGFEERTKGRGIVCTSWAPQLKILSHVAVGG  358

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTHSGW+SVVEA++ EK LI+  FL DQG+  R+L EK+MGY++ RDE DGS + D++A
Sbjct  359   FLTHSGWTSVVEAVQNEKPLILLAFLADQGLNARVLEEKKMGYSVPRDERDGSITSDAIA  418

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              S+R+VMVE+ G+V+ EK+K++K       +Q+ Y+++LL YL
Sbjct  419   NSIRLVMVEDEGRVYREKIKEVKDLFVNTVRQEKYIDELLHYL  461



>gb|KGN48689.1| hypothetical protein Csa_6G497390 [Cucumis sativus]
Length=468

 Score =   457 bits (1175),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 245/458 (53%), Positives = 327/458 (71%), Gaps = 10/458 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNIDLIGL  1481
             LHIVM PWLAFGH+IPYLEL+KL+A++G+++ FVSTP+NI RLP +L PHL P +  + +
Sbjct  7     LHIVMFPWLAFGHMIPYLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFLSFVKI  66

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL-V  1304
             PLPQ+  LP DAE+T DLPYDKV++LK AFD L+  ++ FLQT   DW+++DFA + +  
Sbjct  67    PLPQLHTLPPDAEATSDLPYDKVQFLKEAFDALKQPLSDFLQTSDADWILYDFAPYWVGQ  126

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
              I   L I + +FSIF     A   P S      DS ++ +  T  P W+PF TT+  R+
Sbjct  127   EIGPNLRIKTAFFSIFILQSLAFVGPMSG-----DSRMKLEDFTVPPDWIPFPTTVAFRH  181

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPV  944
             FE++++F+    +   V+D+ R  ++   +  V VR+  E EPEW+QL E++  K  +PV
Sbjct  182   FEIKKIFDFVAGNATGVTDIDRFKMSAHYSDLVVVRAFPEFEPEWIQLLEDIHHKTVLPV  241

Query  943   GLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLEL  764
             G LPT+ YD +ED+     W  IKEWLDKQ KGSVVYVAFGSE KPNQ E+ EIALGLE 
Sbjct  242   GQLPTSEYDLKEDNPT---WQSIKEWLDKQAKGSVVYVAFGSEAKPNQHELTEIALGLEQ  298

Query  763   SQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHS  584
             S+  FFWV R + G +D E  +LPEGFEERT+GRGV+CT+WAPQLKIL H+SVGGFLTHS
Sbjct  299   SRFSFFWVLRTRLGLSDPEPIELPEGFEERTKGRGVVCTTWAPQLKILGHESVGGFLTHS  358

Query  583   GWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRV  404
             GWSSVVEA++ E+ L++  F+ DQGII R+L EK+MGY + R E DGSF+RDSVAESL++
Sbjct  359   GWSSVVEAIQSERALVLLSFVADQGIIARVLEEKKMGYCVPRSELDGSFTRDSVAESLKL  418

Query  403   VMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             VMVEE GKV+ E++++MK     KE+ +  ++  L YL
Sbjct  419   VMVEEEGKVYRERIREMKDLFVNKERDEKLIDGFLSYL  456



>ref|XP_007208586.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
 gb|EMJ09785.1| hypothetical protein PRUPE_ppa023071mg [Prunus persica]
Length=470

 Score =   456 bits (1174),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 231/472 (49%), Positives = 320/472 (68%), Gaps = 6/472 (1%)
 Frame = -3

Query  1681  AMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
             +  +E   LHI + PWLAFGHIIP+ E+AK +A RG+K+ F+STPRNIQRLPK+  HL P
Sbjct  2     SSTTEPKKLHIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPKIPQHLTP  61

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
              I+L+ +PLP+VENLPE+AE+T+D+PY  + YLKIA D L+  ++ FLQT  PDW+IHDF
Sbjct  62    LINLVQIPLPRVENLPENAEATMDVPYHIIPYLKIAHDGLEQGISNFLQTHKPDWIIHDF  121

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAV-IDGVDSPVEPKHTTSKPKWVPFE  1145
             A   L PI   L I   +FSIF AS      P S   +D       P+H T  P+W+PF 
Sbjct  122   APHWLPPIASSLGISRAHFSIFNASTLCFIGPTSPEGLDRYGVRTLPEHFTVPPEWIPFP  181

Query  1144  TTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             + ++ R+FE +++F+    +   VSDL+R+  TV+G     +RSC E+E EWL L +E+ 
Sbjct  182   SNLVFRSFEAKKLFDATKQNASGVSDLFRVQSTVQGCQVYLIRSCREIEGEWLDLLQELQ  241

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
               P +P+GLLP       +  + K  W  I +WLDKQE G+VVY+A GSE   +QE+  E
Sbjct  242   QFPVVPIGLLPPLV----QTREDKEDWSRIYQWLDKQENGTVVYIALGSELNLSQEDFTE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             +ALGLELS LPFFWV R    S D++  KLP+GFEERT+GRG++ T+WAPQ KIL+HDS+
Sbjct  298   LALGLELSGLPFFWVLRTPSWSGDSDSVKLPDGFEERTKGRGLVWTTWAPQTKILAHDSI  357

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTH GWSS++EAL++ + LIM PFL DQG+I R   +K++G  + R+E DGSF+R S
Sbjct  358   GGFLTHCGWSSLIEALQYGRPLIMLPFLYDQGLIARFW-DKKIGIEVPRNEEDGSFTRKS  416

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIH  269
             +AESL +V+V+E GK + +  K+      +K+  D Y++K ++YL     +H
Sbjct  417   LAESLNLVVVDEEGKAYRDGAKEHGEVFKDKDLHDRYMDKCVEYLENHVHMH  468



>ref|XP_003552084.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Glycine max]
 gb|KHN27633.1| UDP-glycosyltransferase 91A1 [Glycine soja]
Length=465

 Score =   456 bits (1172),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 236/467 (51%), Positives = 320/467 (69%), Gaps = 6/467 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA +   L IVM PWLAFGH+IP LELAKL+A +G+++ FVSTPRNIQRLPK  P+ +  
Sbjct  1     MAGDEEKLTIVMFPWLAFGHMIPNLELAKLIARKGHQVSFVSTPRNIQRLPKPSPNTL--  58

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I+ + LPLP+++NLPE+AE+T D+PYD V +LK+A+D LQ+ +  FL++  PDW+ +DF 
Sbjct  59    INFVKLPLPKIQNLPENAEATTDIPYDVVEHLKVAYDALQEPLKRFLESSKPDWLFYDFV  118

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              F    I  KL I S ++SI T   +    P S+++       +P+     P WVPF TT
Sbjct  119   PFWAGSIASKLGIKSAFYSICTPPFSGFLGPPSSLMGKDSLRQKPEDFIVSPPWVPFPTT  178

Query  1138  IMPRNFEMERVFNDAYIDGGN-VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
             +  R FE+ R+ +    +    VSD YR G + +    V +R C E +PEW Q+ E +  
Sbjct  179   VAFRYFEIMRIVDSLSAENNTGVSDAYRYGASAENCDIVVIRGCTEFQPEWFQVLENIYR  238

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             KP +P+G LP+T   D    +    W  +K+WLDK  +GSVVYVAFGSE KP Q+EV EI
Sbjct  239   KPVLPIGQLPST---DPVGGEDTDTWRWVKDWLDKHARGSVVYVAFGSEAKPRQDEVTEI  295

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLE S+LPFFW  R QRG  D +V +LPEGFEERT+  GV+CT+WAPQLKIL H +VG
Sbjct  296   ALGLEKSKLPFFWALRLQRGPWDPDVLRLPEGFEERTKALGVVCTTWAPQLKILGHMAVG  355

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTHSGW+SVVEA+  EK L++  FL DQGI  R+L EK+MGY++ R+E DG F+ DSV
Sbjct  356   GFLTHSGWTSVVEAILNEKPLVLLTFLSDQGINARVLEEKKMGYSVPRNERDGLFTSDSV  415

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAA  281
             AESLR+VMVEE G+++ E++K+MK     +E+Q+ Y++ LL  L ++
Sbjct  416   AESLRLVMVEEEGRIYRERIKEMKDLFVNRERQNMYIDNLLRTLTSS  462



>gb|KEH20103.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   452 bits (1163),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/463 (48%), Positives = 320/463 (69%), Gaps = 4/463 (1%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   LHIVM PWLAFGH+IPYLE+AKL+A++G+++ +VSTPRNIQRLP+L P++ P I  
Sbjct  3     EEKALHIVMFPWLAFGHMIPYLEVAKLIAQKGHQVSYVSTPRNIQRLPQLPPNVAPLIKF  62

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + LP+P+V+NLPE+AE+T D+ +D  +YLK AFD+L+  +  FL++   DW++HDFA F 
Sbjct  63    VSLPMPKVDNLPENAEATTDVSWDVFQYLKDAFDKLEQPLTNFLESSDADWILHDFAPFW  122

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSP-VEPKHTTSKPKWVPFETTIM  1133
             L P+  K+ I  V+F+I T    A   P S +      P  + +  T+ P W+PF TT+ 
Sbjct  123   LGPVATKIGIKCVFFNITTPPNLAFLGPISVLTGKEKDPRTKLEDYTAPPPWIPFNTTVA  182

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              + FE+++           VS+++R+   V+    + +R C E EPEW +L + ++ KP 
Sbjct  183   YKYFEIKKNAEVFSKKDSGVSEMHRVSSCVQNCDTILIRGCTEFEPEWFELLQNLLQKPV  242

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             +P G LP+T ++  +++D    W  IK+WLD Q  GSVVYVAFGSE  P+QEEV EIALG
Sbjct  243   LPAGQLPSTGFNFVDENDT---WQGIKKWLDNQPHGSVVYVAFGSEATPSQEEVNEIALG  299

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LE S LPFFWV R Q G  D  V +LPEGFE+RT+GRGV+CT WAPQ+KIL H ++G F 
Sbjct  300   LEKSNLPFFWVLRAQHGRKDKAVLQLPEGFEDRTKGRGVVCTDWAPQMKILGHMAIGVFF  359

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             +H+GW+SVVEA++ EK L++  FL DQGI  ++L EK+M Y + RDE DGSF+ DSVA +
Sbjct  360   SHAGWTSVVEAVQNEKPLVLMTFLVDQGINAKVLEEKKMAYTVPRDEQDGSFTSDSVART  419

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             +R+VM+EE G+++ E +K++K      E+QD Y++ LLD+L +
Sbjct  420   IRLVMLEEEGRIYRENIKEVKDLFVNIERQDRYIDNLLDHLKS  462



>ref|XP_004250160.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=470

 Score =   452 bits (1162),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 335/470 (71%), Gaps = 3/470 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA  S  LHI + PWLAFGH+IPYLEL+KL+A++G+KI F+STPRNI RLPKL P L P 
Sbjct  1     MAENSKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPSLAPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             ++ + +PLP VE LP++AE+T DLPY++V+YLK+A D L++ MA FL+  +PD+++ DF 
Sbjct  61    LNFVKIPLPYVEKLPKNAEATTDLPYEQVKYLKLAHDALKEPMAKFLEDSAPDFILFDFT  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S+ L  I  K +IP+ YFSIF A+      P   + +  ++ +  +  T  PKWVPFET 
Sbjct  121   SYWLPSIASKFNIPTGYFSIFVAAYLGFTGPVPGLNNNYENRMTLEELTVSPKWVPFETA  180

Query  1138  IMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
             +  + FE+ R++      +  N  D+ R+  T +    + VRSC E EPEWL++ E++  
Sbjct  181   VAFKEFELLRIYEGCKEGEEENFYDISRMYKTFENCDFLLVRSCLEFEPEWLKVVEDIHP  240

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             KP IPVG LPTT+Y+D+  D     W EIK WLDKQEKG V+YVAFGSE K +Q E+ E+
Sbjct  241   KPVIPVGQLPTTSYEDDNTDIDA--WREIKLWLDKQEKGKVIYVAFGSEAKLSQNELTEL  298

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             +LGLELS LPFFWV R +RG +D E+ ++PEGFEERT+ RG++ TSW PQLKILSHDSVG
Sbjct  299   SLGLELSGLPFFWVLRTKRGESDNELIQVPEGFEERTKERGIVYTSWVPQLKILSHDSVG  358

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH+GWSS+VEA++FEK L++  FL DQGI  RLL EK++ Y I R++ DGSF+  +V
Sbjct  359   GFLTHAGWSSIVEAIQFEKPLLLLTFLADQGINARLLEEKKVAYLIPRNDWDGSFTHKAV  418

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTI  272
              ESL +V++E+ G+++ +K+K++K    +K++QD+YV  L+ +L     I
Sbjct  419   VESLYLVLLEKEGEIYQKKIKEVKNLCCDKKRQDDYVENLIRFLQNYKKI  468



>ref|XP_004143545.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
Length=466

 Score =   451 bits (1161),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 235/458 (51%), Positives = 327/458 (71%), Gaps = 10/458 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNIDLIGL  1481
             LHIV+ PW+AFGH+IP+LEL+KL+A++G+++ FVSTP+NI RLP KL PHL   +  + L
Sbjct  7     LHIVIFPWIAFGHMIPFLELSKLIAQKGHRVSFVSTPKNIDRLPTKLPPHLSSFLRFVKL  66

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVP  1301
             P PQ+ +LP DAE+T D+PYDKV++LK AFD+L+  +  FL++   DW++ DFA + L  
Sbjct  67    PFPQINDLPPDAEATSDVPYDKVQFLKKAFDDLKQPIFDFLRSSDVDWILFDFAPYWLSQ  126

Query  1300  -IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
              I   L I + +FSIFT        P        D+ ++P+  T  P WVPF T ++ R+
Sbjct  127   DIGPTLGIKTAFFSIFTPEFLVFVGPMFG-----DNRIKPEDFTVSPHWVPFPTNVVFRH  181

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPV  944
             FE+ R+F+    +   VSDLYR+ ++   +  V VR C E   EW+QL  +V GKP  PV
Sbjct  182   FEIMRIFDSVAGNITGVSDLYRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDVYGKPIFPV  241

Query  943   GLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLEL  764
             G LPT+ Y+  +++     W  IKEWLDKQ K SVVYVAFGSE KP+Q E+ EIALGLE 
Sbjct  242   GQLPTSEYETGDENPA---WERIKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGLEK  298

Query  763   SQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHS  584
             S+L FFWV+R +RG +D +  +LPEGFEERT+GRGV+ T+WAPQLKIL H+S+GGFLTHS
Sbjct  299   SELRFFWVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPQLKILRHESMGGFLTHS  358

Query  583   GWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRV  404
             GWSSVVEA++ E+ L++  F+ DQGII R+L EK+MGY++ R+E DGSF+RD+VAESL++
Sbjct  359   GWSSVVEAIQSERALVLLSFVADQGIIARVLEEKKMGYSVPRNELDGSFTRDAVAESLKL  418

Query  403   VMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             V+VEE GK++ E +++ K     KE+ D  +++LLD++
Sbjct  419   VVVEEEGKIYRETIREAKDLFVNKERDDKLIDRLLDHM  456



>ref|XP_011015214.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Populus euphratica]
Length=477

 Score =   449 bits (1154),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 227/430 (53%), Positives = 299/430 (70%), Gaps = 8/430 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   LHI M PWLAFGHIIP+LELAKL+A+RG+KI F+STPRNIQRLP   P+L P I+L
Sbjct  3     EPDELHIAMFPWLAFGHIIPFLELAKLIAQRGHKISFISTPRNIQRLPSTPPNLTPRINL  62

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + L LP VENLP +AE+T DLP+DK+ YLK+A+D LQDS+  FL + SPDW+I DFA + 
Sbjct  63    VSLALPHVENLPNNAEATADLPFDKIPYLKLAYDGLQDSIFHFLHSSSPDWIIFDFAPYW  122

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSP-VEPKHTTSKPKWVPFETTIM  1133
             L  I  KL I  V FSIF A   +   P S+ +   D P  EP+H T  PKWV F + + 
Sbjct  123   LPEIATKLGISGVLFSIFGAWTISFAGPSSSAMLNDDDPRTEPQHFTVPPKWVTFPSKVA  182

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R  E +R  +   ++   V+D++R G  + G   + VRSC ELE ++++L E++  KP 
Sbjct  183   FRIHEAKRFLDQIELNSSGVTDIFRWGSVLAGCDVIAVRSCLELEADFIRLVEDLHCKPV  242

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IPVGLLP +A  +  +      W+ I EWLDKQ +GSVVY+AFGSE   NQ+++ E+ALG
Sbjct  243   IPVGLLPPSA--EFSEGGVDEKWVAISEWLDKQTQGSVVYIAFGSELTMNQKDITELALG  300

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS L FFW  R +  S      +LP+GFEER +GRGV+ TSWAPQL+I++H+SVGGF+
Sbjct  301   LELSGLQFFWALRNRDDS-----VRLPDGFEERVKGRGVVWTSWAPQLRIMAHESVGGFV  355

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH G+SSV+EAL F   LIM PF  DQG+I R+   K++G  + RDE DGSF+R+SVAES
Sbjct  356   THCGYSSVIEALSFGLALIMLPFAIDQGLIARVFEGKKVGIEVPRDEQDGSFTRNSVAES  415

Query  412   LRVVMVEEHG  383
             LR+V+V++ G
Sbjct  416   LRLVIVDKEG  425



>ref|XP_008440525.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]
Length=467

 Score =   448 bits (1152),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 230/428 (54%), Positives = 307/428 (72%), Gaps = 10/428 (2%)
 Frame = -3

Query  1660  TLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNIDLIG  1484
              LHIVM PWLAFGH+IPYLEL+KL+A++G+++ FVSTP+NI RLP +L PHL P +  + 
Sbjct  6     NLHIVMFPWLAFGHMIPYLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFLSFVK  65

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL-  1307
             +PLPQ+ NLP DAE+T DLPYDKV++LK AFD L+  ++ FL+T   DW+++DF  + + 
Sbjct  66    IPLPQLHNLPPDAEATSDLPYDKVQFLKEAFDALKQPLSDFLRTSDADWIVYDFVPYWIG  125

Query  1306  VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPR  1127
               +   L I + +FSIF     A   P        D  ++ +  T  P W+PF TT+  R
Sbjct  126   QEVGPNLRIKTAFFSIFILQSLAFVGPMLG-----DRRMKLEDFTVPPDWIPFPTTVAFR  180

Query  1126  NFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
             +FE++++F+    +   VSD+ R  ++   +  V VR+  E EPEW+QL E++  K  IP
Sbjct  181   HFEIKKLFDFVAGNTTGVSDIDRFKMSAHYSDLVVVRAFPEYEPEWIQLLEDIHDKTVIP  240

Query  946   VGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLE  767
             VG LPT+ +D +ED+     W  IKEWLDKQ KGSVVYVAFGSE KP+Q E+ EIALGLE
Sbjct  241   VGQLPTSEHDSKEDNRS---WQSIKEWLDKQAKGSVVYVAFGSEAKPSQHELTEIALGLE  297

Query  766   LSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
              S+ PFFWV R + G +D +  +LPEGFEERT+G+GV+CT+WAPQLKIL H+SVGGFLTH
Sbjct  298   KSRFPFFWVLRTRLGLSDPDPIELPEGFEERTKGQGVVCTTWAPQLKILGHESVGGFLTH  357

Query  586   SGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLR  407
             SGWSSVVEA++ E+ L++  FL DQGII R+L EK+MGY + R + DGSF+RDSVAESL+
Sbjct  358   SGWSSVVEAIQSERALVLLSFLADQGIIARVLEEKKMGYCVPRSQLDGSFTRDSVAESLK  417

Query  406   VVMVEEHG  383
             +VMVEE G
Sbjct  418   LVMVEEEG  425



>ref|XP_004143546.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
Length=466

 Score =   447 bits (1150),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 236/458 (52%), Positives = 325/458 (71%), Gaps = 10/458 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNIDLIGL  1481
             LHIV+ PWLAFGH+IP+LEL+KL+A++G+K+ FVSTP+NI RLP KL  HL   +  + L
Sbjct  7     LHIVIFPWLAFGHMIPFLELSKLIAQKGHKVSFVSTPKNIDRLPTKLPSHLSSFLRFVKL  66

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVP  1301
             P PQ+ +LP DAE+T D+PYDKV++LK AFD+L+  +  FLQ+   DW++ DFA + L  
Sbjct  67    PFPQIHDLPPDAEATSDVPYDKVQFLKKAFDDLKQPLFDFLQSSDVDWILFDFAPYWLSQ  126

Query  1300  -IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
              I   L I + +FSI++        P        D+ ++P+  T  P WVPF T ++ R+
Sbjct  127   DIGPTLGIKTAFFSIYSPECLVFLGPMFG-----DNRIKPEDFTVSPHWVPFPTNVVFRH  181

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPV  944
             FE+ R+F+    +   VSDLYR+ ++   +  V VR C E   EW+QL  +V GKP  PV
Sbjct  182   FEIMRIFDSVAGNITGVSDLYRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDVYGKPIFPV  241

Query  943   GLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLEL  764
             G LPT+ Y+  +++     W  IKEWLDKQ K SVVYVAFGSE KP+Q E+ EIALGLE 
Sbjct  242   GQLPTSEYETGDENPA---WGRIKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGLEK  298

Query  763   SQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHS  584
             S+L FFWV+R +RG +D +  +LPEGFEERT+GRGV+ T+WAPQLKIL H+SVGGFLTHS
Sbjct  299   SELRFFWVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPQLKILGHESVGGFLTHS  358

Query  583   GWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRV  404
             GWSSVVEA++ EK L++  FL DQGI  R+L EK+MGY++ R+E DGSF+ D+VAESL++
Sbjct  359   GWSSVVEAIQSEKALVLLTFLADQGINARVLEEKKMGYSVPRNELDGSFTWDAVAESLKL  418

Query  403   VMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             V+VEE GK++ E ++++K     KE+ D  +++LLD++
Sbjct  419   VLVEEEGKIYRETIREIKDLFVNKERDDELIDRLLDHM  456



>ref|XP_010312900.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Solanum lycopersicum]
Length=470

 Score =   445 bits (1145),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 331/465 (71%), Gaps = 3/465 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LHI + PWLAFGH+IPYLEL+KL+A++G+KI F+STPRNI RLPKL P L+P 
Sbjct  1     MAENGKKLHIAVFPWLAFGHMIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPPSLIPF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
              + + LP+P VE LPE+AE+T+DLPY++V++LK+A D LQ+S+A FL+    D+++ DF 
Sbjct  61    FNFVKLPMPHVEKLPENAEATIDLPYEQVKHLKLAHDALQESIAKFLEDSDIDFILFDFV  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S+ L  I  K +IP+ YFSIF A+      P   + +  +  +  +  T  PKWVPFET 
Sbjct  121   SYWLPSIASKFNIPTGYFSIFVAAYLGFTGPVPGLNNNYEIRMTLEELTVSPKWVPFETA  180

Query  1138  IMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
             +  + FE+ R++      +  N  D+ R+  T +    + VRSC E EPEWL++ E++  
Sbjct  181   VAFKEFELLRIYEGCKEGEEENFYDISRMYKTFENCDFLLVRSCLEFEPEWLKVVEDIHP  240

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             KP IPVG LPTT+Y+D+  D     W EIK WLDKQ+KG V+YVAFGSE K +Q E+ E+
Sbjct  241   KPVIPVGQLPTTSYEDDNTDIDA--WREIKLWLDKQDKGKVIYVAFGSEAKLSQNELTEL  298

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             +LGLELS LPFFWV R +RG +D E+ ++PEGFEERT+ RG++ TSW PQLKILSHDSVG
Sbjct  299   SLGLELSGLPFFWVLRTKRGESDDELIQVPEGFEERTKERGIVYTSWVPQLKILSHDSVG  358

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH+GWSS+VEA++FEK L++  FL DQGI  RL+ EK + Y I R++ DGSF+ D+V
Sbjct  359   GFLTHAGWSSIVEAIQFEKPLLLLTFLADQGINARLVEEKNVAYLIPRNDWDGSFTHDAV  418

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
              ESL  V++++ G+++ +K+K++K    +K++QD+YV  LL +L 
Sbjct  419   VESLYFVLLKKEGEIYRKKIKEVKNLCCDKKRQDDYVENLLRFLQ  463



>ref|XP_002533518.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF28862.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=480

 Score =   445 bits (1145),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 240/465 (52%), Positives = 325/465 (70%), Gaps = 8/465 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA+    LHI M PWLAFGH+IP+LELAKL+A++G+KI F+STPRNI RLPKL PHL P 
Sbjct  9     MANRDDELHIAMFPWLAFGHMIPFLELAKLIAQKGHKISFISTPRNIDRLPKLPPHLAPF  68

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I+ + +PLP VENLP  AE+T DLP + V +LK A+D LQ+ ++ FLQ+  PDW++ DF 
Sbjct  69    INFVKIPLPYVENLPRSAEATADLPAEDVVHLKKAYDCLQEPLSNFLQSSLPDWIVFDFV  128

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S+ +  I  K +IPSVYFSIF   I+A     S+  +     +E       PKWVPF + 
Sbjct  129   SYWVPDIACKFNIPSVYFSIF---ISACLCYLSSGEEDYRRVIE--DYIVAPKWVPFPSK  183

Query  1138  IMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
             +  R FE+ ++F      D  N+ D+ R   T+K    +  R+C+ LEPEWLQL E++  
Sbjct  184   VAYRLFEVRKIFEAGITGDESNIYDIKRFQETMKNCDLIAARTCFGLEPEWLQLTEQLHQ  243

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             KP  PVG+LP    D + ++D++  W  IK+WLD+QEK SVVY+AFGSE  P+QEEV+EI
Sbjct  244   KPVFPVGVLPRET-DQDSEEDQEETWKPIKKWLDRQEKRSVVYIAFGSEALPSQEEVIEI  302

Query  781   ALGLELSQLPFFWVYRKQRG-SADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             A GLELS LPFFWV RK  G S + EV  LP GFE+R + RG++ T+WAPQL+IL H+S+
Sbjct  303   AHGLELSGLPFFWVLRKSCGLSEEEEVVDLPNGFEDRVKDRGMVFTNWAPQLRILGHESI  362

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             G FLTHSG  SVVEAL+  + L++ PF  DQG+  +LL EK++GY + R+E DGSF+R+S
Sbjct  363   GAFLTHSGICSVVEALQHGRPLVLLPFNSDQGLNAKLLEEKKIGYLMPRNEEDGSFTRNS  422

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             VAESLR+V+VEE GK++ +K ++M+A   +K++Q  YV+  LDYL
Sbjct  423   VAESLRLVIVEEEGKIYRDKAEEMRALFTDKDRQSRYVDAFLDYL  467



>ref|XP_011015202.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Populus euphratica]
Length=465

 Score =   443 bits (1139),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 226/430 (53%), Positives = 297/430 (69%), Gaps = 8/430 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   LHI M PWLAFGHIIP+LELAKL+A+RG+KI F+STPRNIQRLP +   L P I+L
Sbjct  3     EPDELHIAMFPWLAFGHIIPFLELAKLIAQRGHKISFISTPRNIQRLPSIPLDLTPRINL  62

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
               L LP+VENLP +AE+T DLP+DK+ YLK+A+D LQDS+  FL + SPDW+I DFA + 
Sbjct  63    ASLALPRVENLPNNAEATADLPFDKIPYLKLAYDGLQDSIFHFLHSSSPDWIIFDFAPYW  122

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSP-VEPKHTTSKPKWVPFETTIM  1133
             L  I  KL I  V FSIF A   +   P S+ +   D P  EP+H T  PKWV F + + 
Sbjct  123   LPEIATKLGIYGVLFSIFGAWTISFAGPSSSAMLNDDDPRTEPQHFTVPPKWVTFPSKVA  182

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R  E +R  +   ++   V+D++R G  + G   + VRSC ELE ++L+L E++  KP 
Sbjct  183   FRIHEAKRFLDQIELNSSGVTDIFRWGSVLAGCDVIAVRSCLELEADFLRLVEDLHCKPV  242

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IPVGLLP +A  +  +      W+ I EWLDKQ +GSVVY+AFGSE   NQ+++ E+ALG
Sbjct  243   IPVGLLPPSA--EFSEGGVDEKWVAISEWLDKQTQGSVVYIAFGSELTMNQKDITELALG  300

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS L FFW  R +  S      +LP+GFEER +GRGV+ TSWAPQL+I++H+SVGGF+
Sbjct  301   LELSGLQFFWALRNRDDS-----VRLPDGFEERVKGRGVVWTSWAPQLRIMAHESVGGFV  355

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH G+SSV+EA  F   LIM PF  DQG+I R+   K++G  + RDE DGSF+R+SVAES
Sbjct  356   THCGYSSVIEAFSFGLALIMLPFAIDQGLIARVFEGKKVGIEVPRDEQDGSFTRNSVAES  415

Query  412   LRVVMVEEHG  383
             LR+V+V++ G
Sbjct  416   LRLVIVDKEG  425



>ref|XP_004160942.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 91A1-like 
[Cucumis sativus]
 gb|KGN48695.1| hypothetical protein Csa_6G498430 [Cucumis sativus]
Length=466

 Score =   443 bits (1139),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 324/458 (71%), Gaps = 10/458 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNIDLIGL  1481
             LHIV+ PWLAFGH+IP+LEL+KL+A++G+K+ FVSTP+NI RLP KL  HL   +  + L
Sbjct  7     LHIVIFPWLAFGHMIPFLELSKLIAQKGHKVSFVSTPKNIDRLPTKLPSHLSSFLRFVKL  66

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVP  1301
             P PQ+ +LP DAE+T D+PYDKV++LK AFD+L+  +  FLQ+   DW++ DFA + L  
Sbjct  67    PFPQIHDLPPDAEATSDVPYDKVQFLKKAFDDLKQPLFDFLQSSDVDWILFDFAPYWLSQ  126

Query  1300  -IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
              I   L I + +FSI++        P        D+ ++P+  T  P WVPF T ++ R+
Sbjct  127   DIGPTLGIKTAFFSIYSPECLVFLGPMFG-----DNRIKPEDFTVSPHWVPFPTNVVFRH  181

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPV  944
             FE+ R+F+    +   V+DL R+ ++   +  V VR C E   EW+QL  +V GKP  PV
Sbjct  182   FEIMRIFDSVAGNITGVTDLDRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDVYGKPIFPV  241

Query  943   GLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLEL  764
             G LPT+ Y+  +++     W  IKEWLDKQ K SVVYVAFGSE KP+Q E+ EIALGLE 
Sbjct  242   GQLPTSEYETGDENPA---WGRIKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGLEK  298

Query  763   SQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHS  584
             S+L FFWV+R +RG +D +  +LPEGFEERT+GRGV+ T+WAPQLKIL H+SVGGFLTHS
Sbjct  299   SELRFFWVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPQLKILGHESVGGFLTHS  358

Query  583   GWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRV  404
             GWSSVVEA++ EK L++  FL DQGI  R+L EK+MGY++ R+E DGSF+ D+VAESL++
Sbjct  359   GWSSVVEAIQSEKALVLLTFLADQGINARVLEEKKMGYSVPRNELDGSFTWDAVAESLKL  418

Query  403   VMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             V+VEE GK++ E ++++K     KE+ D  +++LLD++
Sbjct  419   VLVEEEGKIYRETIREIKDLFVNKERDDELIDRLLDHM  456



>ref|XP_010254573.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Nelumbo nucifera]
Length=483

 Score =   443 bits (1140),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 240/479 (50%), Positives = 312/479 (65%), Gaps = 17/479 (4%)
 Frame = -3

Query  1678  MASESST-----LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHP  1514
             MAS SS      LH+VM PWLAFGH++P+LEL+K LAERG+++ FVSTPRNIQRLPK+ P
Sbjct  1     MASLSSVANNNELHVVMFPWLAFGHMMPFLELSKRLAERGHRVSFVSTPRNIQRLPKIPP  60

Query  1513  HLVPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWV  1334
              L   + L+ LPL   + LPE+AE+T+DL Y KV+YLK AFD L+  +  FL++ SPDW+
Sbjct  61    SLSSLVHLVELPLSPTDGLPENAEATVDLSYHKVQYLKKAFDGLEGPLTRFLESSSPDWI  120

Query  1333  IHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVD-SPVEPKHTTSKPKW  1157
             +HDFA   L PI  KL +PS +FS+F AS  A F P +A++ G D    +P+  T  PKW
Sbjct  121   LHDFAPHWLSPITAKLGLPSAFFSLFNASALAFFGPPNALLGGDDDCRTKPEDFTVPPKW  180

Query  1156  VPFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPE--WLQ  983
             VPF      R +E+ R+ +    +   VSD YR+G  V G   V +RSC E E E   L+
Sbjct  181   VPFPLAF--RLYEILRMVDGLDRNASGVSDTYRIGSAVLGCDIVVIRSCMEFESESDCLR  238

Query  982   LAEE-VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKP  806
             L EE +  KP IPVGLLP  A   ++         E  +WLD+Q +GSVVYVAFGSE   
Sbjct  239   LLEEKIYCKPVIPVGLLPLAAPAVKDAMG------EDDKWLDQQGRGSVVYVAFGSEVTL  292

Query  805   NQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLK  626
             +QE+V E+A+GLELS+LPFFWV RK       E   LP+GFEERT+GRGV+C  WAPQ +
Sbjct  293   SQEDVTELAVGLELSELPFFWVLRKPSSLTQEEWGLLPDGFEERTKGRGVVCRGWAPQQR  352

Query  625   ILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDEND  446
             IL+H SVGGFLTH GWSS++EAL+F    I+ P+L DQG+  RLL  +++G  I RDE  
Sbjct  353   ILAHPSVGGFLTHCGWSSIIEALEFGHAFILLPYLADQGLNARLLAWRKLGVEIQRDERS  412

Query  445   GSFSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIH  269
             GSF+R SVAESLR+VMV + G       +KM   +  K+  D YV+ L+ Y+      H
Sbjct  413   GSFTRSSVAESLRLVMVSDEGAELRANARKMAEMVGNKQLHDQYVDHLISYMQENRRSH  471



>ref|XP_004289539.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   442 bits (1138),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 240/469 (51%), Positives = 314/469 (67%), Gaps = 9/469 (2%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNI  1496
             +++   LHI M PWLAFGH+IPYLELAKL+A +G++I F+STPRNI RLP L P L   I
Sbjct  12    SNKDCKLHIGMFPWLAFGHMIPYLELAKLIARKGHQISFISTPRNIDRLPPLPPKLSTLI  71

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
               + LPLP+  NLPE AE+T DLP D+V +LKIA+D L++ +  FL++ + DW+++DFA 
Sbjct  72    TFVKLPLPENPNLPEGAEATSDLPEDQVEHLKIAYDSLKEPITQFLKSSNLDWLLYDFAP  131

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
             + L  I   L IP+ +FSIF AS +    P S  +   D    P+     PKWVPF  T+
Sbjct  132   YWLPEITRNLEIPTAFFSIFLASCSVFLGPTSPEVPS-DYRKLPEDYLVSPKWVPFRATV  190

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R FE+ R++     D  NVSD+YR   T +G   + VRSC E EP WL L   + GKP
Sbjct  191   ALRLFEVLRLYKRITGDETNVSDVYRFKETTRGCDVIAVRSCVEFEPGWLSLLGVIHGKP  250

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVGLL TT      +DD+  +W  IK+WLDKQ K +VVYVAFG+E  P+QEEV EIAL
Sbjct  251   VIPVGLLSTTP-----NDDENDSWWSIKDWLDKQSKNTVVYVAFGTEAMPSQEEVTEIAL  305

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLE S LPFFWV R + G    E  KLPEGFEER  GRGV+  SW PQLKIL+HDS G F
Sbjct  306   GLEKSGLPFFWVLRTKHGE---EAVKLPEGFEERNEGRGVVYRSWVPQLKILAHDSFGVF  362

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             L+H+GWSSVVEAL F + L++ P L DQG+  RL  EK++GY + RD   GSF+ ++VAE
Sbjct  363   LSHAGWSSVVEALTFARPLVLLPMLNDQGLNARLFGEKKVGYELPRDNETGSFTSEAVAE  422

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIH  269
             SLR+V+ +E G+V+ +K K++K    ++E+Q+ YV+K L+YL      H
Sbjct  423   SLRMVIEKEEGRVYRDKAKELKPLFGDRERQNVYVDKFLEYLTIHKRFH  471



>ref|XP_008440527.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]
Length=466

 Score =   441 bits (1133),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 236/469 (50%), Positives = 321/469 (68%), Gaps = 10/469 (2%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNIDLI  1487
             + LHI + PWLAFGH+IP+LEL+K +A++G+++ FVSTPRNI RLP KL PHL   +  +
Sbjct  5     NKLHIAIFPWLAFGHMIPFLELSKHIAQKGHRVSFVSTPRNIDRLPTKLPPHLSSFLRFV  64

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
              LP PQ+ +LP DAE+T D+PYDKV++LK A D+L+  +  FLQ+   DW++ DFA + L
Sbjct  65    KLPFPQIHDLPPDAEATSDVPYDKVQFLKKALDDLKQPLVDFLQSSDVDWILFDFAPYWL  124

Query  1306  VP-IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
                I   L I + +FSI+T        P        D+ ++P+  T  P WVPF T ++ 
Sbjct  125   SQDIGPTLGIKTAFFSIYTPECLVFLGPMFG-----DNRIKPEDFTVSPDWVPFPTNVVF  179

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R+FE+ R+F+    +   VSDL R+      +  V VR C E   EW+QL  ++  KP  
Sbjct  180   RHFEIMRIFDSVSGNITGVSDLDRMKRGAHYSDLVVVRGCPEFGQEWIQLLGDIYCKPVF  239

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             PVG LPTT Y+  +++     W  IKEWLDKQ K SVVYVAFGSE KP+Q E+ EIALGL
Sbjct  240   PVGQLPTTEYETGDENPA---WRTIKEWLDKQPKASVVYVAFGSEAKPSQNELTEIALGL  296

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             E S L FFWV+R +RG +D +  +LPEGFEERT+ RGV+ T+WAPQLKIL H+SVGGFLT
Sbjct  297   EKSDLRFFWVFRTRRGPSDPDPIELPEGFEERTKERGVVWTTWAPQLKILGHESVGGFLT  356

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             HSGWSSVVEA++ EK L++  FL DQGI  R+L EK+MGY++ R+E DGSF+RD+VAESL
Sbjct  357   HSGWSSVVEAIQSEKALVLLTFLADQGINARVLEEKKMGYSVPRNELDGSFTRDAVAESL  416

Query  409   RVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHP  263
             ++V+ EE GK++ E ++K K+    KEK D  +++LLD++    T + P
Sbjct  417   KLVVAEEEGKIYRETIRKAKSLFVNKEKDDKLIDRLLDHMKEKMTKNEP  465



>ref|XP_004288529.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Fragaria vesca 
subsp. vesca]
Length=476

 Score =   441 bits (1133),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 240/469 (51%), Positives = 314/469 (67%), Gaps = 11/469 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             ++ S LHI M PWLAFGH++PYLELAKL+A +G+KI F+STPRNI RLP+L P+L   I 
Sbjct  14    NKDSKLHIAMFPWLAFGHMLPYLELAKLIAGKGHKISFISTPRNIDRLPQLPPNLSTLIT  73

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              + +PLPQ +NLPE AEST DL  D+V YLKIA+D LQ+ +  FL    PDW++ DFA +
Sbjct  74    FVEVPLPQNQNLPEGAESTADLAEDQVPYLKIAYDSLQEPITQFLNRSKPDWLLFDFAPY  133

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              +  I   L IP+ +FSI  A+  +I  P S  I   D  + P+     PKWVPF  T+ 
Sbjct  134   WVPEIANTLGIPTAFFSIILAAALSIVGPTSPEIPADDRKL-PEDYIVPPKWVPFPATVA  192

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R FE+ R++     D  NV D YR   T+     + VRSC E EPEWL L E++ GKP 
Sbjct  193   LRLFEVRRLYTRVIGDETNVGDKYRFTETMWSCDMIVVRSCTEFEPEWLSLLEDLHGKPV  252

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             +PVG+L   +   + DDD    W  IK+WLD+Q K +VVYVAFGSE  P+QEE  EIALG
Sbjct  253   LPVGVL---SPMPKADDDDDETWRSIKDWLDRQSKNTVVYVAFGSEAMPSQEEATEIALG  309

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LE S LPF WV R + G    +   LPEGFEER  GRGV+C SW PQLKIL+HDS G FL
Sbjct  310   LEKSGLPFVWVLRTKHGE---DAVMLPEGFEERNEGRGVVCRSWVPQLKILAHDSFGVFL  366

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             +HSGWSSVVEAL F + L++ P   DQG+  R  +EK++GY + RDE DGSF+ ++VAES
Sbjct  367   SHSGWSSVVEALTFGRPLVLLPMSNDQGLNARYFMEKKVGYELPRDEGDGSFTSEAVAES  426

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             LR+V+ +E G+V+ +K K++K    ++E+Q+ YV+K L+YL    TIH+
Sbjct  427   LRMVIEKEEGRVYRDKAKELKPLFGDRERQNMYVDKFLEYL----TIHN  471



>ref|XP_004287868.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=478

 Score =   441 bits (1133),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 234/477 (49%), Positives = 320/477 (67%), Gaps = 7/477 (1%)
 Frame = -3

Query  1684  SAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLV  1505
             S+ A+    LH+ + PWLAFGHIIP+LE+AK +A +G+K+ F+STPRNIQRLPK+   L 
Sbjct  3     SSSATRHKQLHVALFPWLAFGHIIPFLEVAKHIARKGHKVSFISTPRNIQRLPKIPETLT  62

Query  1504  PNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
             P I L+ +PLP VENLPE+AE+T+D+P+D + YLKIA D L+  ++ FLQ  SPDW+IHD
Sbjct  63    PLITLVQIPLPHVENLPENAEATMDVPHDVIPYLKIAHDGLEQGISEFLQAQSPDWIIHD  122

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEP-KHTTSKPKWVPF  1148
             FA   L PI  KL I + +FSIF AS        S       +P +  +  TS P+W+PF
Sbjct  123   FAPHWLPPIATKLGISNAHFSIFNASTLCFLGSTSPNRVSRYAPRKKLEQYTSPPEWIPF  182

Query  1147  ETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
              + I  R FE +R+ N     +   V+D +RL  T++G    F+RSC E+E EWL L E+
Sbjct  183   PSKIYYRPFEAKRLVNGILTPNASGVTDHFRLESTIQGCQVYFIRSCREIEGEWLDLLED  242

Query  970   VVGKPTI-PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
             +  KP + P GLLP +    +ED  K + W +I EWLDKQEKG VVYVAFGSE   +QEE
Sbjct  243   LHEKPVVLPTGLLPPSLPRSDEDGGKDSDWSKIAEWLDKQEKGKVVYVAFGSELNLSQEE  302

Query  793   VVEIALGLELSQLPFFWVYRK-QRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
               E+ALGLELS LPFFWV RK   GS D +  KLP+GFE+RT+GRG + T+WAPQLKILS
Sbjct  303   FNELALGLELSGLPFFWVLRKPSNGSGDGDSVKLPDGFEDRTKGRGHVWTTWAPQLKILS  362

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H+SVGGFLTH GWSS++E+L++ + LIM PF+ DQG+I R   + ++G  + RDE  G F
Sbjct  363   HESVGGFLTHCGWSSIIESLQYGRPLIMLPFMYDQGLIARFW-DNKIGAEVPRDEETGWF  421

Query  436   SRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             +R+ +A SL++++V+E GK + +          +KE  D Y+++ ++YL   +  HH
Sbjct  422   TRNELANSLKLIVVDEEGKQYRDGANDYSKLFRDKELHDRYMDECVEYLETHA--HH  476



>ref|XP_008440526.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis melo]
Length=468

 Score =   439 bits (1130),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 233/470 (50%), Positives = 329/470 (70%), Gaps = 10/470 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNI  1496
             +E   LHIVMLPW AFGH+IP+LEL+KL+A++G+++ FVSTP+NI RLP +L PHL P +
Sbjct  2     AEDKKLHIVMLPWFAFGHMIPFLELSKLIAQKGHRVSFVSTPKNIDRLPTQLPPHLSPFL  61

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
               + +P+PQ++NLP DAE+T+DLPYDK+R+LK A+D L+  ++ FL+T   D V++DF  
Sbjct  62    SFVKIPMPQLDNLPPDAEATIDLPYDKIRFLKEAYDALKQPLSDFLRTSDADCVLYDFFP  121

Query  1315  FRL-VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             + +   I   L I + +FSIF     A   P S+     D   + +  T  P W+PF TT
Sbjct  122   YWIGQEIGPNLGIKTAFFSIFIPETLAFAGPMSSR----DHRKKVEDFTVPPDWIPFPTT  177

Query  1138  IMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
             +  R++EM+++F++A   +   VSDL RL ++   +  + +++C E   EW+QL  ++ G
Sbjct  178   VALRHYEMKKIFDEAVTGESTGVSDLDRLKLSAHNSDFIVLKACPEFGQEWIQLVGDIHG  237

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             K   P+G LPT+ YD  +D+ +   W  IKEWLDKQ   SVVYVAFGSE KP+Q+E+ EI
Sbjct  238   KNVFPIGQLPTSEYDSGDDNQE---WQSIKEWLDKQPIASVVYVAFGSEAKPSQDELTEI  294

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             A GLE S+LPFFWV R + G +D  VT+LPEGFEERT+GRG++  +WAPQLKIL H+SVG
Sbjct  295   AFGLEKSELPFFWVLRTRSGLSDPNVTELPEGFEERTKGRGIVWNTWAPQLKILGHESVG  354

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFL+HSGWSS VEA++ EK +I  PFL DQGII R+L EK++GY I R+  DGSF+RDSV
Sbjct  355   GFLSHSGWSSAVEAIQSEKAMIFLPFLVDQGIIARILEEKKVGYCIPRNLLDGSFTRDSV  414

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTI  272
              ESL++VMVE+ GK++ EK+K++K     KE+ +  +++ L YL     +
Sbjct  415   EESLKLVMVEDEGKIYREKIKELKGLFVNKERDERLIDQFLSYLKTHRNV  464



>gb|KDP29783.1| hypothetical protein JCGZ_18718 [Jatropha curcas]
Length=465

 Score =   439 bits (1130),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 226/464 (49%), Positives = 319/464 (69%), Gaps = 8/464 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +E+  LH+ + PWLAFGHIIPYL++AK +A++G+KI F+STPRNIQRLPK+ P+L  NI 
Sbjct  2     TETKKLHVALFPWLAFGHIIPYLKVAKHIAQKGHKISFISTPRNIQRLPKIPPNLSSNIH  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              I LPLPQV+NLP DAE+T+D+P +K+ YLKIA+D L++ +  FL+T +PDW+I+DFA++
Sbjct  62    FISLPLPQVDNLPPDAEATMDIPTNKIPYLKIAYDGLKEPLFQFLKTSAPDWIIYDFAAY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFF-PQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
              L PI   L I S +FSIF+A   A      SA+I+G D    P+  T  PKWVPF + +
Sbjct  122   WLPPITSDLGISSAFFSIFSAWTMAFLASSSSAMINGDDERTRPEDFTVPPKWVPFPSKV  181

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R  E +R F    ++   +SD+YRLG  +     + VRSC+ELE + L+L E++ GKP
Sbjct  182   AYRIHEAKRAFEHFEVNDSGLSDMYRLGTVMAAVDVLAVRSCFELEADHLKLFEQLHGKP  241

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +P+GLLP +  D +        WL+I  WLDKQ KGSVVY+AFGSE + +Q+++ ++AL
Sbjct  242   VLPIGLLPPS--DLDVTGGDDETWLKICGWLDKQNKGSVVYIAFGSELEVSQKDLNDLAL  299

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS LPFFW  RKQ  S +     LP+GFEER +GRG++ TSW PQL+IL H+SVGGF
Sbjct  300   GLELSGLPFFWTLRKQGNSFE-----LPDGFEERVKGRGIVWTSWVPQLRILGHESVGGF  354

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH G SSVVEAL F   LI+ P   DQG+  R+  EK++G  + R+E DGSF+++S+AE
Sbjct  355   LTHCGLSSVVEALNFGLALILFPVSIDQGLNARVFEEKKLGVEVKRNEQDGSFTKESLAE  414

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SL + M  E GK++ E   +M+  +  +E  +  +++ +++L  
Sbjct  415   SLMLAMDNEKGKLYRESTNEMRKLITNREVHNGCIDQFVEFLQT  458



>gb|KDP29780.1| hypothetical protein JCGZ_18715 [Jatropha curcas]
Length=471

 Score =   439 bits (1129),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 225/464 (48%), Positives = 318/464 (69%), Gaps = 7/464 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +E   LH+   PWLAFGH+IP+LELAK +A++G+KI F+STPRNI+RLP + P+L  NI+
Sbjct  2     TEPKKLHVAFFPWLAFGHMIPFLELAKHIAQKGHKISFISTPRNIRRLPIIPPNLTSNIN  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              I L LPQV+NLP DAE+T+DLP+ +V YLK+A+D L+D +  FL+T +P+WVI+DF  +
Sbjct  62    FISLSLPQVDNLPPDAEATIDLPFSQVPYLKLAYDSLKDPLLHFLKTSTPNWVIYDFFPY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
              L  I+  L I   +FSI    +I +   P SA+I+G DS   P+  T  PKW+PF + +
Sbjct  122   WLPSILADLGISGAFFSIAGGWTITSFASPLSAMINGRDSRTRPEDFTVPPKWIPFPSKV  181

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R +E ++      +D    SD +RL   + G   V +RSC+ELE ++L+L  E+ GKP
Sbjct  182   AYRLYEAKKTLRHHEVDNSGTSDGFRLSTVMAGCDIVAIRSCFELEADFLRLVGELHGKP  241

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
               PVGLLP      + + D+   WL+I++WLD+Q+KGSVVY+AFGSE   +Q+E  E+AL
Sbjct  242   VFPVGLLPQLTL--DGNGDEDDTWLKIRDWLDEQKKGSVVYIAFGSEVDLSQQEFTELAL  299

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS LPFFW  RK+    D    +LP+GFEER +GRG++ TSW PQ +ILSH+S+GGF
Sbjct  300   GLELSGLPFFWAIRKR----DDNKVELPDGFEERVKGRGLVWTSWVPQPRILSHESIGGF  355

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH G+SS+++AL F   LIM P   D G+I R+  +K++G  + R E+DGSF+RD VA+
Sbjct  356   LTHCGYSSIIDALYFGCALIMLPIAFDHGLIARVFEDKKVGVEVTRHEDDGSFTRDLVAD  415

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             S+R+VMV+E GK++ E  K+M     +KE QD Y+NK + +L  
Sbjct  416   SVRLVMVDEEGKLYRENAKEMSKLFADKELQDRYINKFVVFLQT  459



>ref|XP_010277529.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nelumbo 
nucifera]
Length=474

 Score =   438 bits (1127),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 224/464 (48%), Positives = 309/464 (67%), Gaps = 4/464 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M +E   LHIVM PWLAFGH++P+LEL+K LA+RG++I FV++PRNIQRLP++ P L   
Sbjct  1     MENEKDNLHIVMFPWLAFGHMLPFLELSKCLAQRGHRISFVTSPRNIQRLPQIPPSLSHL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I+L+ LPLP V+NLPE+ E+T+DLPYDK++YLK AFD L++ +  FL+  SPDWVI+DFA
Sbjct  61    INLVNLPLPPVDNLPENTEATIDLPYDKIQYLKKAFDGLEEPLTRFLEASSPDWVIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
                L PI  KL +    F+IF A+        S+++   D   E +H T  PKW+PF + 
Sbjct  121   PHWLPPITNKLGLLGACFNIFNAAAQVFIVSPSSMMGEEDPRSEAEHFTVPPKWIPFPSN  180

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQ-LAEEVVG  962
             +  R  E+ R+F+    +   VSD++R   TV+G+  + +RSC E E +WL+ L EE+  
Sbjct  181   LAFRLHEIRRIFDAVQENVAGVSDIFRFESTVRGSDIIAIRSCVEFEAQWLRLLNEEICR  240

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             KP +PVGLLP +   D  + D   +W+ I+EWLDKQ+  SVVY+A GSE   + E+  E+
Sbjct  241   KPNVPVGLLPPSV-QDIREGDDDESWIAIREWLDKQKSRSVVYIALGSEATLSHEDETEL  299

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLELS+LPFFWV R+  GS+ AE  +LP GFE+RTR RGV+C  WAPQ+KIL+H SVG
Sbjct  300   ALGLELSRLPFFWVLRRPPGSSAAE--ELPTGFEDRTRSRGVVCRGWAPQMKILAHPSVG  357

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
              FLTH GWSS +EAL +E  L++ P    QG+  R L   ++G  I R+E DGSF+R+SV
Sbjct  358   VFLTHCGWSSAIEALGWEVPLVLLPLTSTQGLCARQLAWDKIGVEIPRNEGDGSFTRNSV  417

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             AE+LR+V V E G     + K+M+         D Y++    +L
Sbjct  418   AETLRLVAVSEQGNALRTRAKEMRKIFCNSTLHDGYMDNFERHL  461



>gb|KDP29779.1| hypothetical protein JCGZ_18714 [Jatropha curcas]
Length=465

 Score =   437 bits (1125),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 225/464 (48%), Positives = 318/464 (69%), Gaps = 8/464 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +E+  LH+ + PWLAFGH IPYL++AK +A++G+KI F+STPRNIQRLPK+ P+L  NI 
Sbjct  2     TETKKLHVALFPWLAFGHTIPYLKVAKHIAQKGHKISFISTPRNIQRLPKIPPNLSSNIH  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              I LPLPQV+NLP DAE+T+D+P +K+ YLKIA+D L++ +  FL+T +PDW+I+DFA++
Sbjct  62    FISLPLPQVDNLPPDAEATMDIPTNKIPYLKIAYDGLKEPLFQFLKTSAPDWIIYDFAAY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFF-PQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
              L PI   L I S +FSIF+A   A      SA+I+G D    P+  T  PKWVPF + +
Sbjct  122   WLPPITSDLGISSAFFSIFSAWTMAFLASSSSAMINGDDERTRPEDFTVPPKWVPFPSKV  181

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R  E +R F    ++   +SD+YRLG  +     + VRSC+ELE + L+L E++ GKP
Sbjct  182   AYRIHEAKRAFEHFEVNDSGLSDMYRLGTVMAAVDVLAVRSCFELEADHLKLFEQLHGKP  241

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +P+GLLP +  D +        WL+I  WLDKQ KGSVVY+AFGSE + +Q+++ ++AL
Sbjct  242   VLPIGLLPPS--DLDVTGGDDETWLKICGWLDKQNKGSVVYIAFGSELEVSQKDLNDLAL  299

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS LPFFW  RKQ  S +     LP+GFEER +GRG++ TSW PQL+IL H+SVGGF
Sbjct  300   GLELSGLPFFWTLRKQGNSFE-----LPDGFEERVKGRGIVWTSWVPQLRILGHESVGGF  354

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH G SSVVEAL F   LI+ P   DQG+  R+  EK++G  + R+E DGSF+++S+AE
Sbjct  355   LTHCGLSSVVEALNFGLALILFPVSIDQGLNARVFEEKKLGVEVKRNEQDGSFTKESLAE  414

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SL + M  E GK++ E   +M+  +  +E  +  +++ +++L  
Sbjct  415   SLMLAMDNEKGKLYRESTNEMRKLITNREVHNGCIDQFVEFLQT  458



>sp|Q66PF2.1|URT1_FRAAN RecName: Full=Putative UDP-rhamnose:rhamnosyltransferase 1; Short=FaRT1; 
AltName: Full=Glycosyltransferase 4; Short=FaGT4 
[Fragaria x ananassa]
 gb|AAU09445.1| putative UDP-rhamnose:rhamnosyltransferase [Fragaria x ananassa]
Length=478

 Score =   435 bits (1119),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 231/477 (48%), Positives = 320/477 (67%), Gaps = 7/477 (1%)
 Frame = -3

Query  1684  SAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLV  1505
             S+ A++   LHI + PWLAFGHIIP+LE+AK +A +G+K+ F+STPRNIQRLPK+   L 
Sbjct  3     SSSATKRKKLHIALFPWLAFGHIIPFLEVAKHIARKGHKVSFISTPRNIQRLPKIPETLT  62

Query  1504  PNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
             P I+L+ +PLP VENLPE+AE+T+D+P+D + YLKIA D L+  ++ FLQ  SPDW+IHD
Sbjct  63    PLINLVQIPLPHVENLPENAEATMDVPHDVIPYLKIAHDGLEQGISEFLQAQSPDWIIHD  122

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEP-KHTTSKPKWVPF  1148
             FA   L PI  KL I + +FSIF AS    F   S       +P +  +  TS P+W+PF
Sbjct  123   FAPHWLPPIATKLGISNAHFSIFNASSMCFFGSTSPNRVSRYAPRKKLEQFTSPPEWIPF  182

Query  1147  ETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
              + I  R FE +R+ +     +   V+D +RL  T++G    F+RSC E+E EWL L E+
Sbjct  183   PSKIYHRPFEAKRLMDGTLTPNASGVTDRFRLESTIQGCQVYFIRSCREIEGEWLDLLED  242

Query  970   VVGKPTI-PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
             +  KP + P GLLP +    +ED  K + W +I  WLDKQEKG VVY AFGSE   +QE 
Sbjct  243   LHEKPIVLPTGLLPPSLPRSDEDGGKDSNWSKIAVWLDKQEKGKVVYAAFGSELNLSQEV  302

Query  793   VVEIALGLELSQLPFFWVYRK-QRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
               E+ALGLELS LPFFWV RK   GS D +  KLP+GFE+R +GRG++ T+WAPQLKILS
Sbjct  303   FNELALGLELSGLPFFWVLRKPSHGSGDGDSVKLPDGFEDRVKGRGLVWTTWAPQLKILS  362

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H+SVGGFLTH GWSS++E+L++   LIM PF+ DQG+I R   + ++G  + RDE  G F
Sbjct  363   HESVGGFLTHCGWSSIIESLQYGCPLIMLPFMYDQGLIARFW-DNKIGAEVPRDEETGWF  421

Query  436   SRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             +R+ +A SL++++V+E GK + +   +      +KE  D Y+++ ++YL   +  HH
Sbjct  422   TRNELANSLKLIVVDEEGKQYRDGANEYSKLFRDKELHDRYMDECVEYLETHA--HH  476



>gb|KDP29785.1| hypothetical protein JCGZ_18720 [Jatropha curcas]
Length=465

 Score =   434 bits (1117),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 222/464 (48%), Positives = 317/464 (68%), Gaps = 8/464 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +E+  LH+ + PWLAFGHIIPYL++AK +A++G+KI F+STPRNIQRLPK+ P+L   I 
Sbjct  2     TETKKLHVALFPWLAFGHIIPYLKVAKHIAQKGHKISFISTPRNIQRLPKIPPNLSSKIH  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              I LPLPQV+NLP  AE+T+D+P +K  YLKIA+D L+D +  FL+  +PDW+I+DFA+ 
Sbjct  62    FISLPLPQVDNLPPHAEATMDIPTNKTPYLKIAYDGLKDPLFQFLKISAPDWIIYDFAAH  121

Query  1312  RLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
              L PI   L I S Y SIF+A +I  +    SA+I+G D    P+  T  PKWVPF + +
Sbjct  122   WLPPITSDLGISSAYLSIFSAWTITFLASSSSALINGDDERTRPEGFTVPPKWVPFPSKV  181

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R  E +R F    ++   +SD+YRLG  +     + VRSC+ELE + L+L E++ GKP
Sbjct  182   AYRIHEAKRAFEHFEVNDSGLSDMYRLGTVMAAVDVLAVRSCFELEADHLKLFEQLHGKP  241

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +P+GLLP +  D +        WL+I  WLDKQ KGSV+Y+AFGSE++ NQ+++ E+AL
Sbjct  242   VLPIGLLPPS--DLDVTGGDDETWLKICGWLDKQNKGSVIYIAFGSESEVNQKDLNELAL  299

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS LPFFW  RKQ  S +     LP+GFEER +GRG++ TSW PQL+IL H+SVGGF
Sbjct  300   GLELSGLPFFWTLRKQGNSFE-----LPDGFEERVKGRGIVWTSWVPQLRILGHESVGGF  354

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH G+SS++EAL F   LI+ P    QG+  R+L EK++G  + R+  DGSF+++S+AE
Sbjct  355   LTHCGFSSIIEALNFGLALILFPVSIAQGLNARVLEEKKLGVEVKRNAQDGSFTKESLAE  414

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SL +VM  E GK++ E   +M+  +  ++  +  +++ +++L  
Sbjct  415   SLMLVMDNEKGKLYRESANEMRKLITNRDVHNGCIDQFIEFLQT  458



>ref|XP_004143544.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
Length=467

 Score =   434 bits (1115),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 300/429 (70%), Gaps = 10/429 (2%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNIDLI  1487
             + LHIV+ PWLAFGH+IP+LEL+KL+A++G+K+ FVSTP+NI RLP KL  HL   +  +
Sbjct  5     NNLHIVIFPWLAFGHMIPFLELSKLIAQKGHKVSFVSTPKNIDRLPTKLPSHLSSFLRFV  64

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
              LP PQ+ +LP DAE+T D+PYDKV++LK AFD+L+  +  FLQ+   DW++ DFA + L
Sbjct  65    KLPFPQIHDLPPDAEATSDVPYDKVQFLKKAFDDLKQPLFDFLQSSDVDWILFDFAPYWL  124

Query  1306  VP-IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
                I   L I + +FSI++        P        D+ ++P+  T  P WVPF T +M 
Sbjct  125   SQDIGPTLGIKTAFFSIYSPECLVFLGPMFG-----DNRIKPEDFTVSPHWVPFPTNVMF  179

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R+FE+  VF+    +   VSDLYR+ ++   +  V VR C E   EW+QL  ++ GKP  
Sbjct  180   RHFEIVNVFDSVAGNITGVSDLYRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDLYGKPIF  239

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             PVG LPT+ Y+  +++     W   KEWLDKQ K SVVYVAFGSE KP+Q E+ EIALGL
Sbjct  240   PVGQLPTSEYEIGDENPA---WRTTKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGL  296

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             E S+LPFF V+R +RG +D +  +LPEGFEERT+GRGV+ T+WAPQLKIL H+SVGGFLT
Sbjct  297   EKSELPFFGVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPQLKILGHESVGGFLT  356

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             H G SS+VEA++ EK L++  FL DQGI  R+L EK+MGY+I R+E DGSF RD+VAESL
Sbjct  357   HCGCSSLVEAIQNEKALVLLTFLADQGINARVLEEKKMGYSIRRNELDGSFRRDAVAESL  416

Query  409   RVVMVEEHG  383
             ++V+V E G
Sbjct  417   KLVVVGEEG  425



>ref|XP_002325254.2| hypothetical protein POPTR_0018s13720g [Populus trichocarpa]
 gb|EEF03819.2| hypothetical protein POPTR_0018s13720g [Populus trichocarpa]
Length=420

 Score =   431 bits (1109),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 240/462 (52%), Positives = 308/462 (67%), Gaps = 55/462 (12%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             SS LHI M PWLAFGH+IPYLELAKL+A++G+KI F+STPRN  RLPKLHP + P I  +
Sbjct  4     SSKLHIAMFPWLAFGHMIPYLELAKLIAQKGHKISFISTPRNTDRLPKLHPSISPLITFV  63

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP-DWVIHDFASFR  1310
              L LPQVENL +DAE+T D+PYDKV+YLK A D+L++ ++ FL+T    D ++  FA + 
Sbjct  64    KLSLPQVENLSKDAEATADVPYDKVQYLKQACDDLKEPLSKFLETCDDLDCILFYFAPYW  123

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L  I   L IPSV+FSIFTA++ +   P S    G+D   +P+  T  PKWV F T ++ 
Sbjct  124   LPDIATSLGIPSVFFSIFTAAMLSYVKPAS----GIDDRSKPEDFTIPPKWVTFPTNVVF  179

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R FE+ R+F    + G  VSDLYR    +KG   + VRSC E EPEWLQL EE+ GKP I
Sbjct  180   RLFEVLRIFYQT-LAGNVVSDLYRTQEGIKGCDMIAVRSCMEFEPEWLQLLEEIHGKPVI  238

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             PVG+L TT                                                 LGL
Sbjct  239   PVGVLATT-------------------------------------------------LGL  249

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             ELS LPFFWV RK RGSAD E+ +LPEGFEER++ +G++ TSWAPQLKIL+HDSVGGFLT
Sbjct  250   ELSGLPFFWVLRKHRGSADTELIELPEGFEERSKAQGLVWTSWAPQLKILAHDSVGGFLT  309

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             HSGWSSVVEAL+  + LI+  FL DQGI  R+L +K+MGY+I R+E +G F+RDSVAESL
Sbjct  310   HSGWSSVVEALQHARALILLTFLADQGINARVLEDKKMGYSIPRNEKNGYFTRDSVAESL  369

Query  409   RVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             R+VM +E GK++ +KVK+MK    +K++QD YV+KL+D+L +
Sbjct  370   RLVMEKEEGKIYRDKVKEMKPLFADKDRQDKYVDKLVDHLRS  411



>gb|EYU30925.1| hypothetical protein MIMGU_mgv1a005472mg [Erythranthe guttata]
Length=482

 Score =   433 bits (1114),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 231/484 (48%), Positives = 319/484 (66%), Gaps = 13/484 (3%)
 Frame = -3

Query  1687  FSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHL  1508
              +A   E  +LHIVM PWLAFGHIIPYLEL+KL+A +G+KI FVSTPRNI RLPKL PHL
Sbjct  1     MAAAKEEHKSLHIVMFPWLAFGHIIPYLELSKLIALKGHKISFVSTPRNIDRLPKLPPHL  60

Query  1507  VPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIH  1328
               +I+L+ +PLP+++ LPE+AE+T+D+   ++ YLKIAFD L+  + +FL+   PDW+I 
Sbjct  61    SSSIELVKIPLPKLDELPENAEATMDINGGQMDYLKIAFDGLESGLTSFLEDSDPDWIIC  120

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSA-VIDGVDSPVEPKHTTSKPKWVP  1151
             DFA   L PI  +L I   +F IF A   A F P +  +I G D   + +     PKWV 
Sbjct  121   DFAPHWLPPIAARLGISRAFFLIFNAWFLAFFGPGAEDMISGSDYRTKREDYMVPPKWVE  180

Query  1150  FETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             FET +  R FE   +      +G   SD+YR+G  + G  A+  R C+E EP+WL L EE
Sbjct  181   FETEVAYRGFEANWMVGSGQTNGSGYSDIYRVGKVIVGCEAILARHCHEFEPDWLTLLEE  240

Query  970   VVGKPTIPVGLL-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
             +  +P  P+GL+ P    D ++DD  +  W+ IK+WLD Q KGSVVYVA GSE  P+Q++
Sbjct  241   LHRRPVFPLGLMPPRLPQDGKKDDSDEEIWVSIKKWLDVQNKGSVVYVALGSEVIPSQDQ  300

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVT-KLPEGFEERTRGRGVICTSWAPQLKILS  617
             + E+A GLELS +PFFWV RK  G  +++ + +LP+GFEER  GRG++  SW PQLKILS
Sbjct  301   LSELAHGLELSGVPFFWVLRKPSGLTESDDSVELPDGFEERVNGRGIVWRSWVPQLKILS  360

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             HDSVGGFLTH GWSS+VE L F   LI  PFL DQG+ +R++ EK++G  I R+E +GS+
Sbjct  361   HDSVGGFLTHCGWSSIVEGLMFGHPLITLPFLVDQGLNSRVIAEKQVGVEIPRNEENGSY  420

Query  436   SRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPSG  257
             + +SVA+S+++VM+E  GK F E+ K++ A   + E    Y++  + +L          G
Sbjct  421   TSNSVADSVKLVMLENDGKRFRERAKEIGAIFGDTELHGRYIDNFIKFL----------G  470

Query  256   SHKN  245
              H+N
Sbjct  471   HHRN  474



>ref|XP_004151488.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
 ref|XP_004160943.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Cucumis sativus]
 gb|KGN48690.1| hypothetical protein Csa_6G497890 [Cucumis sativus]
Length=468

 Score =   431 bits (1107),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 229/470 (49%), Positives = 325/470 (69%), Gaps = 10/470 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNI  1496
             ++   LHIVMLPW AFGH+IP+LEL+KL+A++G+++ FVSTP+NI RLP +L PHL P +
Sbjct  2     ADDKKLHIVMLPWFAFGHMIPFLELSKLIAQKGHRVSFVSTPKNIDRLPAQLPPHLSPFL  61

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
               I +P+PQ+ N P DAE+T+DLPYDK+ +LK AFD L+  ++ FL+T   D +++DF  
Sbjct  62    SFIKIPMPQLHNFPPDAEATIDLPYDKIPFLKEAFDALKQPLSDFLRTSDADCILYDFFP  121

Query  1315  FRL-VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             + +   I   L I + +FSIF     A   P S      D   + +  T  P W+PF +T
Sbjct  122   YWIGQEIGPNLGIKTAFFSIFIPETLAFIGPMSPR----DHRKKVEDFTVPPDWIPFPST  177

Query  1138  IMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
             +  R++EM+++F++A       +SDL R+ +    +  + +++C E   EW+QL  ++ G
Sbjct  178   VALRHYEMKKIFDEAVAGKSTGISDLDRIKLGAHNSDFIVLKACPEFGQEWIQLVGDLHG  237

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             K   P+G LPT+ YD  +D+     W  IKEWLDKQ   SVVYVAFGSE KP+Q+E+ EI
Sbjct  238   KTVFPIGQLPTSEYDCGDDNQA---WQSIKEWLDKQPVASVVYVAFGSEAKPSQDELTEI  294

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             A GLE S+LPFFWV R + G +D+ VT+LPEGFEERT+GRG++  +WAPQLKIL H+SVG
Sbjct  295   AFGLEKSELPFFWVLRTRAGLSDSNVTELPEGFEERTKGRGIVWNTWAPQLKILGHESVG  354

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH+GWSS VEA++ EK +I  PFL DQGII R+L EK++GY I R+  DGSF+RDSV
Sbjct  355   GFLTHAGWSSSVEAIQSEKAMIFLPFLVDQGIIARILEEKKVGYCIPRNLLDGSFTRDSV  414

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTI  272
              ESL++VMVE+ GK++ EK+K++KA    KE+ +  +++ L YL +   +
Sbjct  415   EESLKLVMVEDEGKIYREKIKELKAIFVNKERDERLIDQFLSYLKSHRKV  464



>gb|KCW59686.1| hypothetical protein EUGRSUZ_H02446 [Eucalyptus grandis]
Length=437

 Score =   429 bits (1102),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 233/471 (49%), Positives = 303/471 (64%), Gaps = 42/471 (9%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA    +LHIVMLPWLAFGH++PYL+LAKL+A +G++I F+S PRNI R+PK    L   
Sbjct  1     MAETRDSLHIVMLPWLAFGHMMPYLKLAKLMAGKGHRISFLSAPRNIDRIPKPPSDLASL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + LPLP VE+LPE AE+T DLPY+K++YLK ++D LQ+ +A FL++  PDW+++DFA
Sbjct  61    ISFVKLPLPAVEHLPEGAEATSDLPYNKIQYLKKSYDMLQEPVAQFLESSDPDWIMYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              +    I  +L I SV+FSI T +      P                             
Sbjct  121   PYWAGSIASRLGIRSVFFSIMTGACLGFLGP-----------------------------  151

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
                       +F+    +   V+DLYR G   +    + +RS YE+EPEWL L +++  K
Sbjct  152   ----------IFDAVIGNASGVTDLYRFGAGQESCDIIALRSSYEVEPEWLSLLKDIHTK  201

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P  PVG LP     D E   +  +W  IKEWLD Q+KG+VVYVAFGSE KP+Q E+ EIA
Sbjct  202   PIFPVGQLPPR---DPETRGEIDSWRSIKEWLDSQKKGTVVYVAFGSEAKPSQIELTEIA  258

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLELS LPFFWV + + GS+D E   LP GFEER +GRGV+  SW PQLKIL HDSVGG
Sbjct  259   LGLELSGLPFFWVLKTRLGSSDTESVVLPNGFEERVKGRGVVWDSWVPQLKILEHDSVGG  318

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH+GWSSVVEAL FE+ LI+  FL DQG+  R L E+++GY I R+E+DGS +R SVA
Sbjct  319   FLTHAGWSSVVEALSFERALILFTFLADQGLNARFLEERQIGYPIPRNESDGSVTRQSVA  378

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             ESLR+VMVEE G+V+ EK K+M+    +K  Q+ YVN LL+YL     + H
Sbjct  379   ESLRLVMVEEKGRVYREKAKEMRPIFGDKNVQERYVNNLLNYLKEHRPVKH  429



>gb|KDP29791.1| hypothetical protein JCGZ_18726 [Jatropha curcas]
Length=465

 Score =   428 bits (1101),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 224/462 (48%), Positives = 314/462 (68%), Gaps = 7/462 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +E   LHIV+ PWLAFGHIIP+LELAKLLA+RG+KI F+STP+NIQRLPK+ P+L   + 
Sbjct  2     NEPKKLHIVLFPWLAFGHIIPFLELAKLLAKRGHKISFISTPKNIQRLPKIPPNLANLVH  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
             L+ L LP  ++LP ++E+T D+P  KV YLK A+D LQ  +  FL+T +PDW+I+DFA F
Sbjct  62    LVTLTLPSEDHLPPNSEATTDIPTHKVPYLKKAYDNLQCPLLQFLETSTPDWIIYDFAPF  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              L  I   L I S +FSI+       F   SA+I+G D   +P+  T  PKWVPF + + 
Sbjct  122   WLPRITADLGISSAFFSIYGGWSLTFFGSSSAMINGDDLRTQPEDFTVPPKWVPFPSKVA  181

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R  E ++  +   ++    SD++RLG  + G   + +RSC+ELE ++L+L E++ GKPT
Sbjct  182   FRLHEAKKALSHVQVNDSGCSDMFRLGSVMAGCDVIAIRSCFELEGDFLRLVEQLHGKPT  241

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             +P GLLP +  D + + ++   W  I +WL+ Q KGSVVY+AFGSE + +Q+E+ E+A G
Sbjct  242   LPTGLLPPS--DPDVNGEEDETWRIISQWLNSQNKGSVVYIAFGSEVEVSQQELTELAFG  299

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS LPFFW  R +  S       LP  FEER +GRG++  +W PQL+ILSH+SVGG L
Sbjct  300   LELSGLPFFWTLRIKDNS-----LGLPNEFEERVQGRGLVWKTWVPQLRILSHESVGGIL  354

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH G+SS++EAL F + LIM P   DQG+I R+  EK++G  I RDE DGSF+RDSVAES
Sbjct  355   THCGYSSIIEALYFGRALIMLPIALDQGLIARVFEEKKVGVEITRDEQDGSFTRDSVAES  414

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             LR+VMV++ GK + +  K+M+  L +K+  D YV++ ++ L 
Sbjct  415   LRLVMVDKEGKEYRDAAKEMRELLADKDLHDRYVDRFVELLQ  456



>ref|XP_008236324.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Prunus mume]
Length=463

 Score =   428 bits (1100),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 232/468 (50%), Positives = 309/468 (66%), Gaps = 17/468 (4%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M S    LHI M PWLAFGH+IPYLELAKL+A+ G++I F+STPRNI+RLP+L P L  +
Sbjct  1     MDSSDQKLHIAMFPWLAFGHMIPYLELAKLIAQEGHQISFISTPRNIERLPQLPPILSSS  60

Query  1498  -IDLIGLPLPQVEN-LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
              I  + LPLP+V++  PE AE+T D+  +KV  LK  +D LQ  +  FL++ +PDW++ D
Sbjct  61    LITFVKLPLPRVDDDFPEAAEATTDVSQNKVMKLKKVYDALQQPLTHFLESSNPDWLLFD  120

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFE  1145
             FA++        L IP  +FSIF  +  A   P S  I   D    P+  T  PKWVPF 
Sbjct  121   FAAYWAPTTARNLGIPCAFFSIFIGACLAFVGPTSPEI-SPDDRKNPEDYTVPPKWVPFP  179

Query  1144  TTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
             + +    FE+ RV+ D    D  NVSD+YR    ++G   + +R C E +PEWL+L +++
Sbjct  180   SNVAFHLFEVHRVYLDTITGDESNVSDIYRFMEGMRGCDVIAIRDCMEFDPEWLRLLQDI  239

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP +PVG LPTT +++ +       W  + EWLD+Q K SVVYVAFGSE  P+QEE+ 
Sbjct  240   HRKPVLPVGQLPTTNHEENDR------WGSMSEWLDRQPKASVVYVAFGSEAMPSQEEIT  293

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
              IALGLELS+LPF WV R         V KLP+GFEER  GRG++C SWAPQLKIL HDS
Sbjct  294   TIALGLELSELPFIWVLR-------TNVVKLPQGFEERIGGRGLVCRSWAPQLKILGHDS  346

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VG FL+HSGWSSVVEAL F + L++     DQG+  RLL E+++GY I RDE DGSF+ D
Sbjct  347   VGVFLSHSGWSSVVEALSFGRALVLLTMSNDQGLNARLLEERKIGYCIPRDEEDGSFTSD  406

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SVAESL++V+  E GK++ +K K++K    +++KQD YV+  L+YL A
Sbjct  407   SVAESLKLVIEMEEGKIYRDKAKELKPLFGDRKKQDTYVHNFLEYLKA  454



>ref|XP_004240255.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Solanum 
lycopersicum]
Length=469

 Score =   428 bits (1100),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 222/472 (47%), Positives = 305/472 (65%), Gaps = 7/472 (1%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             ++ LHIVM PWLAFGHIIPYLEL+KL+A++G+KI F+STPRNI RLPKL      +I L+
Sbjct  2     TNKLHIVMFPWLAFGHIIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPLEYSTSITLV  61

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
              +PLP V+ LPE+AE+T+D+    + YLK A D ++  + +FL+  SPDW+IHDFA + L
Sbjct  62    KIPLPHVDGLPENAEATMDIHTKDIVYLKKALDGMELQLTSFLEKTSPDWIIHDFAPYWL  121

Query  1306  VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDG-VDSPVEPKHTTSKPKWVPFETTIMP  1130
              PI  +L I   +F +  A   A +     ++ G  D P  P+     PKW+PFET  + 
Sbjct  122   APITTRLRIARGFFRVINAWFLAFWGSTDMMLTGYTDPPPTPEDLMVMPKWIPFETKAVF  181

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R+ E + V +    +   VSD+YR G T+K    V +R CYE E +WL+L E++  +P +
Sbjct  182   RHHEAKWVVDAMQKNVSGVSDIYRAGATIKDVDVVIIRHCYEFEGQWLKLLEDLHHRPIV  241

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             PVGL+P +     ++ D    W  IK WLD+Q KGSVVYVA GSE      E+ E+A GL
Sbjct  242   PVGLMPPS----LDNSDNNGTWTCIKGWLDEQTKGSVVYVALGSEVTIGPREINELAYGL  297

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             ELS +PFFWV RK   S   +  +LP+GFEERT GRG++  SW PQLKILSH SVGGFLT
Sbjct  298   ELSGVPFFWVLRKLSNSGHMDYVELPDGFEERTHGRGIVWKSWVPQLKILSHKSVGGFLT  357

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             H GWSS++E L F   LIM PFL DQG+  R+L +KE+G  I R+E DGS++RDSV+ S+
Sbjct  358   HCGWSSIIEGLMFGHPLIMLPFLVDQGLNARVLEDKEIGIEIPRNEEDGSYTRDSVSSSV  417

Query  409   RVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL--HAASTIHHPS  260
             ++VMVE+ G+   E+ +++ +    K   D Y+  L+ +L  H   +  H S
Sbjct  418   KLVMVEKDGRRIREEAREISSIYGNKRLHDKYIEDLIQFLEDHRKMSYGHSS  469



>gb|KDP29789.1| hypothetical protein JCGZ_18724 [Jatropha curcas]
Length=473

 Score =   428 bits (1100),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 232/467 (50%), Positives = 321/467 (69%), Gaps = 10/467 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +E   LH+   PWLAFGH+IP+LELAK +A++G+KI F+STPRNIQRLPK+ P+L  NI+
Sbjct  2     TEPKRLHVAFFPWLAFGHMIPFLELAKRIAQKGHKISFLSTPRNIQRLPKIPPNLSSNIN  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              I LPLPQV+NLP DAE+T+DLP+DK+RYL++A+D L+D +  FL+T +P+WVI+D   +
Sbjct  62    FISLPLPQVDNLPPDAEATIDLPFDKIRYLRMAYDSLKDPLVQFLETSTPNWVIYDCFPY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
              L PI+  L I S +FSIF   ++     P  A+IDG DS   P+  T  PKW+PF + +
Sbjct  122   WLPPILADLGISSAFFSIFGGWTLTFWASPSLAMIDGDDSRFHPEDFTVPPKWIPFPSKV  181

Query  1135  MPRNFEMERVFNDAYIDGGNV-SDLYRLGVTVKGASA--VFVRSCYELEPEWLQLAEEVV  965
               R  E +R+ +   +D   +   ++R  V+   AS+  + +RSC+ELE ++L+L  E+ 
Sbjct  182   AYRLHEAKRIPHRFEVDKSGIPKHIFRSSVSSVMASSDIIAIRSCFELEADFLRLVRELH  241

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
             GKP  PVGLLP      + + D+   WL+I++WLDKQEKGSVVY+AFGSE   +Q E  E
Sbjct  242   GKPVFPVGLLPPLTL--DGNGDEDDTWLKIRDWLDKQEKGSVVYIAFGSEVDLSQNEFTE  299

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             +ALGLELS LPFFW  RK R    AE   LP+GFEER  GRG+  TSW PQ +ILSH+SV
Sbjct  300   LALGLELSGLPFFWASRK-RNDYSAE---LPDGFEERVEGRGMFWTSWVPQPRILSHESV  355

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTH G+SS+++AL   + LIM P   D G+I R+  +K++G  I RDE DGS++RDS
Sbjct  356   GGFLTHCGFSSIIDALYSGRALIMLPITFDHGLIARVFEDKKVGVEITRDEEDGSYTRDS  415

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             VA+S+++VMVEE GK++ E  K+M      KE  D Y+++ ++ L  
Sbjct  416   VADSVKLVMVEEEGKLYRENAKEMSKLFANKELHDRYIDQFVELLQT  462



>ref|XP_002270331.2| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=481

 Score =   425 bits (1093),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 227/468 (49%), Positives = 299/468 (64%), Gaps = 9/468 (2%)
 Frame = -3

Query  1690  QFSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPH  1511
             Q S+   +   LHIVM PWLAFGHI+PYLEL+KL+A+ G++I F+STPRNI+RLPKL P+
Sbjct  12    QASSAMDDPEKLHIVMFPWLAFGHILPYLELSKLIAQEGHRISFISTPRNIERLPKLPPN  71

Query  1510  LVPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVI  1331
             L P IDL+  PLP  +NLPE+AE+T DLPY  + YLK AFD LQ+ +  FL+T  PDWVI
Sbjct  72    LQPLIDLVKFPLPNDDNLPENAEATTDLPYGNIPYLKKAFDGLQEPVTRFLETSHPDWVI  131

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVP  1151
             HDFA   L PI  K  +   +F IF+A+        S +++G D   E     + P WV 
Sbjct  132   HDFAPHWLPPIAAKHGVSRAFFCIFSATALCFGGSTSIMMEGGDPRTELHQFAAPPPWVT  191

Query  1150  FETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             F T +    F + R  +    +   VSD +R+G  + G   + +RSC ELEPEWL L  +
Sbjct  192   FPTKVALPLFLLRRSLDHDQANVSGVSDSFRMGSAILGCDVLAIRSCTELEPEWLDLLGK  251

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP  P+GLLP +A      +    +W  IKEWLDKQEK  VVYVA G+E  P ++E+
Sbjct  252   LHQKPLFPIGLLPPSA----PVNGDDDSWPPIKEWLDKQEKECVVYVALGTEVTPTEDEL  307

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              E+A GLELS LPFFW  RK+  + D     LP+ FEERT+GRG++  SWAPQL+IL HD
Sbjct  308   TELAFGLELSGLPFFWALRKRHDAVD-----LPDRFEERTKGRGMVWRSWAPQLRILDHD  362

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             SVGGF+TH GWSSV+E L F + LIM P   DQG+  R   E ++G  I RD+ +   SR
Sbjct  363   SVGGFVTHCGWSSVIEGLHFGQALIMLPLWGDQGVNARTFEEMKVGVEIPRDQEEERLSR  422

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
              SVAE+L +VMVEE GK++  K K+M   L +K +   YV+  ++YL 
Sbjct  423   KSVAETLSLVMVEETGKIYRNKAKEMSKLLGDKHRHHRYVSDFVEYLQ  470



>ref|XP_002532389.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30001.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=433

 Score =   423 bits (1088),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 234/465 (50%), Positives = 303/465 (65%), Gaps = 41/465 (9%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M +  S LHI M PWLAFGH+IP+LE AKLLAE+G                         
Sbjct  1     MENGDSNLHIAMFPWLAFGHMIPWLEFAKLLAEKG-------------------------  35

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
                          LP +AE+T+DLP  KVR+LK A D LQ  M   L++L+PDWV+ DFA
Sbjct  36    -------------LPPNAEATMDLPPSKVRHLKKAVDMLQQPMTHLLESLAPDWVLFDFA  82

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              + +  +  KL I S +F+I TA++ A   P S +I+G D   + +  T  PKWV F +T
Sbjct  83    PYWIPSVAAKLGIKSAFFTICTATMVAFLGPSSLLINGDDDRKKLEDFTVPPKWVTFPST  142

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             I  R ++++  F+ A  +   VSD  R G  +K +  + VRSC E EPEWL+L E +  K
Sbjct  143   IAYRYYDIKNTFDCAEDNISGVSDFLRWGWCLKSSDIIMVRSCSEFEPEWLELLESIHQK  202

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
                PVG LP TA    E DDK  +W  IK+WLD QEKGSVVYVAFGSE KP+QE++ E+A
Sbjct  203   RVFPVGQLPPTA---CETDDKTDSWRWIKDWLDMQEKGSVVYVAFGSEAKPSQEQLTELA  259

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LG+ELS +PFFWV R +RG AD E+T+LP GFEERT+GRGV+ TSWAPQLKIL+H+S GG
Sbjct  260   LGIELSGMPFFWVIRNRRGVADTELTELPPGFEERTKGRGVVWTSWAPQLKILAHESTGG  319

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTHSGWSSVVEAL F + LI+  F  DQGI  R+L EK++GY+I R+E DGSF R+SVA
Sbjct  320   FLTHSGWSSVVEALMFGRALILLTFYADQGINARVLEEKKIGYSIPRNEFDGSFKRNSVA  379

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             ES+++VMV E GK++ +K K+M     ++ +QDNYVN +L YL  
Sbjct  380   ESVKLVMVSEEGKIYRDKAKEMSGLFGDRARQDNYVNNILSYLKG  424



>ref|XP_007205156.1| hypothetical protein PRUPE_ppa005394mg [Prunus persica]
 gb|EMJ06355.1| hypothetical protein PRUPE_ppa005394mg [Prunus persica]
Length=463

 Score =   424 bits (1090),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 229/468 (49%), Positives = 311/468 (66%), Gaps = 17/468 (4%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M S    LHI M PWLAFGH+IPYLELAKL+A++G++I F+STPRNI+RLP+L P+L  +
Sbjct  1     MDSSDQKLHIAMFPWLAFGHMIPYLELAKLIAQKGHQISFISTPRNIERLPQLPPNLSSS  60

Query  1498  -IDLIGLPLPQVEN-LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
              I  + LPLP+V++  PE AE+T D+  +KV  LK  +D LQ  +  FL++ +PDW++ D
Sbjct  61    LITFVKLPLPRVDDDFPEGAEATTDVSQNKVMKLKKVYDALQQPLTHFLESSNPDWLLFD  120

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFE  1145
             FA++        L IP  +FSIF  +  A   P S  I   D    P+  T +PKWVPF 
Sbjct  121   FAAYWAPTTARNLGIPCAFFSIFIGACLAFLGPTSPEI-SPDDRKNPEDYTVQPKWVPFP  179

Query  1144  TTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
             + +    FE+ RV+ D+   D  NVSD+YR    +KG   + +R C E + +WL+L +++
Sbjct  180   SNVAFHLFEVHRVYLDSTTGDESNVSDVYRFMGGMKGCDVIAIRGCMEFDLKWLRLLQDI  239

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP +PVG LPTT Y++ +       W  ++EWLD+Q K SVVYVAFGSE  P+QEE+ 
Sbjct  240   HRKPILPVGQLPTTNYEENDR------WGSMREWLDRQLKASVVYVAFGSEAMPSQEEIT  293

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
              IALGLELS+LPF WV R         V KLPEGFE+R  GRG++C SWAPQLKIL HDS
Sbjct  294   TIALGLELSKLPFIWVLR-------TNVVKLPEGFEKRMGGRGLVCRSWAPQLKILGHDS  346

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VG FL+HSGWSSVVEAL F + L++     DQG+  R L E+++ Y I RDE DGSF+ D
Sbjct  347   VGVFLSHSGWSSVVEALTFGRALVLLTMSNDQGLNARFLEERKIVYCIPRDEEDGSFTSD  406

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SVAESL++V+  E GK++ +K +++K    +++KQD YV+  L+YL A
Sbjct  407   SVAESLKLVIEMEEGKIYRDKAEELKPLFGDRKKQDAYVHNFLEYLKA  454



>ref|XP_009364807.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Pyrus 
x bretschneideri]
Length=476

 Score =   424 bits (1091),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 307/457 (67%), Gaps = 4/457 (1%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI + PWLAFGHIIP LE+AK +A+RG+K+ F+STPRNIQRLPK+ P+L P IDL+ +P
Sbjct  16    LHIALFPWLAFGHIIPALEVAKHIAQRGHKVSFISTPRNIQRLPKIPPNLTPLIDLVQIP  75

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP+VENLPE+AE+T+D+PYD + YLK+A D L+  + +FLQT +PDW+I+DFA + L PI
Sbjct  76    LPRVENLPENAEATMDVPYDLIPYLKLAHDGLEQGITSFLQTHTPDWIIYDFAPYWLPPI  135

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSP-VEPKHTTSKPKWVPFETTIMPRNF  1121
                L I    F  F       F P    +    SP   P+H T  P+W+PF + +  R F
Sbjct  136   ASNLGISRAMFGGFNTYTGCAFGPTLPDVLSRYSPRTLPEHFTVPPEWIPFPSKLFFRLF  195

Query  1120  EMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVG  941
             E +++F+    +   +SD +R+   ++G+     RSC E+E  WL L  E+  KP IPVG
Sbjct  196   EAKKLFDALEHNASGISDWFRMKSAIEGSQVCLFRSCREIEGAWLDLVPELYRKPAIPVG  255

Query  940   LLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELS  761
             LLP +    + +D + ++W  + +WLDKQE+ +VVYVA GSE  P QEE  E+ALGLELS
Sbjct  256   LLPPSV--QDTEDKEDSSWSIVCQWLDKQERATVVYVALGSEINPTQEEFTELALGLELS  313

Query  760   QLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSG  581
              LPFFW  R   GS      KLP+ FE+R++GRG++  +WAPQ +IL+H +VGGFLTH G
Sbjct  314   GLPFFWALRTPNGSTPGNSVKLPDEFEDRSKGRGLVWRTWAPQRQILAHKAVGGFLTHCG  373

Query  580   WSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVV  401
             WSS++E L     LIM PFL DQG+  RL  ++++G  + R++ DGSF++++VAESL +V
Sbjct  374   WSSLIEGLHCGIPLIMFPFLYDQGLNARLW-DRKVGIEVPRNDEDGSFTKNAVAESLNLV  432

Query  400   MVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             MV+E GK + +  K+  A + +K+  D Y++K ++Y 
Sbjct  433   MVDEEGKAYRDGTKEYSAVIGDKDLHDRYMDKCVEYF  469



>ref|XP_004288503.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=477

 Score =   424 bits (1091),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 225/469 (48%), Positives = 317/469 (68%), Gaps = 5/469 (1%)
 Frame = -3

Query  1684  SAMASE-SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHL  1508
             S ++SE    LHI + PWLAFGHIIP+LE+AK +A RG+K+ F+STPRNIQRLPK+   L
Sbjct  2     SFLSSEPKKQLHIALFPWLAFGHIIPFLEVAKHIARRGHKVSFISTPRNIQRLPKIPETL  61

Query  1507  VPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIH  1328
              P I L+ +PLP VENLP++AE+T+D+PYD + YLK+A D L+  ++ FLQ  +PDW+IH
Sbjct  62    TPLITLVQIPLPHVENLPDNAEATMDVPYDVIPYLKLAHDGLERGLSKFLQAQTPDWIIH  121

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEP-KHTTSKPKWVP  1151
             DFA   L PI  KL +   +FSIF AS    F   SA      +P +  +H T  P+WVP
Sbjct  122   DFAPHWLPPIATKLGVAIGHFSIFNASSLCFFGSTSADRASRYAPRKKLEHFTVPPEWVP  181

Query  1150  FETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             F + ++ R FE  R+  D    +   V+D +R+  TV+G    F+R+C E+E EWL L E
Sbjct  182   FPSKLVMRPFEAARILEDGRKPNASGVNDWFRMISTVQGCQVYFIRTCREVEGEWLDLLE  241

Query  973   EVVGKPTI-PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQE  797
             ++  KP + P GLLP      +ED++  + W  I +WLDKQEKG VVYVA GSE   +QE
Sbjct  242   DLHQKPVVLPTGLLPPFVPRSDEDEEGGSDWSRIADWLDKQEKGKVVYVALGSELNLSQE  301

Query  796   EVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
             E  E+ALGLELS LPFFWV RK    +D +   LP+GFEERT+ RG++  +W+PQ KIL+
Sbjct  302   EFNELALGLELSGLPFFWVLRKPSHVSDGDSVNLPDGFEERTKDRGLVWKTWSPQPKILA  361

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H+S+GGFLTH GWSS++EAL++ + LI+ PF+ DQG+I R   +K++G  ++RDE  G+F
Sbjct  362   HESIGGFLTHCGWSSLIEALQYGRPLILLPFMYDQGLIARFW-DKKIGIEVSRDEESGAF  420

Query  436   SRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +R+ +A+SL +V+V+E GK + +  K+      +KE    Y++K ++YL
Sbjct  421   TRNELAKSLNLVVVDEEGKPYRDGAKEYSELFGDKELHSRYMDKCVEYL  469



>ref|XP_008236334.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Prunus 
mume]
Length=473

 Score =   423 bits (1088),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 213/461 (46%), Positives = 308/461 (67%), Gaps = 6/461 (1%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   L I + PWLAFGHIIP+ E+AK +A RG+K+ F+STPRNIQRLPK+  HL P I+L
Sbjct  12    EPKKLQIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPKIPQHLTPLINL  71

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + +PLP VENLPE+AE+T+D+PY  + YLKIA D L+  ++ FL+T  PDW+IHDFA + 
Sbjct  72    VQIPLPCVENLPENAEATMDVPYHIIPYLKIAHDGLEQGISNFLRTHKPDWIIHDFAPYW  131

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAV-IDGVDSPVEPKHTTSKPKWVPFETTIM  1133
             L PI   L I   +FS+F AS    + P S   +D       P+  T   +W+PF + ++
Sbjct  132   LPPIASSLGISRAHFSVFNASSLCFYGPTSPQGLDRYGVRTLPEQFTVPAEWIPFPSNMV  191

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              ++FE + +F+    +  +VSD +R+  T++G    F+RSC E E  WL L +E+  KP 
Sbjct  192   LKSFEAKNLFDSMKQNASSVSDWFRVKSTIQGCQVYFIRSCRETEGAWLDLLQELQQKPV  251

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             +P GL+P       +  + K  W  I +WLDK++K +VVY+A GSE   +Q++  E+ALG
Sbjct  252   VPTGLMPPVV----QAREDKEDWSTIAQWLDKKQKATVVYIALGSELNLSQQDFTELALG  307

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS LPFFWV RK   S +    KLP+GFEERT+GRG++ T+WAPQ +IL+HDS+GGFL
Sbjct  308   LELSGLPFFWVLRKPSWSGNGGSGKLPDGFEERTKGRGLVWTTWAPQTQILAHDSIGGFL  367

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH G SS+VE L++ + L+M P L DQG+I R   +K++G  + R+E DGSFSR S+AES
Sbjct  368   THCGASSLVEGLQYGRPLLMLPCLYDQGLIARFW-DKKVGIEVPRNEEDGSFSRKSLAES  426

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             L +++V+E GK + +  ++      +K+  D Y++K ++Y+
Sbjct  427   LNLLVVDEAGKAYRDGAEEYSVLFQDKDLHDRYMDKCVEYM  467



>emb|CAN80742.1| hypothetical protein VITISV_015059 [Vitis vinifera]
Length=481

 Score =   424 bits (1089),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 226/468 (48%), Positives = 297/468 (63%), Gaps = 9/468 (2%)
 Frame = -3

Query  1690  QFSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPH  1511
             Q S+   +   LHIVM PWLAFGHI+PYLEL+KL+A+ G++I F+STPRNI+RLPKL P+
Sbjct  12    QASSAMDDXEKLHIVMFPWLAFGHILPYLELSKLIAQEGHRISFISTPRNIERLPKLPPN  71

Query  1510  LVPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVI  1331
             L P IDL+  PLP  +NLPE+AE+T DLPY  + YLK AFD LQ+ +  FL+T  PDWVI
Sbjct  72    LQPLIDLVKFPLPNDDNLPENAEATTDLPYGNIPYLKKAFDGLQEPVTRFLETSHPDWVI  131

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVP  1151
             HDFA   L PI  K  +   +F IF+A+        S +++G D   E     + P WV 
Sbjct  132   HDFAPHWLPPIAAKHGVSRAFFCIFSATALCFGGSTSIMMEGGDPRTELHQFAAPPPWVT  191

Query  1150  FETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             F T +    F + R  +    +   VSD +R+G  + G   + +RSC ELEPEWL L  +
Sbjct  192   FPTKVALPLFLLRRSLDHDQANVSGVSDSFRMGSAILGCDVLAIRSCTELEPEWLDLLGK  251

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP  P+GLLP +A      +    +W  IKEWLDKQEK  VVYVA G+E  P ++E+
Sbjct  252   LHQKPLFPIGLLPPSA----PVNGDDDSWPPIKEWLDKQEKECVVYVALGTEVTPTEDEL  307

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              E+A GLELS LPFFW  RK+  + D     LP+ FEERT+GRG++  SWAPQL+IL HD
Sbjct  308   TELAFGLELSGLPFFWALRKRHDAVD-----LPDRFEERTKGRGMVWRSWAPQLRILDHD  362

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             SVGGF+TH GWSSV+E L F + LIM P   DQG   R   E ++G  I RD+ +   SR
Sbjct  363   SVGGFVTHCGWSSVIEGLHFGQALIMLPLWGDQGXNARTFEEMKVGVEIPRDQEEERLSR  422

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
              SVAE+L +VMVEE GK++  K K+M   L +  +   YV+  ++YL 
Sbjct  423   KSVAETLSLVMVEETGKIYRNKAKEMSKLLGDXHRHHXYVSDFVEYLQ  470



>ref|XP_010646446.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Vitis vinifera]
Length=462

 Score =   423 bits (1087),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 227/458 (50%), Positives = 304/458 (66%), Gaps = 11/458 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHIVM PWLAFGHI+PYL+L+KL+A++G++I F+STPRNI RLPKL P L P I+LI LP
Sbjct  7     LHIVMFPWLAFGHILPYLQLSKLIAQKGHRISFISTPRNIDRLPKLPPILQPLINLIKLP  66

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP+V+NLPE+AE+T DLPY+K  YLK AFD LQ+ +  FL    PDWV+HDFA   L P+
Sbjct  67    LPKVDNLPENAEATTDLPYEKTPYLKKAFDGLQEPLTHFLINSHPDWVVHDFAPHWLPPV  126

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTS-KPKWVPFETTIMPRNF  1121
             +++  +   +FSI+ AS    F   ++++ G   P +  H  +  P WVPF + +    F
Sbjct  127   LDEHGVSRSFFSIYGAS-TLCFAGSTSIMLGSGDPRKELHQFAVPPPWVPFPSNLGLPPF  185

Query  1120  EMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVG  941
             +M+R+      +   VSD YR+G  +     V VRSC ELE EWL L  E+  KP +P+G
Sbjct  186   QMKRILGYDQPNLSGVSDSYRMGSVISACDVVAVRSCAELESEWLDLLRELYHKPVLPIG  245

Query  940   LLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELS  761
             LLP  A        +  +W+ I EWLDKQEK SVVYVA GSE  P ++E+ E+ALGLELS
Sbjct  246   LLPPLA----PVSGEDDSWIPILEWLDKQEKASVVYVALGSEATPREDELTELALGLELS  301

Query  760   QLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSG  581
              LPFFW  RK+  S +     LP+GFE+RT+ RGV+  +WAPQL+IL H+SVGGF+TH G
Sbjct  302   GLPFFWALRKRHDSVE-----LPDGFEDRTKDRGVVWRTWAPQLRILGHESVGGFVTHCG  356

Query  580   WSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVV  401
              SSV E L F + LIM P   DQGII +   E ++G  I RDE +G FS  SVA++L +V
Sbjct  357   LSSVXEGLYFGRALIMFPLWGDQGIIAKAFQEMKVGIEIPRDEEEGWFSSKSVAQTLSLV  416

Query  400   MVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             MVEE G+++ EK K++     +K+ Q  Y+N  ++YL 
Sbjct  417   MVEEEGRIYREKAKELSKLFGDKDLQQRYINDFVEYLQ  454



>ref|XP_004288528.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Fragaria vesca 
subsp. vesca]
Length=475

 Score =   423 bits (1088),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 228/462 (49%), Positives = 307/462 (66%), Gaps = 8/462 (2%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNI  1496
             +++ + LHI + PWLAFGH++PYLELAKL+A +G+KI F+STP+NI RLP L P L   I
Sbjct  13    SNKDTKLHIALFPWLAFGHMLPYLELAKLIAGKGHKISFISTPKNIDRLPPLPPKLSALI  72

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
               + +PL Q  NLPE AE+T DL  ++V +LKIA+D L++ +  FL++ +PDWV+ DFA 
Sbjct  73    TFVKIPLQQYPNLPEGAEATADLTEEQVFHLKIAYDSLREPITQFLKSSNPDWVLFDFAP  132

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
             + +  I   L I + +++I  A + A   P S  I   D  + P+  T  PKWV F TT+
Sbjct  133   YWVPEIARSLGIRTAFYTIVMAVVVAFLGPTSPEIPADDRKL-PEDYTVPPKWVSFSTTV  191

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R FE+ R+      D  NVS + R  V ++G   + VRSC E EPEWL L E + GKP
Sbjct  192   AWRLFEVLRLLKQITGDDTNVSVVQRFMVGLQGCDLIAVRSCAEFEPEWLNLLEVMHGKP  251

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +PVG+L T      + DD    W  IKEWLD+Q K +VVYVAFG+E  P QEE  EIAL
Sbjct  252   VLPVGVLSTMP----KTDDDDETWRSIKEWLDRQSKKTVVYVAFGTEAIPTQEEATEIAL  307

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLE S LPFFWV R + G    +  KLPEGFEER  GRGV+C SW PQLKIL+HDS G F
Sbjct  308   GLEKSGLPFFWVLRTKHGE---DAVKLPEGFEERNEGRGVVCRSWVPQLKILAHDSFGVF  364

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             L+HSGWSSVVEAL F + L++ P   DQG+  R   EK++GY + RDE+DGSF+ ++VAE
Sbjct  365   LSHSGWSSVVEALTFGRPLVLFPLSNDQGLNARYFGEKKVGYELPRDEHDGSFTSEAVAE  424

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             SLR+V+ +E G+V+ E  K++K    +++ Q+ Y++K L+YL
Sbjct  425   SLRMVIEKEEGRVYRETAKELKTLFGDRDLQNVYLDKFLEYL  466



>ref|XP_004289519.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Fragaria vesca subsp. vesca]
Length=480

 Score =   422 bits (1084),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 223/476 (47%), Positives = 314/476 (66%), Gaps = 7/476 (1%)
 Frame = -3

Query  1684  SAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLV  1505
             S  A++   LHI + PWLAFGH+IP+LE+AK +A RG+K+ F+STPRNIQRL K+  +L 
Sbjct  3     STSATKPQKLHIGLFPWLAFGHMIPFLEVAKHIARRGHKVSFISTPRNIQRLSKIPQNLT  62

Query  1504  PNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
             P I L+ +PLP+VENLPE AE+T+D+P D + YLKIA D L++ ++ FLQT +PDW+I+D
Sbjct  63    PLITLVQIPLPRVENLPEYAEATMDVPIDVIPYLKIAHDGLENGISEFLQTHAPDWIIYD  122

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSP-VEPKHTTSKPKWVPF  1148
             FA + L PI  KL I    F  F AS        +  +    +P  +P+  T  P+W PF
Sbjct  123   FAPYWLPPIAIKLGIKRAIFCTFNASTMCFLGSTAPEVTSRYAPRTKPEQYTVPPEWFPF  182

Query  1147  ETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
              + +  + FE +RV +     +   ++D +R+  T +G    F+RSC E+E EWL L ++
Sbjct  183   PSKLCFKPFEAKRVVDGLMTPNASGMTDWFRVESTYQGCQVYFIRSCREIEGEWLDLLQD  242

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP +P GLLP       ++D    +W  I EWLDKQ+KG VVYVAFGSE   +QEE 
Sbjct  243   LNQKPVVPTGLLPPPV-QTSDEDQHDNSWSRIAEWLDKQKKGEVVYVAFGSEINLSQEEF  301

Query  790   VEIALGLELSQLPFFWVYRK-QRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
              E+ALGLEL  LPFFWV RK    S D +  KLP+GFE+RT GRG++ T+WAPQ KIL+H
Sbjct  302   NELALGLELCGLPFFWVLRKPSHRSGDGDTVKLPDGFEDRTNGRGLVWTTWAPQQKILAH  361

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
             +SVGGFL+H GWSS++EAL++ + LIM PF+ DQG+I RL   K+ G  ++RDE  G F+
Sbjct  362   ESVGGFLSHCGWSSLIEALQYGRPLIMLPFMYDQGLIARLW-NKKTGIEVSRDEESGWFT  420

Query  433   RDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             RD +A S+ +V+V E GK + +  K+ +    +KE  D Y+++ ++YL + S  HH
Sbjct  421   RDELARSVNLVVVHEEGKPYRDGAKEYRELFRDKELHDRYMDECVEYLESYS--HH  474



>ref|XP_009801322.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
sylvestris]
Length=463

 Score =   419 bits (1077),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 223/463 (48%), Positives = 298/463 (64%), Gaps = 5/463 (1%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +E+  LH+V+ PWLAFGH+IP+ ELAK +A +G+K+ ++ST RNI RLPK    L  +I 
Sbjct  2     AETKKLHVVLFPWLAFGHLIPFFELAKQIARKGHKVSYISTSRNIDRLPKFSQKLNYSIH  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              + L LP  + LPE+AE+T D+P DKV+YLK AFD L+  +  FL+   PDW+I+DF  +
Sbjct  62    FVNLSLPLTKGLPENAEATKDVPLDKVQYLKKAFDGLESELTQFLEDSVPDWIIYDFTPY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              L PI  +L I   +FS F A  +  F P   VIDG     +P+  T  PKW+PF + I 
Sbjct  122   WLPPIAGRLGISRAFFSTFNAWSSVFFGPAKDVIDGNIQRTKPEDFTVPPKWIPFPSNIA  181

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R +E+ R F     +   VSD +R G +V G     VRSC ELE EWL L  E+  KP 
Sbjct  182   FRLYEINRYFGHGQENVSGVSDWHRFGESVSGCDVFLVRSCNELEREWLDLLPELHQKPI  241

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             +PVGLLP +    + + DK  AW  I  WL  Q K SVVYVA G+E  P+QEE+ E+A G
Sbjct  242   VPVGLLPPSV--QDTEGDKSYAWGFINNWLAMQRKKSVVYVALGTEATPSQEELTELAHG  299

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS LPFFW  RKQ    D  + KLPEGFEERT+ RG++  SWAPQL+IL HDSVG FL
Sbjct  300   LELSGLPFFWALRKQH---DFLLLKLPEGFEERTKTRGIVWMSWAPQLRILEHDSVGCFL  356

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH GW S++E L+F K L+M PFL DQ +  R L EK +G  I R+E DGS +R+SVAES
Sbjct  357   THCGWGSIIEGLQFGKPLVMLPFLGDQALNARCLEEKMVGLEIPRNERDGSLTRNSVAES  416

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             L++VM +E GK++ EK  +M+     ++  DNY++  ++++  
Sbjct  417   LKLVMNDEKGKIYWEKANEMRKIFGNRDLCDNYIDDFIEFVRT  459



>ref|XP_008338469.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Malus 
domestica]
Length=474

 Score =   419 bits (1078),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 217/457 (47%), Positives = 303/457 (66%), Gaps = 4/457 (1%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI + PWLAFGHIIP LE+AK +A+RG+K+ F+STPRNIQRLPK+ P+L P IDL+ + 
Sbjct  14    LHIALFPWLAFGHIIPALEVAKHIAQRGHKVSFISTPRNIQRLPKIPPNLTPLIDLVQIX  73

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP+VENLPE+AE+T+D+PYD + YLK+A D L+  + +FLQT +PDW+I+DFA + L PI
Sbjct  74    LPRVENLPENAEATMDVPYDLIPYLKLAHDGLEQGITSFLQTHTPDWIIYDFAPYWLPPI  133

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSP-VEPKHTTSKPKWVPFETTIMPRNF  1121
                L I    F  F       F P    +    SP   P+H T  P+WVPF + +  R F
Sbjct  134   ASNLGISRAMFGGFNTYTACAFGPTLPDVLSRYSPRTLPEHFTVPPEWVPFPSKLFFRLF  193

Query  1120  EMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVG  941
             E +++F+    +   +SD +R+   V+G+     RSC E+E +WL L  E+  KP IPVG
Sbjct  194   EAKKLFDALEHNASGISDWFRMKSXVEGSQVCLFRSCREIEGDWLDLVPELYHKPAIPVG  253

Query  940   LLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELS  761
             LLP +    + +D +  +W  + EWLDKQE+ +VVYVA GSE  P QEE  E+ALGLELS
Sbjct  254   LLPPSV--QDTEDKEDXSWSIVCEWLDKQERATVVYVALGSEINPTQEEFTELALGLELS  311

Query  760   QLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSG  581
              LPFFW  R   GSA     KLP+ FE+R +GRG++  +WAPQ +IL+H +VGGF TH G
Sbjct  312   GLPFFWALRTPNGSAAGNSVKLPDEFEDRNKGRGLVWRTWAPQRQILAHKAVGGFWTHCG  371

Query  580   WSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVV  401
             WSS++E +     LIM PFL DQG+  RL  ++++G  + R++ DGSF++  VAESL +V
Sbjct  372   WSSLIEGIHRGIPLIMFPFLYDQGLNARLW-DRKVGIEVPRNDEDGSFTKKEVAESLNLV  430

Query  400   MVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             MV+E GK + +  K+  A + +K+  D Y++K ++Y 
Sbjct  431   MVDEEGKAYRDGAKEYSAVIADKDLHDRYMDKCVEYF  467



>ref|NP_565540.4| UDP-glycosyltransferase 91A1 [Arabidopsis thaliana]
 sp|Q940V3.1|U91A1_ARATH RecName: Full=UDP-glycosyltransferase 91A1 [Arabidopsis thaliana]
 gb|AAK96560.1| At2g22590/T9I22.3 [Arabidopsis thaliana]
 gb|AAL36076.1| At2g22590/T9I22.3 [Arabidopsis thaliana]
 gb|AEC07325.1| UDP-glycosyltransferase 91A1 [Arabidopsis thaliana]
 gb|AHL38846.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=470

 Score =   419 bits (1076),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 225/471 (48%), Positives = 310/471 (66%), Gaps = 11/471 (2%)
 Frame = -3

Query  1690  QFSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHP  1514
              F     + + LH+VM PWLAFGH++PYLEL+KL+A++G+K+ F+STPRNI RL P+L  
Sbjct  3     NFKDNDGDGTKLHVVMFPWLAFGHMVPYLELSKLIAQKGHKVSFISTPRNIDRLLPRLPE  62

Query  1513  HLVPNIDLIGLPLPQVEN-LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDW  1337
             +L   I+ + L LP  +N LPED E+T D+P++ + YLKIA+D L+  +  FL++  PDW
Sbjct  63    NLSSVINFVKLSLPVGDNKLPEDGEATTDVPFELIPYLKIAYDGLKVPVTEFLESSKPDW  122

Query  1336  VIHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKW  1157
             V+ DFA F L PI  +L I + +FS F  +   I  P        +    P      PKW
Sbjct  123   VLQDFAGFWLPPISRRLGIKTGFFSAFNGATLGILKPPGFE----EYRTSPADFMKPPKW  178

Query  1156  VPFETTIMPRNFEMERVFND--AYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQ  983
             VPFET++  + FE   +F    A    GNV D++R+G  + G   +FVRSCYE E EWL 
Sbjct  179   VPFETSVAFKLFECRFIFKGFMAETTEGNVPDIHRVGGVIDGCDVIFVRSCYEYEAEWLG  238

Query  982   LAEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPN  803
             L +E+  KP IPVG+LP      +E  +    WL +K+WLD ++  S+VYVAFGSE KP+
Sbjct  239   LTQELHRKPVIPVGVLPPKP---DEKFEDTDTWLSVKKWLDSRKSKSIVYVAFGSEAKPS  295

Query  802   QEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKI  623
             Q E+ EIALGLELS LPFFWV + +RG  D E  +LPEGFEERT  RG++   W  QL+ 
Sbjct  296   QTELNEIALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRT  355

Query  622   LSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDG  443
             LSHDS+G  LTH GW +++EA++F K + M  F+ DQG+  R++ EK++GY I RDE +G
Sbjct  356   LSHDSIGLVLTHPGWGTIIEAIRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDETEG  415

Query  442   SFSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              F+++SVA SLR+VMVEE GKV+ E VK+MK    + ++QD YV+  L+YL
Sbjct  416   FFTKESVANSLRLVMVEEEGKVYRENVKEMKGVFGDMDRQDRYVDSFLEYL  466



>ref|XP_006360400.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Solanum tuberosum]
Length=471

 Score =   418 bits (1074),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 216/459 (47%), Positives = 299/459 (65%), Gaps = 5/459 (1%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             + LHIVM PWLAFGHIIPYLEL+KL+A++G+KI F+STPRNI RLPKL      +I L+ 
Sbjct  7     NKLHIVMFPWLAFGHIIPYLELSKLIAQKGHKISFISTPRNIDRLPKLPLEYSTSITLVK  66

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             +PLP V+ LPE+AE+T+D+    + YLK A D ++  + +FL+  SPDWVIHDFA + L 
Sbjct  67    IPLPHVDGLPENAEATMDIHTKDIVYLKKALDGMELELTSFLEKTSPDWVIHDFAPYWLA  126

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPV-EPKHTTSKPKWVPFETTIMPR  1127
             PI  +L I   +F +  A   A       ++ G  +P   P+     PKW+PFET +  R
Sbjct  127   PITTRLRISRGFFRVVNAWFLAFGGSTDMMLTGSSNPPPTPEDFMVTPKWIPFETKVAFR  186

Query  1126  NFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
             + E + V +    +   VSD+YR G T+K    V +R C E E +WL+L E++  +P +P
Sbjct  187   HHEAKWVVDAMQKNVSGVSDIYRSGATIKDVDVVIIRHCCEFESQWLKLLEDLYHRPIVP  246

Query  946   VGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLE  767
             VGL+P +     ++ D    W  IKEWLD+Q KGSVVYVA GSE      E+ E+A GLE
Sbjct  247   VGLMPPS----LDNSDNNGTWTCIKEWLDEQTKGSVVYVALGSEVTIGPSEINELAYGLE  302

Query  766   LSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
             LS + FFW  RK+  S + +  +LP+GFEER  GRG++  SW PQLK+LSH+SVGGFLTH
Sbjct  303   LSGVAFFWALRKRPYSGNMDYVELPDGFEERIHGRGIVWKSWVPQLKLLSHESVGGFLTH  362

Query  586   SGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLR  407
              GWSS++E L F   LIM PFL DQG+  R+L +KE+G  I R+E DGS++RDSV+ S++
Sbjct  363   CGWSSIIEGLMFGHPLIMLPFLVDQGLNARILEDKEIGIEIPRNEEDGSYTRDSVSSSVK  422

Query  406   VVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +VMVE+ G+   EK K++ +    +   D Y+  L+ +L
Sbjct  423   LVMVEKDGRKIREKAKEISSIFGNRRLHDKYIEDLIQFL  461



>ref|XP_009623232.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
tomentosiformis]
Length=466

 Score =   418 bits (1074),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 224/467 (48%), Positives = 301/467 (64%), Gaps = 5/467 (1%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +E+  LH+V+ PWLAFGH+IP+ ELAK +A +G+K+ ++ST RNI RLPKL   L  +I 
Sbjct  2     TETKKLHVVLFPWLAFGHLIPFFELAKQIARKGHKVSYISTSRNIDRLPKLSQKLNYSIH  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              + L LP  + LPE+AE+T D+P DKV+YLK AFD L+  +  FL    PDW+I+DF  +
Sbjct  62    FVNLSLPLTKGLPENAEATKDVPLDKVQYLKKAFDGLESELTQFLVDSVPDWIIYDFTPY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              L PI  KL I   +FS F A  +  F P   +IDG     +P+  T  PKW+PF + I 
Sbjct  122   WLPPIAGKLGISCAFFSTFNAWSSVFFGPAKDIIDGNVQRTKPEDFTVPPKWIPFPSNIA  181

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R +E+ R F     +   VSD +R   +V       VRSC +LE EWL L  ++  KP 
Sbjct  182   FRLYEINRFFGHGQENISGVSDWHRFRASVSDCDVFLVRSCNKLEREWLDLLPQLHQKPV  241

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             +PVGLLP +    + + DK+ AW  I  WL  Q + SVVYVA G+E  P+QEE+ E+A G
Sbjct  242   VPVGLLPPSV--QDTEGDKRDAWGFINNWLAMQREKSVVYVALGTEATPSQEELTELAHG  299

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS LPFFW  RKQ    D  + KLPEGFEERT+ RG++ TSWAPQL+IL HDSVG FL
Sbjct  300   LELSGLPFFWALRKQH---DFLLLKLPEGFEERTKNRGIVWTSWAPQLRILEHDSVGVFL  356

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH GW S++E LKF K L+M PFL DQ +  R L EK +G  I+R+E DGS +R+SVAES
Sbjct  357   THCGWGSIIEGLKFGKPLVMLPFLGDQALNARGLEEKMVGLEISRNEKDGSLTRNSVAES  416

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTI  272
             L++VM +E GK++ EK  +MK     ++  D Y++  ++YLH   ++
Sbjct  417   LKLVMNDEKGKIYWEKANEMKKIFGNRDLSDIYIDDFIEYLHKNKSL  463



>ref|XP_009800982.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
sylvestris]
Length=489

 Score =   418 bits (1075),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 221/467 (47%), Positives = 302/467 (65%), Gaps = 4/467 (1%)
 Frame = -3

Query  1681  AMASESST--LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHL  1508
             A   E +T  LH+VM PWLAFGHIIP+LEL+K +A++G+KI F+STP+NI RLPKL    
Sbjct  11    ANGDEGNTDKLHVVMFPWLAFGHIIPFLELSKFIAQKGHKISFISTPKNIDRLPKLPLEF  70

Query  1507  VPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIH  1328
               +I  + +PLP+V+ LPE+AE+T+D+  +++ YLK A D ++  +  FL+  SPDW+I 
Sbjct  71    SNSITFVKIPLPKVDGLPENAEATMDITTEEIIYLKKAMDGMEKEVTKFLEKNSPDWIIQ  130

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSKPKWVP  1151
             DFA + L PI  KL I  +++ I  A   A F     +++    +P   +     PKW+P
Sbjct  131   DFAQYWLAPISAKLGISRIFYCIINAWFIAFFGSTENMVNTNSGTPPTVEDFLVPPKWIP  190

Query  1150  FETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             FET    R  E   +   +  +   VSDLYR GVT+ GA A   R CYE E +WL+L E+
Sbjct  191   FETKAAYRRHEARWMVGSSQKNVSGVSDLYRNGVTMTGADATIFRHCYEFEGQWLKLLED  250

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +   P IP GL+P     + +D+    +W+ IKEWLD++ KGSVVYVA GSE      ++
Sbjct  251   LHNIPMIPSGLMPPMV-KNIDDEKNNQSWMSIKEWLDEKPKGSVVYVALGSEVTIGLNDI  309

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              E+ALGLELS+ PFFWV RK   S + +  +LPEGFEER +GRG++  SWAPQL ILSHD
Sbjct  310   NELALGLELSRSPFFWVLRKPSKSGNTDPIELPEGFEERIKGRGIVWKSWAPQLNILSHD  369

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             SVGGFLTH GWSS++E L F   LIM PFL DQG+  R+L +K +G  I R+E DGS++ 
Sbjct  370   SVGGFLTHCGWSSIIEGLMFGHPLIMLPFLVDQGLNARILEDKGVGVEIPRNEEDGSYTS  429

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             DSVA S+ +VMVE  GK+  EK K+M +    K   D Y+  L+++L
Sbjct  430   DSVANSVNLVMVENEGKIIREKAKEMISIFGNKNLHDKYIENLIEFL  476



>emb|CDP01583.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   417 bits (1072),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 222/463 (48%), Positives = 311/463 (67%), Gaps = 6/463 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA+E+  LH+V+ PWLAFGH+IP+LELAK +A++G+++ +VSTPRN+ RLPK+   L+  
Sbjct  1     MAAEAKKLHVVVFPWLAFGHMIPFLELAKSIAQKGHRVTYVSTPRNVDRLPKIPSTLISQ  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             ++ + LPLPQ+ NLPE+AE+T DLP  KV  LK A+D LQ  +A FL+T  PDW+I+DFA
Sbjct  61    LNYLKLPLPQIANLPENAEATTDLPITKVHCLKKAYDGLQIEVAQFLETTLPDWLIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S  L  ++ KL I   +FS   A  +A FF  +       +  +P+     PKWVPF + 
Sbjct  121   SHSLPSMVGKLGISLAFFSSMNA-WSAAFFGSAKTFH---TRTQPEDFLVPPKWVPFPSK  176

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R  E+ R+      +   VSD  R+   + G  A+ VRSC ELE +WL L E++  K
Sbjct  177   VAFRRHELMRMDAGNVENASGVSDWDRVAEALIGCDAILVRSCRELESDWLDLTEKMHEK  236

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P I VGL+P +A   + +DD    W  I  WL++  K SV+YVA G+E  P+QEE+ E+A
Sbjct  237   PVITVGLMPPSA--RDREDDGDDTWHTISGWLNRHGKESVIYVALGTEVAPSQEELTELA  294

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
              GLELS LPFFW  RK+ G ++ E  +LP+GFEER + RG++ TSW PQL++L+HDSVGG
Sbjct  295   TGLELSGLPFFWALRKKEGLSEFESLELPDGFEERVKERGIVWTSWTPQLRVLAHDSVGG  354

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH GWSSV+E L+  + L+M PF  DQG+  R L EK +G  + RDE+DGS SRDSVA
Sbjct  355   FLTHCGWSSVIEGLQNGRPLVMLPFQLDQGLNARALEEKMVGIEVPRDEDDGSLSRDSVA  414

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             ESLR+VM ++ G+V+ +K K+MK    +K+ Q+ Y + L++YL
Sbjct  415   ESLRLVMADQKGQVYRDKAKEMKLIFGDKDLQEKYEDNLIEYL  457



>gb|AAD15567.1| putative anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis 
thaliana]
Length=470

 Score =   416 bits (1069),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 225/471 (48%), Positives = 309/471 (66%), Gaps = 11/471 (2%)
 Frame = -3

Query  1690  QFSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHP  1514
              F     + + LH+VM PWLAFGH++PYLEL+KL+A++G+K+ F+STPRNI RL P L  
Sbjct  3     NFKDNDGDGTKLHVVMFPWLAFGHMVPYLELSKLIAQKGHKVSFISTPRNIDRLLPWLPE  62

Query  1513  HLVPNIDLIGLPLPQVEN-LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDW  1337
             +L   I+ + L LP  +N LPED E+T D+P++ + YLKIA+D L+  +  FL++  PDW
Sbjct  63    NLSSVINFVKLSLPVGDNKLPEDGEATTDVPFELIPYLKIAYDGLKVPVTEFLESSKPDW  122

Query  1336  VIHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKW  1157
             V+ DFA F L PI  +L I + +FS F  +   I  P        +    P      PKW
Sbjct  123   VLQDFAGFWLPPISRRLGIKTGFFSAFNGATLGILKPPGFE----EYRTSPADFMKPPKW  178

Query  1156  VPFETTIMPRNFEMERVFND--AYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQ  983
             VPFET++  + FE   +F    A    GNV D++R+G  + G   +FVRSCYE E EWL 
Sbjct  179   VPFETSVAFKLFECRFIFKGFMAETTEGNVPDIHRVGGVIDGCDVIFVRSCYEYEAEWLG  238

Query  982   LAEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPN  803
             L +E+  KP IPVG+LP      +E  +    WL +K+WLD ++  S+VYVAFGSE KP+
Sbjct  239   LTQELHRKPVIPVGVLPPKP---DEKFEDTDTWLSVKKWLDSRKSKSIVYVAFGSEAKPS  295

Query  802   QEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKI  623
             Q E+ EIALGLELS LPFFWV + +RG  D E  +LPEGFEERT  RG++   W  QL+ 
Sbjct  296   QTELNEIALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRT  355

Query  622   LSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDG  443
             LSHDS+G  LTH GW +++EA++F K + M  F+ DQG+  R++ EK++GY I RDE +G
Sbjct  356   LSHDSIGLVLTHPGWGTIIEAIRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDETEG  415

Query  442   SFSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              F+++SVA SLR+VMVEE GKV+ E VK+MK    + ++QD YV+  L+YL
Sbjct  416   FFTKESVANSLRLVMVEEEGKVYRENVKEMKGVFGDMDRQDRYVDSFLEYL  466



>ref|XP_002270369.2| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=464

 Score =   415 bits (1067),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 212/425 (50%), Positives = 274/425 (64%), Gaps = 9/425 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHIVM PWLAFGHI+PYLEL+KL+A  G+ I F+STPRNI RLPKL  +L P IDL+  P
Sbjct  7     LHIVMFPWLAFGHILPYLELSKLIAREGHLISFISTPRNIDRLPKLPLNLQPLIDLVKFP  66

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP ++NLPE+AE+T DLPY+K+ YLK AFD LQ+ +  FL+T  PDWVIHDF    L PI
Sbjct  67    LPNIDNLPENAEATTDLPYEKIPYLKKAFDGLQEPVTRFLETSHPDWVIHDFTPHWLPPI  126

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
               K  +   +F   +A+      P S +++G D   E     + P WV F T +    F 
Sbjct  127   AAKHGVSRAFFCTSSATTLCFCGPTSIMMEGGDPRTELHQLATAPPWVTFPTKVASPLFL  186

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
             + R+      D   VSD +R+G  + G   + +RSC ELEPEWL L  ++  KP  P+GL
Sbjct  187   LRRILGIHQADVSGVSDKFRMGSAILGCDVLAIRSCTELEPEWLDLLGKLHQKPLFPIGL  246

Query  937   LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQ  758
             LP +A      +    +W  I+EWLDKQEK  VVYVA G+E  P ++E+ E+A GLELS 
Sbjct  247   LPPSA----PVNGDDDSWPPIREWLDKQEKECVVYVALGTEVTPTEDELTELAFGLELSG  302

Query  757   LPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSGW  578
             LPFFW  RK+  S D     LP+GFEERT+GRG++  +WAPQL+IL H+SVGGF+ H GW
Sbjct  303   LPFFWALRKRHDSVD-----LPDGFEERTKGRGMVWRTWAPQLRILDHESVGGFVIHCGW  357

Query  577   SSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVVM  398
             SSV+E L F + L M P   DQG+  R   E ++G  I RD+ +G  SR SVAE+L +VM
Sbjct  358   SSVIEGLHFGQALTMLPLWGDQGLNARTFEEMKVGVEIPRDQEEGWLSRKSVAETLSLVM  417

Query  397   VEEHG  383
             VEE G
Sbjct  418   VEEAG  422



>ref|XP_010419269.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=471

 Score =   415 bits (1067),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 224/468 (48%), Positives = 308/468 (66%), Gaps = 12/468 (3%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNI  1496
              + + LH+ M P+LAFGH++PYLEL+KL+AE+G+ + F+STPRNI RL P+L  +L   I
Sbjct  9     GDGAKLHVAMFPFLAFGHMVPYLELSKLIAEKGHTVSFISTPRNIDRLLPRLPENLSSAI  68

Query  1495  DLIGLPLPQV--ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             + + LPLP V    LPED E+T DLP + + YLKIA+D L+  +  FL++  PDWV+ DF
Sbjct  69    NFVKLPLPVVGDNKLPEDGEATTDLPVELISYLKIAYDGLKSPVTKFLESAKPDWVLQDF  128

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             A++ L PI   L I + + S +  +   I  P        +    P      PKWVPFET
Sbjct  129   AAYWLPPISRSLGIKTGFLSAYNGATLGILKPPGFE----EYRTCPADFMKPPKWVPFET  184

Query  1141  TIMPRNFEMERVFND--AYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
              +  + FE   +F+   A    GNV D++R+G  + G  A+FVRSCYE E EWL + +++
Sbjct  185   PVAFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDL  244

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP IPVG+LP      EE  +    WL +K+WLD ++  SVVYVAFGSE KP+Q E+ 
Sbjct  245   HRKPVIPVGVLPPK---MEEKFEDTDTWLTVKKWLDSRKTKSVVYVAFGSEAKPSQTELN  301

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             EIALGLELS LPFFWV R +RGS D E  +LPEGFEERT GRG++   W  QL+ LSHDS
Sbjct  302   EIALGLELSGLPFFWVLRTRRGSGDTEPVELPEGFEERTAGRGMVWRGWVEQLRTLSHDS  361

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             +G  LTH GW +++EA++F K + +  FL DQG+  R++ +K++GY I RDE +G F+++
Sbjct  362   IGLALTHPGWGTIIEAIRFSKPMAVLVFLNDQGLNARVIEQKKIGYMIPRDETEGFFTKE  421

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SVA+SL++VM EE GKV+ E VK MK    + ++QD YV+  LDYL A
Sbjct  422   SVAKSLKLVMEEEEGKVYRENVKDMKGVFGDMDRQDRYVDSFLDYLVA  469



>emb|CDP01582.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   414 bits (1065),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 213/464 (46%), Positives = 308/464 (66%), Gaps = 11/464 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA++S +LH+VM PWLAFGH IP+LEL+K +A+RG+K+ F+STP+NI RLP++ P    +
Sbjct  1     MANKSGSLHVVMFPWLAFGHFIPFLELSKFIAQRGHKVSFISTPKNIDRLPRIPPEFASS  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + +PLP V+ LPE+ E+T+DL    V  LK A+D L+  +  FL+  +PDW+I+DFA
Sbjct  61    ITFVKIPLPPVDGLPENVEATVDLGGLDVAVLKKAYDGLEPELTRFLEYSAPDWIIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQ-SAVIDGVDSPVEPKHTTSKPKWVPFET  1142
              + + PI  KL+I   +F IF+A+  A F     A+I G D   + +  T  PKW+PFE+
Sbjct  121   PYWIPPIAAKLNISKSFFCIFSAASMAFFVRSVDAMIAGTDPRTKVEDFTVPPKWIPFES  180

Query  1141  TIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
              +  + +E   V     ++G  VSD YR+G  +K A    +R C E E +WL+L E+++ 
Sbjct  181   KLAFKLYESRWVVQGQNLEGSGVSDSYRVGSAIKDADVTLIRYCPEFEGQWLKLLEDLLK  240

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             +  IP+GL+P     ++   +   +W+ IK+WLD Q KGSVVYVA GSE   NQ ++ E+
Sbjct  241   RHVIPLGLMPPPV--EKSIVENNESWIAIKDWLDGQGKGSVVYVALGSEVSLNQLQLSEL  298

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLELS +PFFW  R   G        LPEGFE+R +GRG++  +WAPQL +LSHDSVG
Sbjct  299   ALGLELSGVPFFWALRNPSG--------LPEGFEDRVKGRGIVWKNWAPQLNVLSHDSVG  350

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH GWSS +E L F   LIM PF+ D G+I R+L EK++G  I R++ DGS++  SV
Sbjct  351   GFLTHCGWSSSIEGLMFGHPLIMLPFVADTGLIARMLEEKQVGIEIPRNDVDGSYTSHSV  410

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             A S+R++MVE  GK+F +K K++ A   +++  D+Y++K +DYL
Sbjct  411   ANSVRLIMVENEGKIFKDKAKEISAIFGDQDLHDSYLHKCVDYL  454



>emb|CAN70983.1| hypothetical protein VITISV_027120 [Vitis vinifera]
Length=605

 Score =   419 bits (1078),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 303/458 (66%), Gaps = 33/458 (7%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNI  1496
             + +   LHIVM PWLAFGH+IPYLELAKL+A+ G+++ FVSTPRNI RLPKL P+L   I
Sbjct  8     SKQGDELHIVMFPWLAFGHMIPYLELAKLIAQSGHRVSFVSTPRNIDRLPKLPPNLASFI  67

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
               + LPLP V NLPE+AE+T DLPY+KV+YLK+A D LQ+ MA FL+  +PDWV+HDF +
Sbjct  68    TFVKLPLPHVSNLPENAEATTDLPYNKVQYLKLAHDLLQEPMALFLEAAAPDWVLHDFTA  127

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
               L PI  KL I   +FSIF AS  ++          +D   EP+H T  PKWVPF + +
Sbjct  128   HWLDPIATKLGISCAFFSIFIASAMSVLGSGYQ----LDYRSEPEHFTVVPKWVPFHSNV  183

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
                 FE++++F+    D   VSD YR   ++KG   + VRSC+ELEPEWL+L E++  KP
Sbjct  184   AFCYFEIKKIFDCMNGDASGVSDRYRFTESIKGCDLLAVRSCFELEPEWLRLLEQLHRKP  243

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVG L    + D  DDDK   W ++KEWLDK   GSVVYVAFGSE KPNQ E+ E AL
Sbjct  244   VIPVGQLAPNLH-DCGDDDKDERWQQMKEWLDKXASGSVVYVAFGSEAKPNQTELTESAL  302

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLE SQLPFFWV + +RG  D EV +LP+GFEERT+                        
Sbjct  303   GLEQSQLPFFWVLKLRRGPTDTEVIRLPDGFEERTK------------------------  338

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
                 GW+SVVEAL+ E+ LI+  FL DQG+    L EK MGY I R+E DGSF+R++VA 
Sbjct  339   ----GWTSVVEALQLERPLILLTFLADQGLNASFLQEKRMGYLIPRNEQDGSFTREAVAH  394

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKL  302
             SLR+V++EE GK++ +K K+M+    ++++Q++YV+ L
Sbjct  395   SLRLVVMEEGGKIYRDKAKEMRGVFGDRDRQNHYVDTL  432



>ref|XP_006294142.1| hypothetical protein CARUB_v10023135mg [Capsella rubella]
 gb|EOA27040.1| hypothetical protein CARUB_v10023135mg [Capsella rubella]
Length=471

 Score =   415 bits (1066),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 223/468 (48%), Positives = 311/468 (66%), Gaps = 11/468 (2%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPN  1499
               + + LH+ M PWLAFGH++PY EL+KL+A++G+ + F+STPRNI RL P+L  +L   
Sbjct  9     GGDGTKLHVAMFPWLAFGHMVPYFELSKLIAQKGHTVSFISTPRNIDRLLPRLPQNLSSA  68

Query  1498  IDLIGLPLPQVEN-LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             I+ + LPLP  +N LPED E+T D+P++ V YLKIAFD L+  +  FL++  PDWV+ DF
Sbjct  69    INFVKLPLPVGDNKLPEDGEATTDVPFELVSYLKIAFDGLKSPVTEFLESSKPDWVLQDF  128

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             A++ L P+  +L I + + S F  +   I  P        +    P      PKWVPFET
Sbjct  129   AAYWLPPVSRRLGIKTGFLSAFNGATLGILKPPGFE----EYRTCPADFMKPPKWVPFET  184

Query  1141  TIMPRNFEMERVFND--AYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
              +  + FE   +F+   A    GNV D++R+G  + G  A+FVRSCYE E EWL + +++
Sbjct  185   PVAFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDL  244

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP IPVG+LP      EE  +    WL +K+WLD ++  SVVYVAFGSE KP+Q E+ 
Sbjct  245   HRKPVIPVGVLPPKP---EEKFEDTDTWLTVKKWLDSRKAKSVVYVAFGSEAKPSQTELN  301

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             EIALGLELS LPFFWV + +RGS D E T+LPEGFEERT  RG++   W  QL+ LSH+S
Sbjct  302   EIALGLELSGLPFFWVLKTRRGSWDTEPTELPEGFEERTADRGMVWRGWVEQLRTLSHES  361

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             +G  LTH GW +++EA++F K + M  F+ DQG+  R++ EK++GY I RDE +G F+++
Sbjct  362   IGLVLTHPGWGTIIEAIRFAKPMAMLVFVFDQGLNARVIEEKKIGYMIPRDETEGFFTKE  421

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SVA+SL++VM EE GKV+ E VK+MK    + ++QD YV+  LDYL A
Sbjct  422   SVAKSLKLVMEEEEGKVYRENVKEMKGVFGDMDRQDLYVDSFLDYLVA  469



>ref|XP_011084238.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=470

 Score =   414 bits (1063),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 207/432 (48%), Positives = 283/432 (66%), Gaps = 2/432 (0%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNI  1496
             A     LHI +LPWLAFGHIIPYLEL+K +A++G++I F+STPRNI RLPKL PHL  +I
Sbjct  3     AKNQQNLHIAVLPWLAFGHIIPYLELSKHIAQKGHRISFISTPRNIDRLPKLPPHLSSSI  62

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
              L+ +PLP++  LPE+AE+T+D+   ++  LK AFD L+  +  FL+   PDW+I+DFA+
Sbjct  63    ALVKIPLPRIAELPENAEATMDIHAGQMGLLKKAFDALEPGLTRFLEDSRPDWIIYDFAA  122

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
               + P+  +L I   +F I  A     F     +I G D   +P+     PKWV FET +
Sbjct  123   HWVPPVAVRLGISRAFFFIINAWFLGFFGATDTLISGSDYRTKPEDFMVPPKWVKFETKV  182

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R FE E     +  +    SD YR+G  + G  A+ +R C E EPEWL L EE+  +P
Sbjct  183   AFRRFEAEWSDGASKSNESGFSDYYRIGKVIAGCEAILIRHCNEFEPEWLTLLEELHHRP  242

Query  955   TIPVGLLPTTAY-ddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
              IP+GL+P         +D     W  IK WL++Q KGSVVYVA GSE  P+Q++VVE+A
Sbjct  243   VIPLGLMPPKVQDHSTNNDANHTVWTGIKNWLNRQNKGSVVYVALGSEVTPSQDQVVELA  302

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
              GLELS +PFFWV RK   S +++  +LP GFEER  GRG++  SWAPQ++IL H SVGG
Sbjct  303   HGLELSGVPFFWVLRKVSAS-ESKPVELPNGFEERVSGRGMVWRSWAPQVEILKHASVGG  361

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FL+H GWSS+VE L +   LI  PFL DQG+ +R++VEK++G  I R+E DG+++R  VA
Sbjct  362   FLSHCGWSSIVEGLMYGNPLITLPFLVDQGLNSRVIVEKQLGVEIPRNEQDGTYTRKWVA  421

Query  418   ESLRVVMVEEHG  383
             +S+++VMV E G
Sbjct  422   DSVKLVMVGEEG  433



>emb|CDP04856.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   412 bits (1060),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 217/464 (47%), Positives = 307/464 (66%), Gaps = 11/464 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA +S +LH+VM PWLAFGH IP+L+L+K +A+RG+K+ F+STP+N+ RLPK+      +
Sbjct  1     MAGKSGSLHVVMFPWLAFGHFIPFLDLSKFIAQRGHKVSFISTPKNVDRLPKIPLEFASS  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + +PLP+V+ LPE+ E+T+DL    V  LK A+D L+  +  FL   +PDW+I+DFA
Sbjct  61    ITYVKIPLPRVDGLPENVEATVDLGGLDVAVLKKAYDGLEPELTRFLGYSAPDWIIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
              + L PI  KL+I   +FSI++A S+  +  P  A+I G D   + +  T  PKW+PFE+
Sbjct  121   PYWLPPIAAKLNISKSFFSIYSAFSMAFLAPPFEALIAGADPRTKVEDFTVPPKWIPFES  180

Query  1141  TIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
              +  +  E   +     +DG  VSDLYR+G  VKGA  + +R C+E E +WL+L E++  
Sbjct  181   KVAFKLHESRWMLESRNLDGSGVSDLYRVGSVVKGADVILMRHCHEFEGQWLKLVEDLQA  240

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             +P IPVGL+P     ++   +   +W+ IK+WLD Q KGSVVYVA GSE   NQ ++ E+
Sbjct  241   RPLIPVGLMPPPV--EKSSLENNESWIAIKDWLDGQGKGSVVYVALGSEVSLNQLQLSEL  298

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLE S +PFFW  R   G        LP GFE+R +GRG++  +WAPQL ILSHDSVG
Sbjct  299   ALGLESSGVPFFWALRNPSG--------LPGGFEDRVKGRGIVWKNWAPQLNILSHDSVG  350

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH GW S +E L F   LIM PF+ D G+I R+L EK +G  I R++ DGS++ DSV
Sbjct  351   GFLTHCGWGSSIEGLMFGHPLIMLPFVIDTGLIARVLEEKLVGIEIPRNDVDGSYTSDSV  410

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             A S+R+VMVE  GKVF +K K++ A   +++  ++Y+ K +DYL
Sbjct  411   ANSVRLVMVENEGKVFKDKAKEIGAIFGDQDLHNSYLQKSVDYL  454



>ref|XP_004250157.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Solanum 
lycopersicum]
Length=474

 Score =   413 bits (1061),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 217/472 (46%), Positives = 306/472 (65%), Gaps = 14/472 (3%)
 Frame = -3

Query  1681  AMASESST--LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHL  1508
             A   E++T  LHIVM PWLAFGHIIP+LEL+K LA +G+KI F+STPRNI RLPK+    
Sbjct  2     ANGDENTTKKLHIVMFPWLAFGHIIPFLELSKFLALKGHKISFISTPRNIDRLPKIPSEF  61

Query  1507  VPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIH  1328
               +I  + +PLP+++ LP+DAE+T+D+  +++ YLK A D +++ +  FL+   PDW+I 
Sbjct  62    SNSITFVKIPLPKIDGLPKDAEATMDITSEEMTYLKKAMDGMENEVTNFLENNCPDWIIQ  121

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIF------FPQSAVIDGVDSPVEPKHTTSK  1166
             DFA + L PI  +L I  +++SI    INA F      F      +   SP + +     
Sbjct  122   DFAQYWLAPISTRLGISRIFYSI----INAWFLSFLGSFENMINTNNCTSPPKLEDFLVP  177

Query  1165  PKWVPFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWL  986
             PKW+PFET    R  E   +   +  +   VSD+YR GVT++GA A+ +R C+E E +WL
Sbjct  178   PKWIPFETKATYRLHEARWMVESSQKNVSGVSDMYRNGVTIEGADAIIIRHCHEFEGQWL  237

Query  985   QLAEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKP  806
             +L E++   P +P GL+P     +    +K  +W+ IKEWLD++ KGSVVYVA GSE   
Sbjct  238   KLLEDLHHMPVLPTGLMPPIV--ESSSHEKNESWISIKEWLDEKPKGSVVYVALGSEVTV  295

Query  805   NQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLK  626
              Q E+ E+A GLELS  PFFWV RK  G    +   LP+GFEERT+ RG++  SWAPQLK
Sbjct  296   GQNEINELARGLELSGSPFFWVLRKSSGLGSIDPIVLPDGFEERTKDRGIVWKSWAPQLK  355

Query  625   ILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDEND  446
             ILSH+SVGGFLTH GWSS++E L F   LIM PFL DQG+  R++ +K +G  + R+E D
Sbjct  356   ILSHESVGGFLTHCGWSSIIEGLMFGHSLIMLPFLVDQGLNARIIEDKGVGIEVPRNEED  415

Query  445   GSFSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             GS++ +SVA S+++VMV+  GK+  EK K++ +    KE  D Y+  L+++L
Sbjct  416   GSYTSNSVANSVKLVMVKNDGKLIREKAKELSSIFSNKELHDKYIENLINFL  467



>emb|CDP21084.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   410 bits (1053),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 213/464 (46%), Positives = 308/464 (66%), Gaps = 11/464 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA +SS+LH+VMLPWLAFGH IP+LEL+K +A RG+K+ FVSTP+NI RLPK+ P+L  +
Sbjct  1     MADKSSSLHVVMLPWLAFGHFIPFLELSKFIARRGHKVSFVSTPKNIDRLPKIPPNLASS  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + +PLP V+ LPE+ E+T+DL    V  LK A+D L+  +  FL++  PDW+I+DFA
Sbjct  61    ISFVKIPLPPVDGLPENVEATVDLGGLDVAVLKKAYDGLEPELTRFLESSVPDWIIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQ-SAVIDGVDSPVEPKHTTSKPKWVPFET  1142
              + +  I  KL+I   +F IF+A+      P   A++ G D   + +  T  PKW+PF++
Sbjct  121   PYWIPHIAAKLNISKSFFCIFSAASLVFSAPSLDAMVAGTDPRTKLEDFTVPPKWIPFKS  180

Query  1141  TIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
              +  +  E   V     +DG  VSD+YR+G  +KGA    +R C E E +WL+L E+++ 
Sbjct  181   KLAFKLHESRFVVRSKNLDGSGVSDMYRVGSAIKGADVTLIRYCPEFEGQWLKLLEDLLQ  240

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             +  IP+GL+P     ++   +   +W+ IK+WLD Q KGSVV+VA GSE   NQ ++ E+
Sbjct  241   RHIIPLGLMPPP--MEKSIVENNESWIAIKDWLDGQGKGSVVFVALGSEVSLNQLQLSEL  298

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLELS +PFFW  R   G        LPEGF++R +G G++  +WAPQL ILSHDSVG
Sbjct  299   ALGLELSGVPFFWALRNPSG--------LPEGFDDRVKGTGIVWKNWAPQLNILSHDSVG  350

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH GWSS +E L F   LIM PF+ D G+I R++ EK++G  I R++ DGS++  SV
Sbjct  351   GFLTHCGWSSSIEGLMFGHPLIMLPFIIDTGLIARIMEEKQVGIEIPRNDVDGSYTSHSV  410

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             A S+R++MVE  GK+F +K K++ A   +++  D+Y++K +DYL
Sbjct  411   ANSVRLIMVENEGKIFKDKAKEISAIFGDQDLHDSYLHKCVDYL  454



>ref|XP_010417017.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=472

 Score =   410 bits (1053),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 220/468 (47%), Positives = 307/468 (66%), Gaps = 12/468 (3%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNI  1496
              + + LH+ MLPWLAFGH++PY EL+KL+A++G+ + F+STPRNI RL P+L  +L   I
Sbjct  10    GDGTKLHVAMLPWLAFGHMVPYFELSKLIAQKGHTVSFISTPRNIDRLLPRLPKNLSSAI  69

Query  1495  DLIGLPLPQV--ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             + + LPLP V    LPED E+T D+P++ + YLKIAFD L+  +  FL++  PDWV+ DF
Sbjct  70    NFVRLPLPVVGDNKLPEDGEATTDVPFELISYLKIAFDGLKSPVTEFLESSKPDWVLQDF  129

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             A++ L PI  +L I + + S F  +   I  P        +    P      PKWVPFET
Sbjct  130   AAYWLPPISRRLGIKTGFLSAFNGATLGILKPPGFE----EYRTCPADFMKPPKWVPFET  185

Query  1141  TIMPRNFEMERVFND--AYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
              +  + FE   +F+   A    GNV D++R+G  + G  A+FVRSCYE E EWL + +++
Sbjct  186   PVAFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDL  245

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP IPVG+LP      EE  +    WL +K+WLD ++  SVVY+AFGSE KP+Q E+ 
Sbjct  246   HRKPVIPVGVLPPK---MEEKFEDTDTWLTVKKWLDSRKAKSVVYIAFGSEAKPSQTELN  302

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
              IALGLELS LPFFWV + +RG  D E  +LPEGFEERT  RG++   W  QL+ LSH+S
Sbjct  303   AIALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHES  362

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             +G  LTH GW +V+EA++F K + M  F+ DQG+  R++ +K++GY I RDE +G F+++
Sbjct  363   IGVVLTHPGWGTVIEAIRFSKPMAMLVFVYDQGLNARVIEQKKIGYMIPRDETEGFFTKE  422

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SVA+SL++VM EE GKV+ E VK MK    + ++QD YV+  LDYL A
Sbjct  423   SVAKSLKLVMEEEEGKVYRENVKDMKGVFGDMDRQDRYVDSFLDYLVA  470



>ref|XP_010431575.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=471

 Score =   409 bits (1052),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 221/468 (47%), Positives = 308/468 (66%), Gaps = 12/468 (3%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNI  1496
              + + LH+ M P+LAFGH++PYLEL+KL+A++G+ + F+STPRNI RL P+L  +L   I
Sbjct  9     GDGTKLHVAMFPFLAFGHMVPYLELSKLIAQKGHTVSFISTPRNIDRLLPRLPENLSSAI  68

Query  1495  DLIGLPLPQV--ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             + + LPLP V    LPED E+T DLP + + YLKIA+D L+  +  FL++  PDWV+ DF
Sbjct  69    NFVKLPLPVVGDNKLPEDGEATTDLPVELISYLKIAYDGLKSPVTEFLESSKPDWVLQDF  128

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             A++ L PI  +L I + + S +  +   I  P        +    P      PKWVPFET
Sbjct  129   AAYWLPPISRRLGIKTGFLSAYNGATLGILKPPGFE----EYRTCPADFMKPPKWVPFET  184

Query  1141  TIMPRNFEMERVFND--AYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
              +  + FE   +F+   A    GNV D++R+G  + G  A+FVRSCYE E EWL + +++
Sbjct  185   PVAFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDL  244

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP IPVG+LP      EE  +    WL +K+WLD ++  SVVYVAFGSE KP+Q E+ 
Sbjct  245   HRKPVIPVGVLPPK---LEEKFEDTDTWLTVKKWLDSRKAKSVVYVAFGSEAKPSQTELN  301

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             EIALGLELS LPFFWV R +RGS D E  +LPEGFEERT  RG++   W  QL+ LSH+S
Sbjct  302   EIALGLELSGLPFFWVLRTRRGSGDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHES  361

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             +G  LTH GW +++EA++F K + +  FL DQG+  R++ +K++GY I RDE +G F+++
Sbjct  362   IGLALTHPGWGTIIEAIRFSKPMAVLVFLNDQGLNARVIEQKKIGYMIPRDETEGFFTKE  421

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SVA+SL++VM EE GKV+ E VK MK    + ++QD YV+  LDYL A
Sbjct  422   SVAKSLKLVMEEEEGKVYRENVKDMKGVFGDMDRQDRYVDSFLDYLVA  469



>emb|CDP21820.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   408 bits (1049),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 211/453 (47%), Positives = 303/453 (67%), Gaps = 11/453 (2%)
 Frame = -3

Query  1645  MLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLPLPQV  1466
             MLPWLAFGH IP+LEL+K +A++G+K+ FVSTP+NI RLP++ P+L  +I  + +PLP+V
Sbjct  1     MLPWLAFGHFIPFLELSKFMAQKGHKVSFVSTPKNIDRLPRIPPNLASSITFVKIPLPRV  60

Query  1465  ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPIMEKL  1286
             + LPE+ E+T+DL    V  LK A+D L+  +  FL+  +PDW+I+DFA + + PI  KL
Sbjct  61    DGLPENVEATVDLGDLDVAVLKKAYDGLEPELTRFLEYSAPDWIIYDFAPYWIPPIAAKL  120

Query  1285  SIPSVYFSIFTASINAIFFPQ-SAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFEMER  1109
             +I   +F IF+A+  A F P   A+I G D   + +  T  PKW+PFE+ +  + +E   
Sbjct  121   NISKSFFCIFSAASMAFFVPSVDAMIAGTDPRTKVEDFTVPPKWIPFESKLAFKLYESRW  180

Query  1108  VFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGLLPT  929
             V     +DG  VSD YR+G  +KGA    +R C E E +WL+L E+++ +  IP+GL+P 
Sbjct  181   VVQGQNLDGSGVSDSYRVGSAIKGADVTLIRYCSEFEGKWLKLLEDLLQRHIIPLGLMPP  240

Query  928   TAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQLPF  749
                 ++   +   +W+ IK+WLD Q KGSVVYVA GSE   NQ ++ E+ALGLELS +PF
Sbjct  241   PV--EKSIVENNESWIAIKDWLDGQGKGSVVYVALGSEVSLNQLQLSELALGLELSGVPF  298

Query  748   FWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSGWSSV  569
             FW  R   G        LPEGFE+R +G G++  +WAPQL +LSHDSVGGFLTH GWSS 
Sbjct  299   FWALRNPSG--------LPEGFEDRVKGTGIVWKNWAPQLNVLSHDSVGGFLTHCGWSSS  350

Query  568   VEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVVMVEE  389
             +E L F   LIM PF+ D G+I R+L EK++G  I R++ DGS++  SVA S+R++MVE 
Sbjct  351   IEGLMFGHPLIMLPFVADTGLIARVLEEKQVGIEIPRNDVDGSYTSHSVANSVRLIMVEN  410

Query  388   HGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              GK+F +K K++ A   +++  D+Y++K +DYL
Sbjct  411   EGKIFKDKAKEISAIFGDQDLHDSYLHKCVDYL  443



>emb|CDP21083.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   408 bits (1049),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 218/464 (47%), Positives = 310/464 (67%), Gaps = 11/464 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA++S +LH+VM PWLAFGH IP+LEL+K +A++G+K+ F+STP+NI RLPKL P+L  +
Sbjct  1     MANKSGSLHVVMFPWLAFGHFIPFLELSKFIAQKGHKVSFISTPKNIDRLPKLPPNLASS  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  I +PLP V+ LPE+ E+T+DL    V +LK A+D  +  +  FL+  +PDW+I+DFA
Sbjct  61    ITFIKIPLPPVDGLPENVEATVDLGGLDVAFLKKAYDGFEPDLTRFLEDSAPDWIIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQ-SAVIDGVDSPVEPKHTTSKPKWVPFET  1142
              + L PI  KL+I   +FSI +AS    F P   A+I+G D   + +     PKW+PFE+
Sbjct  121   PYWLPPIAAKLNIARSFFSIVSASTVVFFGPSFDAMINGTDPRSKVEDYIVPPKWIPFES  180

Query  1141  TIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
              +  + +E + +   + +DG   SD+YR+G  +KGA  V VR C E E +WL L E +  
Sbjct  181   KVAYKLYESKWIVGASNLDGSGASDMYRVGSVIKGADVVLVRHCREFEGQWLNLLENLQR  240

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             +P +P+GL+P     ++   +   +W+ IK+WLD Q KGSVVYVAFGSE   +Q E+ E+
Sbjct  241   RPVMPLGLMPPKV--EKSGLESNESWIAIKKWLDGQGKGSVVYVAFGSEVSMSQLELGEL  298

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLELS +PFFW  R   G        LPEGFE+R  GRG++  +WAPQL ILSHDSVG
Sbjct  299   ALGLELSGVPFFWALRNPSG--------LPEGFEDRVEGRGIVWKNWAPQLNILSHDSVG  350

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH GWSS +E L     LIM PF+ D G++ R+L EK++G  I R+  DGS++RDSV
Sbjct  351   GFLTHCGWSSSIEGLMLGHPLIMLPFVIDTGLVARILEEKQVGIEIPRNPVDGSYTRDSV  410

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             A+S+R++M E+ GK + +K K++ A   ++E  D Y+ + +DYL
Sbjct  411   AKSVRLIMEEDEGKSYRDKAKEISAVFGDRELHDGYLQRFVDYL  454



>ref|XP_010472246.1| PREDICTED: UDP-glycosyltransferase 91A1 [Camelina sativa]
Length=471

 Score =   409 bits (1050),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 221/468 (47%), Positives = 307/468 (66%), Gaps = 12/468 (3%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNI  1496
              + + LH+ MLPWLAFGH++PY EL+KL+A++G+ + F+STPRNI RL P+L  +L   I
Sbjct  9     GDGTKLHVAMLPWLAFGHMVPYFELSKLIAQKGHTVSFISTPRNIDRLLPRLPKNLSSAI  68

Query  1495  DLIGLPLPQV--ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             + + LPLP V    LPED E+T D+P++ + YLKIAFD L+  +  FL++  PDWV+ DF
Sbjct  69    NFVRLPLPVVGDNKLPEDGEATTDVPFELISYLKIAFDGLKSPVTEFLESSKPDWVLQDF  128

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             A++ L PI  +L I + + S F  +   I  P        +    P      PKWVPFET
Sbjct  129   AAYWLPPISRRLGIKTGFLSAFNGATLGILKPPGFE----EYRTCPAGFMKPPKWVPFET  184

Query  1141  TIMPRNFEMERVFND--AYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
              +  + FE   +F+   A    GNV D++R+G  + G  A+FVRSCYE E EWL + +++
Sbjct  185   PVAFKLFECRYIFHGFMAETTEGNVPDIHRVGGVIDGCDAIFVRSCYEYEAEWLGMIQDL  244

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP IPVG+LP      EE  +    WL +K+WLD ++  SVVYVAFGSE KP+Q E+ 
Sbjct  245   HRKPVIPVGVLPPKP---EEKFEDTDTWLTVKKWLDSRKTKSVVYVAFGSEAKPSQTELN  301

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
              IALGLELS LPFFWV + +RG  D E  +LPEGFEERT  RG++   W  QL+ LSH S
Sbjct  302   AIALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWRGWVEQLRTLSHAS  361

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             +G  LTH GW +V+EA++F K + M  F+ DQG+  R++ +K++GY I RDE +G F+++
Sbjct  362   IGLVLTHPGWGTVIEAIRFAKPMAMLVFVYDQGLNARVIEQKKIGYMIPRDETEGFFTKE  421

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SVA+SL++VM EE GKV+ E VK+MK    + ++QD YV+  LDYL A
Sbjct  422   SVAKSLKLVMEEEEGKVYRENVKEMKGVFGDMDRQDRYVDSFLDYLVA  469



>ref|XP_011073572.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=468

 Score =   407 bits (1046),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 208/456 (46%), Positives = 298/456 (65%), Gaps = 6/456 (1%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LH+VM PWLAFGHIIP+ EL+K +A++G+KI F+STPRNI RLPKL P LV +IDL+ +P
Sbjct  12    LHVVMFPWLAFGHIIPFFELSKFIAQKGHKITFISTPRNIDRLPKLPPDLVSSIDLVKIP  71

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP++E LPE+AE+T+D+  + V +LK A+D ++D +A FL+    D +I+DFA + L PI
Sbjct  72    LPKLEELPENAEATMDVRPEDVEHLKKAYDGMEDGVARFLENSDADIIIYDFAPYWLAPI  131

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
               +L I   +F IF A   A      A+I+G++     +   + P+WV F+T +  R +E
Sbjct  132   ATRLGISRFFFCIFNAWFLAFLGTTDALINGLEGRSRQEDFLAPPEWVTFDTKVAYRLYE  191

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
              +     A  +    SD YR G  + G +A+ +R C E EP+WL+L EE+  K  IP+GL
Sbjct  192   AKWALGAAGTNASGFSDTYRAGKAIAGCNAMIIRHCNEFEPKWLKLLEELHQKEVIPLGL  251

Query  937   LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQ  758
             +P      +++     AW+ IK WL    K SVVYVA GSE   +++++ E+A GLELS 
Sbjct  252   MPPQV---QDNTSTNEAWVSIKNWLCTHPKESVVYVALGSEVVLSRDQISELAHGLELSG  308

Query  757   LPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSGW  578
             +PF W  RK  GSA  E   LPEGFEERT+GRG++  +WAPQLKIL HD VG FLTH GW
Sbjct  309   VPFLWALRKPAGSATIE---LPEGFEERTKGRGIVWKNWAPQLKILGHDGVGAFLTHCGW  365

Query  577   SSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVVM  398
             SS+VE L F + L+M PF  DQG+  R+L +K++G  + R+E DG+++R++VAES+R VM
Sbjct  366   SSIVEGLMFGRPLVMLPFQIDQGLNARVLGDKQVGMEVPRNEQDGTYTRNAVAESVRTVM  425

Query  397   VEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             V+  G+   +  K   A   +KE  D Y++  +++L
Sbjct  426   VDGVGQKLRDTAKATSAMFGDKELHDRYLHNFVEHL  461



>emb|CAN80741.1| hypothetical protein VITISV_015058 [Vitis vinifera]
Length=448

 Score =   406 bits (1043),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 227/462 (49%), Positives = 296/462 (64%), Gaps = 38/462 (8%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
              + + LHIV+ PWLAFGH+IPYLELAKL+A+RG+ + FVSTPRNI RLPKL P+L P I 
Sbjct  10    QDDAKLHIVLFPWLAFGHMIPYLELAKLVAQRGHHVSFVSTPRNIDRLPKLPPNLTPFIS  69

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
              + +PLP V NLPE+AE+T DLP +KV +LK A++ L++ +  FL   +PDWV+HDF ++
Sbjct  70    FVKIPLPHVPNLPENAEATTDLPENKVPFLKQAYNLLEEGITGFLDAAAPDWVLHDFTAY  129

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              LVPI  KL I   + SIFTAS    F P      G D   EP+  T  PKWVPF + + 
Sbjct  130   WLVPIATKLGIACGFLSIFTASALCFFNPS-----GQDHRTEPEDFTVAPKWVPFPSRVA  184

Query  1132  PRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
              R FE+ ++FN+A   D    SD++R    ++G   + VRSC ELEPEWL+L E++  KP
Sbjct  185   FRYFEVVKIFNNAIAGDASGTSDMHRFEACLRGCDLLAVRSCTELEPEWLRLLEQLYQKP  244

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +PVG LP        DDD+   WLEIK WLDKQ  GSVVYVAFGSE KPNQ E+ EIAL
Sbjct  245   VVPVGQLPPI-LPHGGDDDEDETWLEIKGWLDKQAGGSVVYVAFGSEAKPNQTELTEIAL  303

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLE S+LPFFW  + +RG  D EV +L EGFEERT+GRGV                    
Sbjct  304   GLEQSELPFFWALKLKRGPCDIEVIQLXEGFEERTKGRGV--------------------  343

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
                        AL+ E+ LI+  FL DQG+    L EK MG  I R+E DGSF+R++VA 
Sbjct  344   -----------ALQLERPLILLTFLADQGLNASFLREKXMGXLIPRNEEDGSFTREAVAR  392

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             SLR+V+VEE  K + +K K+M+A   ++++Q+ YV+ L+  L
Sbjct  393   SLRLVVVEEGDKFYRDKAKEMRAVFGDRDRQNQYVDTLVSCL  434



>ref|XP_006404721.1| hypothetical protein EUTSA_v10000154mg [Eutrema salsugineum]
 gb|ESQ46174.1| hypothetical protein EUTSA_v10000154mg [Eutrema salsugineum]
Length=472

 Score =   404 bits (1037),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 222/468 (47%), Positives = 302/468 (65%), Gaps = 14/468 (3%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPN  1499
                 + LH+ M PWLAFGH++PYLEL+KL+A++G+ + F+STPRNI RL P+L  +L   
Sbjct  9     GGNGAKLHVAMFPWLAFGHMVPYLELSKLIAQKGHTVSFISTPRNIDRLLPRLPENLHSA  68

Query  1498  IDLIGLPLPQV--ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
             I  + LPL     + LPED E+T D+P+D + YLKIAFD L+  +  FL++  PDW++ D
Sbjct  69    IKFVKLPLSGGVDKKLPEDGEATTDVPFDLIPYLKIAFDGLRIPVTEFLESSKPDWILQD  128

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDS-PVEPKHTTSKPKWVPF  1148
             FA++ L PI  +L I + +FS F  +   I  P      G D     P    + PKWVPF
Sbjct  129   FAAYWLPPISRRLGIKTGFFSAFNGATLGILKPP-----GFDEYRTSPADFMTPPKWVPF  183

Query  1147  ETTIMPRNFEMERVFND--AYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             ET +  + FE   +F    A    GNV D++R+   + G   + VRSCYE E EWL L +
Sbjct  184   ETPVAFKLFECRYIFKGFMAETTEGNVPDVHRVAGVIDGCDVIAVRSCYEYEAEWLGLIQ  243

Query  973   EVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
             ++  KP IPVG+LP      EE  D    WL IK WLD ++  SVVYVAFGSE KPNQ E
Sbjct  244   DLHRKPVIPVGVLPPKT---EEKYDDTDTWLSIKAWLDSRKSKSVVYVAFGSEAKPNQTE  300

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
             +  IA GLELS LPFFWV + +RG  D E  +LPEGFEERT+ RG++   W  QL+ LSH
Sbjct  301   LNAIAFGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTKERGMVWRGWVEQLRTLSH  360

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
             DS+G  LTH GW +++EA++F K + M  F+ DQG+  R++ EK++GY I RDE +G F+
Sbjct  361   DSIGLVLTHPGWGTIIEAVRFAKPMAMLVFVYDQGLNARVIEEKKIGYMIPRDETEGFFT  420

Query  433   RDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             ++SVA+SLR+VM EE GKV+ E VK+MK    + ++QD YV+  L+YL
Sbjct  421   KESVAKSLRLVMEEEEGKVYRENVKEMKRVFGDMDRQDRYVDSFLNYL  468



>ref|XP_010934404.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=491

 Score =   403 bits (1035),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 223/465 (48%), Positives = 298/465 (64%), Gaps = 5/465 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             +   S  LHI + PWLAFGH++P+L+L+K LA+RG++I+F+STPRNIQRLPK+ PHL P 
Sbjct  24    IMDNSGVLHIAVFPWLAFGHMLPFLQLSKSLAKRGHRIYFLSTPRNIQRLPKIPPHLAPL  83

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP--DWVIHD  1325
             ID + LPLP+VE LPE+AE+T DLP  +V+YLK+AFD L   +  FL+  SP  DW+I D
Sbjct  84    IDFVSLPLPKVEGLPENAEATPDLPKYQVQYLKVAFDRLGGPLENFLEEASPKPDWIILD  143

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFE  1145
             FA   +  +  K  +P   FS+FTA   A + P  ++  G D  +E    TS PK + FE
Sbjct  144   FACHWVPKLASKFGVPCALFSVFTAPFLAFWRPSESLSRGGDDVLE--EFTSPPKGISFE  201

Query  1144  TTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             T++  R  E  RV +    +   V D  RL +T++G   V  RSC EL  +WL   +E+ 
Sbjct  202   TSVSFRLHEARRVIHGYENNASGVCDADRLLLTIEGCRVVAPRSCRELHSDWLCYLQELY  261

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              KP IP+GLLP  A DD    D  +    +  WLDKQ  GSVVYVAFGSET  + E + E
Sbjct  262   KKPVIPIGLLPP-APDDGAGVDATSDESNVFHWLDKQAPGSVVYVAFGSETVLSTEILHE  320

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             +A GLELSQ+PF W  RK    A      LPEGFE+RTR  GVI   W  QLK+L+H SV
Sbjct  321   LAFGLELSQVPFLWAIRKPVDVAGEGKEVLPEGFEDRTRDHGVIAMGWIDQLKVLAHASV  380

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GG LTHSGWSSV+E+L+F   LIM PF+ DQGII R++ E+ +G  + R+E DGSFSR+ 
Sbjct  381   GGCLTHSGWSSVIESLQFGHPLIMLPFIVDQGIIARVMEERRIGIEVPRNEEDGSFSRED  440

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +A+++R+VMVEE G  F  +  ++K     K+  + YV + + YL
Sbjct  441   LAKAIRLVMVEEEGNQFRSEATELKEIFGNKDYHERYVEEFILYL  485



>ref|XP_002865752.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42011.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=515

 Score =   402 bits (1032),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 296/457 (65%), Gaps = 14/457 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             +HI M PWLA GH++P+L L+KLLA++G+KI F+STPRNI RLPKL  +L  +I  +  P
Sbjct  9     MHIAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNILRLPKLPSNLSSSITFVSFP  68

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP +  LP  +ES++D+PY+K + LK AFD LQ  +  FL+  SPDW+I+D+AS  L  I
Sbjct  69    LPSISGLPPSSESSMDVPYNKQQSLKAAFDLLQPPLTEFLRLSSPDWIIYDYASHWLPSI  128

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
              ++L I   +FS+F A+      P S++I+  +S   P+  T  P WVPF++TI+ R  E
Sbjct  129   AKELGISKAFFSLFNAATLCFMGPSSSLIE--ESRSTPEDFTVVPPWVPFKSTIVFRYHE  186

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
             + R       D   VSD  R G T+ G+ AVFVRSC E EPEW  L +++  KP  P+G 
Sbjct  187   VSRYVEKTDEDVTGVSDSVRFGYTIDGSDAVFVRSCPEFEPEWFSLLQDLYRKPVFPIGF  246

Query  937   LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQ  758
             LP       EDDD    W+ IKEWLDKQ   SVVYV+ G+E    +EE+ E+ALGLE S+
Sbjct  247   LPPVI----EDDDDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLRREELTELALGLEKSE  302

Query  757   LPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSGW  578
              PFFWV R +         ++P+GFEER +GRG++   W PQ+KILSH+SVGGFLTH GW
Sbjct  303   TPFFWVLRNE--------PQIPDGFEERVKGRGMVHVGWVPQVKILSHESVGGFLTHCGW  354

Query  577   SSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVVM  398
             +SVVE + F K  I  P L +QG+ TRLL  K +G  + RDE DGSF  DSVA+S+R+VM
Sbjct  355   NSVVEGIGFGKVPIFLPVLNEQGLNTRLLQGKGLGVEVLRDERDGSFGSDSVADSVRLVM  414

Query  397   VEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             +++ G+   EKVK MK      ++   YV++L+ ++ 
Sbjct  415   IDDAGEEIREKVKLMKGLFGNMDENIRYVDELVGFMR  451



>ref|XP_006353004.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Solanum tuberosum]
Length=474

 Score =   400 bits (1027),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 208/438 (47%), Positives = 288/438 (66%), Gaps = 10/438 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVP  1502
             M +E   LH+VM PWLA GHIIP+  L+K LA+RG+++ F+STPRNI+R+  K+   L P
Sbjct  1     MENEKERLHVVMFPWLAMGHIIPFFHLSKCLAQRGHRVTFISTPRNIERVVNKVPSDLAP  60

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLS---PDWVI  1331
              + ++  PLP+VENLP DAES++D+PY K ++LKIAFD L+  +  FL++ S   PDW++
Sbjct  61    LLHILSFPLPKVENLPNDAESSMDIPYQKAQFLKIAFDLLEIPLTNFLESSSNPKPDWIV  120

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVP  1151
             +D+AS  L  I  KL +   +FS+FTA+  + + P  A+++  D    P+  T  PKW+P
Sbjct  121   YDYASHWLPQIAGKLGVSRAFFSLFTAATMSFYGPPWALLN--DDRSIPEDYTVIPKWIP  178

Query  1150  FETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
              ET ++ R  E+++ F +A  D    SD  R G ++ G+  +  R+C E EPEW  L  E
Sbjct  179   LETKVVYRLHEIKKNF-EAPADESGTSDGVRFGASIDGSDVILFRNCVEFEPEWFSLVCE  237

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP I +G+LP +  ++E+ D     WL IK WLDKQ + SVVYVA G+E   NQEE+
Sbjct  238   LYQKPVISIGVLPPSVVENEKFDSNDTTWLGIKNWLDKQNQDSVVYVALGTEATLNQEEL  297

Query  790   VEIALGLELSQLPFFWVYRKQ--RGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
              E+ALGLE   LPF WV R Q      D+ + +LP+G+E+R + RGVI   W PQ KILS
Sbjct  298   NELALGLEKCGLPFIWVLRDQPIHNQEDSRI-QLPDGYEDRVKNRGVIYKGWVPQTKILS  356

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H SVGGFLTH GW+SV+EAL F + LIM P L DQG+ TRLL EK +G  I R+E DG F
Sbjct  357   HLSVGGFLTHCGWNSVIEALCFGRVLIMFPVLNDQGLNTRLLQEKGVGVEIPRNEKDGFF  416

Query  436   SRDSVAESLRVVMVEEHG  383
             + DSVAE+++  +V E G
Sbjct  417   TSDSVAEAVKFGVVSEEG  434



>ref|XP_006292848.1| hypothetical protein CARUB_v10019108mg [Capsella rubella]
 gb|EOA25746.1| hypothetical protein CARUB_v10019108mg [Capsella rubella]
Length=472

 Score =   399 bits (1024),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 215/467 (46%), Positives = 296/467 (63%), Gaps = 10/467 (2%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPN  1499
               + + +H+ M PWLAFGH +PYLEL+KL+ ++G+ + F+STPRNI RL P+L   +   
Sbjct  9     GEDGTKIHVAMFPWLAFGHFVPYLELSKLMVQKGHTVSFISTPRNIDRLLPRLPEDVSSA  68

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I+ + LP P    LPEDAE+T+D+P     YLKIAFD LQ  +  FL++  PDW++ DFA
Sbjct  69    INFVKLPFPGHNKLPEDAEATIDVPLHLGSYLKIAFDGLQVPLTEFLESSKPDWLLQDFA  128

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              + L PI  +L I + YFS +  +  AI  P        +    P+   + PKWVPFET 
Sbjct  129   PYWLPPIASRLGIKNAYFSAYNCACFAIHKPPGFE----EYRTSPEDFLTSPKWVPFETP  184

Query  1138  IMPRNFEMERVFNDAYIDG--GNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
                + FE + +FN   ++   G+++D+ R+   + G     VRS  E E EW  L +++ 
Sbjct  185   AFCQQFESKFIFNGFMLESSEGDIADVDRIAGVLNGCDIFVVRSSNEYEAEWFTLVQQLY  244

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
             GKP IPVG+LP      EE       WL  K+WLD +E  SVVYV+FG+E KP+Q E+  
Sbjct  245   GKPVIPVGVLPPKP---EEKFKDTDTWLATKKWLDSRETNSVVYVSFGTEAKPSQTELNA  301

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             IALGLELS LPFFWV R QRG  D E  +LPEGFEERT  RG++   W  QL+ LSHDS+
Sbjct  302   IALGLELSGLPFFWVLRTQRGPWDTEPLELPEGFEERTADRGMVWRGWVEQLRTLSHDSI  361

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             G  L+HSGWS+++EA++F K ++M  F+ DQG   R++ EK++G  I RD+  GSF+++ 
Sbjct  362   GLVLSHSGWSTIIEAVRFAKPMVMLSFVYDQGFNLRVVEEKKIGRMILRDDTTGSFTKED  421

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             V +SLR+VM EE GKV+ E VK MK    + E+QD YV+  LDYL A
Sbjct  422   VTKSLRLVMDEEEGKVYRENVKDMKKVFGDMEQQDRYVDSFLDYLVA  468



>ref|XP_009623131.1| PREDICTED: UDP-glycosyltransferase 91C1 [Nicotiana tomentosiformis]
Length=476

 Score =   399 bits (1024),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 204/437 (47%), Positives = 283/437 (65%), Gaps = 8/437 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M +E   LHIVM PWLA GHIIP+  L+K LA+RG+++ F+STPRN++RL K+   L P 
Sbjct  1     MENERKPLHIVMFPWLAMGHIIPFFHLSKCLAQRGHRVTFISTPRNLERLGKVPSDLTPL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLS---PDWVIH  1328
             ++++ +PLP+VENLP+ AES++D+PY K ++LKIAFD L+  +  FL+ LS   PDW+++
Sbjct  61    LNIVSIPLPKVENLPDQAESSMDIPYQKAQFLKIAFDLLETPLITFLENLSNPKPDWIVY  120

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPF  1148
             D+AS  L      L +   +FS+FTA+  A F P  A+++  D    P+  T  P W+ F
Sbjct  121   DYASHWLPHRARDLGVSCAFFSLFTAATMAFFGPPRALLN--DERSIPEDYTVVPNWISF  178

Query  1147  ETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
             ET +  R  E+++ F +A  +    SD  R G ++ G+  V  R+C E EPEW  L  E+
Sbjct  179   ETDVKYRLHEIKKNF-EAPANESGTSDGARFGGSIDGSDFVLFRTCVEFEPEWFNLVSEL  237

Query  967   VGKPTIPVGLLPTTA--YddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
               KP I +G+LP +    +D         WL IK+WLDKQ + SVVYVA G+E+  +Q+E
Sbjct  238   FQKPVISIGVLPPSIEDNEDLGRSSNNTTWLSIKKWLDKQNQNSVVYVALGTESTLSQKE  297

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
             + E+ALGLE   LPFFWV R Q      E   LP+G+EER + RGVI   W PQ KILSH
Sbjct  298   LNELALGLEKCGLPFFWVIRNQPKLNQEESQILPDGYEERVKNRGVIYRGWVPQAKILSH  357

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
              S+GGFLTH GW+SV+EAL F + LIM P + DQG+ TRLL  K +G  I R+ENDG F+
Sbjct  358   LSIGGFLTHCGWNSVIEALCFGRVLIMFPVMNDQGLNTRLLQCKGVGVEIPRNENDGLFT  417

Query  433   RDSVAESLRVVMVEEHG  383
              +SVAE+++  +V E G
Sbjct  418   SESVAETVKFAVVSEEG  434



>ref|XP_004250156.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Solanum 
lycopersicum]
Length=483

 Score =   399 bits (1024),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 215/473 (45%), Positives = 301/473 (64%), Gaps = 15/473 (3%)
 Frame = -3

Query  1681  AMASESST--LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHL  1508
             A   ES+T  LHIVM PWLAFGHIIP+LEL+K +A +G+KI F+S+PRNI RLPK+    
Sbjct  10    ANGDESNTKKLHIVMFPWLAFGHIIPFLELSKFIARKGHKISFISSPRNIDRLPKIPSEF  69

Query  1507  VPNIDLIGLPLPQVENLPEDAESTLDL-PYDKVRYLKIAFDELQDSMAAFLQTLSPDWVI  1331
               +I  + +PL +++ LP+DAE+T+D+   +++ YLK A D ++  +  FL+   PDW+I
Sbjct  70    SNSITFVKIPLAKIDGLPKDAEATIDIITSEEMTYLKKAMDGMEKDVTNFLENSCPDWII  129

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTASINAIF------FPQSAVIDGVDSPVEPKHTTS  1169
              DFA + L PI  +L I  +++SI    INA F      F      +   SP + +    
Sbjct  130   QDFAQYWLAPISTRLGISRIFYSI----INAWFLSFLGSFENMINTNNCTSPPKLEDFLV  185

Query  1168  KPKWVPFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEW  989
              PKW+PFET    R  E   +   +  +   VSD+YR GVT++GA A+ +R C+E E +W
Sbjct  186   PPKWIPFETKATYRLHEARWMVESSQKNVSGVSDMYRNGVTIEGADAIIIRHCHEFEGQW  245

Query  988   LQLAEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETK  809
             L+L E++   P +P GL+P     +    +K  +W+ IK+WLD++ KGSVVYVA GSE  
Sbjct  246   LKLLEDLHHMPVLPTGLMPPIV--ESSSHEKNESWISIKDWLDEKPKGSVVYVALGSEVT  303

Query  808   PNQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQL  629
               Q E+ E+A GLELS  PFFWV RK  G    +   LP+GFEERT+ RG++  SWAPQL
Sbjct  304   VGQNEINELARGLELSGSPFFWVLRKSSGLGSIDPIVLPDGFEERTKDRGIVWKSWAPQL  363

Query  628   KILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDEN  449
             KILSH+SVGG LTH GWSS++E L F   LIM PFL DQG+  R+L +K +G  + R+E 
Sbjct  364   KILSHESVGGLLTHCGWSSIIEGLIFGHPLIMLPFLVDQGLNARILQDKGVGVEVPRNEE  423

Query  448   DGSFSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              G+++ DSV  S+++VMVE  GK+  EK K+M A    KE  D Y+  L+++L
Sbjct  424   GGTYTSDSVVNSVKLVMVENDGKIIREKAKEMSAIFGNKELHDKYIENLINFL  476



>ref|XP_010680364.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Beta 
vulgaris subsp. vulgaris]
Length=468

 Score =   398 bits (1022),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 212/460 (46%), Positives = 308/460 (67%), Gaps = 9/460 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNIDLIGL  1481
             LHIV+ PWLAFGH+IP+LEL+K LA + + I +VS PRN++RL  K+  +L+P I+L+ +
Sbjct  7     LHIVVFPWLAFGHMIPFLELSKHLAIKRHHISYVSAPRNLERLLSKIPQNLIPFIELVPV  66

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP-DWVIHDFASFRLV  1304
             PLP+V  LP +AE+T D+P+D V  LK  +D L++ +A FL+  SP DW+I+D+ S+ L 
Sbjct  67    PLPRVGKLPPNAEATSDVPFDDVELLKKTYDGLKEPLARFLEASSPIDWIIYDYPSYWLP  126

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVI-DGVDSPVEPKHTTSKPKWVPFETTIMPR  1127
             PI ++L I  V+ S+     +A F P S +I DG  +   P++ TS  +WVPF   I+ R
Sbjct  127   PIADRLGIQKVFLSLMNGWSSATFGPSSKMIKDGDGTWSNPENLTSPLEWVPFNNNIVYR  186

Query  1126  NFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
               E +     A  +   VSD++R G +V+      +RSC ELE E+LQL EE+ GKP +P
Sbjct  187   FHEAKNSLGAAQTNASGVSDMFRSGSSVRDCDIFAIRSCRELEAEYLQLLEELHGKPVVP  246

Query  946   VGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLE  767
             VGL+P +   +E    K   W  +K WLD+  K SVVYV+ GSE   +Q+E+ E+ALGLE
Sbjct  247   VGLMPVSV--EEGQRAKDDTWQSMKGWLDEHTKNSVVYVSLGSEFALSQDEITELALGLE  304

Query  766   LSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
             LS LPFFW  RKQ G+      +LP+GFEERTRGRG++ T+WAPQ ++L+HDSVG FLTH
Sbjct  305   LSMLPFFWALRKQAGTQ----PELPDGFEERTRGRGLVWTNWAPQTQLLAHDSVGAFLTH  360

Query  586   SGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLR  407
              GWSS++E L+F + L+M PF+ DQG+  R++ +K++G  I R+  DGSF++ SVA+SL+
Sbjct  361   CGWSSIIEGLQFGRPLVMLPFVLDQGLNARVMEQKKVGIEIPRNNRDGSFNKISVAQSLK  420

Query  406   VVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             VV  + HG ++ ++ KKM   + +K   + Y+ +   YLH
Sbjct  421   VVCGDIHGTIYRDEAKKMSRMVADKNLHNQYMEEFEAYLH  460



>ref|XP_011099970.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=502

 Score =   399 bits (1025),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/467 (45%), Positives = 301/467 (64%), Gaps = 7/467 (1%)
 Frame = -3

Query  1678  MASES----STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPH  1511
             MAS++      LH+VM PWLAFGH+IP+LEL+K +A +G+KI F+STPRNI RLPKL P 
Sbjct  32    MASKAFNGGRQLHVVMFPWLAFGHMIPFLELSKFIAGKGHKITFISTPRNIDRLPKLPPD  91

Query  1510  LVPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVI  1331
             LV +I    +PLP++E LPE+AE+T+D+  ++V +LK A+D ++D +  FL+   PD +I
Sbjct  92    LVSSIAFAKIPLPKLEGLPENAEATMDVLPEEVEHLKKAYDGMEDDLTQFLENSDPDIII  151

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVP  1151
             +DFA   L  I  +L I   +F IF A   A      A+I+G+D     ++  + P+WV 
Sbjct  152   YDFAPHWLPAIATRLRISRFFFCIFNAWFFAFLGNTKAMINGLDDRTRLENFLAPPEWVT  211

Query  1150  FETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             FET +  R +E + +   A  +    SD YR G  + G +A+ +R C E E +WL++ EE
Sbjct  212   FETKVAYRLYEADLILCAAVTNASGFSDFYRAGKVIAGCNAMIIRHCNEFESKWLKVLEE  271

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +     IP+GL+P   +  +  D    AW+ I  WL  Q K SVVYVA GSE   +++++
Sbjct  272   LHQIEVIPLGLMP--PHVQDTSDSSNEAWVSITNWLCSQIKESVVYVALGSEVVLSRDQI  329

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              E+A GLELS LPF W +RK  GS +A+  +LP+GFE R +GRGV+  +WAPQLKIL H+
Sbjct  330   SELAHGLELSGLPFLWAFRKPAGSREADF-ELPDGFEGRIKGRGVVLKNWAPQLKILGHE  388

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             +VG FLTH GWSS+VE L F   LIM PF+ DQG+  R+L E+++G  I R+E DGS++R
Sbjct  389   AVGAFLTHCGWSSIVEGLTFGHPLIMLPFVIDQGLNARVLAERQVGVEIPRNEQDGSYTR  448

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             ++VA+SLR VMVE  G+   +  K M     ++E  D Y++  ++YL
Sbjct  449   NAVAQSLRRVMVEVEGQKLRDTAKAMSILFGDRELHDRYLHNFVEYL  495



>ref|XP_006353159.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Solanum tuberosum]
Length=484

 Score =   397 bits (1021),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 212/464 (46%), Positives = 300/464 (65%), Gaps = 5/464 (1%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             S +  LHIVM PWLAFGHIIP+LEL+K +A +G+KI F+STPRNI RLPK+      +I 
Sbjct  15    SNTKKLHIVMFPWLAFGHIIPFLELSKFIARKGHKISFISTPRNIDRLPKIPSEFSNSIT  74

Query  1492  LIGLPLPQVENLPEDAESTLDL-PYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
              + +PLP+++ LP+DAE+T+D+   +++ YLK A D ++  +  FL+   PDW+I DFA 
Sbjct  75    FVKIPLPKIDGLPKDAEATIDIITSEEMTYLKKAMDGMEKDVTNFLEKNCPDWIIQDFAQ  134

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIF--FPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             + L PI  KL I  +++SIF A   +    F +    +   SP + +     PKW+PFET
Sbjct  135   YWLAPISAKLGISRIFYSIFNAWFISFHGSFEKMINTNNCTSPPKLEDFLVPPKWIPFET  194

Query  1141  TIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
                 R  E   +   +  +   VSD+YR GVT++G+ A+ VR C+E E +WL+L E++  
Sbjct  195   KAAYRLHEARWMVGSSQKNVSGVSDVYRCGVTIRGSDAIIVRHCHEFEGQWLKLLEDLHH  254

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
              P +P GL+P     +   D+K  +W+ IKEWLD++ KGS+VYVA GSE      E+ E+
Sbjct  255   IPVLPTGLMPPLV--ESSSDEKNESWISIKEWLDEKPKGSIVYVALGSEVTVGPSEINEL  312

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             A GLELS  PFFWV RK  G  + +   L +GFEERT+G+G++  SWAPQ+KILSH SVG
Sbjct  313   AHGLELSGSPFFWVLRKPSGVENIDPIVLLDGFEERTKGQGIVWKSWAPQMKILSHKSVG  372

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH GWSS +E L F   LIM PFL DQG+  R+L +K +G  + R+E +GS++ +SV
Sbjct  373   GFLTHCGWSSTIEGLMFGHPLIMLPFLVDQGLNARILEDKGVGVEVPRNEENGSYTSNSV  432

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             A S+++VMV   GK+  EK K+M+A    KE  D Y+  L+ +L
Sbjct  433   ANSVKLVMVGNDGKLIREKAKEMRAIFGNKELHDRYIENLIKFL  476



>gb|AFJ53032.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=458

 Score =   396 bits (1018),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 221/427 (52%), Positives = 287/427 (67%), Gaps = 12/427 (3%)
 Frame = -3

Query  1645  MLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLPLPQ-  1469
             M PWLAFGHI+P+L+LAKL+A+RG+ I F+STPRNI RLPKL P L   I  + LPLP  
Sbjct  1     MFPWLAFGHILPFLQLAKLIAQRGHLISFISTPRNIDRLPKLPPALSSLITFVKLPLPSS  60

Query  1468  -VENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPIME  1292
              V+ LP  AE+T DL    V YLK A+D LQ  ++ FLQ+ +PD++I D+A F L PI  
Sbjct  61    DVQGLPHAAEATSDLEARHVGYLKRAYDLLQHQLSTFLQSSNPDFIICDYAPFWLPPIAR  120

Query  1291  KLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI-MPRNFEM  1115
             +L IP+V+FSIF AS+ A   P +   D  D     +  T KP+WVPFETT    R FE 
Sbjct  121   RLGIPTVFFSIFIASVLAFTSPPADDEDE-DYRKTVEDLTEKPRWVPFETTSGYYRPFEA  179

Query  1114  ERVFNDAYIDGGN--VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVG  941
             +  F  A + GG     +L+R    ++G   V VR+C ELE +WL+L E++  KP  P+G
Sbjct  180   KVSFEMAVVGGGGQEFPELHRFRQMLRGCDFVAVRTCPELEHDWLKLLEQIHKKPVFPIG  239

Query  940   LLPTTAYddeedddkkaAWLEIKEWLDK-QEKGSVVYVAFGSETKPNQEEVVEIALGLEL  764
             +LP     +E+++  +  W  IKEWLD  +EKGSVVYVAFGSE  P+QEE+ EIA GLEL
Sbjct  240   VLPN-PIKEEDEEGDEDTWKSIKEWLDDGKEKGSVVYVAFGSEAIPSQEELTEIATGLEL  298

Query  763   SQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHS  584
             S LPFFWV R    S+D    +LPEGFEERT GRG++   WAPQ+KIL H+SVG    HS
Sbjct  299   SGLPFFWVLR----SSDDPRRELPEGFEERTAGRGLVWKGWAPQVKILGHESVGCMFCHS  354

Query  583   GWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRV  404
             GWSSVVEAL+F + L++  F  DQG+ ++LL EK +GY + R+++DG F R+SVAESLR 
Sbjct  355   GWSSVVEALQFGRPLVLLTFYADQGLNSKLLQEKGLGYLVPRNDDDGRFRRESVAESLRT  414

Query  403   VMVEEHG  383
             VM+ E G
Sbjct  415   VMLAEEG  421



>ref|XP_007018258.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY15483.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=466

 Score =   397 bits (1019),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 210/460 (46%), Positives = 299/460 (65%), Gaps = 3/460 (1%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             S  LHIVM PWLA GH IP+  L+KLLA+RG++I FVSTPRN+ +LPK+  +L   I L+
Sbjct  4     SKVLHIVMFPWLAMGHFIPFFRLSKLLAQRGHRISFVSTPRNLSKLPKIPSNLSSQITLV  63

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
               PLP+V NLP  AES++D+ +++ + LK AFD LQ  + +FL++  PDW+I+D+AS  L
Sbjct  64    SFPLPEVPNLPSLAESSMDITHNQQQPLKHAFDLLQPLLTSFLESSKPDWIIYDYASHWL  123

Query  1306  VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSK-PKWVPFETTIMP  1130
               +  +L +   +F++FTA+  +   P SA+I+G D         +K PKWVPFE+ +  
Sbjct  124   PSVAAQLGVSRAFFAVFTAACLSFLGPPSALINGGDGARSTADDFTKVPKWVPFESNLAY  183

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R  E+ +       D     D  R GVT++ +  V +RS  E EP+W  L  ++  KP  
Sbjct  184   RLHEITKYVERTDEDTFGPPDTVRFGVTIQESDVVVIRSSDEFEPDWFNLLRQLFEKPVT  243

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             PVG LP     +E++  K   W+ +KEWLDKQ   SVVYVA G+E   ++EE+ ++A+GL
Sbjct  244   PVGFLP--PILEEDEIQKDEKWVVVKEWLDKQRVNSVVYVALGTEVHLSKEELSDLAMGL  301

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             E S LPFFWV +K  GS+ +E+  LP+G EER +GRG +   W PQ+KILSH+S+GGFLT
Sbjct  302   EKSGLPFFWVLKKSPGSSQSELDMLPDGLEERVKGRGFVHLGWVPQVKILSHESIGGFLT  361

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             H GW+SV+EAL   + LIM P L DQG+  RLL E+++G  I R+E DGSF+ D VAES+
Sbjct  362   HCGWNSVIEALGLGRVLIMFPVLNDQGLNARLLHERKVGVEIPRNEIDGSFTSDEVAESV  421

Query  409   RVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             R+ +VEE G+   E V+ +K+   +K + D YV+K +  L
Sbjct  422   RLAVVEESGQSLRETVQAIKSYFGDKGRNDGYVDKFVRQL  461



>ref|NP_199780.1| UDP-glycosyltransferase 91C1 [Arabidopsis thaliana]
 sp|Q9LTA3.1|U91C1_ARATH RecName: Full=UDP-glycosyltransferase 91C1 [Arabidopsis thaliana]
 dbj|BAA98157.1| anthocyanidin-3-glucoside rhamnosyltransferase-like [Arabidopsis 
thaliana]
 dbj|BAC41828.1| putative anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis 
thaliana]
 gb|AAO63454.1| At5g49690 [Arabidopsis thaliana]
 gb|AED95845.1| UDP-glycosyltransferase 91C1 [Arabidopsis thaliana]
Length=460

 Score =   395 bits (1014),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 209/458 (46%), Positives = 292/458 (64%), Gaps = 13/458 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             +H+ M PWLA GH++P+L L+KLLA++G+KI F+STPRNI+RLPKL  +L  +I  +  P
Sbjct  9     MHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLQSNLASSITFVSFP  68

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP +  LP  +ES++D+PY+K + LK AFD LQ  +  FL+  SPDW+I+D+AS  L  I
Sbjct  69    LPPISGLPPSSESSMDVPYNKQQSLKAAFDLLQPPLKEFLRRSSPDWIIYDYASHWLPSI  128

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
               +L I   +FS+F A+      P S++I+ + S   P+  T  P WVPF++ I+ R  E
Sbjct  129   AAELGISKAFFSLFNAATLCFMGPSSSLIEEIRS--TPEDFTVVPPWVPFKSNIVFRYHE  186

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
             + R       D   VSD  R G ++  + AVFVRSC E EPEW  L +++  KP  P+G 
Sbjct  187   VTRYVEKTEEDVTGVSDSVRFGYSIDESDAVFVRSCPEFEPEWFGLLKDLYRKPVFPIGF  246

Query  937   LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQ  758
             LP      E+DD     W+ IK+WLDKQ   SVVYV+ G+E     EEV E+ALGLE S+
Sbjct  247   LPPV---IEDDDAVDTTWVRIKKWLDKQRLNSVVYVSLGTEASLRHEEVTELALGLEKSE  303

Query  757   LPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSGW  578
              PFFWV R +         K+P+GF+ R +GRG++   W PQ+KILSH+SVGGFLTH GW
Sbjct  304   TPFFWVLRNE--------PKIPDGFKTRVKGRGMVHVGWVPQVKILSHESVGGFLTHCGW  355

Query  577   SSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVVM  398
             +SVVE L F K  I  P L +QG+ TRLL  K +G  ++RDE DGSF  DSVA+S+R+VM
Sbjct  356   NSVVEGLGFGKVPIFFPVLNEQGLNTRLLHGKGLGVEVSRDERDGSFDSDSVADSIRLVM  415

Query  397   VEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             +++ G+    K K MK      ++   YV++L+ ++ +
Sbjct  416   IDDAGEEIRAKAKVMKDLFGNMDENIRYVDELVRFMRS  453



>gb|AFJ53033.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=464

 Score =   395 bits (1014),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 222/463 (48%), Positives = 309/463 (67%), Gaps = 9/463 (2%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             + LHI M PWLAFGHI+P+L+LAKL+A +G+KI F+ST +NI RLP++     P I  + 
Sbjct  4     TKLHIAMFPWLAFGHILPFLQLAKLIASKGHKISFISTSKNIDRLPQIRQ---PLITFVK  60

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             L LP V+ LP  A ST DLP + V YLK A+D L+  +A FL++ +PDW++ D+  F L 
Sbjct  61    LNLPSVDGLPPTAHSTSDLPIEDVHYLKKAYDLLKPQLADFLRSSNPDWIVFDYVPFWLP  120

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
             P+  +L+IP+VYFSIF AS+ A   P    +   +   + +  T++P+W+   +T+  R 
Sbjct  121   PLARELNIPTVYFSIFLASVMAFVGPP---VGEAEYREKTEDYTARPRWMKLNSTVYYRR  177

Query  1123  FEMERVFNDAYIDG--GNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             FE E+ F     DG    V + +R   +++G   + VRSC E+E E+L L EE+ GKP  
Sbjct  178   FEAEKAFPAISGDGELRIVPEFHRFQQSLRGCDLIAVRSCREIELEYLDLLEEIQGKPVF  237

Query  949   PVG-LLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             P+G LL       E+     + WL I++WLD+ +KGSVVYVAFGSE KP+Q+E+ EIA G
Sbjct  238   PIGVLLSEDNSGSEDSISGGSDWLGIRKWLDEHKKGSVVYVAFGSEAKPSQDELTEIATG  297

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LE+S LPFFWV R +R   D EV +LP+GFE RT+G+GV+   WAPQ+KIL+HDSVGGFL
Sbjct  298   LEISGLPFFWVLRTRRSPDDPEVLELPDGFEVRTQGKGVVWKGWAPQVKILTHDSVGGFL  357

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             THSGWSSVVE+L+F + L++  F  DQG+ ++LL EK +GY + RDE DG F+R++VAES
Sbjct  358   THSGWSSVVESLQFGRPLVLLTFYADQGLNSKLLQEKGVGYLVPRDELDGRFTREAVAES  417

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             +R+V+ EE G+   +K  +MK      EK  +YV   L YL A
Sbjct  418   VRMVVDEEDGRRHRDKAGEMKELFGHVEKHRSYVGDFLRYLEA  460



>emb|CDP00928.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   393 bits (1009),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 202/432 (47%), Positives = 280/432 (65%), Gaps = 5/432 (1%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             S  LH+VM PWLA GH+IP+L L+K LA++G+KI F+STPRN+QR+PK+   L   I+++
Sbjct  4     SKFLHVVMFPWLAMGHLIPFLRLSKCLAQKGHKISFISTPRNLQRIPKVPHDLASLIEMV  63

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQ--TLSPDWVIHDFASF  1313
              +PLP+ +NLP+  ES++D+P++K ++LKIAFD LQ  +A FL+  T  PDW+++D+AS 
Sbjct  64    SIPLPEGDNLPKQGESSMDVPHEKEQFLKIAFDLLQSPIATFLENTTPKPDWILYDYASH  123

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              L  I  K  I   YFS+FTA+  A   P S +++ VD     +  T  PKW+PF   I 
Sbjct  124   WLPEIAAKNGIARAYFSLFTAATMAYIGPPSILLNEVDGRSTAEAFTRVPKWIPFPLNIA  183

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R  E+ +   D+  +    SD+ R    ++G+  V  R+C E EPEW  L  E+  KP 
Sbjct  184   YRLHEVAKHIEDSSGNESGTSDVIRFAAAIEGSDLVVFRTCVEFEPEWFDLVCELYKKPV  243

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             I +G+LP +   ++++ +    WL IK+WLDKQ    VVYVA G+E    Q EV E+ALG
Sbjct  244   ISLGVLPPSLD-EDDELETDETWLSIKDWLDKQSVSRVVYVALGTEVALGQTEVHELALG  302

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEER--TRGRGVICTSWAPQLKILSHDSVGG  599
             LE S+LPFFWV RK  GS       LPEGF ER    GRGVI T W PQ+KILSH ++GG
Sbjct  303   LEQSELPFFWVLRKSPGSTKDVSQMLPEGFTERINANGRGVIYTEWVPQVKILSHPAIGG  362

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             +LTH GW+SV+EAL F + LI+ P + DQG+  RLL  K++G  I R+  DGSF+  +VA
Sbjct  363   YLTHCGWNSVIEALGFGRVLILFPVMNDQGLNARLLEGKKVGVEIPREAEDGSFTSTAVA  422

Query  418   ESLRVVMVEEHG  383
             E+LR+ +V E G
Sbjct  423   ETLRLAVVSEDG  434



>ref|XP_011020572.1| PREDICTED: UDP-glycosyltransferase 91C1 [Populus euphratica]
Length=473

 Score =   392 bits (1008),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 206/462 (45%), Positives = 293/462 (63%), Gaps = 2/462 (0%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             + + L +VM PWLA GH+IP+L L+KLLAE+G+KI+FVSTPRN+ RLPK+   L   I L
Sbjct  3     DGNRLQVVMFPWLATGHLIPFLRLSKLLAEKGHKIYFVSTPRNLNRLPKIPKQLSSEIIL  62

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             +  P P V NLP  AES+ D+PY K + LK  FD L+  +  FL++  PDW+ +D+AS  
Sbjct  63    VSFPFPHVPNLPSCAESSTDVPYTKQQLLKKGFDLLEPPLTTFLESSKPDWIFYDYASHW  122

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L  +  +L I   +FS+FTA+  +   P S +++  DS  + +  T  PKW+PFE+ I+ 
Sbjct  123   LSSVAARLGISCAFFSLFTAACLSYIGPPSTLMNIGDSRSKAEDFTVVPKWIPFESDIVF  182

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQ-LAEEVVGKPT  953
             R  E+ +       D    SD  R G    G+  V +RS  E EPEW   L +++  KP 
Sbjct  183   RLHEVTKYVEKTEEDETGPSDSIRFGFAAGGSDVVIIRSSPEFEPEWFNLLHDQLYKKPI  242

Query  952   IPVGLL-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
             IPVG L P   +++E+D      W  IKEWLDKQ+  SVVYVA G+E   + EE+ E+AL
Sbjct  243   IPVGFLPPIVEHNEEDDTKDGLKWGNIKEWLDKQKANSVVYVALGTEASLSGEELKELAL  302

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLE S LPFFWV  K  GS    +  LP+GF+ER + RG++   WAPQ+KILSHDSVGGF
Sbjct  303   GLENSTLPFFWVLNKIPGSTKNALDMLPDGFQERVKNRGIVHGGWAPQVKILSHDSVGGF  362

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             +TH GW+S++E L F + LI+ P L DQG+ +RLL  K++G  I R E DGSF+  SVAE
Sbjct  363   MTHCGWNSIIEGLTFGRVLILLPILNDQGLNSRLLHGKKLGLEIPRKEQDGSFTWASVAE  422

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             S+R  MV++ G  +  + ++++    + ++ + +V +L++YL
Sbjct  423   SMRTAMVDDSGVPWRNRAREIRCLFGDVDRNNCFVARLVNYL  464



>ref|XP_006282295.1| hypothetical protein CARUB_v10028581mg [Capsella rubella]
 gb|EOA15193.1| hypothetical protein CARUB_v10028581mg [Capsella rubella]
Length=458

 Score =   391 bits (1005),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 206/424 (49%), Positives = 275/424 (65%), Gaps = 11/424 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             +HI M PWLA GH++P+L L+KLLA++G+KI F+STPRNIQRLPKL P+L  +I  +  P
Sbjct  9     MHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNIQRLPKLPPNLSSSITFVSFP  68

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP +  L   +ES++D+PY+K + LK AFD LQ  +  FL   SPDW+++D+AS  L  I
Sbjct  69    LPLISGLSPTSESSMDVPYNKQQSLKAAFDLLQPPLKEFLLVSSPDWIVYDYASHWLPSI  128

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
               +L I   +FS+F A+      P S++ID V +   P   T  P WVPF++ I+ R  E
Sbjct  129   AAELGISKAFFSLFNAATLCFQGPSSSLIDEVRT--TPDDFTVVPPWVPFKSNIVFRYHE  186

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
             + R       D   VSD +R G +++G+ AVFVRSC + EPEW  L + +  KP  P G 
Sbjct  187   VARYVEKTDKDVTGVSDSFRFGYSIEGSDAVFVRSCPKFEPEWFGLLKVLYQKPVFPTGF  246

Query  937   L-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELS  761
             L P    +DE++D+    W+ IKEWLDKQ   SVVYV+ G+E    +EEV E+ALGLE S
Sbjct  247   LPPVIVDEDEDEDEDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLRREEVTELALGLEKS  306

Query  760   QLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSG  581
             + PFFWV R +         K P+GFEER +GRG++   W PQ+KIL H+SVGGFLTH G
Sbjct  307   ETPFFWVLRNK--------PKFPDGFEERVKGRGMVHVGWVPQVKILRHESVGGFLTHCG  358

Query  580   WSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVV  401
             W+SVVE L F K  I  P L +QG+ TRLL  K +G  + RDE DGSF   SVAES+R+V
Sbjct  359   WNSVVEGLGFGKVPIYLPVLNEQGLNTRLLHGKGLGVEVLRDERDGSFDSYSVAESVRLV  418

Query  400   MVEE  389
             MV++
Sbjct  419   MVDD  422



>ref|XP_009774870.1| PREDICTED: UDP-glycosyltransferase 91C1 [Nicotiana sylvestris]
Length=472

 Score =   392 bits (1006),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 202/435 (46%), Positives = 277/435 (64%), Gaps = 7/435 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M +E   LH+VM PWLA GHIIP+  L+K LA+RG+K+ F+STP+NI+RL K+   +   
Sbjct  1     MENERKPLHVVMFPWLAMGHIIPFFHLSKWLAQRGHKVTFISTPKNIERLDKVPSDIAHL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLS---PDWVIH  1328
             +++I +PLP+VENLP+ AES++D+PY K ++LKIAFD L+  +  FL+  S   PDW+++
Sbjct  61    LNIISIPLPKVENLPDHAESSMDIPYQKAQFLKIAFDLLETPLITFLENSSNPKPDWIVY  120

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPF  1148
             D+AS  L      L +   +FS+FTA+  A F P   +++  D    P+  T  P W+PF
Sbjct  121   DYASHWLPQRARDLGVSCAFFSLFTAATMAFFGPPQVLLN--DERSIPEDYTIVPNWIPF  178

Query  1147  ETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
             ET +  R  E+++ F +A  D    SD  R G ++ G+  V  R+C E EPEW  L  E+
Sbjct  179   ETDVKYRLHEIKKNF-EAPADESGTSDGARFGGSIDGSDVVLFRTCVEFEPEWFNLVSEL  237

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP I +G+LP +  +D         WL IK+WLD Q + SVVYVA G+E   +Q+E+ 
Sbjct  238   FQKPVISIGVLPPS-IEDLGRGSNDTTWLSIKKWLDMQNQNSVVYVALGTEATLSQKELN  296

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             E+ALGLE   LPFFWV R Q      E   LP G+EER + RGVI   W PQ KILSH S
Sbjct  297   ELALGLEKCGLPFFWVIRNQPRMNQEESQMLPNGYEERVKNRGVIYRGWVPQTKILSHSS  356

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             +GGFLTH GW+SV+EAL F   LIM P + DQG+ TRLL  K +G  I R+ENDG F+ +
Sbjct  357   IGGFLTHCGWNSVIEALCFGWVLIMFPVMNDQGLNTRLLQGKGVGVEIPRNENDGLFTSE  416

Query  427   SVAESLRVVMVEEHG  383
             SVAE+++  +V E G
Sbjct  417   SVAETVKFAVVSEEG  431



>ref|XP_010518639.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=469

 Score =   392 bits (1006),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 210/464 (45%), Positives = 298/464 (64%), Gaps = 10/464 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNI  1496
              + + LH+ M PWLAFGH++P+LEL+ L+ ++G+ + F+STP NI RL P+L  +L   I
Sbjct  9     GDGTKLHVAMFPWLAFGHLVPHLELSILMVQKGHNVSFISTPGNIDRLLPRLPENLSSAI  68

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
             + + LP    + LP DAE+T D+P+D V YLKIAFD L+  +  FL++L PDW++ DFA 
Sbjct  69    NFVKLPFAGHKKLPVDAEATTDVPFDLVPYLKIAFDGLRVPLTEFLESLKPDWLLQDFAP  128

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
             + L PI  +L I + YF  F   I  I  P        +    P+   +KPKWVPFET +
Sbjct  129   YWLPPIARRLGIKNAYFGAFNCGIFGILKPPGFE----EYRKSPEDFVTKPKWVPFETPV  184

Query  1135  MPRNFEMERVFNDAYIDG--GNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
               + FE + +FN A ++   GN+ DL R+   + G   + +RSC E E EWL+L +++  
Sbjct  185   FFQLFESKAIFNGAVVESTEGNIPDLDRIAGVLDGCDIIVIRSCNEYETEWLELLQDLHR  244

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             KP IPVG+LP      +E      AWL  K+WLD ++  SVVYV+FG+E KP+Q E   I
Sbjct  245   KPVIPVGVLPPK---LDETFKDTDAWLSTKKWLDSRKTNSVVYVSFGTEAKPSQSEFNSI  301

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLELS LPFFW  R +RG  D+E  +LPEGFEERT  RG++   W  QL+ L+HDS+G
Sbjct  302   ALGLELSGLPFFWALRTRRGPWDSEPLELPEGFEERTADRGMVWRGWVEQLRTLNHDSIG  361

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
               L+HSGW++++EA++F K ++M  F+  QG   R+  EK++G+ I R+E  GSF+++ V
Sbjct  362   LVLSHSGWNTLIEAVRFAKPMVMIGFVYGQGFNARVAEEKKIGHMILREETTGSFTKEDV  421

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             A++LR+VM  E GKV+ E VK MK    + E QD YV+  LDYL
Sbjct  422   AQALRLVMEGEEGKVYRESVKDMKGVFGDMETQDRYVDSFLDYL  465



>ref|XP_010506987.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=469

 Score =   392 bits (1006),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 211/466 (45%), Positives = 297/466 (64%), Gaps = 10/466 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNI  1496
              +   LH+ M PWLAFGH++P+LEL+ L+ ++G+ + F+STP NI+RL P+L  +L   I
Sbjct  9     GDGPKLHVAMFPWLAFGHLVPHLELSMLMVQKGHNVSFISTPGNIERLLPRLPENLSSAI  68

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
             + + LP    + LP+ AE+T D+P+D V YLKIAFD L+  +A FL++  PDW++ DFA 
Sbjct  69    NFVKLPFAGHKELPDAAEATTDVPFDLVPYLKIAFDGLRTPLAEFLESSKPDWLLQDFAP  128

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
             + L PI  +L I + YF  F   I  I  P        +    P+    +PKWVPFET +
Sbjct  129   YWLPPIASRLGIKNAYFGAFNCGIFGILKPPGFE----EYRKSPEDFVLQPKWVPFETPV  184

Query  1135  MPRNFEMERVFNDAYIDG--GNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
               + FE + +FN A ++   GN+ D  R+   + G   + +RSCYE E EWL+L +++  
Sbjct  185   FFQLFESKAIFNGAVVESTEGNIPDFDRIAGVLDGCDIIVIRSCYEYEAEWLELLQDLHR  244

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             KP IPVG+LP      +E      AWL  K+WLD +   SVVYV+FG+E KP+Q E   I
Sbjct  245   KPVIPVGVLPPK---LDETFKDTDAWLSTKKWLDSRGTNSVVYVSFGTEAKPSQSEFNSI  301

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLELS LPFFWV R +RG  D E  +LPEGFEERT  RG++   W  QL+ L+HDS+G
Sbjct  302   ALGLELSGLPFFWVLRTRRGPFDTEPLELPEGFEERTADRGMVWRGWVEQLRTLNHDSIG  361

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
               L+HSGW++++EA++F K ++M  F+  QG   R+  EK++G+ I RDE  GSF+++ V
Sbjct  362   LVLSHSGWNTLIEAVRFAKPMVMIGFVYGQGFNARVAEEKKIGHMILRDETTGSFTKEDV  421

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             A++LR+VM  E GKV+ E VK MK    + E QD YV+  LDYL A
Sbjct  422   AQALRLVMEGEEGKVYRESVKDMKGVFGDMETQDRYVDSFLDYLVA  467



>ref|XP_009623239.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Nicotiana 
tomentosiformis]
Length=449

 Score =   390 bits (1003),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 216/466 (46%), Positives = 290/466 (62%), Gaps = 33/466 (7%)
 Frame = -3

Query  1681  AMASESST--LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHL  1508
             A  +ES+T  LH+VM PWLAFGHI+P+LEL+K +A++G+KI F+STPRNI RLPKL    
Sbjct  2     ANGAESNTNKLHVVMFPWLAFGHIVPFLELSKFIAQKGHKISFISTPRNIDRLPKLPLEF  61

Query  1507  VPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIH  1328
               +I  I + LP+V+ LPE+AE+T+D+  +++ YLK A D ++  +  FL+  SPDW+I 
Sbjct  62    STSITFIKISLPKVDGLPENAEATMDITTEEIIYLKKAMDGMEKEVTNFLEKNSPDWIIQ  121

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPF  1148
             DFA + L PI  K    + Y   F +S                            K   F
Sbjct  122   DFAQYWLAPISAK---TTAYGGGFLSST---------------------------KMDTF  151

Query  1147  ETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
             ET    R  E   +   +  +   VSDLYR GVT+ GA A   R C+E E +WL+L E++
Sbjct  152   ETKAAYRRHEARWIVGSSQKNVSGVSDLYRNGVTMIGADATIFRHCHEFEGQWLKLLEDL  211

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
                P IP GL+P    ++  D+    +W+ IKEWLD++ KGSVVYVA GSE    + E+ 
Sbjct  212   HNIPIIPSGLMPPMV-ENNNDEKNYQSWISIKEWLDEKPKGSVVYVALGSEVTIGRNEIN  270

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             E+ALGLELS+ PFFWV RK  GS   +  +LPEGFEER +GRG++  SWAPQL ILSHDS
Sbjct  271   ELALGLELSESPFFWVLRKPSGSGITDPIELPEGFEERIKGRGIVWKSWAPQLNILSHDS  330

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VGGFLTH GWSS++E L F   LIM PFL DQG+  R+L +K +G  I R+E DGS++ D
Sbjct  331   VGGFLTHCGWSSIIEGLMFGHPLIMLPFLVDQGLNARILEDKGVGVEIPRNEEDGSYTSD  390

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             SVA S+ +VMVE  GK+  EK K+M +    K   D Y+  L+++L
Sbjct  391   SVANSVNLVMVENEGKIIREKAKEMISIFGNKNLHDKYIENLIEFL  436



>ref|XP_008779257.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1, partial 
[Phoenix dactylifera]
Length=423

 Score =   389 bits (1000),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/422 (48%), Positives = 273/422 (65%), Gaps = 5/422 (1%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +  LHI + PWLAFGH++P+L+L+K LA RG++I F++TPRNIQRLPK+ PHL P ID +
Sbjct  4     NGALHIAVFPWLAFGHMLPFLQLSKSLAMRGHRISFLATPRNIQRLPKIPPHLAPLIDFV  63

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP--DWVIHDFASF  1313
              +PLP+VE LPE+AE+T DLP D+V+YLK+AFD L  ++ +FL   SP  DW+I DFA  
Sbjct  64    SMPLPKVEGLPENAEATPDLPKDQVQYLKVAFDRLGGALESFLDEASPKPDWIILDFACH  123

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              +  +     +P  +FS+F A   A + P  ++  G D+ +E    T+ PK + FET++ 
Sbjct  124   WVPKLASMFGVPCAFFSVFAAPFLAFWRPSESISRGGDNVLE--ELTAPPKGISFETSVA  181

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R  E  RV      +   V D  RL +TV+G   V  RSC+EL  +WL   +E+ GKP 
Sbjct  182   FRLHEARRVIRGYVNNASGVCDADRLLLTVEGCKVVAPRSCWELHSDWLCYLQELYGKPV  241

Query  952   IPVGLLP-TTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
             IPVGLLP  T       D           WLDKQ  GSVVY AFGSET  + E + E+A 
Sbjct  242   IPVGLLPPATDDGGAGVDATSRESNNALRWLDKQAPGSVVYAAFGSETVLSTEMLHELAF  301

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELSQ+PF WV RK    AD     LPEGFE+RTR RGVI   W  QL++L+H SVGG 
Sbjct  302   GLELSQVPFLWVIRKPVDIADEGREILPEGFEDRTRDRGVIAMGWIDQLEVLAHASVGGC  361

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTHSGWSSV+E+L+    LIM PF+ DQGII R++ E+ +G  + R+E DGSF+R+ +A+
Sbjct  362   LTHSGWSSVIESLQLGHLLIMLPFIVDQGIIARVMEERRIGIEVPRNEEDGSFNREELAK  421

Query  415   SL  410
             ++
Sbjct  422   AI  423



>gb|KGN48693.1| hypothetical protein Csa_6G498410 [Cucumis sativus]
Length=416

 Score =   389 bits (998),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 212/457 (46%), Positives = 296/457 (65%), Gaps = 58/457 (13%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLP-KLHPHLVPNIDLIGL  1481
             LHIV+ PW+AFGH+IP+LEL+KL+A++G+++ FVSTP+NI RLP KL PHL   +  + L
Sbjct  7     LHIVIFPWIAFGHMIPFLELSKLIAQKGHRVSFVSTPKNIDRLPTKLPPHLSSFLRFVKL  66

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVP  1301
             P PQ+ +LP DAE+T D+PY                                        
Sbjct  67    PFPQINDLPPDAEATSDVPY----------------------------------------  86

Query  1300  IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNF  1121
               +K+ I +  F +F   +              D+ ++P+  T  P WVPF T ++ R+F
Sbjct  87    --DKVHIFTPEFLVFVGPMFG------------DNRIKPEDFTVSPHWVPFPTNVVFRHF  132

Query  1120  EMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVG  941
             E+ R+F+    +   VSDLYR+ ++   +  V VR C E   EW+QL  +V GKP  PVG
Sbjct  133   EIMRIFDSVAGNITGVSDLYRMKMSAHYSDLVVVRGCPEFGQEWIQLLGDVYGKPIFPVG  192

Query  940   LLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELS  761
              LPT+ Y+  +++     W  IKEWLDKQ K SVVYVAFGSE KP+Q E+ EIALGLE S
Sbjct  193   QLPTSEYETGDENPA---WERIKEWLDKQPKDSVVYVAFGSEAKPSQNELTEIALGLEKS  249

Query  760   QLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSG  581
             +L FFWV+R +RG +D +  +LPEGFEERT+GRGV+ T+WAP+LKIL H+S+GGFLTHSG
Sbjct  250   ELRFFWVFRTRRGPSDPDPIELPEGFEERTKGRGVVWTTWAPRLKILRHESMGGFLTHSG  309

Query  580   WSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVV  401
             WSSVVEA++ EK L++  FL DQG+  R+L EK+MGY + R+E DGSF+RD+VAESL++V
Sbjct  310   WSSVVEAIQSEKALVLLTFLADQGMNARVLEEKKMGYPVPRNELDGSFTRDAVAESLKLV  369

Query  400   MVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +VEE GK++ E +++ K     KE+ D  +++LLD++
Sbjct  370   VVEEEGKIYRETIREAKDLFVNKERDDKLIDRLLDHM  406



>ref|XP_011001966.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Populus euphratica]
Length=435

 Score =   388 bits (997),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 200/389 (51%), Positives = 270/389 (69%), Gaps = 2/389 (1%)
 Frame = -3

Query  1450  DAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPIMEKLSIPSV  1271
             DAE+T+DLP +KV+YLKIA D++Q+  A  L++L PDW+ +DFA +   PI  +L I S 
Sbjct  38    DAEATIDLPANKVQYLKIALDKVQEPFAKVLESLDPDWIFYDFAQYWTGPIAAQLGIKST  97

Query  1270  YFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFEMERVFNDAY  1091
             YFSI  A++ A   P S +IDG D   +P+     PKWV F+TT+  + +++   F+   
Sbjct  98    YFSICIAAMVAFIGPPSPLIDGDDYRKKPEDFMIPPKWVSFQTTVAYKYYDIINTFDCVE  157

Query  1090  IDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGLLPTTAYdde  911
              D   V+DL R G+ ++    + VRS +E+EPEWL + E +  KP  PVG LP   Y  E
Sbjct  158   DDASGVNDLMRWGLCLQSCDFIAVRSSFEIEPEWLHVLETIHEKPVFPVGQLPPVEYALE  217

Query  910   edddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQLPFFWVYRK  731
             E +     W  +K+WLD QEK SVVYVAFGSE KP Q ++ E+ALGLELS LPFFWV R 
Sbjct  218   EKNSDA--WSSMKKWLDMQEKSSVVYVAFGSEAKPTQAQLTELALGLELSGLPFFWVLRT  275

Query  730   QRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSGWSSVVEALKF  551
             +RG AD ++ +LP GFEERT+G+GV+CT+WAPQL IL+H+S+ GFLTHSGWSSVVEAL F
Sbjct  276   RRGIADTDLIELPPGFEERTKGQGVVCTTWAPQLMILAHESIAGFLTHSGWSSVVEALTF  335

Query  550   EKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVVMVEEHGkvfa  371
             +K LI+  F  DQGI  R+L EK++GY+I R+E DGSF+RDSVAESLR+VMV E GK++ 
Sbjct  336   QKALILLTFYSDQGINARVLEEKKIGYSIPRNELDGSFTRDSVAESLRLVMVSEEGKIYR  395

Query  370   ekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             +  K+M     + ++QD YV+ +L YL +
Sbjct  396   DMAKEMSGLFGDTDRQDRYVDNILIYLKS  424



>ref|XP_004287416.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Fragaria vesca 
subsp. vesca]
Length=469

 Score =   389 bits (1000),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 277/429 (65%), Gaps = 16/429 (4%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPH--LVPNIDLIG  1484
             LH+V+ PWLA GH+IP+  L+KL+A++G+K+ F+STPRN+QRLPK+ PH  L   I L+ 
Sbjct  13    LHLVVFPWLAMGHLIPFFHLSKLIAQKGHKVSFISTPRNLQRLPKIPPHSSLSSLITLVP  72

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             LPLP VENLP+DAES+ D+PY+K + LK AFD L+  MA FL++ +PDWV++D+AS  L 
Sbjct  73    LPLPHVENLPDDAESSNDVPYNKQQLLKKAFDLLESPMADFLESSAPDWVVYDYASHWLP  132

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
             P+  KL +   YF +FTA+  A+  P S +IDG D   + +  T    W+PF++ +  R 
Sbjct  133   PLAAKLGVSRAYFCLFTAACMAVIGPPSLLIDGQDKRTKTEDFTVVSPWIPFKSDMAFRY  192

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK--PTI  950
              E+ +  ++   +     D  R G+ V+ +  V +RS  E EPEW +L  E+ G+  P +
Sbjct  193   HEVAKYVHE---NESGTPDTVRFGIAVRDSDVVLMRSSEEFEPEWFELLRELYGRSIPVL  249

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             PVG LP    +             +K+WLD+Q   SVVYVA G+E   +Q E+ E+ALGL
Sbjct  250   PVGFLPPLVEEKPT---------RVKDWLDEQRVNSVVYVALGTEATLSQGELTELALGL  300

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             E S LPFFWV R    S  A    LP+GF ER R RG++   WAPQ+ ILSHDSVGGFLT
Sbjct  301   ERSGLPFFWVLRDPPESTRAVSEMLPDGFLERVRDRGMVHFGWAPQVWILSHDSVGGFLT  360

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             H GW+S++E L F K LI+ P L DQG+  RL   K +G  I R+E DGSF+RD+VAE +
Sbjct  361   HCGWNSMIEGLGFGKVLILFPMLNDQGLNARLANGKGLGVEIPRNELDGSFTRDAVAEFV  420

Query  409   RVVMVEEHG  383
             R+ MVEE G
Sbjct  421   RLAMVEEEG  429



>ref|XP_010506988.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=470

 Score =   388 bits (997),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 211/464 (45%), Positives = 296/464 (64%), Gaps = 10/464 (2%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNIDL  1490
              + LH+ M PWLAFGH++P+L+L+ L+ ++G+ + F+STPRNI RL P+L  +L   ++ 
Sbjct  12    GTKLHVAMFPWLAFGHLVPHLQLSMLMVQKGHTVSFISTPRNIDRLLPRLPENLSSALNF  71

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + LP      LPEDAEST D+P D V YLKIAFD LQ  +  FL++  PDW++ DFA + 
Sbjct  72    VKLPFAGHNKLPEDAESTTDVPLDLVPYLKIAFDGLQVPLTEFLESSKPDWLLQDFAPYW  131

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L PI  +L I + YFS    S   I  P        +    P+   ++PKWVPF+T +  
Sbjct  132   LPPIASRLGIKNGYFSALNCSFLGILKPPGFE----EYRTSPEAFLTQPKWVPFQTPVPF  187

Query  1129  RNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
             R +E++ +F D  ++    N+ D+ RL   + G   + VRSC E E EW +L +++  KP
Sbjct  188   RLYEIQPMFEDIMLEHTEENIPDMDRLAGVIDGCDIIVVRSCTEYEAEWFRLIKDLHRKP  247

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVG+LP      EE      AWL  K+WLD ++  SVVY++FGSE KP+Q E+  IAL
Sbjct  248   VIPVGVLPPKP---EEKFKDTDAWLSTKKWLDSRKTNSVVYISFGSEVKPSQTELNAIAL  304

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS+LPFFWV R +RG  D E  +LPEGFEERT  RG++   W  QL+ L+HDS+G  
Sbjct  305   GLELSRLPFFWVLRTRRGPWDTEPLELPEGFEERTAERGIVWRGWVEQLRTLNHDSIGLV  364

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH GWS+++EA++F K ++M  F+ DQG   R+  EK++G+ I RDE  G F+++ V++
Sbjct  365   LTHCGWSTMIEAVRFAKPMVMLGFVLDQGFNARVAEEKKVGHMIPRDETTGFFTKEDVSK  424

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SLR+VM  E GKV+ E VK MK    + + QD YV+  LDYL A
Sbjct  425   SLRLVMEGEEGKVYRENVKDMKGVFGDMDTQDRYVDSFLDYLFA  468



>ref|XP_002303861.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|EEE78840.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=473

 Score =   388 bits (997),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 206/462 (45%), Positives = 294/462 (64%), Gaps = 2/462 (0%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             + + L +VM PWLA GH+IP+L+L+KLLAE+G+KI+FVSTPRN+ RLPK+   L   I L
Sbjct  3     DGNRLQVVMFPWLATGHLIPFLQLSKLLAEKGHKIFFVSTPRNLNRLPKIPKQLSSEIIL  62

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             +  P P V NLP  AES+ D+PY K + LK  FD L+  +  FL++  PDW+ +D+AS  
Sbjct  63    VSFPFPHVPNLPSCAESSTDVPYTKQQLLKKGFDLLEPPLTTFLESSKPDWIFYDYASHW  122

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L  +  +L I   +FS+FTA+  +   P SA++   D   + +  T  PKW+PFE+ ++ 
Sbjct  123   LPSVAARLGISCAFFSLFTAACLSYIGPPSALMTIGDPRSKAEDFTVVPKWIPFESDLVF  182

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQ-LAEEVVGKPT  953
             R  E+ +       D    SDL R G    G+  V +RS  E EPEW   L +++  KP 
Sbjct  183   RLHEVTKYVEKTEEDETGPSDLIRFGFAAGGSDVVIIRSSPEFEPEWFNLLHDQLYKKPI  242

Query  952   IPVGLL-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
             IPVG L P   +++E+D+     W  IKEWLDKQ+  SVVYVA G+E   + EE+ E+AL
Sbjct  243   IPVGFLPPIVEHNEEDDNIDGHEWSNIKEWLDKQKVHSVVYVAIGTEASLSGEELKELAL  302

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLE S LPFFWV  K  GS    +  LP+GF+ER + RG+I   WAPQ+KILSHDSVGGF
Sbjct  303   GLENSTLPFFWVLNKIPGSTKNALDMLPDGFQERVKNRGIIHGGWAPQVKILSHDSVGGF  362

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             +TH GW+S++E L F + LI+ P L +QG+ +RLL  K++G  I R E DGSF+  SVAE
Sbjct  363   MTHCGWNSIIEGLTFGRVLILLPILNEQGLNSRLLHGKKLGLEIPRKEQDGSFTWASVAE  422

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             S+R  MV++ G  +  + ++++    + ++ + +V  L++YL
Sbjct  423   SMRTAMVDDSGVSWRNRAREIRYLFGDVDRNNCFVASLVNYL  464



>ref|XP_010535333.1| PREDICTED: UDP-glycosyltransferase 91C1 [Tarenaya hassleriana]
Length=461

 Score =   385 bits (990),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 216/466 (46%), Positives = 293/466 (63%), Gaps = 13/466 (3%)
 Frame = -3

Query  1678  MASES-STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
             MA+E   T+H+VM PWLA GH++P+L L+KLLA +G++I FVSTPRNI RLPKL P L  
Sbjct  1     MATEEIKTMHVVMFPWLAMGHLLPFLRLSKLLARKGHRISFVSTPRNISRLPKLPPDLTT  60

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
              I  +   LP V  LP DAES++D+PY+  + LK AFD LQ  +  FL+  SP+WV++D+
Sbjct  61    MITFVPFTLPPVSGLPLDAESSMDVPYNTQQRLKAAFDLLQIPVTEFLRRSSPEWVVYDY  120

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             AS  L  I  ++ +   YFSIF A+    F P   +I   DS   P+  T  P WVPFE+
Sbjct  121   ASHWLPKIAAEIGVSKAYFSIFNAASMCFFGPPEELI--ADSRTSPEDFTVVPTWVPFES  178

Query  1141  TIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
              I  R  E+ +       D   VSD  R G ++  + AV VRSC E EPEW  L  ++ G
Sbjct  179   DIAFRIHEITKYVEKTEEDETGVSDAVRFGYSIGESDAVLVRSCPEFEPEWFGLLLDLYG  238

Query  961   KPTIPVGLLPTTAYdd--eedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
             KP +P G LP    ++   E++D+   W+ IK+WLD+Q   SVVYVA G+E +  ++E+ 
Sbjct  239   KPVVPTGFLPLVMEEEVFVENNDEDTTWIGIKKWLDEQRVNSVVYVALGTEARVTRKELG  298

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             E+ALGLE S LPFFWV R +        +KLP+G+ ER +GRG++   W PQ+KILSHDS
Sbjct  299   EMALGLEKSALPFFWVLRNE--------SKLPDGYMERVKGRGLVHFGWVPQVKILSHDS  350

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VGGF+TH GWSSV+E L   +  I+ P + DQG+  RLL  K +G  I RDE DGSFS D
Sbjct  351   VGGFVTHCGWSSVIEGLGLGRVPILFPVVNDQGLNARLLQGKGLGVEIPRDERDGSFSCD  410

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             SVA+S+R  M +E  +    KVK+MK+    K+    +V++L+ YL
Sbjct  411   SVADSIRSAMADESDEPVRAKVKEMKSLFGNKDTDMRHVDELVRYL  456



>gb|KFK32801.1| hypothetical protein AALP_AA6G289900 [Arabis alpina]
Length=471

 Score =   386 bits (991),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 214/468 (46%), Positives = 304/468 (65%), Gaps = 23/468 (5%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNIDLIGL  1481
             L++ M P+LAFGH++PYLEL+KL+A++G+ + F+STPRNI RL P+L  +L   I+ I L
Sbjct  15    LYVAMFPFLAFGHMVPYLELSKLMAQKGHTVSFISTPRNIDRLLPRLPENLSSAINFIKL  74

Query  1480  PLPQV-ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             PL  V + LPE  E+T DLP++ + YLKIA+D L+  +  FL++  PDWV+ DFA + L 
Sbjct  75    PLSTVGDKLPEGGEATTDLPFELISYLKIAYDGLRVPVTEFLESSKPDWVLQDFAPYWLP  134

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSK------PKWVPFET  1142
             PI   L I + +FS F  +   +  P          P   ++ T +      PKWVPFET
Sbjct  135   PISRHLGIKTAFFSAFNGATLGLLKP----------PGFEEYRTCQADFLTPPKWVPFET  184

Query  1141  TIMPRNFEMERVFNDAYIDG--GNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
              +  + FE + +F    ++   GNV D++R+   + G   + VRSCYE E EWL L +++
Sbjct  185   PVAFKLFECKDIFKGFMVETTEGNVPDVHRVAGVIDGCDVIAVRSCYEYEAEWLGLIQDL  244

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP IPVG+LP      EE  +    W+ IK WLD ++  SVV+VAFGSE KP+  EV 
Sbjct  245   HRKPVIPVGVLPPKP---EEKFEDTDTWVTIKAWLDSRKSKSVVHVAFGSEAKPSHTEVD  301

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
              IALGLELS LPFFWV + +RG  D E  +LPEGFEERT  RG++   W  QL+ LSHDS
Sbjct  302   AIALGLELSGLPFFWVLKTRRGPWDTEPVELPEGFEERTADRGMVWKGWVEQLRTLSHDS  361

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             +G  LTH GW +++EA++F K ++M  F+ DQG+  R++ EK++GY I R+E +G F+++
Sbjct  362   IGLVLTHPGWGTIIEAVRFGKPMVMLVFVCDQGLNARVIEEKKIGYMIPREEKEGLFTKE  421

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             SVA+SLR+VM EE GKV+ E VK+MK    + ++QD YV+  ++YL A
Sbjct  422   SVAKSLRLVMEEEEGKVYRENVKEMKNVFGDMDRQDRYVDDFMEYLVA  469



>ref|XP_009112190.1| PREDICTED: UDP-glycosyltransferase 91B1 [Brassica rapa]
Length=455

 Score =   385 bits (989),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 213/469 (45%), Positives = 288/469 (61%), Gaps = 25/469 (5%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA  +  LH+ + PWLA GH+IPYL+L+KL+A +G+ + F+STPRNI RLPK      P+
Sbjct  1     MAEPNHKLHVAVFPWLALGHMIPYLQLSKLIATKGHTVSFISTPRNIARLPK-----TPS  55

Query  1498  IDLIGLPLPQV--ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
             I+ + LPLP     NLPE+AEST D+P   + YLK AFD L +  + FLQ   PDW+++D
Sbjct  56    INFVSLPLPHAVDNNLPENAESTTDVPETHIAYLKKAFDGLSEPFSQFLQASKPDWIVYD  115

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPF  1148
                + + PI EKL +    F  F A SI  I  P S +I+G D     +     P WVPF
Sbjct  116   ILHYWVPPIAEKLGVRRALFCTFNAASIIVIDGPSSIMINGRDPRKTVEDLMDPPPWVPF  175

Query  1147  ETTIMPRNFEMERV--FNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             ET I+ R FE  R+  +  A + G  ++D YR G+   G+  + +R+C ELEPEW+QL  
Sbjct  176   ETNIVYRAFEARRILEYPTAGVTGAELNDSYRTGLASAGSEVIAIRTCTELEPEWIQLLG  235

Query  973   EVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
             E+ GKP IP+GLLP  A DD+ D        +I EWLD+Q   SVVYVA G+E   N++E
Sbjct  236   EIQGKPVIPIGLLPAKATDDDVD-------DDIIEWLDRQRAKSVVYVALGTEVTVNEKE  288

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
             +  +A GLELS LPFFW  RK           LP+GFEER +GRGV+   W PQ +ILSH
Sbjct  289   IQGLAHGLELSGLPFFWTIRKAS-------VFLPDGFEERVKGRGVVRAEWVPQGRILSH  341

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
              SVGGF+TH GW SVVE L F   LIM P   DQ ++ R+L    +G  I R+E DGSF+
Sbjct  342   GSVGGFVTHCGWGSVVEGLSFGVPLIMFPCNLDQPLVARMLAGMNIGREIPRNERDGSFT  401

Query  433   RDSVAESLRVVMVEEHGkvfaekvkkmkakl-fekeKQDNYVNKLLDYL  290
               SV E++R+V+VEE GK++ +  + M+  +   +  QD YV+  + +L
Sbjct  402   SVSVVETIRLVVVEEEGKIYRDNAESMQKNVFGNRRLQDQYVDSFIKFL  450



>gb|AFJ53031.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=477

 Score =   385 bits (988),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 287/441 (65%), Gaps = 16/441 (4%)
 Frame = -3

Query  1681  AMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
             A  + + +LHI M PWLAFGHI+P+L+LAKL+A+RG+ I F+STPRNI RLPKL P L  
Sbjct  2     ASTNNNKSLHIAMFPWLAFGHILPFLQLAKLIAQRGHTISFISTPRNIDRLPKLPPALSS  61

Query  1501  NIDLIGLPLPQ--VENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLS---PDW  1337
              I  + LPLP   V+ LP  AE+T DL    V YLK A+D LQ  ++ FLQ+ S   PD+
Sbjct  62    LITFVKLPLPSSDVQGLPPAAEATSDLEARHVGYLKRAYDLLQHPLSTFLQSSSSHPPDF  121

Query  1336  VIHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKW  1157
             +I D+A F L  +  +L IP+V+FSIF AS  A   P +   D  D     +    KP+W
Sbjct  122   IICDYAPFWLPAVARRLGIPTVFFSIFIASSLAFSSPPADDEDE-DYRRAAEDLAEKPRW  180

Query  1156  VPFETTI-MPRNFEMERVFNDAYIDGGN--VSDLYRLGVTVKGASAVFVRSCYELEPEWL  986
             VPFETT    R FE +  F    + GG     +++R    ++G   + VR+C ELE +WL
Sbjct  181   VPFETTSGYFRPFEAKASFEMVLVGGGGQEFPEIHRFRQMLRGCDYIAVRTCPELEYDWL  240

Query  985   QLAEEVVGKPTIPVGLLPT-TAYddeedddkkaAWLEIKEWL-DKQEKGSVVYVAFGSET  812
             +L E++  KP  P+G+LP     +DE+++  +  W  IKEWL D +E+GSVVYVAFGSE 
Sbjct  241   KLLEQMHKKPVFPIGVLPNPIKEEDEKEEGDEDTWKSIKEWLNDGKERGSVVYVAFGSEA  300

Query  811   KPNQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQ  632
              P+QEE+ EIA+GLELS LPFFWV R        +  +LPEGFEERT GRGV+   WAPQ
Sbjct  301   IPSQEELTEIAIGLELSGLPFFWVVRSSN-----DHRELPEGFEERTAGRGVVWKGWAPQ  355

Query  631   LKILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDE  452
             +KIL H+SVG    HSGWSSVVEAL+F   L++  F  DQG+  +LL EK +GY + R++
Sbjct  356   VKILGHESVGCLFCHSGWSSVVEALQFGHPLVLLTFYADQGLNAKLLQEKGVGYLVPRND  415

Query  451   NDGSFSRDSVAESLRVVMVEE  389
             +DG F R+SVAESLR VM+ E
Sbjct  416   DDGRFRRESVAESLRAVMLAE  436



>ref|XP_010934416.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=465

 Score =   384 bits (985),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 212/462 (46%), Positives = 290/462 (63%), Gaps = 6/462 (1%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E  +L IV  PWLAFGH++P+L+L+K LA+RG++I F+STPRN+QRLPK+ P L P I  
Sbjct  2     EGGSLRIVFFPWLAFGHMLPFLDLSKSLAKRGHRISFLSTPRNLQRLPKIPPDLAPLIHF  61

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP--DWVIHDFAS  1316
             + LPLP+VE LPE AEST D+  D+V++LK AFD L    + FL+  SP  DW+IHDF  
Sbjct  62    VSLPLPKVEGLPEAAESTTDVRPDEVQFLKKAFDGLAIPFSKFLEESSPKPDWIIHDFGH  121

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
               L PI     IP  + SI  AS  A   P S +     S   P+  T  P+W+ F T++
Sbjct  122   HWLPPIASGFHIPCAFLSILPASFIAFVGPPSEMKR--SSRRTPEQFTKPPEWISFPTSV  179

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
                  E + +      +   ++DL R  +TV+G   V  RSC+E E +WL+L EE+  KP
Sbjct  180   AYHLHEAKWMVEAFKANASGIADLQRFCLTVEGCHFVAFRSCFEFESDWLRLLEELYKKP  239

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVGLLP    +   DD    A   I EWLD Q   SVVYVA GSE   + E + E+AL
Sbjct  240   VIPVGLLPPQVQEGSPDDVHGKA--RIFEWLDTQAPKSVVYVALGSEAMLSIELLHELAL  297

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS++PF W  RK  G A  +   LPEGFEERT G+GV+   W PQ+K+L+H SVGGF
Sbjct  298   GLELSKVPFLWALRKPAGMAGDDADILPEGFEERTEGQGVVAKGWIPQIKVLAHASVGGF  357

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH GW S++E L+F   L++ P   DQG+  R++ EK++G  I R+E DGSF+R+SVA+
Sbjct  358   LTHCGWGSIIEGLRFGHGLMLLPIAVDQGLNARIMGEKKIGLEIQRNEVDGSFNRESVAK  417

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             ++R VMVEE G+ F  K ++++    +K+ Q+ Y+   + +L
Sbjct  418   AIRSVMVEEEGEPFRFKAQELQHVFADKDSQERYMENFIRHL  459



>ref|XP_010910495.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=472

 Score =   384 bits (985),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 211/462 (46%), Positives = 294/462 (64%), Gaps = 9/462 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LH+V+ PWLAFGH++P+LEL+K LA+RG++I F+STPRNI+RLP + P +   +DL+ LP
Sbjct  6     LHVVVFPWLAFGHMLPFLELSKSLAKRGHRISFLSTPRNIRRLPNIPPQIASLVDLVSLP  65

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP--DWVIHDFASFRLV  1304
             LP+V+ LPEDAE+T DLP  +V+YLK AFD L +  A FLQ +SP  DW+IHDF    + 
Sbjct  66    LPKVDGLPEDAEATTDLPPPEVQYLKKAFDGLDEPFARFLQEVSPKPDWIIHDFCHHWIS  125

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAV-IDGVDSPVEPKHTTSKPKWVPFETTIMPR  1127
             PI  +  +P  +FSI  +S      P S + + G+     P+  T  P+W+ F ++   R
Sbjct  126   PIASRSKVPCAFFSIIPSSSLVFLGPPSEMKLGGLRR--TPEQFTKPPEWISFPSSAAFR  183

Query  1126  NFEMERVFNDAYIDGGN-VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
               E  RVF + Y D  +  SD+ RL   ++G   V +RSC E E +WL L EE+  K T+
Sbjct  184   LHEA-RVFMEHYRDNASGFSDIQRLERIIQGCELVAIRSCKEFESDWLALLEELYEKKTV  242

Query  949   -PVGLLPTTAYddeedddkkaAWL-EIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              PVGLLP    +  ED         ++ EWL+ Q  GSVVYVA GSE   + E + E+AL
Sbjct  243   VPVGLLPPHVQERIEDVHTNTTGAAQVFEWLNGQTPGSVVYVALGSEAMLSVELMHELAL  302

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS++PF W  RK  G    +V  LPEGFE+RTRG GV+   W PQL +L+H SVGGF
Sbjct  303   GLELSEVPFVWALRKPAGMGAGDVEILPEGFEDRTRGLGVVAKGWIPQLSVLAHPSVGGF  362

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH GWSS++E L+F   LI+ P   DQG+I R++ EK++G  + R+E DGSFS++ VA+
Sbjct  363   LTHCGWSSIIEGLQFGHALILLPLFVDQGLIARIMEEKKIGLEVPRNEEDGSFSKEGVAK  422

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             ++R++MVEE  + F  K   +K    +   Q+ YV+  +  L
Sbjct  423   AIRLIMVEEEAEPFRCKAGDLKEVFSDNGSQERYVDNFVRCL  464



>ref|XP_009408288.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   383 bits (983),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 193/465 (42%), Positives = 298/465 (64%), Gaps = 6/465 (1%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             +  +LHIVMLPWLAFGH++P++EL+K +A+ G+++  + T RNIQRLP++ PHL   +  
Sbjct  2     DDGSLHIVMLPWLAFGHLLPFMELSKRMAQHGHRVSLLVTKRNIQRLPRVPPHLSSLLQF  61

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDELQDSMAAFL-QTLS--PDWVIHDF  1322
             + LP+P +E+LPE+AE+++DLP D++R YL+ AFD  Q  +++FL QTL   PDW++ D+
Sbjct  62    VELPMPSIEHLPENAEASIDLPSDELRPYLRQAFDTFQHQLSSFLRQTLPRVPDWILFDY  121

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             A++    +  +  +P  Y  +F A++ + F P ++++    +   P+     P+WVPFE+
Sbjct  122   AAYWAPRVAAEFGVPCAYLGLFNAAVLSFFGPSASLMGCEGARETPEQFMELPEWVPFES  181

Query  1141  TIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             T+  + +E   +F    + D   VS+ YR G T++    + VRSC E EP+W  L  ++ 
Sbjct  182   TVFFKPYEARELFKPGVLPDASGVSEAYRFGRTLEDCQLISVRSCPEFEPDWFHLLGKLH  241

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              +P IPVG  P +  + + D++    W  I +WL KQ+  SVVYVAFGSE K    +V E
Sbjct  242   KRPVIPVGFFPPSPQESDTDEESDRRWRSIFQWLAKQKPESVVYVAFGSEVKLTSSQVHE  301

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             IALGLE SQLPF W  R    S  +    LPEGFEERT+GRG++C  W PQ ++L+H S+
Sbjct  302   IALGLEGSQLPFVWALRAPADSHGSPAA-LPEGFEERTQGRGLVCLGWVPQARLLAHPSM  360

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGFLTH+GW+S+VE L     +++ P + DQG+  R LVE+++   + R+E DGSF+ + 
Sbjct  361   GGFLTHAGWNSIVEGLALGLPVVLMPLMFDQGLNARNLVERKISVEVPRNEEDGSFTGEG  420

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +A +LR+VMVEE G+    K K+ +    +++  D +V + L YL
Sbjct  421   IATTLRLVMVEEQGQPLRAKAKEYREVFGDEKLNDRHVWEFLKYL  465



>gb|KDP41496.1| hypothetical protein JCGZ_15903 [Jatropha curcas]
Length=481

 Score =   383 bits (983),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 270/424 (64%), Gaps = 1/424 (0%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M +    LH+V+ PWLA GH+IPY   + LLA++G+K+ FVSTPRN+  LPK+ P L  N
Sbjct  1     MENSRKQLHVVVFPWLAMGHLIPYHRFSILLAQKGHKVSFVSTPRNLLNLPKIPPKLSSN  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I LI LPLP +  LP +AE+T D+PY K + LK AFD L+  + AFLQ + PDWVI+D+A
Sbjct  61    ISLISLPLPSIPALPPNAETTTDIPYVKQQLLKKAFDFLRSPLIAFLQKVKPDWVIYDYA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S  L  I+ +L I + +FS+F A+  +   P S +++G D  +  +  T  PKWVPFE+ 
Sbjct  121   SHWLPSIVAELGISTAFFSLFNAATLSFIGPPSMLMNGGDLRLTAEDFTVVPKWVPFESN  180

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             I  R  E+ +       D   ++D  R G  +  A  V VRS  ELEPEW  L  ++  +
Sbjct  181   IAYRVHEVTKYVEKTEEDETGLTDSVRFGFAIGNADLVIVRSSPELEPEWFDLFGKLSQR  240

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P IP+G LP    ++E ++     W +IKEWLDK E  SVVYVA G+E+   ++EV E+ 
Sbjct  241   PNIPIGFLPPLV-EEENNNADVGGWADIKEWLDKHEAKSVVYVALGTESALTKKEVRELG  299

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLE S  PFFWV R    S    +  LP+GF+ER + RG++ T WAPQ+ ILSH+SVG 
Sbjct  300   LGLEKSSSPFFWVLRNSPESTQNVLEMLPDGFQERVKDRGIVYTRWAPQVNILSHESVGT  359

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH GW+SVVE L F K LI+ P L DQG+  RLL  K++G  I R+E DG+F+ DSVA
Sbjct  360   FLTHCGWNSVVEGLSFGKVLILFPMLNDQGLNARLLHGKKLGLEIPRNELDGAFTSDSVA  419

Query  418   ESLR  407
             E +R
Sbjct  420   ELVR  423



>gb|AAR06918.1| UDP-glycosyltransferase 91D1 [Stevia rebaudiana]
Length=485

 Score =   383 bits (983),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 215/489 (44%), Positives = 301/489 (62%), Gaps = 20/489 (4%)
 Frame = -3

Query  1696  H*QFSAMASESS------TLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQ  1535
             H    AMA+  S       LH+   PWLAFGHI+P+L+L+KL+AE+G+K+ F+ST RNIQ
Sbjct  7     HQNSKAMATSDSIVDDRKQLHVATFPWLAFGHILPFLQLSKLIAEKGHKVSFLSTTRNIQ  66

Query  1534  RLPKLHPHLVPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQ  1355
             RL     H+ P I+++ L LP+V+ LPEDAE+T D+  + ++YLK A D LQ  +  FL+
Sbjct  67    RLSS---HISPLINVVQLTLPRVQELPEDAEATTDVHPEDIQYLKKAVDGLQPEVTRFLE  123

Query  1354  TLSPDWVIHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQS-AVIDGVDSPVEPKH  1178
               SPDW+I+DF  + L  I   L I   YF + T    A   P S A+I+  D     + 
Sbjct  124   QHSPDWIIYDFTHYWLPSIAASLGISRAYFCVITPWTIAYLAPSSDAMINDSDGRTTVED  183

Query  1177  TTSKPKWVPFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELE  998
              T+ PKW PF T +  R  ++ R+  + Y +   +SD YR+G+  KG+  +  +  +E  
Sbjct  184   LTTPPKWFPFPTKVCWRKHDLARM--EPY-EAPGISDGYRMGMVFKGSDCLLFKCYHEFG  240

Query  997   PEWLQLAEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGS  818
              +WL L E +   P +PVGLLP     +   D+K   W+ IK+WLD ++KGSVVYVA GS
Sbjct  241   TQWLPLLETLHQVPVVPVGLLPP----EIPGDEKDETWVSIKKWLDGKQKGSVVYVALGS  296

Query  817   ETKPNQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWA  638
             E   +Q EVVE+ALGLELS LPF W YRK +G A ++  +LP+GF ERTR RG++ TSWA
Sbjct  297   EALVSQTEVVELALGLELSGLPFVWAYRKPKGPAKSDSVELPDGFVERTRDRGLVWTSWA  356

Query  637   PQLKILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIAR  458
             PQL+ILSH+SV GFLTH G  S+VE L F   LIM P   DQ +  RLL +K++G  I R
Sbjct  357   PQLRILSHESVCGFLTHCGSGSIVEGLMFGHPLIMLPIFCDQPLNARLLEDKQVGIEIPR  416

Query  457   DENDGSFSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA--  284
             +E DG  +++SVA SLR V+VE  G+++    + +     + + +  YV++ +DYL    
Sbjct  417   NEEDGCLTKESVARSLRSVVVENEGEIYKANARALSKIYNDTKVEKEYVSQFVDYLEKNA  476

Query  283   -ASTIHHPS  260
              A  I H S
Sbjct  477   RAVAIDHES  485



>ref|XP_004233155.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Solanum lycopersicum]
Length=479

 Score =   382 bits (982),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 202/438 (46%), Positives = 283/438 (65%), Gaps = 9/438 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVP  1502
             M +E   LH+VM PWLA GHIIP+  L+K LA RG+++ F+STPRNI+R+  K+   L  
Sbjct  1     MENEKDKLHVVMFPWLAMGHIIPFFHLSKCLARRGHRVTFISTPRNIERVVNKVPSDLAH  60

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLS---PDWVI  1331
              + ++   LP+VENLP+DAES++D+PY K ++LKIAFD L+  +  +L++ S   PDW++
Sbjct  61    LLHIVWFQLPKVENLPDDAESSMDIPYQKAQFLKIAFDSLEIPLTNYLESSSNPKPDWIV  120

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVP  1151
             +D+AS  L  I  KL +   +FS+FTA+  + + P  A+++   S  E    T  PKW+P
Sbjct  121   YDYASHWLPQIAGKLGVSRAFFSLFTAATMSFYGPPCALLNDERSIAE--DYTVVPKWIP  178

Query  1150  FETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             FET ++ R  E+++ F +A  D    SD  R G ++  +  +  R+C E E EW  L  E
Sbjct  179   FETKVVYRLHEIKKNF-EAPADESGTSDGARFGASIDASDVILFRNCVEFESEWFSLVSE  237

Query  970   VVGKPTIPVGLLP-TTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
             +  KP I +G+LP +   D E+DD   A+W  IK WLDK  + SVVYVA G+E   NQ+E
Sbjct  238   LYQKPIISIGVLPPSVVVDQEQDDSNDASWSGIKSWLDKHNQDSVVYVALGTEATLNQQE  297

Query  793   VVEIALGLELSQLPFFWVYRKQ-RGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
             + E+ALGLE   LPF WV R Q + +      +LP+G+E+R + RGVI   W PQ KILS
Sbjct  298   LNELALGLEKCGLPFVWVLRDQPKHNQQDSCIQLPDGYEDRVKNRGVIYKGWVPQTKILS  357

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H SVGGFLTH GW+SV+EAL F + L+M P L DQG+ TRLL EK +G  I R+E DG F
Sbjct  358   HSSVGGFLTHCGWNSVIEALCFGRVLVMFPVLNDQGLNTRLLQEKGVGVEIPRNEKDGFF  417

Query  436   SRDSVAESLRVVMVEEHG  383
             + DSVAE+++  +V E G
Sbjct  418   TSDSVAEAVKFGVVSEEG  435



>gb|AAM53963.1|AF515727_1 UDP-glucosyltransferase [Stevia rebaudiana]
Length=473

 Score =   382 bits (981),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 210/478 (44%), Positives = 299/478 (63%), Gaps = 14/478 (3%)
 Frame = -3

Query  1681  AMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
             ++  +   LH+   PWLAFGHI+P+L+L+KL+AE+G+K+ F+ST RNIQRL     H+ P
Sbjct  6     SIVDDRKQLHVATFPWLAFGHILPFLQLSKLIAEKGHKVSFLSTTRNIQRLSS---HISP  62

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
              I+++ L LP+V+ LPEDAE+T D+  + ++YLK A D LQ  +  FL+  SPDW+I+DF
Sbjct  63    LINVVQLTLPRVQELPEDAEATTDVHPEDIQYLKKAVDGLQPEVTRFLEQHSPDWIIYDF  122

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQS-AVIDGVDSPVEPKHTTSKPKWVPFE  1145
               + L  I   L I   YF + T    A   P S A+I+  D     +  T+ PKW PF 
Sbjct  123   THYWLPSIAASLGISRAYFCVITPWTIAYLAPSSDAMINDSDGRTTVEDLTTPPKWFPFP  182

Query  1144  TTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             T +  R  ++ R+  + Y +   +SD YR+G+  KG+  +  +  +E   +WL L E + 
Sbjct  183   TKVCWRKHDLARM--EPY-EAPGISDGYRMGMVFKGSDCLLFKCYHEFGTQWLPLLETLH  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
               P +PVGLLP     +   D+K   W+ IK+WLD ++KGSVVYVA GSE   +Q EVVE
Sbjct  240   QVPVVPVGLLPP----EIPGDEKDETWVSIKKWLDGKQKGSVVYVALGSEALVSQTEVVE  295

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             +ALGLELS LPF W YRK +G A ++  +LP+GF ERTR RG++ TSWAPQL+ILSH+SV
Sbjct  296   LALGLELSGLPFVWAYRKPKGPAKSDSVELPDGFVERTRDRGLVWTSWAPQLRILSHESV  355

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
              GFLTH G  S+VE L F   LIM P   DQ +  RLL +K++G  I R+E DG  +++S
Sbjct  356   CGFLTHCGSGSIVEGLMFGHPLIMLPLFGDQPLNARLLEDKQVGIEIPRNEEDGCLTKES  415

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA---ASTIHHPS  260
             VA SLR V+VE  G+++    +++     + + +  YV++ +DYL     A  I H S
Sbjct  416   VARSLRSVVVENEGEIYKANARELSKIYNDTKVEKEYVSQFVDYLEKNARAVAIDHES  473



>ref|XP_010442438.1| PREDICTED: UDP-glycosyltransferase 91C1 [Camelina sativa]
Length=465

 Score =   381 bits (979),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 204/429 (48%), Positives = 269/429 (63%), Gaps = 13/429 (3%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   +HI M PWLA GH++P+L L+KLLA++G+KI F+STPRN++RLPKL  +L  +I  
Sbjct  6     EEEVMHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNLERLPKLPSNLSSSITF  65

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             +  PLP +  L   +ES++D+PY+K + LK AFD LQ  +  FL   SPDW+I D+AS  
Sbjct  66    VSFPLPLISGLSPTSESSMDVPYNKQQSLKAAFDLLQAPLKEFLGRSSPDWIIFDYASHW  125

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L  I  +L I   +FS+F A+      P S++ID + +   P+  T  P WVPF++ I  
Sbjct  126   LPSIAAELGISKAFFSLFNAATLCFLGPSSSLIDELRT--TPEDFTVVPPWVPFKSNIAF  183

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R  E+ R       D   VSD  R G ++  + AVFVRSC E EPEW  L +++  KP  
Sbjct  184   RYHEVTRYVEKTDEDVTGVSDSVRFGYSIGESDAVFVRSCPEFEPEWFGLLKDLYQKPVF  243

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             P G LP       EDDD    W+ IKEWLDKQ   SVVYV+ G+E    +EEV E+ALGL
Sbjct  244   PSGFLPPVIE---EDDDDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLRREEVTELALGL  300

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             E S+ PFFWV R +          +P+GFEE  +GRG++   W PQ+KIL H+SVGGFLT
Sbjct  301   EKSETPFFWVLRNE--------PHIPDGFEETVKGRGMVHVGWVPQVKILRHESVGGFLT  352

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             H GW+SVVE L F K  I  P L +QG+ TRLL  K +G  + RDE DGSF   SVA+S+
Sbjct  353   HCGWNSVVEGLGFGKAPIFLPVLNEQGLNTRLLHGKGIGVEVLRDERDGSFDSCSVADSV  412

Query  409   RVVMVEEHG  383
             R+VMV+E G
Sbjct  413   RLVMVDEEG  421



>gb|AHL38585.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=920

 Score =   395 bits (1015),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 292/459 (64%), Gaps = 13/459 (3%)
 Frame = -3

Query  1660  TLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGL  1481
              +H+ M PWLA GH++P+L L+KLLA++G+KI F+STPRNI+RLPKL  +L  +I  +  
Sbjct  8     VMHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLQSNLASSITFVSF  67

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVP  1301
             PLP +  LP  +ES++D+PY+K + LK AFD LQ  +  FL+  SPDW+I+D+AS  L  
Sbjct  68    PLPPISGLPPSSESSMDVPYNKQQSLKAAFDLLQPPLKEFLRRSSPDWIIYDYASHWLPS  127

Query  1300  IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNF  1121
             I  +L I   +FS+F A+      P S++I+ + S   P+  T  P WVPF++ I+ R  
Sbjct  128   IAAELGISKAFFSLFNAATLCFMGPSSSLIEEIRS--TPEDFTVVPPWVPFKSNIVFRYH  185

Query  1120  EMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVG  941
             E+ R       D   VSD  R G ++  + AVFVRSC E EPEW  L +++  KP  P+G
Sbjct  186   EVTRYVEKTEEDVTGVSDSVRFGYSIDESDAVFVRSCPEFEPEWFGLLKDLYRKPVFPIG  245

Query  940   LLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELS  761
              LP      E+DD     W+ IK+WLDKQ   SVVYV+ G+E     EEV E+ALGLE S
Sbjct  246   FLPPV---IEDDDAVDTTWVRIKKWLDKQRLNSVVYVSLGTEASLRHEEVTELALGLEKS  302

Query  760   QLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSG  581
             + PFFWV R +         K+P+GF+ R +GRG++   W PQ+KILSH+SVGGFLTH G
Sbjct  303   ETPFFWVLRNE--------PKIPDGFKTRVKGRGMVHVGWVPQVKILSHESVGGFLTHCG  354

Query  580   WSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVV  401
             W+SVVE L F K  I  P L +QG+ TRLL  K +G  ++RDE DGSF  DSVA+S+R+V
Sbjct  355   WNSVVEGLGFGKVPIFFPVLNEQGLNTRLLHGKGLGVEVSRDERDGSFDSDSVADSIRLV  414

Query  400   MVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             M+++ G+    K K MK      ++   YV++L+ ++ +
Sbjct  415   MIDDAGEEIRAKAKVMKDLFGNMDENIRYVDELVRFMRS  453


 Score =   395 bits (1015),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 292/459 (64%), Gaps = 13/459 (3%)
 Frame = -3

Query  1660  TLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGL  1481
              +H+ M PWLA GH++P+L L+KLLA++G+KI F+STPRNI+RLPKL  +L  +I  +  
Sbjct  468   VMHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLQSNLASSITFVSF  527

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVP  1301
             PLP +  LP  +ES++D+PY+K + LK AFD LQ  +  FL+  SPDW+I+D+AS  L  
Sbjct  528   PLPPISGLPPSSESSMDVPYNKQQSLKAAFDLLQPPLKEFLRRSSPDWIIYDYASHWLPS  587

Query  1300  IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNF  1121
             I  +L I   +FS+F A+      P S++I+ + S   P+  T  P WVPF++ I+ R  
Sbjct  588   IAAELGISKAFFSLFNAATLCFMGPSSSLIEEIRS--TPEDFTVVPPWVPFKSNIVFRYH  645

Query  1120  EMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVG  941
             E+ R       D   VSD  R G ++  + AVFVRSC E EPEW  L +++  KP  P+G
Sbjct  646   EVTRYVEKTEEDVTGVSDSVRFGYSIDESDAVFVRSCPEFEPEWFGLLKDLYRKPVFPIG  705

Query  940   LLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELS  761
              LP      E+DD     W+ IK+WLDKQ   SVVYV+ G+E     EEV E+ALGLE S
Sbjct  706   FLPPV---IEDDDAVDTTWVRIKKWLDKQRLNSVVYVSLGTEASLRHEEVTELALGLEKS  762

Query  760   QLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSG  581
             + PFFWV R +         K+P+GF+ R +GRG++   W PQ+KILSH+SVGGFLTH G
Sbjct  763   ETPFFWVLRNE--------PKIPDGFKTRVKGRGMVHVGWVPQVKILSHESVGGFLTHCG  814

Query  580   WSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVV  401
             W+SVVE L F K  I  P L +QG+ TRLL  K +G  ++RDE DGSF  DSVA+S+R+V
Sbjct  815   WNSVVEGLGFGKVPIFFPVLNEQGLNTRLLHGKGLGVEVSRDERDGSFDSDSVADSIRLV  874

Query  400   MVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             M+++ G+    K K MK      ++   YV++L+ ++ +
Sbjct  875   MIDDAGEEIRAKAKVMKDLFGNMDENIRYVDELVRFMRS  913



>gb|ACE87855.1| UDP-glucosyltransferase [Stevia rebaudiana]
Length=473

 Score =   380 bits (977),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 211/478 (44%), Positives = 300/478 (63%), Gaps = 14/478 (3%)
 Frame = -3

Query  1681  AMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
             ++  +   LH+   PWLAFGHI+PYL+L+KL+AE+G+K+ F+ST RNIQRL     H+ P
Sbjct  6     SIVDDRKQLHVATFPWLAFGHILPYLQLSKLIAEKGHKVSFLSTTRNIQRLSS---HISP  62

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
              I+++ L LP+V+ LPEDAE+T D+  + + YLK A D LQ  +  FL+  SPDW+I+D+
Sbjct  63    LINVVQLTLPRVQELPEDAEATTDVHPEDIPYLKKASDGLQPEVTRFLEQHSPDWIIYDY  122

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQS-AVIDGVDSPVEPKHTTSKPKWVPFE  1145
               + L  I   L I   +FS+ T    A   P + A+I+G D     +  T+ PKW PF 
Sbjct  123   THYWLPSIAASLGISRAHFSVTTPWAIAYMGPSADAMINGSDGRTTVEDLTTPPKWFPFP  182

Query  1144  TTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             T +  R  ++ R+    Y   G +SD YR+G+ +KG+  +  +  +E   +WL L E + 
Sbjct  183   TKVCWRKHDLARLV--PYKAPG-ISDGYRMGLVLKGSDCLLSKCYHEFGTQWLPLLETLH  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
               P +PVGLLP         D+K   W+ IK+WLD ++KGSVVYVA GSE   +Q EVVE
Sbjct  240   QVPVVPVGLLPPEV----PGDEKDETWVSIKKWLDGKQKGSVVYVALGSEVLVSQTEVVE  295

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             +ALGLELS LPF W YRK +G A ++  +LP+GF ERTR RG++ TSWAPQL+ILSH+SV
Sbjct  296   LALGLELSGLPFVWAYRKPKGPAKSDSVELPDGFVERTRDRGLVWTSWAPQLRILSHESV  355

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
              GFLTH G  S+VE L F   LIM P   DQ +  RLL +K++G  I R+E DG  +++S
Sbjct  356   CGFLTHCGSGSIVEGLMFGHPLIMLPIFGDQPLNARLLEDKQVGIEIPRNEEDGCLTKES  415

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA---ASTIHHPS  260
             VA SLR V+VE+ G+++    +++     + + +  YV++ +DYL     A  I H S
Sbjct  416   VARSLRSVVVEKEGEIYKANARELSKIYNDTKVEKEYVSQFVDYLEKNTRAVAIDHES  473



>emb|CAN73977.1| hypothetical protein VITISV_022298 [Vitis vinifera]
Length=438

 Score =   379 bits (973),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 213/461 (46%), Positives = 281/461 (61%), Gaps = 33/461 (7%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             +   LHIVM PWLAFGHI+PYLEL+KL+A++G++I F+STPRNI RLPKL P L P I+L
Sbjct  3     DPEKLHIVMFPWLAFGHILPYLELSKLIAQKGHRISFISTPRNIDRLPKLPPILQPLINL  62

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             I LPLP+V+NLPE+AE+T DLPY+K+ YLK AFD LQ+ +  FL    PDWV+HDFA   
Sbjct  63    IKLPLPKVDNLPENAEATTDLPYEKIPYLKKAFDGLQEPVTRFLINSHPDWVVHDFAPHW  122

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L P++++  +   +FSIF AS        S ++   D   E       P WVPF + +  
Sbjct  123   LPPVLDEHGVSRSFFSIFGASTLCFLGSXSIMMGDGDPRKELHQFAVPPPWVPFPSNLGL  182

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
               F+M+ V      +   VSD YR+G  +     V VRSC ELE EWL L  E+  KP +
Sbjct  183   PPFQMKTVLGYDQPNLSGVSDSYRMGSVISACDVVAVRSCAELESEWLDLLRELYHKPVL  242

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             P+GLLP  A        +  +W+ I EWLDKQEK SV                       
Sbjct  243   PIGLLPPLA----PVSGEDDSWIPILEWLDKQEKASV-----------------------  275

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
              LS LPFFW  RK+  S +     LP+GFE+RT+ RGV+  +WAPQL+IL H+SVGGF+T
Sbjct  276   -LSGLPFFWALRKRHDSVE-----LPDGFEDRTKDRGVVWRTWAPQLRILGHESVGGFVT  329

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             H G SSVVE L F + L M P   DQGII +   E ++G  I RDE +G FS  SVA++L
Sbjct  330   HCGLSSVVEGLXFGRALXMFPLWGDQGIIAKAFQEMKVGIEIPRDEEEGWFSSKSVAQTL  389

Query  409   RVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
              +VMVEE G+++ EK K++     +K+ Q  Y+N  ++YL 
Sbjct  390   SLVMVEEXGRIYREKAKELSKLFGDKDLQQRYINDFVEYLQ  430



>ref|XP_007222833.1| hypothetical protein PRUPE_ppa005106mg [Prunus persica]
 gb|EMJ24032.1| hypothetical protein PRUPE_ppa005106mg [Prunus persica]
Length=477

 Score =   380 bits (976),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 196/433 (45%), Positives = 275/433 (64%), Gaps = 6/433 (1%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             ++  LH+V+ PWLA GH+IP+  L+KL+A++G+ + F+STPRNI RLPK+  HL   I+L
Sbjct  6     KNGVLHVVVFPWLAMGHLIPFFHLSKLIAQKGHSVSFISTPRNILRLPKIPSHLSSLINL  65

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTL--SPDWVIHDFAS  1316
             + LPLP+++NLP DAES+ D+PY+K + LK AFD L+  +  FL +    PDWVI+D+AS
Sbjct  66    VSLPLPRLDNLPNDAESSTDVPYNKQQLLKRAFDLLELPLTDFLGSSESKPDWVIYDYAS  125

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
               L P+  +  I   +FS F+A+  A   P + +I+G D     +  T  P+WVPFE+ +
Sbjct  126   HWLPPVAARFDISRAFFSCFSAACLAYIGPPAPLINGQDFRTNAEDFTLVPEWVPFESDM  185

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK-  959
               R  E+ +    +  +     D  R G  +  +  VF+RS  E EPEW  L  E+ GK 
Sbjct  186   AYRLHEIAKYLQRSSENESVTPDTVRFGFAINESEVVFIRSSDEFEPEWFNLLRELYGKG  245

Query  958   -PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
              P +P+G LP     +E+ D+    W+ I EWLDKQ   SV+Y+A G+E   ++EE+ E+
Sbjct  246   KPVVPIGFLP--PLINEQVDEFDTNWVGINEWLDKQRVNSVIYIAVGTEATLSREELTEL  303

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLELS +PFFWV R    S  +    LP GF ER  GRGV+   WAPQ++ILSHDSVG
Sbjct  304   ALGLELSGVPFFWVLRNPPESTQSVFEMLPHGFVERVEGRGVVHLGWAPQVRILSHDSVG  363

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             GFLTH GW+S++E L F + LI+ P + DQG+  RL   K +G  I R   DGSF+RDSV
Sbjct  364   GFLTHCGWNSMIEGLGFGRVLILFPMVNDQGLNARLGNNKGLGVEIPRIAQDGSFTRDSV  423

Query  421   AESLRVVMVEEHG  383
             A+ +R+ MVE+ G
Sbjct  424   AKLVRLAMVEDSG  436



>ref|XP_007206476.1| hypothetical protein PRUPE_ppa019000mg [Prunus persica]
 gb|EMJ07675.1| hypothetical protein PRUPE_ppa019000mg [Prunus persica]
Length=363

 Score =   376 bits (965),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 186/366 (51%), Positives = 249/366 (68%), Gaps = 5/366 (1%)
 Frame = -3

Query  1681  AMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
             +  +E   LHI + PWLAFGHIIP+ E+AK +A RG+K+ F+STPRNIQRLPK+  HL P
Sbjct  2     SSTTEPKKLHIAVFPWLAFGHIIPFFEVAKHVARRGHKVSFISTPRNIQRLPKIPQHLTP  61

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
              I+L+ +PLP+VENLPE+AE+T+D+PY  + YLKIA D L+  ++ FLQT  PDW+IHDF
Sbjct  62    LINLVQIPLPRVENLPENAEATMDVPYHIIPYLKIAHDGLEQGISNFLQTHKPDWIIHDF  121

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSA-VIDGVDSPVEPKHTTSKPKWVPFE  1145
             A   L PI   L I   +FSIF AS      P S   +D       P+H T  P+W+PF 
Sbjct  122   APHWLPPIASSLGISRAHFSIFNASTLCFIGPTSPEGLDRYGVRTLPEHFTVPPEWIPFP  181

Query  1144  TTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             + ++ R+FE +++F+    +   VSDL+R+  TV+G     +RSC E+E EWL L +E+ 
Sbjct  182   SNLVFRSFEAKKLFDATKQNASGVSDLFRVQSTVQGCQVYLIRSCREIEGEWLDLLQELQ  241

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
               P +P+GLLP       +  + K  W  I +WLDKQE G+VVY+A GSE   +QE+  E
Sbjct  242   QFPVVPIGLLPPLV----QTREDKEDWSRIYQWLDKQENGTVVYIALGSELNLSQEDFTE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             +ALGLELS LPFFWV R    S D++  KLP+GFEERT+GRG++ T+WAPQ KIL+HDS+
Sbjct  298   LALGLELSGLPFFWVLRTPSWSGDSDSVKLPDGFEERTKGRGLVWTTWAPQTKILAHDSI  357

Query  604   GGFLTH  587
             GGFLTH
Sbjct  358   GGFLTH  363



>ref|XP_010440988.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Camelina sativa]
Length=497

 Score =   380 bits (977),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 200/429 (47%), Positives = 267/429 (62%), Gaps = 16/429 (4%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   +HI M PWLA GH++P+L L+KLLA++G+KI F+STPRN++RLPKL  +L  +I  
Sbjct  41    EEEVMHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNLERLPKLPSNLSSSITF  100

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             +  PLP +  L   +ES++D+PY+K + LK AFD LQ  +  FL   SPDW+I+D+AS  
Sbjct  101   VSFPLPLISGLSPTSESSMDVPYNKQQSLKAAFDLLQAPLKEFLLRSSPDWIIYDYASHW  160

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L  I  +L I   +FS+F A+      P S++ID   +   P+  T  P WVPF++ +  
Sbjct  161   LPSIAAELGISKAFFSLFNAATLCFLGPSSSLIDEFRT--TPEDFTVVPPWVPFKSNVAF  218

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R  E+ R       D   VSD  R G ++  + AVFVRSC E E EW  L +++  KP  
Sbjct  219   RYHEVTRYVEKTDEDVTGVSDSVRFGYSIGESDAVFVRSCPEFESEWFGLLKDLYQKPVF  278

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             P G LP         +D    W+ IKEWLDKQ   SVVYV+ G+E    +EEV E+ALGL
Sbjct  279   PTGFLPPV------IEDDDTTWVRIKEWLDKQRVNSVVYVSLGTEASLCREEVTELALGL  332

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             E S+ PFFWV R +  +        P+GFEER +GRG++   W PQ+KIL H+SVGGFLT
Sbjct  333   EKSETPFFWVLRNEPLT--------PDGFEERVKGRGMVHVGWVPQVKILRHESVGGFLT  384

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             H GW+SVVE L F K  I  P L +QG+ TRLL  K +G  + RDE DGSF   SVA+S+
Sbjct  385   HCGWNSVVEGLGFGKAPIFLPVLNEQGLNTRLLHGKGIGVEVLRDERDGSFDSCSVADSV  444

Query  409   RVVMVEEHG  383
             R+VMV+E G
Sbjct  445   RLVMVDEEG  453



>ref|XP_008219240.1| PREDICTED: UDP-glycosyltransferase 91C1 [Prunus mume]
Length=477

 Score =   377 bits (969),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 197/432 (46%), Positives = 272/432 (63%), Gaps = 6/432 (1%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +  LH+V+ PWLA GH+IP+  L+KL+A++G+ + F+STPRNI RLPK+  HL   I+L+
Sbjct  7     NGVLHVVVFPWLAMGHLIPFFRLSKLIAQKGHTVSFISTPRNILRLPKIPSHLSSLINLV  66

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTL--SPDWVIHDFASF  1313
              LPLP+++NLP DAES+ D+PY+  + LK AFD L+  +  FL +    PDWVI+D+AS 
Sbjct  67    SLPLPRLDNLPNDAESSTDVPYNGQQLLKRAFDLLELPLTDFLGSSESKPDWVIYDYASH  126

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              L P+  +  I   +FS F+A+  A   P + +++G D     +  T  P+WVPFE+ + 
Sbjct  127   WLPPVAARFDISRAFFSCFSAACLAYIGPPAPLVNGQDFRTNAEDFTLVPEWVPFESDMA  186

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK--  959
              R  E+ +    +  +     D  R G  +  +  VF+RS  E EPEW  L  E+ GK  
Sbjct  187   YRLHEIAKYLQRSSENESVTPDTVRFGFAINESEVVFIRSSDEFEPEWFNLLREIYGKGK  246

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P +P+G LP     DE+ D+    W+ IKEWLDKQ   SV+Y+A G+E   +QEE+ E+A
Sbjct  247   PVVPIGFLPPP--IDEQVDEFDTNWVGIKEWLDKQRVNSVIYIAVGTEAILSQEELTELA  304

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLELS +PFFWV R    S       LP GF ER  GRGV+   WAPQ++ILSHDSVGG
Sbjct  305   LGLELSGVPFFWVLRNPPESTQYVFEMLPHGFVERVEGRGVVHLGWAPQVRILSHDSVGG  364

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH GW+S++E L F + LI+ P + DQG+  RL   K +G  I R   DGSF+RDSVA
Sbjct  365   FLTHCGWNSMIEGLGFGRVLILFPMVNDQGLNARLGNNKGLGVEIPRIAQDGSFTRDSVA  424

Query  418   ESLRVVMVEEHG  383
             + +R  MVE+ G
Sbjct  425   KLVRFAMVEDSG  436



>ref|XP_010482257.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X1 [Camelina 
sativa]
 ref|XP_010482258.1| PREDICTED: UDP-glycosyltransferase 91C1-like isoform X2 [Camelina 
sativa]
Length=461

 Score =   376 bits (966),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 200/429 (47%), Positives = 268/429 (62%), Gaps = 13/429 (3%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   +HI M PWLA GH++P+L L+KLLA++G+KI F+STPRN++RLPKL  +L  +I  
Sbjct  6     EEEVMHIAMFPWLAMGHLLPFLSLSKLLAQKGHKISFISTPRNLERLPKLPSNLSSSITF  65

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             +  PLP +  L   +ES++D+PY K + LK AFD LQ  +  FL   SPDW+I D+AS  
Sbjct  66    VSFPLPLISGLSPTSESSMDVPYIKQQSLKAAFDLLQAPLKEFLGRSSPDWIIFDYASHW  125

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L  I  +L I   +FS+F A+      P S++ID + +   P+  T  P WVPF++ +  
Sbjct  126   LPSIAAELGISKAFFSLFNAATLCFLGPSSSLIDELRT--TPEDFTVVPPWVPFKSNVAF  183

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R  E+ R       D   VSD  R G ++  + AVFVRSC E EPEW  L +++  KP  
Sbjct  184   RYHEVTRYVEKTDEDVTGVSDSVRFGYSIGESDAVFVRSCPEFEPEWFGLLKDLYQKPVF  243

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             P G LP      E+ DD    W+ IKEWLDKQ   SVVYV+ G+E    +EEV E+ALGL
Sbjct  244   PTGFLPPV---IEDGDDDDTTWVCIKEWLDKQRVNSVVYVSLGTEASLRREEVTELALGL  300

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             E S+ PFFWV R +          +P+GFE+  +GRG++   W PQ+KIL H+SVGGFLT
Sbjct  301   EKSETPFFWVLRNE--------PHIPDGFEKTVKGRGMVHVGWVPQVKILRHESVGGFLT  352

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             H GW+SVVE L F K  I  P L +QG+ TRLL  K +G  + RDE DGSF   SVA+S+
Sbjct  353   HCGWNSVVEGLGFGKAPIFLPVLNEQGLNTRLLHGKGIGVEVLRDERDGSFDSCSVADSV  412

Query  409   RVVMVEEHG  383
             R+VM++E G
Sbjct  413   RLVMMDEEG  421



>emb|CDP00929.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   377 bits (968),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 191/432 (44%), Positives = 275/432 (64%), Gaps = 5/432 (1%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             S+ LH+VM PWLA GH+IP+  L+KLLA +G+KI F+STPRN+QRLPK+   L   I+L+
Sbjct  4     SNVLHVVMFPWLAMGHLIPFFRLSKLLAGKGHKISFISTPRNLQRLPKIPQELASQIELV  63

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTL--SPDWVIHDFASF  1313
              +PLP+V+NLP+  E++ D+P++K ++LKIAFD L+  +A+FL+     PDW+IHD+AS 
Sbjct  64    SIPLPEVDNLPKQGETSTDIPHEKDQFLKIAFDLLRSPIASFLENTRPKPDWIIHDYASH  123

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              L  I  +  + + +FS+FTA+  +     SA++ G D     +  T  PKW+PF +   
Sbjct  124   WLPEIAAQNGVSAAFFSLFTAAALSFLGRPSALLSGEDGRSTAEDFTVVPKWIPFPSNCA  183

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R  E+ +   DA  +    SD  R   ++  +  V  R+  E EPEW  L  E+  KP 
Sbjct  184   YRLHEVRKNIEDASGNESGASDFVRFAASIDRSDLVIFRTSVEFEPEWFNLVRELYQKPV  243

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             + +G+LP +   D+++ +    W +I+ WLDKQ    VVYVA G+E   +Q+EV ++A+G
Sbjct  244   VSLGVLPPSLD-DDDELETDEKWQKIQNWLDKQTASKVVYVALGTEATISQKEVQDLAIG  302

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEER--TRGRGVICTSWAPQLKILSHDSVGG  599
             LE S+LPFFWV RK  GS       LPEGF ER    G+GV+ T W PQ+KILSH ++GG
Sbjct  303   LEQSELPFFWVLRKPPGSKKDVTDMLPEGFRERINANGQGVVYTEWVPQVKILSHPAIGG  362

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             +LTH GW+SV+EAL F + LI+ P + DQG+  RLL  K++G  I R   DG F+  +VA
Sbjct  363   YLTHCGWNSVIEALGFGRVLILFPVMNDQGLNARLLEGKKVGVEIPRAAEDGLFTSTAVA  422

Query  418   ESLRVVMVEEHG  383
             E+LR  +V E G
Sbjct  423   ETLRYAVVSEEG  434



>ref|XP_010060107.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 91C1-like 
[Eucalyptus grandis]
Length=473

 Score =   377 bits (967),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 191/426 (45%), Positives = 270/426 (63%), Gaps = 3/426 (1%)
 Frame = -3

Query  1660  TLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGL  1481
             +LHI M PWLA GH+IP+  L+K LA+RG+KI F+STPRN+QRLPK+  +L P I+LI L
Sbjct  13    SLHIAMFPWLAMGHLIPFFHLSKHLAQRGHKISFISTPRNLQRLPKIPQNLSPLINLIPL  72

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVP  1301
             P P + NL   AES++D  + K + LKIA D+LQ ++  FL++   DW+I+DFAS  L  
Sbjct  73    PFPHIPNLTPHAESSIDTSFSKQQLLKIAIDKLQPAITCFLESSQLDWIIYDFASHWLPS  132

Query  1300  IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNF  1121
                +L I   +  +F A++  +  P + +I G D     +     P+W+PFE+ I+ R++
Sbjct  133   TAAELGIHRCFCGLFNAAVLCLIGPPTVLIGGSDPRTTIEDFLRVPEWIPFESDIVFRSY  192

Query  1120  EMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVG  941
             E+ R+   +        D  R+GVT++ +  V VR+C E EPEW+ L  ++  KP +P+G
Sbjct  193   EITRLXQHSSEYISETPDTVRMGVTIRDSEVVAVRTCVEFEPEWIDLLRDLYQKPLVPIG  252

Query  940   LLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELS  761
              LP     ++++D     W+ IK WLD+Q   SVVYVA G+E   +QEEV E+ALGLE S
Sbjct  253   FLPPC--MEDDEDVNDMKWVSIKAWLDEQRLNSVVYVALGTEGVLSQEEVTELALGLEKS  310

Query  760   QLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSG  581
             +L FFWV R    S    +  LP GF +   GRG++CT WAPQ++ILSHDSVGGFLTH G
Sbjct  311   ELSFFWVLRNPPESTQKAIDMLPNGFLQGVEGRGMVCTDWAPQVQILSHDSVGGFLTHCG  370

Query  580   WSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVV  401
             W+S++E L F + L++ P   DQG   RLL  K +G  + R E DG F+ D+VAE LR  
Sbjct  371   WNSIIEGLAFGRVLMLFPMTTDQGPNARLLQGKGLGIEVTRKE-DGMFTSDAVAELLRFA  429

Query  400   MVEEHG  383
             MV++ G
Sbjct  430   MVDDFG  435



>ref|XP_006396998.1| hypothetical protein EUTSA_v10028640mg [Eutrema salsugineum]
 gb|ESQ38451.1| hypothetical protein EUTSA_v10028640mg [Eutrema salsugineum]
Length=466

 Score =   376 bits (965),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 214/474 (45%), Positives = 299/474 (63%), Gaps = 10/474 (2%)
 Frame = -3

Query  1690  QFSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPH  1511
             + + M  +  +LH+ M PWLA GH++P+L L+KLLA++G+KI F+STPRNI+RLPKL  +
Sbjct  3     RLARMEEKEGSLHVAMFPWLAMGHLLPFLRLSKLLAQKGHKISFISTPRNIERLPKLPSN  62

Query  1510  LVPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVI  1331
             L  +I  +  PLP   NLP  +ES++D+PY   + LK AFD L+  +  FL+  SPDW+I
Sbjct  63    LSSSITFVSFPLPPFPNLPPSSESSMDVPYINQQSLKSAFDLLKLPVTEFLRRSSPDWII  122

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVP  1151
             +D+AS  L  I  +L I   +FS+F AS      P S++I+   S   P+  T  P W+P
Sbjct  123   YDYASHWLPSIAMELGISKAFFSLFNASALCFMGPPSSLIEDFRS--TPEDFTVVPLWIP  180

Query  1150  FETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             FE+ I+ R  E+ R       D   VSD  R G ++  + AVFVRSC E EPEW  L ++
Sbjct  181   FESKIVFRYHEVTRYVEKTEEDVTGVSDSVRFGYSISESDAVFVRSCPEFEPEWFGLLQD  240

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP  P G LP  + +D + +++ A W+ IKEWLDKQ   SVVYV+ G+E    QEE+
Sbjct  241   LYQKPIFPTGFLPPVS-EDVDGEEEDATWVCIKEWLDKQRVNSVVYVSLGTEASLPQEEL  299

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
             VE+ALGLE S++PFFWV R        E T + +GFEER +GRG++   W PQ+KILSH+
Sbjct  300   VELALGLEKSKVPFFWVLRN-------EETLILDGFEERVKGRGMVQVGWVPQVKILSHE  352

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             SVGGFLTH GW+SVVE L F +  I  P L +QG+ TRLL  K +G  + R+E DGSF  
Sbjct  353   SVGGFLTHCGWNSVVEGLGFGRVPIFLPVLNEQGLNTRLLEGKGIGVEVPRNERDGSFDS  412

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIH  269
             DSVA+S+R+ MV+  G+      K MK     K++   YV++L+ Y+ +  + H
Sbjct  413   DSVADSVRLAMVDGGGESKRANAKMMKGLFGNKDENIRYVDELVGYMRSKGSSH  466



>ref|XP_002527371.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF35043.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=470

 Score =   376 bits (965),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 195/426 (46%), Positives = 269/426 (63%), Gaps = 0/426 (0%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +S LH+ + PWLA GH+IP+L  + LLA++G+ + F+STP N+ RLPK+ P L  +I LI
Sbjct  4     TSKLHVAVFPWLAMGHLIPFLRFSNLLAQKGHLVSFISTPGNLHRLPKIPPQLSSHISLI  63

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
              LPLP V  LP +AE+T D+PY K + LK AFD L+  +A FL+T  PDWVI+D+AS  L
Sbjct  64    SLPLPSVPGLPSNAETTTDVPYTKQQLLKKAFDLLESPLATFLETKKPDWVIYDYASHWL  123

Query  1306  VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPR  1127
               I  K+ I S +FS+FTA+  +   P S  ++G D  +  +  T  P+WVPFE+ I   
Sbjct  124   PSIASKVGISSAFFSLFTAATLSFIGPPSLTMNGGDLRLTAEDFTIVPRWVPFESNIKYC  183

Query  1126  NFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
               E+ +       D    +D  R      GA  V +RS  E EPEW  L  ++  KP IP
Sbjct  184   IHEVTKYIEKTEEDETGPNDTVRFAFASGGADVVIIRSSPEFEPEWFDLYSKMSEKPIIP  243

Query  946   VGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLE  767
             +G LP    ++E+DD     W +I EWLDK+E  SVVYVA G+E    ++EV E+ALGLE
Sbjct  244   LGFLPPLEVEEEDDDIDVKGWADIIEWLDKKEAESVVYVALGTEAALTRQEVRELALGLE  303

Query  766   LSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
              S+ PF WV +   G+    +  L +G+EER + RG+I   W PQ+KILSH+SVGGFLTH
Sbjct  304   KSRSPFIWVLKNPPGTTQNALEMLQDGYEERVKDRGMIYCGWVPQVKILSHESVGGFLTH  363

Query  586   SGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLR  407
              GW+SVVE L F + LI+ P L DQG+  RLL  K++G  + R+E+DG+F+ DSVAE +R
Sbjct  364   CGWNSVVEGLSFGRVLILFPVLNDQGLNARLLHGKKIGLEVPRNESDGAFTSDSVAELVR  423

Query  406   VVMVEE  389
                V++
Sbjct  424   KAKVDD  429



>ref|XP_002532391.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF30003.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=454

 Score =   375 bits (962),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 227/468 (49%), Positives = 302/468 (65%), Gaps = 40/468 (9%)
 Frame = -3

Query  1690  QFSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPH  1511
             Q   +  E   LH+ + PWLAFGHIIPYL+LA+L+A++G+KI F+ST RNIQRLP++   
Sbjct  19    QQDLIMGEPKKLHVALFPWLAFGHIIPYLDLAQLIAQKGHKISFISTSRNIQRLPQVSSK  78

Query  1510  LVPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVI  1331
             L  +I LI L LPQVENLP DAEST+DLPYD V YLK A+D LQD +  FLQT +PDW+I
Sbjct  79    LSSSIKLISLTLPQVENLPHDAESTMDLPYDHVPYLKKAYDLLQDQLLHFLQTSAPDWII  138

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWV  1154
             +DF+   L PI   L I   +FSIF A S+  +    SA+I+G D   + +H T  P WV
Sbjct  139   YDFSPHWLPPIAANLGISGAFFSIFGAWSLTFLGSSSSAMINGDDPRTKAEHLTVPPDWV  198

Query  1153  PFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             PF + +  R  E +R  +              LG+   G                     
Sbjct  199   PFSSKVAFRLHEAKRALD-------------HLGMNNSG---------------------  224

Query  973   EVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
             ++ GKP +PVG+LP +A D  +D D    W+EI  WLDK  KGSVVY+AFGSE+ P+QEE
Sbjct  225   QLHGKPVLPVGILPPSALDSSDDKDDT--WIEISSWLDKHNKGSVVYIAFGSESAPSQEE  282

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
             + E+ALGLELS LPFFW  RK+    + +  KLP+GFEER +GRG++  SWAPQ+KIL+H
Sbjct  283   LEELALGLELSGLPFFWTLRKRN---NDDSIKLPDGFEERVKGRGLVWMSWAPQVKILAH  339

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
             +SVGGFLTH G+SS++EAL F + LIM P   DQG+I R+  EK++G  I RDE +G F+
Sbjct  340   ESVGGFLTHCGYSSIIEALHFGRALIMFPLSLDQGLIARVFEEKKVGVEIKRDEENGWFT  399

Query  433   RDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +DSVAESL++VMV+  G V+ +K K+MK     KE  D Y+   +++L
Sbjct  400   KDSVAESLKLVMVKTEGNVYRDKAKEMKKVFGNKELHDRYMGHFVEFL  447



>gb|AIE12480.1| UGT3 [Panax ginseng]
Length=471

 Score =   375 bits (963),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 199/463 (43%), Positives = 294/463 (63%), Gaps = 7/463 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
              +  LH+VM PWLA GH+IP+L+L+K+LA +G+++ F+STPRNI+RLPK+ P L P I+L
Sbjct  3     NNHVLHVVMFPWLAIGHLIPFLQLSKILALKGHRVSFISTPRNIERLPKIPPDLSPMINL  62

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQT--LSPDWVIHDFAS  1316
             +  P P+V NLP++A S++D+P+ K ++LKIAFD L+  +  FL+   L PDW+++D+AS
Sbjct  63    VTFPFPKVHNLPDEAGSSMDIPHHKAQFLKIAFDLLKSPLVDFLKNTRLKPDWIVYDYAS  122

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
               L  I  +L I   YFS+F+A+  A   P S ++ G D  ++ +  T  PKW+PF++ +
Sbjct  123   HWLPSIAGELGISRGYFSLFSAACMAFLGPPSLLVSGEDGRLKGEDFTIVPKWIPFQSDV  182

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
             + R  E+ +  + +  +    SD  R G ++ G+  V  R+  E EPEW  L  ++  KP
Sbjct  183   VYRLHEVIKYVDGSAGNESGASDSVRFGASIGGSDLVLFRTSVEFEPEWFNLVCQLYRKP  242

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +PV         D +D   +  W+ IKEWLDKQ   SVVYVA GSE   +++E+ E+AL
Sbjct  243   VVPV----GVLPPDNDDFGNEEKWVFIKEWLDKQMVDSVVYVALGSEAILSRDELSELAL  298

Query  775   GLELSQLPFFWVYRKQRGSA-DAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             GLE   LPFFWV R   GS  D     LP+GF ER + RGV+   W PQ+KILSH +VGG
Sbjct  299   GLEQCGLPFFWVLRMPPGSTQDESQLLLPDGFVERVKSRGVVHQGWVPQVKILSHSAVGG  358

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH GW+SVVEAL + + LI+ P + DQG+  RLL  K++G  I R+E DG+F+ DSVA
Sbjct  359   FLTHCGWNSVVEALGYGRVLILFPVMNDQGLNARLLKGKKVGVEIPRNERDGAFTSDSVA  418

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +S+R+ MV + G+      ++M+       + DN ++  + +L
Sbjct  419   DSVRIAMVSQEGESVRATAREMRGLFGHGIRNDNCIDNFVSHL  461



>ref|XP_009415710.1| PREDICTED: LOW QUALITY PROTEIN: putative UDP-rhamnose:rhamnosyltransferase 
1 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   375 bits (962),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 207/469 (44%), Positives = 292/469 (62%), Gaps = 17/469 (4%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             S+LH+V+ PWLAFGH+IP+LEL+K LA+RG+ ++F+STPRNI RLPKL P L P+ID + 
Sbjct  4     SSLHVVLFPWLAFGHLIPFLELSKSLAKRGHHVFFLSTPRNISRLPKLPPSLAPSIDFVP  63

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLS--PDWVIHDFASFR  1310
             +PLP  E LP+ AE+T DLP +KV+YL  AFD L+ S+A FL   S  P W+IHD+A + 
Sbjct  64    IPLPPCEGLPDGAEATSDLPREKVKYLNKAFDGLEQSVAEFLVQTSPKPSWIIHDYAPYW  123

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L  I  ++ +P ++F+ F A ++A F        G+  PVE    T+ P+W+PF T +  
Sbjct  124   LPLIATRVGVPCIFFNTFPAFVSAFFTGPGG--RGMQRPVE--AFTTPPEWIPFPTKLAY  179

Query  1129  RNFEMERVFNDAYIDG-GNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
             R +E   + +    D    VS + R+ +  KG   + VR+C E E EWL L  E   KP 
Sbjct  180   RAYEARSLSDHVKRDDVSGVSLVRRIEMVGKGCELMAVRACTEFEREWLSLLREHNEKPV  239

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IPVGLLP +  D   + ++ A   +I  WL  Q  GSV+ +A GSE   + E + E+A G
Sbjct  240   IPVGLLPPSIKDRSGEANQGANTGDIFLWLRDQAPGSVLXIALGSEVALSAELLRELAFG  299

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             +E   LPF W  R+       ++  LPEGFEER +GRGV+   W PQL++L+H+SVGGFL
Sbjct  300   VEQGGLPFLWALRRPD-----DMEALPEGFEERLKGRGVVAFGWIPQLQVLAHESVGGFL  354

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH GW S++E L F + L++ P   DQG+  RL+ EK +G  I RDE DGSF+R++VA +
Sbjct  355   THCGWGSLIEGLAFGRPLVLLPIAFDQGLNARLMEEKSLGVEIGRDEEDGSFTREAVAHA  414

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHH  266
             + +VMVEE GK   +  K+MK    + E  + YV++ + YL      HH
Sbjct  415   IGLVMVEEAGKTIRDAAKEMKDVFGDTECHEKYVDEFVQYLQ-----HH  458



>ref|XP_007148435.1| hypothetical protein PHAVU_006G208400g [Phaseolus vulgaris]
 gb|ESW20429.1| hypothetical protein PHAVU_006G208400g [Phaseolus vulgaris]
Length=474

 Score =   375 bits (962),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 205/466 (44%), Positives = 285/466 (61%), Gaps = 10/466 (2%)
 Frame = -3

Query  1684  SAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLV  1505
             S+ A     LH+VM PWLA GH+ P  E++K+LA++G+    VSTP+ I RLPKL   L 
Sbjct  8     SSNAKTDKPLHVVMFPWLAMGHVFPCFEVSKILAQKGHYATLVSTPKIIDRLPKLPQTLS  67

Query  1504  PNIDLIGLPL-PQVE--NLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWV  1334
             P + L  LPL P ++  NLP+DA+ST+D+P +K+ YLK+A+D LQ  M   L+T +PDWV
Sbjct  68    PFLKLTKLPLSPHIDQNNLPQDADSTMDIPSNKLYYLKLAYDALQQPMTQILKTSNPDWV  127

Query  1333  IHDFASFRLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKW  1157
              +DFA+  +  + + L IP  YFS   A SI     P+  + D   S   P+     PKW
Sbjct  128   FYDFAASWIPQLAKSLHIPCAYFSPCPAWSICFFDTPKQQLGDAAASRTNPEDYYGPPKW  187

Query  1156  VPFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLA  977
             VPF T I  R +E+ ++  D  ++    S ++ L     G     +RSC +LEPEWL   
Sbjct  188   VPFPTNIGLRPYEVRKLLEDVKVNETGASPVFDLNEANSGCDMFVIRSCRDLEPEWLDYL  247

Query  976   EEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQE  797
              E   KP +PVGLLP     D E++D    W++IK WLD Q+  SVVY+AFGSE K +QE
Sbjct  248   GEFYHKPVVPVGLLPPVQVMDSEEEDNNPDWVQIKAWLDTQKASSVVYIAFGSEVKLSQE  307

Query  796   EVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
              + E+ALG+ELS LPFFWV RK        V  LP+GFE+R +  GV+  +WAPQ KIL+
Sbjct  308   NLNELALGIELSGLPFFWVLRK------GSVELLPDGFEDRIKDCGVVWKTWAPQAKILA  361

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             HDS+GG LTH G  S++E L F   L+M PFL DQ + +R++ EK++G  I R+  DGSF
Sbjct  362   HDSIGGCLTHCGSGSMIENLYFGHVLVMLPFLLDQALYSRVMEEKKVGIEIPRNPEDGSF  421

Query  436   SRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLL  299
              R SV++++R+ MVEE G  + E  K++  K   K  Q+ Y+   +
Sbjct  422   RRSSVSKAVRLAMVEEEGSAYRENAKELGKKFSNKHFQNQYIQHFI  467



>ref|XP_002275824.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=465

 Score =   374 bits (959),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 198/465 (43%), Positives = 290/465 (62%), Gaps = 9/465 (2%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +  +H+VM+PWLAFGH+IP+L+LA  LAE G  + F+STPRNIQRLPKL P L+P I+L+
Sbjct  2     AGNMHVVMVPWLAFGHMIPHLQLAIALAEAGIHVSFISTPRNIQRLPKLSPTLLPLINLV  61

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
              LPLP V  LPE  E+T++LP++K++YLKIA+  L+  +  FL+  SPDW+I D      
Sbjct  62    ALPLPAVLGLPEGCEATVELPFEKIKYLKIAYALLKQPLKRFLEGASPDWMIVDLPVDWA  121

Query  1306  VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVE--PKHTTSKPKWVPFETTIM  1133
                  + ++P + F++FT++ N  F P   +       V   P+  T+ P+WV F + + 
Sbjct  122   AEAARECAVPLLAFTMFTSASNVFFGPPEYLTGDGQRRVRPSPESMTTPPEWVTFPSLVA  181

Query  1132  PRNFEMERVFNDAYIDGGN-VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
              R FE        Y D  +  +D  R+  T+    AV +RSC E E E+L + ++++ KP
Sbjct  182   YREFEARGAHPGFYGDNSSGTTDADRIATTLSACDAVAIRSCREFEGEYLSIYQKMLRKP  241

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVGLLP         +    AW +I +WLD+Q+  SVV+V FGSE K +Q++V EIA 
Sbjct  242   VIPVGLLPREG----SHEITNQAWRKIFKWLDEQKPKSVVFVGFGSECKLSQDQVHEIAY  297

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS+L F W  RK   + + +V  LP G+ +RT GRGV+C  WAPQ++IL+H S+GG 
Sbjct  298   GLELSELTFLWALRKPNWAIE-DVDALPSGYSDRTSGRGVVCMEWAPQMEILAHPSIGGS  356

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             L HSGW S +E ++F    I+ PF+ DQG+  RLLVEK M   I R  +DGSFSRD +A+
Sbjct  357   LFHSGWGSAIETMQFGHCPIVLPFVIDQGLNARLLVEKGMAVEIERG-DDGSFSRDDIAK  415

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAA  281
             SLR+ MV E G+    + +++     +++   +Y+++L+ YL   
Sbjct  416   SLRLAMVMEEGEKLRIRAREVAMIFGDQKLHQSYIDELVKYLKGG  460



>ref|XP_010547586.1| PREDICTED: UDP-glycosyltransferase 91B1 [Tarenaya hassleriana]
Length=466

 Score =   373 bits (958),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 204/464 (44%), Positives = 280/464 (60%), Gaps = 11/464 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
              S  LH+V+ PWLAFGH+IP+LEL+  +A +G+ + F+STPRNI RL ++       +  
Sbjct  5     NSKKLHVVVFPWLAFGHMIPFLELSNRIAMKGHTVSFISTPRNICRLSQIPSLSSTPVTF  64

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + LPLP V++LPE+AE+T DLP   V +LK AFD + ++ + FL+   PDWVI DF    
Sbjct  65    VALPLPPVDHLPENAEATTDLPETHVGFLKKAFDGMSEAFSEFLEASRPDWVIFDFVQHW  124

Query  1309  LVPIMEKLSIPSVYFSIFT-ASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
             + PI EKL +   +FS F  A+I  I  P S +IDG D        T  P WVPFET ++
Sbjct  125   VPPIAEKLGVSRAFFSTFNAATICIIGGPSSDMIDGRDPRKTAMDLTVPPPWVPFETHVL  184

Query  1132  PRNFEMERV--FNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
              R FE  ++  +  A + G +++D YR G+   G+  + +R+C ELEPEW+QL  ++  K
Sbjct  185   FRLFEARKIMEYPTAGVTGSDLNDNYRAGLACTGSDVIAIRTCMELEPEWIQLLGKLHDK  244

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P I  GLL         D+     W +I  WLDKQ++ SVVYVA G+E     EE+  +A
Sbjct  245   PVILTGLLSAGPV----DNPDDRTWQDISGWLDKQQRNSVVYVALGTEVTVTPEEIQGLA  300

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
              GLELS LPF W  RK+    +A    LP GFEER  G+G++ T W PQ KILSH S+GG
Sbjct  301   HGLELSGLPFLWALRKR---TEASGQLLPHGFEERVNGQGIVWTGWVPQTKILSHGSIGG  357

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             F+TH GW S VE L F + LIM P   DQ ++ R L    +G  I RDE DGSF+  SVA
Sbjct  358   FVTHCGWGSAVEGLSFGRPLIMFPCNLDQPLVARFLAGMNVGVEIPRDEKDGSFTIGSVA  417

Query  418   ESLRVVMVEEHGkvfaekvkkmkakl-fekeKQDNYVNKLLDYL  290
             E++R V+ EE GK++ E     + ++   K  QD YVN  +++L
Sbjct  418   ETIRKVVTEEDGKIYRENAASQQKRVFGNKTLQDQYVNTFVEFL  461



>ref|XP_010492649.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=469

 Score =   373 bits (958),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 205/466 (44%), Positives = 289/466 (62%), Gaps = 10/466 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNI  1496
              + + LH+ M PWLAFGH++P LEL+ L+ ++G+ + F+STPRNI RL P+L  +L   I
Sbjct  9     GDGTKLHVAMFPWLAFGHLVPQLELSMLMVQKGHTVSFISTPRNIDRLLPRLPENLSSAI  68

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
             + + LP    + LP DAE+T D+P+D V YLKIAFD L+  +  FL++  PDW++ DFAS
Sbjct  69    NFVKLPFAGHKKLPVDAEATTDVPFDLVPYLKIAFDGLRVPLTEFLESSKPDWLLQDFAS  128

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
             + L PI  +L I + YF  F ++   I  P        +    P+   + PKWVPF+T  
Sbjct  129   YWLPPIASRLGIKNAYFGPFNSACLGIHKPPGYE----EYRTSPEDFLTNPKWVPFKTPA  184

Query  1135  MPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
               + +E++ +F     +    N+ D+ R+   + G   + VRSC E E EWL LA+++  
Sbjct  185   PFQLYEIQNMFEGMMSESTEENIPDMERVAGVMSGCEIIVVRSCNEYEAEWLGLAQDLHR  244

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             KP IPVG+LP      + +     AWL  K+ LD ++  SVVYV FG+E KP+Q E   I
Sbjct  245   KPVIPVGVLPPK---LDRNFKDTDAWLSAKKLLDSRKSKSVVYVTFGTEAKPSQSEFNTI  301

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             ALGLELS LPFFWV + QRG  D E  +LPEGFEERT  RG++   W  QL+ L+HDS+G
Sbjct  302   ALGLELSGLPFFWVLKTQRGQWDTEPLELPEGFEERTAERGIVWRGWVEQLRTLNHDSIG  361

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
                THSGW S++EA+ F K ++M  F+ DQG   R+  EK++G  I RD+  G F+++ V
Sbjct  362   LIFTHSGWGSMIEAVTFAKPMVMLSFVYDQGYNGRVAEEKKIGRMIPRDDTTGIFTKEDV  421

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             A+SLR+VM  E GKV+ + VK MK    + + QD YV+  LDYL A
Sbjct  422   AKSLRLVMDGEEGKVYRDNVKDMKGVFGDMDTQDRYVDSFLDYLVA  467



>ref|XP_010502543.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=452

 Score =   372 bits (954),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 206/463 (44%), Positives = 289/463 (62%), Gaps = 22/463 (5%)
 Frame = -3

Query  1645  MLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRL-PKLHPHLVPNIDLIGLPLPQ  1469
             M PWLAFGH++P+LEL+KL+ ++G+ + F+STPRNI RL P+L  +    I+ + LP   
Sbjct  1     MFPWLAFGHLVPHLELSKLMVQKGHTVSFISTPRNIDRLLPRLPENHSSAINFVKLPFSG  60

Query  1468  VENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPIMEK  1289
                LP+DAE+T D+P+D V YLKIAFD L+  +  FL++  PDW++ DF  + L PI   
Sbjct  61    HNKLPQDAEATTDVPFDLVPYLKIAFDGLRVPLTEFLESSKPDWLLQDFGPYWLPPIASC  120

Query  1288  LSIPSVYFSIFTASINAIFFPQSAVIDGVDSP------VEPKHTTSKPKWVPFETTIMPR  1127
             L I + +FS F            A + G+  P        P+   ++PKWVPF+T +  R
Sbjct  121   LGIKNAFFSAFNC----------ACLGGLKPPGFEEYRTSPEDFLTQPKWVPFKTPVPFR  170

Query  1126  NFEMERVFNDAYIDG--GNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              +E++ +F    ++    N+ D+ R+G  + G   + VRSC E E EWL L + +  KP 
Sbjct  171   LYEIQPMFEGIMLESTEDNIPDVDRIGRVISGCDIMVVRSCNEYEAEWLGLLQNLHRKPV  230

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IPVG+LP      +E      AWL  K+ LD ++  SVVYV+FG+E  P+Q E   IALG
Sbjct  231   IPVGVLPPK---LDEKFKDTDAWLSTKKLLDSRKSNSVVYVSFGTEANPSQSEFNSIALG  287

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS LPFFWV R +RG  D E   LPEGFEERT  RG++   W  QL+ L+HDS+G  L
Sbjct  288   LELSGLPFFWVLRTRRGPWDTEPLDLPEGFEERTAERGIVWRGWVEQLRTLNHDSIGLVL  347

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             THSGWSS++EA++F K ++M  F+ DQG+  R+  EK++G+ I RDE  G F+++ VA+S
Sbjct  348   THSGWSSMIEAVRFAKPMVMLGFVYDQGLNARVAEEKKIGHMIPRDETTGFFTKEDVAKS  407

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             LR+VM  E GKV+ + VK MK    + + QD YV+  LDYL A
Sbjct  408   LRLVMDGEEGKVYRDSVKDMKGVFGDMDTQDRYVDSFLDYLVA  450



>ref|XP_011036928.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Populus 
euphratica]
Length=466

 Score =   372 bits (954),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 214/469 (46%), Positives = 295/469 (63%), Gaps = 18/469 (4%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +  LHIVMLPW+AFGH+IP+ +L+  LA+ G K+ FVSTPRNI+RLPK+ P L   +  +
Sbjct  2     AEKLHIVMLPWIAFGHMIPFFQLSIDLAKAGIKVSFVSTPRNIKRLPKIPPSLADLVTFV  61

Query  1486  GLPLPQVEN--LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
               PLP ++N  LPED E+T+D+P +K+ YLKI+FD LQ  +  F+    PDW+I D   +
Sbjct  62    EFPLPSLDNDILPEDGEATVDIPAEKIEYLKISFDLLQHPLKQFIADQLPDWIIIDMIPY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFF--PQSAVIDGVDSPVEPKHT--TSKPKWVPFE  1145
              +V I  +  +P ++FS+F+A +  +F   P+  V DG    + P  T  TSKP+WV F 
Sbjct  122   WMVEIAREKKVPLIHFSVFSA-VAYVFLGHPECLVGDG-QRRLRPSWTSMTSKPEWVDFP  179

Query  1144  TTIMPRNFEMERVFNDAYIDGGN---VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             +++  RN E   VF   Y  GGN   ++D  R+   + G  A  VRSC E E ++L L E
Sbjct  180   SSVAYRNQEAVGVFEGIY--GGNASGITDSERVSKILHGCQAFAVRSCAEFEGDYLNLFE  237

Query  973   EVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
              ++GKP IPVGLLP      E  +     W EI +WLD Q+  SVV+V FGSE K  +++
Sbjct  238   RLIGKPVIPVGLLPQEK--PERKEFTDGRWGEIFKWLDDQKPKSVVFVGFGSEYKLTRDQ  295

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
             V EIA GLELS LPF W  RK  G A+ ++  LP GF ERT  RG++C  WAPQ++IL H
Sbjct  296   VYEIAHGLELSGLPFLWALRKP-GWANDDLDALPSGFGERTSDRGIVCMGWAPQMEILGH  354

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
              S+GG L HSGW SV+E+L+F   LI+ PF+ DQ +  R LVEK +G  + R E DGSF+
Sbjct  355   PSIGGSLFHSGWGSVIESLQFGHTLILLPFIVDQPLNARYLVEKALGVEVQRGE-DGSFT  413

Query  433   RDSVAESLRVVMVEEHGkvfaekvkkmkak-lfekeKQDNYVNKLLDYL  290
             RD +A++L++ MV E GK   EK  +  A    +K  QD Y+ K +D+L
Sbjct  414   RDGIAKALKLAMVSEEGKSLREKASEAAAIFGNQKLHQDYYIGKFVDFL  462



>ref|NP_201358.1| UDP-glycosyltransferase 91B1 [Arabidopsis thaliana]
 sp|Q9LSM0.1|U91B1_ARATH RecName: Full=UDP-glycosyltransferase 91B1 [Arabidopsis thaliana]
 dbj|BAA98174.1| anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis thaliana]
 gb|ABH04468.1| At5g65550 [Arabidopsis thaliana]
 gb|AED98070.1| UDP-glycosyltransferase 91B1 [Arabidopsis thaliana]
 gb|AHL38568.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=466

 Score =   372 bits (954),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 208/468 (44%), Positives = 289/468 (62%), Gaps = 14/468 (3%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LH+ + PWLA GH+IPYL+L+KL+A +G+ + F+ST RNI RLP +   L  +
Sbjct  1     MAEPKPKLHVAVFPWLALGHMIPYLQLSKLIARKGHTVSFISTARNISRLPNISSDL--S  58

Query  1498  IDLIGLPLPQ-VENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             ++ + LPL Q V++LPE+AE+T D+P   + YLK AFD L ++   FL+   P+W+++D 
Sbjct  59    VNFVSLPLSQTVDHLPENAEATTDVPETHIAYLKKAFDGLSEAFTEFLEASKPNWIVYDI  118

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFE  1145
                 + PI EKL +    F  F A SI  I  P S +I G D     +     P WVPFE
Sbjct  119   LHHWVPPIAEKLGVRRAIFCTFNAASIIIIGGPASVMIQGHDPRKTAEDLIVPPPWVPFE  178

Query  1144  TTIMPRNFEMERV--FNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             T I+ R FE +R+  +  A + G  ++D  RLG+   G+  + +RSC ELEPEW+QL  +
Sbjct  179   TNIVYRLFEAKRIMEYPTAGVTGVELNDNCRLGLAYVGSEVIVIRSCMELEPEWIQLLSK  238

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             + GKP IP+GLLP T  DD +D+     WL+I+EWLD+ +  SVVYVA G+E   + EE+
Sbjct  239   LQGKPVIPIGLLPATPMDDADDEGT---WLDIREWLDRHQAKSVVYVALGTEVTISNEEI  295

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
               +A GLEL +LPFFW  RK+  ++      LP+GF+ER + RGVI T W PQ KILSH 
Sbjct  296   QGLAHGLELCRLPFFWTLRKRTRAS----MLLPDGFKERVKERGVIWTEWVPQTKILSHG  351

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             SVGGF+TH GW S VE L F   LIM P   DQ ++ RLL    +G  I R+E DG F+ 
Sbjct  352   SVGGFVTHCGWGSAVEGLSFGVPLIMFPCNLDQPLVARLLSGMNIGLEIPRNERDGLFTS  411

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkakl-fekeKQDNYVNKLLDYL  290
              SVAE++R V+VEE GK++       + K+   K  QD Y +  +++L
Sbjct  412   ASVAETIRHVVVEEEGKIYRNNAASQQKKIFGNKRLQDQYADGFIEFL  459



>dbj|BAC43110.1| putative anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis 
thaliana]
Length=466

 Score =   371 bits (953),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 208/468 (44%), Positives = 289/468 (62%), Gaps = 14/468 (3%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LH+ + PWLA GH+IPYL+L+KL+A +G+ + F+ST RNI RLP +   L  +
Sbjct  1     MAEPKPKLHVAVFPWLALGHMIPYLQLSKLIARKGHTVSFISTARNISRLPNISSDL--S  58

Query  1498  IDLIGLPLPQ-VENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             ++ + LPL Q V++LPE+AE+T D+P   + YLK AFD L ++   FL+   P+W+++D 
Sbjct  59    VNFVSLPLSQTVDHLPENAEATTDVPETHIAYLKKAFDGLSEAFTEFLEASKPNWIVYDI  118

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFE  1145
                 + PI EKL +    F  F A SI  I  P S +I G D     +     P WVPFE
Sbjct  119   LHHWVPPIAEKLGVRRAIFCTFNAASIIIIGGPASVMIQGHDPRKTAEDLIVPPPWVPFE  178

Query  1144  TTIMPRNFEMERV--FNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             T I+ R FE +R+  +  A + G  ++D  RLG+   G+  + +RSC ELEPEW+QL  +
Sbjct  179   TNIVYRLFEAKRIMEYPTAGVTGVELNDNCRLGLAYVGSEVIVIRSCMELEPEWIQLLSK  238

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             + GKP IP+GLLP T  DD +D+     WL+I+EWLD+ +  SVVYVA G+E   + EE+
Sbjct  239   LQGKPVIPIGLLPATPMDDADDEGT---WLDIREWLDRHQAKSVVYVALGTEVTISNEEI  295

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
               +A GLEL +LPFFW  RK+  ++      LP+GF+ER + RGVI T W PQ KILSH 
Sbjct  296   QGLAHGLELCRLPFFWTLRKRTRAS----MLLPDGFKERVKERGVIWTEWVPQTKILSHG  351

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             SVGGF+TH GW S VE L F   LIM P   DQ ++ RLL    +G  I R+E DG F+ 
Sbjct  352   SVGGFVTHCGWGSAVEGLSFGVPLIMFPCNLDQPLVARLLSGMNIGLEIPRNERDGLFTS  411

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkakl-fekeKQDNYVNKLLDYL  290
              SVAE++R V+VEE GK++       + K+   K  QD Y +  +++L
Sbjct  412   ASVAETIRHVVVEEEGKIYRNNGASQQKKIFGNKRLQDQYADGFIEFL  459



>ref|XP_009108218.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Brassica rapa]
Length=473

 Score =   370 bits (949),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 209/467 (45%), Positives = 298/467 (64%), Gaps = 6/467 (1%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E  TLH+ M PWLA GH++P+L ++KLLA++G+K+ F+STPRNI+RLPKL P+L  +I  
Sbjct  11    EDETLHVAMFPWLAMGHLLPFLNISKLLAQKGHKVSFISTPRNIERLPKLPPNLSSSITF  70

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + LPLP + NLP  +ES++D+PY   + LK AFD LQ  +  FL+  SPDW+I+D+ S  
Sbjct  71    VSLPLPPIPNLPPSSESSMDVPYINQQSLKSAFDLLQLPVTEFLRRSSPDWIIYDYTSHW  130

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L P+  +L I   +FS+F AS      P S++I+  D+   P   T  P W+PFE+ ++ 
Sbjct  131   LPPVATELGIKKAFFSLFNASALCFMGPPSSLIE--DARTTPDDFTVVPPWIPFESDVVF  188

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R  E+ R       D   +SD  R G ++  + AVFVRSC E EPEW  L  ++  KP  
Sbjct  189   RYHEVARYVEKTEEDVTGISDSVRFGYSIGESDAVFVRSCPEFEPEWFVLLRDLYQKPVF  248

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             P G LP     ++ +DD  A W  IKEWLDKQ   SVVYV+ G+E    +EE+ E+ALGL
Sbjct  249   PTGFLPPPV-SEDHEDDGDATWARIKEWLDKQRVNSVVYVSLGTEASLPREELAELALGL  307

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             E S++PF W  R +   ++  +   P+GFEER  GRG++   W PQ+KILSH+SVGGFLT
Sbjct  308   EKSKVPFLWALRNEPTRSEPLI---PDGFEERVGGRGMVHVGWVPQVKILSHESVGGFLT  364

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             H GW+SVVE L F +  I  P L +QG+ TRLL  K++G  I R+E DG F  DSVA+++
Sbjct  365   HCGWNSVVEGLGFGRVPIFLPVLNEQGLNTRLLRGKDIGVEIPRNERDGRFWSDSVADTV  424

Query  409   RVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIH  269
             R+ M+++ G++   KVK MK     +++   YV++L+DY+ +  + H
Sbjct  425   RLAMIDDAGELKRTKVKMMKGLFGNRDENILYVDELIDYMKSKGSSH  471



>ref|XP_008788945.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=464

 Score =   369 bits (948),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 201/462 (44%), Positives = 286/462 (62%), Gaps = 7/462 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E  +L IV  PWLAFGH++P+LEL+K LA+RG++I F+ST RN++RLPK+   L P I  
Sbjct  3     EDGSLRIVFFPWLAFGHMLPFLELSKSLAKRGHRISFLSTRRNLKRLPKIPHDLAPFIHF  62

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP--DWVIHDFAS  1316
             + LPLP+VE L   AEST D+  D+V++LK AFD L    + FL+  SP  DW+IHDF  
Sbjct  63    VYLPLPKVEGLRAAAESTTDVLPDEVQFLKKAFDGLDIPFSEFLEEASPKPDWIIHDFGH  122

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
               L PI  K +IP  +  I  AS  A   P S + D      E    T  P+W+ F +++
Sbjct  123   HWLPPIASKFNIPCAFLCIVPASFIAFIGPPSEMKDSSRRTAE--QFTKPPQWISFPSSV  180

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R  E   +      +   ++D+ R  +TV+G + +  RSC+E E +WL+L EE+  KP
Sbjct  181   AYRLHEARLIVESFKANASGIADIRRFCLTVEGCNFIAFRSCFEFESDWLRLLEELYEKP  240

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVGLLP    +  +D    A    I EWLDKQ   +V Y A GSE   + E + E+AL
Sbjct  241   VIPVGLLPPQVQEGSDDVHGNA---RIFEWLDKQAPNTVAYAALGSEAMLSVELLHELAL  297

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS++PF W  RK    A  +   LPEGF ERT G+G++   W PQ+K+L+H SVGGF
Sbjct  298   GLELSKVPFLWALRKPASMAGDDADILPEGFLERTGGQGIVAMGWIPQIKVLAHASVGGF  357

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTHSGW S++E L+F   L++ P   DQG+  R++ EK++G  I R+E DGSF+R+SVA+
Sbjct  358   LTHSGWGSIIEGLRFGHGLVLLPISVDQGLNARIMEEKKIGLEIQRNEEDGSFNRESVAK  417

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             ++R+VMVEE G++F  K  +++    +++ Q+ YV   + +L
Sbjct  418   AIRLVMVEEEGELFRCKAMELQRLFADRDSQERYVEDFILHL  459



>ref|XP_006415140.1| hypothetical protein EUTSA_v10007607mg [Eutrema salsugineum]
 gb|ESQ33493.1| hypothetical protein EUTSA_v10007607mg [Eutrema salsugineum]
Length=452

 Score =   368 bits (945),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 199/463 (43%), Positives = 277/463 (60%), Gaps = 15/463 (3%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M      +H+ M PWLA GH++P+L L+KLLA++G+K+ F+STPRNI+RLPKL  +L  +
Sbjct  1     MERREGAMHVAMFPWLAMGHLLPFLRLSKLLAQKGHKVLFISTPRNIKRLPKLPSNLSSS  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  +  PLP        +E ++D+ ++K + LK +FD LQ  +  FL+  SPDWV++D+A
Sbjct  61    ITFVSFPLPAFPGSTPGSECSMDVSFNKQQSLKSSFDLLQLPLTKFLRDSSPDWVVYDYA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S  L  +  +L I   +FS+F A+      P S +ID   S  +P+  T  P W+PF + 
Sbjct  121   SHWLPQVAAELGISKAFFSLFNAASLCFLGPPSLLIDNFRS--KPEDFTVVPPWIPFHSN  178

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             I  R  E+  V +    D   VSD  R G ++    AVFV S  E EPEWL L +E+  K
Sbjct  179   IAYRYHEITLVGDKKEKDTTGVSDPVRFGYSISNCDAVFVHSSPEFEPEWLGLLQELYQK  238

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P  P G LPT A     + +    W+ IK+WLD Q   SVVYVA G+E     EE+ E+A
Sbjct  239   PVFPTGFLPTDA-----EVEGDTTWIAIKKWLDMQRVNSVVYVALGTEAILCPEELTELA  293

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
              GLE S +PFFWV R +        +++P+GFEER  GRG++   WAPQ+ ILSHDSVGG
Sbjct  294   HGLEKSDVPFFWVLRNE--------SQVPDGFEERVEGRGMVHFGWAPQVNILSHDSVGG  345

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH GW+S+VE L   +  I  P L +QG+ TRLL  K +G  I RDE DG+F  DSVA
Sbjct  346   FLTHCGWNSLVEGLGLGRVPIFFPVLNEQGLNTRLLEGKGLGVEIPRDEKDGAFDSDSVA  405

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              S+R+ M+++ G+    K K MK      ++   YV++LL Y+
Sbjct  406   YSVRLAMIDDAGESIRAKAKLMKGLFGNIDENSRYVDELLGYM  448



>ref|XP_002275850.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=468

 Score =   369 bits (946),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 204/468 (44%), Positives = 296/468 (63%), Gaps = 14/468 (3%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             + LH+VM+PWLAFGH+IP+L+L+  LA+ G ++ FVSTPRNI+RLPKL P L P I  + 
Sbjct  2     ADLHVVMVPWLAFGHMIPFLQLSIALAKAGVRVSFVSTPRNIRRLPKLPPDLEPLISFVE  61

Query  1483  LPLPQVEN--LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             LPLP V+   LPEDAE+T+D+P +K++YLK+A+D LQ     F+   SPDW+I D  +  
Sbjct  62    LPLPAVDGGLLPEDAEATVDVPTEKIQYLKLAYDLLQHPFKKFVADQSPDWIISDTMAHW  121

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEP--KHTTSKPKWVPFETTI  1136
             +V   E+  IPS+ F +F+++      P   +I      V P  +  TS P+WV F +++
Sbjct  122   VVETAEEHRIPSMAFILFSSAAAVFVGPNECLIGEGRRRVRPSPESLTSSPEWVSFPSSV  181

Query  1135  MPRNFEMERVFNDAYIDGGNVS---DLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
               R +E    +   +  G NVS   D +R+        AV VRSC E E E+L + E+++
Sbjct  182   AFRGYEARTCYAGFF--GENVSGITDAHRVAKVCHACKAVAVRSCIEFEGEYLNIHEKIM  239

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
             GKP IPVG LP         +  + +W EI +WLD+Q+  SVV+V FGSE K  +++V E
Sbjct  240   GKPVIPVGFLPPE--KQGGRETTEGSWSEIFKWLDEQKPKSVVFVGFGSECKLTKDQVHE  297

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             IA GLELS+LPF W  RK   + + ++  LP  F +RT G+G++   WAPQ++IL+H S+
Sbjct  298   IAYGLELSELPFLWALRKPNWTME-DIDALPSCFSDRTSGKGIVWMGWAPQMEILAHPSI  356

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GG L HSGW SV+E L+F   L++ PF+ DQG+  RLLVEK +   I R E DGSFSR+ 
Sbjct  357   GGSLFHSGWGSVIETLQFGHCLVLLPFIVDQGLNARLLVEKGLAVEIERSE-DGSFSRED  415

Query  424   VAESLRVVMVEEHGkvfaekvkkmkak-lfekeKQDNYVNKLLDYLHA  284
             +A+SLRV MV E G+    + ++  A  + ++ +Q++Y+  L+ YL A
Sbjct  416   IAKSLRVAMVSEEGEKLRARAREAAAIFIDKRLQQEHYIGGLVKYLKA  463



>ref|XP_008378603.1| PREDICTED: UDP-glycosyltransferase 91C1 [Malus domestica]
Length=487

 Score =   369 bits (948),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 197/431 (46%), Positives = 269/431 (62%), Gaps = 6/431 (1%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             + LH+V+ PWLA GH+IP+  L+ L+A+RG+ + FVSTPRN+ RLPK+  HL   ++L+ 
Sbjct  18    AVLHVVVFPWLAMGHLIPFFHLSTLIAQRGHTVSFVSTPRNLSRLPKIPSHLSSLVNLVS  77

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
              PLP++ NLP DAES+ D+P+ K + LK AFD LQ  + AFL++  PDWVI+D+A   L 
Sbjct  78    FPLPRLPNLPNDAESSTDVPFHKQQLLKTAFDMLQTPLTAFLESSRPDWVIYDYAPHWLP  137

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
              I  +L +   +F    A+  A   P S +I G D   + +  T  PKWVPFE+ +  R 
Sbjct  138   AIAARLGVAHAFFFCVNAACLAYLGPPSVLISGQDGRTKAEDFTVVPKWVPFESDMAYRL  197

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK----P  956
              E+ +    +  +     D  R GV ++ +  VFVRS  E EPEWL L  E+  +    P
Sbjct  198   HEVAKWVQASSGNESGTPDTVRFGVAIEESDVVFVRSSDEFEPEWLNLVRELYREVKVKP  257

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +PVG LP     +EE  +    W  IK WLDKQ   SVVY+A G+E   +QEE+ E+AL
Sbjct  258   VVPVGFLPPN--IEEEASEFDETWGGIKGWLDKQRVNSVVYIALGTEATLSQEELTELAL  315

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS +PFFWV R    S  +    LP GF ER +GRGV+   WAPQ++ILSHDS GGF
Sbjct  316   GLELSGVPFFWVLRNPPESTQSVSEMLPPGFLERVKGRGVVDLGWAPQVRILSHDSXGGF  375

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH GW+S++E L F + L+  P + DQG+  RL   K +G  I R+E DGSF+RDSVAE
Sbjct  376   LTHCGWNSMIEGLMFGRVLMFFPMVNDQGLNARLGNGKGLGVEIPRNERDGSFTRDSVAE  435

Query  415   SLRVVMVEEHG  383
              +R+ MV++ G
Sbjct  436   FVRLAMVDDSG  446



>ref|XP_007148436.1| hypothetical protein PHAVU_006G208500g [Phaseolus vulgaris]
 gb|ESW20430.1| hypothetical protein PHAVU_006G208500g [Phaseolus vulgaris]
Length=476

 Score =   368 bits (944),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 203/475 (43%), Positives = 293/475 (62%), Gaps = 24/475 (5%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI MLPWLA GH+ PY ELAK+LA++G+ + F+STP+NI R+PK+   L P I L+ LP
Sbjct  19    LHIAMLPWLAAGHVNPYSELAKILAQKGHFVTFISTPKNIDRMPKIPQPLQPFIKLVRLP  78

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LPQ E+LPE AEST+D+P  K+ +LK+A++ LQD +   L+T  PDWV +DFA+  L  I
Sbjct  79    LPQTEHLPEGAESTMDIPKSKICHLKLAYEGLQDPVLELLKTSRPDWVFYDFATEWLPEI  138

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTT------SKPKWVPFETTI  1136
              + LSIP  ++++ TA+ N +F+         D P E + ++        PKW+PF+TT+
Sbjct  139   AKSLSIPCAHYNL-TAAWNKVFY---------DPPKEARTSSFNIQDMCNPKWLPFQTTL  188

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
               R +E+ R       D       + L           +R+  ELE EWL    +    P
Sbjct  189   HLRPYEIIRAMRSRRDDDTGRCASFDLAKVYSSCDMFLLRTSRELEGEWLDYLSQRYDMP  248

Query  955   TIPVGLL-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
              IPVGL+ P+    D  ++D+   WL IKEWLD QE  SVVY+AFGSE K +QE+V E+A
Sbjct  249   VIPVGLVPPSIQIKDVGEEDENPDWLRIKEWLDSQECSSVVYIAFGSELKLSQEDVTELA  308

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
              G+E+S+LPFFW +R  +  +     +LPEGFEERT  RG +  SWAPQ KIL H ++GG
Sbjct  309   HGIEISKLPFFWAFRNMKEDS----LELPEGFEERTEDRGFVWKSWAPQSKILGHAAIGG  364

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
              +TH G +S+VE L F   L+  P+L DQ + +R+L EK++   +AR E DGSF+R+SVA
Sbjct  365   CVTHCGTNSLVEMLNFGHVLVTLPYLLDQALFSRVLEEKKVAIEVARSEEDGSFTRESVA  424

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPSGS  254
             ++LR+ +VEE G  + +  K+M      ++ Q+ Y++   D + A    + PS +
Sbjct  425   KTLRLAVVEEEGSSYRKNAKEMGKVFSCRDLQNQYID---DCILALQNYNAPSNT  476



>ref|XP_002320817.1| hypothetical protein POPTR_0014s08440g [Populus trichocarpa]
 gb|EEE99132.1| hypothetical protein POPTR_0014s08440g [Populus trichocarpa]
Length=467

 Score =   365 bits (938),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 207/467 (44%), Positives = 290/467 (62%), Gaps = 13/467 (3%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +  LHIVMLPW+AFGH+IP+ +L+  LA+ G K+ FVSTPRNI+RLPK+ P L   +  +
Sbjct  2     AEKLHIVMLPWIAFGHMIPFFQLSIDLAKAGIKVSFVSTPRNIKRLPKIPPSLADLVKFV  61

Query  1486  GLPLPQVEN--LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
               PLP ++N  LPED E+T+D+P +K+ YLKIA+D LQ  +  F+    PDW+I D   +
Sbjct  62    EFPLPSLDNDILPEDGEATVDIPAEKIEYLKIAYDLLQHPLKQFIADQLPDWIIIDMIPY  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFF--PQSAVIDGVDSPVEPKHT--TSKPKWVPFE  1145
              +V I     +P ++FS+F+A +  +F   P+  ++      + P  T  TSKP+WV F 
Sbjct  122   WMVEIARDKKVPLIHFSVFSA-VAYVFLGHPECLLVGDGQKRLRPSWTSMTSKPEWVDFP  180

Query  1144  TTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
             +++  RN E   VF   Y  +   ++D  R+   + G  A+ VRSC E E ++L L E V
Sbjct  181   SSVAYRNHEAVGVFEWIYKGNASGITDGERVSKILHGCQALAVRSCAEFEGDYLNLFERV  240

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
             +GKP IPVGLLP      E  +     W EI +WLD Q+  SVV+V FGSE K  +++V 
Sbjct  241   IGKPVIPVGLLPQEK--PERKEFTDGRWGEIFKWLDDQKPKSVVFVGFGSEYKLTRDQVY  298

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             EIA GLELS LPF W  RK  G A+ ++  LP GF ERT  RG++C  WAPQ++IL H S
Sbjct  299   EIAHGLELSGLPFLWALRKP-GWANDDLDALPSGFGERTSDRGIVCMGWAPQMEILGHPS  357

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             +GG L HSGW S++E+L+F   LI+ PF+ DQ +  R LVEK +G  + R E DGSF+RD
Sbjct  358   IGGSLFHSGWGSIIESLQFGHTLILLPFIIDQPLNARYLVEKGLGVEVQRGE-DGSFTRD  416

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkak-lfekeKQDNYVNKLLDYL  290
              VA++L + M+   GK   EK  +  A    +K  QD Y+ K +D+L
Sbjct  417   GVAKALNLAMISAEGKGLREKASEAAAIFGNQKLHQDYYIGKFVDFL  463



>gb|KFK29804.1| hypothetical protein AALP_AA7G181400 [Arabis alpina]
Length=457

 Score =   364 bits (934),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 196/423 (46%), Positives = 261/423 (62%), Gaps = 13/423 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI M PWLA GH++P+L L+K LA++G+KI ++STPRNIQRLPKL   L  +I  I  P
Sbjct  9     LHIAMFPWLAMGHLLPFLNLSKSLAQKGHKISYISTPRNIQRLPKLPSTLSSSITFISFP  68

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP    L    ES++D+PY+K + LK AFD LQ  +  FL   SPDW+I+D+AS  L  I
Sbjct  69    LPPFPGLSPSFESSMDIPYNKQQSLKSAFDLLQTPIKNFLLRSSPDWIIYDYASHWLPSI  128

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
               +L I   +FS+F A+      P S++I    S  +P+  T  P WVPFE+ I+ R  E
Sbjct  129   ATELGISKAFFSLFNAASLCFMGPPSSLIQETRS--KPEDFTVVPSWVPFESNIVFRYHE  186

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
             + R       D   VSD  R G ++  +  V VRSC E EPEW +L  ++  KP  P G 
Sbjct  187   VARYVEKTEEDVTGVSDSVRFGYSIGESDVVIVRSCVEFEPEWFRLLLDLYQKPVFPTGF  246

Query  937   LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQ  758
             LP  +   E + D  A W+ IKEWLDKQ   SVVYVA G+E    +EE+ E+ LGLE+S 
Sbjct  247   LPPVS---EGEGDDDATWVCIKEWLDKQRVNSVVYVALGTEASLPKEELAELGLGLEISN  303

Query  757   LPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSGW  578
             + FFWV R +         ++P+GFEER   RG++   W PQ+KILSH+SVGGFLTH GW
Sbjct  304   VSFFWVLRNE--------LEIPDGFEERVEERGMVHVGWVPQVKILSHESVGGFLTHCGW  355

Query  577   SSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVVM  398
             +SVVE L   +  I+ P L +QG+  RLL  K +G  I RDE DG+F  DSVA S+R+ M
Sbjct  356   NSVVEGLGLGRVPILLPVLNEQGLNARLLQGKGLGVEIVRDERDGTFDSDSVASSVRLAM  415

Query  397   VEE  389
             +++
Sbjct  416   MDD  418



>ref|XP_007134322.1| hypothetical protein PHAVU_010G037600g [Phaseolus vulgaris]
 gb|ESW06316.1| hypothetical protein PHAVU_010G037600g [Phaseolus vulgaris]
Length=441

 Score =   363 bits (931),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 205/473 (43%), Positives = 287/473 (61%), Gaps = 39/473 (8%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA +   LHIV+ PWLAFGH++P+ ELAKL+A++G+KI F+STPRNI RLPK+  +L P 
Sbjct  1     MAEQQEKLHIVVFPWLAFGHMLPFFELAKLIAQKGHKISFISTPRNIHRLPKVPENLQPL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             +DLI LPLP+V+ LPE+AE+T+D+P+  + YLK+AFD L+  +  FL+     W+I+DFA
Sbjct  61    VDLIELPLPRVDKLPENAEATVDIPHHIIPYLKLAFDGLEQPLTKFLERCKAHWIIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              + L PI  KL I  ++FSIF AS   +                  +T    K      +
Sbjct  121   PYWLPPISSKLGISCIFFSIFNASGLCLILGD--------------YTRKASK------S  160

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  + F  E    +A   G  VSD++RL     GA    +RSC E+E E L+L E + GK
Sbjct  161   VQNKGFPKEHY--EANESG--VSDVFRLLRISNGAQVFALRSCMEIEGEPLKLCESIHGK  216

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
               IPVGLLP +   +  +D     W  I  WLDKQEKGSV+YVAFG+E   + E+  EI 
Sbjct  217   TMIPVGLLPPS--LEFSEDSNDENWNTILNWLDKQEKGSVIYVAFGTEMTLSDEDFTEIT  274

Query  778   LGLELSQLPFFWVYRKQRGSA----DAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
             +G+E+S  PFFWV +KQ  S+    D  V            G G++  +WAPQ++ILSH 
Sbjct  275   MGIEMSGFPFFWVLKKQNTSSVELQDVVVN---------NSGNGMVWRTWAPQMRILSHK  325

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             S+GGFLTH GWSSV+E+L+    L+M PF  DQ I++RL+ EK +G  + R E++G FSR
Sbjct  326   SIGGFLTHCGWSSVIESLQIGCPLVMLPFQNDQFIVSRLMEEKGVGIKVQRSEDEGKFSR  385

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTI  272
             +S+A +LR VM+EE GK +  + +KM      KE Q  Y ++ +DY+     I
Sbjct  386   ESLANALRSVMLEEEGKTYRSQAEKMSKVFGNKELQKKYADEFVDYMETHRPI  438



>ref|XP_011084237.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Sesamum indicum]
Length=465

 Score =   363 bits (933),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 201/474 (42%), Positives = 294/474 (62%), Gaps = 16/474 (3%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M      LHIVM PWLA GH+ P+L L+  LA++G++I F+STPRN+ R  K+   L   
Sbjct  1     MEGGGKVLHIVMFPWLAIGHLRPFLRLSICLAQKGHRISFISTPRNLHRAVKVPQDLSHL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTL--SPDWVIHD  1325
             I++I  PLP+VE+LP  AES++D+P+ K + LK+AFD L+  ++ FL  +   PDW+++D
Sbjct  61    INVIAFPLPEVEHLPPHAESSMDVPHVKQQLLKVAFDLLRPLVSDFLDNVRPKPDWIVYD  120

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFE  1145
             +AS  L  + E++ I   +FS+FTA+  A     SA++D   S       T  P+W+PF 
Sbjct  121   YASHWLPKLAEEMGISRAFFSLFTAAFMAFLGSPSALMDQKYSRSTAADFTIVPEWIPFP  180

Query  1144  TTIMPRNFEM----ERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLA  977
             + +  R  EM    E+  +    D G  SD  R G+++ G+  V  RSC E EPEW  L 
Sbjct  181   SDMAFRLHEMSKNMEKDADGNEYDSGT-SDSIRFGLSIDGSEIVIFRSCVEFEPEWFDLV  239

Query  976   EEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQE  797
              ++  KP IPVG+LP    + + +++    WL+IK+WLD Q+  S+VYVA G+E   +Q 
Sbjct  240   RQLYQKPVIPVGILPVEDEEHDNNEE----WLKIKQWLDAQKDDSLVYVALGTEAALSQT  295

Query  796   EVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
             E  E+ALGLE   LPFFWV  +     +     LP+GF++R   RG++ T WAPQ+KILS
Sbjct  296   EAQELALGLEQCGLPFFWVLNR-----NYLPEMLPDGFQDRVANRGMVYTEWAPQIKILS  350

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H +VG FLTH GW+S  EAL F + LI+ P + DQG+  RLL EK++G  I R+E DGSF
Sbjct  351   HPAVGAFLTHCGWNSATEALGFGRVLILFPVMNDQGLNARLLQEKKVGVEIPRNEKDGSF  410

Query  436   SRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAAST  275
             +RDSV+E++R+V+V E G+   E  +KMK    +K +  +YV+ L+ ++    T
Sbjct  411   TRDSVSETVRLVLVSEEGRKVRENARKMKELFGDKSRSSSYVDSLVQHMVQTRT  464



>ref|XP_007134314.1| hypothetical protein PHAVU_010G036800g [Phaseolus vulgaris]
 gb|ESW06308.1| hypothetical protein PHAVU_010G036800g [Phaseolus vulgaris]
Length=438

 Score =   362 bits (928),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 204/477 (43%), Positives = 291/477 (61%), Gaps = 46/477 (10%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA +   LHIV+ PWLAFGH++P+LELAKL+A++G+KI F+STPRNI RLPK+  +L P 
Sbjct  1     MAEQQEKLHIVVFPWLAFGHMLPFLELAKLIAQKGHKISFISTPRNIHRLPKVPENLQPL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             +DLI LPLP+V+ LPE+AE+T+D+P+  + YLK+AFD L+  +  FL+   P W+I+DFA
Sbjct  61    VDLIELPLPRVDKLPENAEATVDIPHHIIPYLKLAFDGLEQPLTKFLERSKPHWIIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              + L PI  KL I  V F IF+AS          +    D     +  + + K +P E  
Sbjct  121   PYWLPPISSKLGISCVSFCIFSAS---------GMYSFSDFFTRKESESPRSKGIPEE--  169

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
                         N+   D   VSD++R+  T  GA  +  RSC E+E E L+L E +  K
Sbjct  170   -----------HNEN--DESGVSDMFRVLRTSNGAQVIASRSCMEIEGEPLKLCESIYRK  216

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
               IPVGLLP +      +D     W  I  WLDKQEKGSV+YVAFGSE   + E+  EI 
Sbjct  217   TVIPVGLLPPS--LQFSEDSNDENWNTILNWLDKQEKGSVIYVAFGSEVTLSDEDFTEIT  274

Query  778   LGLELSQLPFFWVYRKQRGSA----DAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
             +G+E+S  PFFWV +KQ  S+    D  V            G+G++ T+WAPQ++ILSH 
Sbjct  275   MGIEMSGFPFFWVLKKQNTSSVELQDVVVN---------NSGKGMVWTTWAPQMRILSHK  325

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             S+GGFLTH GWSSV+E+L+    L+M PF  +Q I+ RL+ EK++G+ + R+E+ G F+R
Sbjct  326   SIGGFLTHCGWSSVIESLQIGCPLVMLPFQNEQFIVARLMEEKKVGFKVERNEHHGKFTR  385

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPS  260
             +S+A +LR VM+EE    +  + ++M     +KE    Y++  +DY+     IH P+
Sbjct  386   ESLAIALRSVMLEE---TYRSEAQEMSKIFGDKELHQKYIDHFVDYME----IHRPT  435



>ref|XP_010938322.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=469

 Score =   362 bits (930),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 196/463 (42%), Positives = 287/463 (62%), Gaps = 7/463 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI MLPWLAFGH+IP+L LA  LA  G ++ F+STPRNIQRLPK+ PHL   I  I LP
Sbjct  6     LHIAMLPWLAFGHMIPFLHLAVALATAGLRVSFLSTPRNIQRLPKIPPHLTSLITFIQLP  65

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP+V+ LP+ AE+T+DLP D+V  LKIA+D LQ+S+  FL   SPD+VIHDF  +     
Sbjct  66    LPRVDGLPDQAEATVDLPTDEVPLLKIAYDLLQNSVKKFLAEESPDYVIHDFLQYWAAAA  125

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVE--PKHTTSKPKWVPFETTIMPRN  1124
                + + S++FS+++A+  A F P  A+ +     +   P+  TS P W+P  +T+  R 
Sbjct  126   ARDMGVQSIFFSVYSAATLAFFGPPEALTEDGRRKLRPTPESLTSPPDWLPSGSTVAFRR  185

Query  1123  FEMERVFNDAY-IDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
              E E  ++ A+ ++   ++D+ R  + V+  +AV +R+C E E E+L++   +  KP IP
Sbjct  186   REAEVFYSAAFTMNSSGITDIDRFRLVVESCTAVAIRTCPEYEGEYLEIVRRLYRKPVIP  245

Query  946   VGL-LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             VGL LP+        ++    W  +  WLD Q   SVV+V+FGSE K  + E+ E+A GL
Sbjct  246   VGLILPSP--LAASGEEGDDRWARVIRWLDAQTPMSVVFVSFGSEYKMERRELHELAHGL  303

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             EL+ +PF WV R+      ++   LP GF +RT+GRG +C  WAPQL+IL+H S+GG L 
Sbjct  304   ELANVPFLWVLRRPSWCNGSDEEALPAGFIDRTKGRGTLCFGWAPQLEILAHPSIGGSLF  363

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             HSGW S++E+L+    L++ P + DQ +  RLLVEK +   + R + DGSF+RD + ++L
Sbjct  364   HSGWGSIIESLRHGHALVVLPCMVDQSLNARLLVEKGIAVEVER-QGDGSFTRDGIVKAL  422

Query  409   RVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAA  281
              + MV   G+    K +KM     ++E  D YV + +DYL  A
Sbjct  423   DMAMVSGQGEELRTKTRKMATLFADQELDDKYVREFVDYLLKA  465



>ref|XP_002302598.1| hypothetical protein POPTR_0002s16380g [Populus trichocarpa]
 gb|EEE81871.1| hypothetical protein POPTR_0002s16380g [Populus trichocarpa]
Length=467

 Score =   362 bits (929),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 199/465 (43%), Positives = 282/465 (61%), Gaps = 10/465 (2%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +S LHIV+ PW AFGHI+P+   +K LAE G  + FVSTPRNIQRLP + P L P I+L+
Sbjct  2     ASDLHIVIFPWSAFGHILPFFHFSKALAEAGVHVSFVSTPRNIQRLPAISPTLAPLINLV  61

Query  1486  GLPLPQVE---NLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
              LP P ++    LPE AE+T D+P +K++YLKIA+D LQ     F+   SP+W+I DF S
Sbjct  62    ELPFPALDVKYGLPEGAEATADIPAEKIQYLKIAYDLLQHPFKQFVAEKSPNWIIVDFCS  121

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIF-FPQSAVIDGVDSP-VEPKHTTSKPKWVPFET  1142
                V I ++  IP +Y SIF+  + A    P   V DG       P+  TS P+W+ F +
Sbjct  122   HWAVDIAKEYGIPLIYLSIFSGVMGAFMGHPGYFVGDGQKRYWGSPESLTSPPEWITFPS  181

Query  1141  TIMPRNFEMERVFNDAYIDGGN-VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             ++  R++E + ++   Y +  + + D  R+  TV G  A+ VRSC E E E++ + ++++
Sbjct  182   SVAFRSYEAKNMYPGIYGENASGIRDAERVAKTVSGCQAIAVRSCIEFEGEYMDVYQKIM  241

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              K  IP+GLLP      EE +     W  I EWLD QE  SVV+V FGSE K  ++EV E
Sbjct  242   SKQVIPIGLLPPE--KPEEREITDGTWNTIFEWLDNQEHESVVFVGFGSECKLTKDEVYE  299

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             IA GLELS+LPF W  RK   +A  ++  LP  F  +T  +G++   WAPQL++LSH S+
Sbjct  300   IAYGLELSKLPFLWALRKPNWAA-TDLDVLPPEFNNKTSEKGIVSIGWAPQLELLSHPSI  358

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GG L HSGW SV+E L++   LI+ PF+ DQG+  RLLVEK +   + R E DGSF+R  
Sbjct  359   GGSLFHSGWGSVIETLQYGHCLIVLPFIADQGLNARLLVEKGLAVEVDRKE-DGSFTRHD  417

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +A+SLR+ MV E G     + K        ++   +Y+N+ + YL
Sbjct  418   IAKSLRLAMVSEEGSQLKTRAKDAATIFQNRKLHQDYINRFVKYL  462



>ref|XP_008789644.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=464

 Score =   362 bits (928),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 209/463 (45%), Positives = 278/463 (60%), Gaps = 8/463 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E  +LHIV+ PWLAFGH++P+L L+K LA+RG+ I F+STPRNI RLPKL P L P I+ 
Sbjct  2     EEGSLHIVVFPWLAFGHLLPFLGLSKSLAKRGHHISFLSTPRNILRLPKLPPSLAPLIEF  61

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP--DWVIHDFAS  1316
             I + LP  ++LP +AE+T DL  D V+YLK AFD L   +A FL+  SP  DW+I DF  
Sbjct  62    IPIRLPPSDHLPNNAEATTDLLPDDVQYLKKAFDGLDQPIAKFLEQASPKPDWIIQDFTP  121

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
             + L PI  KL IP   F+ F A  +A  + +    DG      P+  T  P+W+PF TT 
Sbjct  122   YWLPPIAAKLHIPCAMFNTFPAYFSAFVWGE----DGARMRGPPERLTVVPEWIPFPTTA  177

Query  1135  MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
             + R FE  +      +D   VS   R  + V+    + +RSC EL+ + L    E+   P
Sbjct  178   VLRLFEARQFDYMLQVDASGVSAADRFEMVVRRCKLMALRSCMELDRQVLSTMSELFNMP  237

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +PVGLLP +  +  E     ++ + I  WLDKQ   SVVYV+ GSE   + E V E+A 
Sbjct  238   VVPVGLLPPSVDEGGEKIASTSS-MNIFRWLDKQTPRSVVYVSLGSEATLSSELVHELAF  296

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS  PF W  R+  G    EV  LPEGFE+R  G G++   WAPQ +IL+H+SVGGF
Sbjct  297   GLELSGQPFLWALRRPAGMPK-EVELLPEGFEDRIAGNGMVTMDWAPQTEILAHESVGGF  355

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH GW S+VE L F   L+  P   DQ I  R++VEKE+G  +  DE DGSF RD+VA+
Sbjct  356   LTHGGWGSLVEGLGFGHPLVFLPVFGDQPINARVMVEKEIGVEVRSDEEDGSFKRDAVAQ  415

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             +LR+VMVEE GK    +  KMK     KE Q+  +++ + YL 
Sbjct  416   ALRLVMVEEEGKKIRNEANKMKLIFGNKELQERCIDEFVRYLR  458



>ref|XP_004972263.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Setaria italica]
Length=495

 Score =   362 bits (929),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 207/483 (43%), Positives = 288/483 (60%), Gaps = 31/483 (6%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +  +H++MLPWLAFGHI+P+ ELAK +A +G+++  +STPRN +RL ++ P L   + ++
Sbjct  27    AGAMHVLMLPWLAFGHILPFTELAKRIARQGHRVTLLSTPRNTRRLIRIPPDLADLVRVV  86

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDELQDSMAAFLQTLS-----------P  1343
              + LP+VE LPEDAE+++DLP D +R YL++A+D      AAF   LS           P
Sbjct  87    DITLPRVERLPEDAEASIDLPSDDLRPYLRVAYD------AAFAAKLSDILQEPGPPGRP  140

Query  1342  DWVIHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSK  1166
             DWV+ D+A +       +  +P    S+F A+  +IF P  A++  G  +  +P+H T  
Sbjct  141   DWVLIDYAPYWAPAAAARHGVPCACLSLFGAAALSIFGPPDALLGRGKHARTKPEHLTGV  200

Query  1165  PKWVPFETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEW  989
             P +VPF TT+  R FE    F  A + D   VS+ YR G  ++G+  V +RS  E EPEW
Sbjct  201   PDYVPFPTTVAYRGFEARAFFEPALVPDDSGVSEAYRFGKCIEGSQLVGIRSSAEFEPEW  260

Query  988   LQLAEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETK  809
             LQ+  E+  KP IPVGL P     D    +         +WLDKQ  GSVVY AFGSE K
Sbjct  261   LQVLGELHRKPVIPVGLFPPPPTQDVGGHEATL------QWLDKQAPGSVVYAAFGSEAK  314

Query  808   PNQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTK--LPEGFEERTRGRGVICTSWAP  635
                 ++  IALGLE S LPF W +R     ADA   K  LPEGFEER  GRG++C  W P
Sbjct  315   LTSVQLQTIALGLEASDLPFLWAFRP---PADANEGKSGLPEGFEERVNGRGLVCRGWVP  371

Query  634   QLKILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARD  455
             Q ++L+H+SVG FLTH+GW+S+ E L    +L++ P + DQGI  RLLVEK++G  +ARD
Sbjct  372   QARLLAHESVGAFLTHAGWNSITEGLACGVRLVLLPLMFDQGINARLLVEKKVGVEVARD  431

Query  454   ENDGSFSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAAST  275
             E DGSF+ + +A +LR V+VE+ G+VF  KVK++       +  D  V   L  L   S 
Sbjct  432   EEDGSFTPNDIAAALRRVVVEDEGEVFGNKVKELAKVFGNDDVNDRCVRDFLGCLSEYSL  491

Query  274   IHH  266
               H
Sbjct  492   QQH  494



>ref|XP_008788932.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=494

 Score =   362 bits (929),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 210/473 (44%), Positives = 291/473 (62%), Gaps = 12/473 (3%)
 Frame = -3

Query  1687  FSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHL  1508
             FS M  +   LH+V+ PWLAFGH++P+LEL+K LA+RG++I F+STPRNIQRLPK+   +
Sbjct  21    FSTM--DDGPLHVVVFPWLAFGHMLPFLELSKSLAKRGHRISFLSTPRNIQRLPKIPSQI  78

Query  1507  VPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLS--PDWV  1334
                +DL+ LPLP+V+ LPEDAE+T D+P   V+YL  AFD L +    FL+  S  PDW+
Sbjct  79    ASLVDLVSLPLPKVDGLPEDAEATTDIPPPMVQYLMKAFDGLDEPFTRFLREASPKPDWI  138

Query  1333  IHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAV-IDGVDSPVEPKHTTSKPKW  1157
             IHDF+   + PI     +P  +FSIF +S      P S + + G+     P+  T  P+W
Sbjct  139   IHDFSHHWIPPIASMFEVPCAFFSIFPSSTLVFIGPPSEMKLGGLRR--TPEQFTKPPEW  196

Query  1156  VPFETTIMPRNFEMERVFNDAYIDGGN-VSDLYRLGVTVKGASAVFVRSCYELEPEWLQL  980
             + F ++   R +E  R+F   Y D  +  S+  RL + ++    V VRSC E E +WL L
Sbjct  197   ISFPSSAAFRLYEA-RLFTAHYRDNASGFSEFRRLELVIQRCKLVAVRSCKEFESDWLPL  255

Query  979   AEEVV-GKPTIPVGLLPTTAYddeedddkkaAWL-EIKEWLDKQEKGSVVYVAFGSETKP  806
              EE+   KP +P GLLP    +  ED       + ++  WL+ Q  GSVV V  GSE   
Sbjct  256   LEELYEKKPVVPAGLLPPHLQERIEDVHTNTTGVAQVFGWLNGQTLGSVVCVVLGSEATL  315

Query  805   NQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLK  626
             + E V E+ALGLELS++PF W  RK  G A ++V  LP+GFE RTRG GV+   W PQL 
Sbjct  316   SVELVHELALGLELSKVPFVWALRKPAGMA-SDVEILPKGFEVRTRGLGVVAMGWIPQLS  374

Query  625   ILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDEND  446
             +L+H SVGGF TH GWSS++E L+F   LI+ P   D G+  R++ +K +G  + RDE D
Sbjct  375   VLAHPSVGGFFTHCGWSSIIEGLQFGHPLILLPIFADHGLNARIMEDKRIGLEVPRDEED  434

Query  445   GSFSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             GSF R+ VA+ +R++MVEE GK F  K  K+K    +KE Q+ YV+ L+  L 
Sbjct  435   GSFGREGVAKVIRLIMVEEEGKPFRCKAGKLKEVFSDKESQERYVDNLVRCLQ  487



>ref|XP_010938324.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=469

 Score =   361 bits (926),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 195/463 (42%), Positives = 286/463 (62%), Gaps = 7/463 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI MLPWLAFGH+IP+L LA  LA  G ++ F+STPRNIQRLPK+ PHL   I  I LP
Sbjct  6     LHIAMLPWLAFGHMIPFLHLAVALATAGLRVSFLSTPRNIQRLPKIPPHLTSLITFIQLP  65

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP+V+ LP+ AE+T+DLP D+V  LKIA+D LQ+S+  FL   SPD+VIHDF  +     
Sbjct  66    LPRVDGLPDQAEATVDLPTDEVPLLKIAYDLLQNSVKKFLAEESPDYVIHDFLQYWAAAA  125

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVE--PKHTTSKPKWVPFETTIMPRN  1124
                + + S++FS+++A+  A F P  A+ +     +   P+  TS P W+P  +T+  R 
Sbjct  126   ARDMGVQSIFFSVYSATTLAFFGPPEALTEDGRRKLRPTPESLTSPPDWLPSGSTVAFRR  185

Query  1123  FEMERVFNDAY-IDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
              E E  ++ A+ ++   ++D+ R  + V+  +AV +R+C E E ++L++   +  KP IP
Sbjct  186   REAEVFYSAAFTMNSSGITDIDRFRLVVESCTAVAIRTCPEYEGDYLEIVRRLYRKPVIP  245

Query  946   VGL-LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             VGL LP+        ++    W  +  WLD Q   SVV+V+FGSE K  + E+ E+A GL
Sbjct  246   VGLILPSPP--AAGGEEGDDRWARVFRWLDSQTPKSVVFVSFGSEYKMERRELHELAHGL  303

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             EL+ +PF WV R+      ++   LP GF +RT+ RG +C  WAPQL+IL+H SVGG L 
Sbjct  304   ELANVPFLWVLRRPSWCNGSDEEALPAGFIDRTKSRGTLCFGWAPQLEILAHPSVGGSLF  363

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             HSGW S++E L+    L++ P + DQ +  RLLVEK +   + R ++DGSF+RD + ++L
Sbjct  364   HSGWGSIIETLRHGHTLVVLPCMVDQSLNARLLVEKGIAVEVER-QDDGSFTRDGIVKAL  422

Query  409   RVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAA  281
              V MV   G+    K ++M     ++E  D YV + +DYL  A
Sbjct  423   DVAMVSGQGEELRTKTREMATLFADQELDDKYVREFVDYLLKA  465



>gb|EYU37211.1| hypothetical protein MIMGU_mgv1a018729mg, partial [Erythranthe 
guttata]
Length=466

 Score =   360 bits (924),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 196/437 (45%), Positives = 276/437 (63%), Gaps = 14/437 (3%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   LHIVM PWLA GHI P+  L++ LA +G++I F+STPRN+QR+ K+   L   I+L
Sbjct  5     EGKFLHIVMFPWLAIGHIRPFFRLSECLARKGHRISFISTPRNLQRIVKVPRELSHLINL  64

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTL--SPDWVIHDFAS  1316
             I  PLP+VENLP +AES++D+P+ K + LK+A D LQ  + +FL+     PDW+++D+AS
Sbjct  65    IAFPLPEVENLPPNAESSMDVPHVKQQLLKVALDLLQPCVRSFLERARPKPDWIVYDYAS  124

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVD-SPVEPKHTTSKPKWVPFETT  1139
               L P+ E+  I   YFS+FTA+  +   P  A+I G     +  +  T  P+WVPF + 
Sbjct  125   HWLPPLAEEFGISRGYFSLFTAAFMSFLGPTDALIFGEKYGRLTAEDYTVVPEWVPFPSD  184

Query  1138  IMPRNFEM----ERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             +  R  EM    E+       D G  SD  R G+++ G+  V  RS  E EPEW  L ++
Sbjct  185   VAFRLHEMTKNMEKDAEGNEYDSG-TSDSIRFGLSINGSEIVIFRSYVEFEPEWFDLIQQ  243

Query  970   VVGKPTIPVGLLP-TTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
             +  KP IP+G+LP      ++E D+    W  IKEWLD Q++ S+VYVA G+E   +Q+E
Sbjct  244   LYQKPIIPIGVLPIEDDEREDEFDNDDTEWPTIKEWLDSQKQNSIVYVALGTEATLSQKE  303

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
               E+ALGLE S LPFFWV  +   S       LP GF ER + RG++ T WAPQ+KILSH
Sbjct  304   AHELALGLEQSGLPFFWVLNRNHLS-----EMLPHGFIERVKNRGMVYTKWAPQIKILSH  358

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
              +VGGFLT  GW+SV EAL F + LI+ P + DQG+  RLL +K++G  I R+E DGSF+
Sbjct  359   SAVGGFLTRCGWNSVTEALGFGRVLILFPIMNDQGLNARLLHDKKVGIEIPRNEKDGSFT  418

Query  433   RDSVAESLRVVMVEEHG  383
              +SVA+++++ +V E G
Sbjct  419   SESVAKTVKLALVSEDG  435



>ref|XP_011023290.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Populus 
euphratica]
Length=467

 Score =   359 bits (922),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 198/465 (43%), Positives = 283/465 (61%), Gaps = 10/465 (2%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +S LHIV+ PW AFGHI+P+   +K LAE G  + FVSTPRNIQRLP + P L P I+L+
Sbjct  2     ASDLHIVIFPWSAFGHILPFFHFSKALAEAGVHVSFVSTPRNIQRLPAISPTLAPLINLV  61

Query  1486  GLPLPQVE---NLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
              LP P ++    LPE AE+T+D+P +K++YLKIA+D LQ     F+   SP+W+I DF S
Sbjct  62    ELPFPALDVKYGLPEGAEATVDIPAEKIQYLKIAYDLLQHPFKQFVAEKSPNWIIADFCS  121

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIF-FPQSAVIDGVDSP-VEPKHTTSKPKWVPFET  1142
                V I ++  IP +Y SIF+ +  A    P + V DG       P+  TS P+W+ F +
Sbjct  122   HWAVDIAKEYGIPLIYLSIFSGATRAFMGHPGNFVGDGQKRFWGSPESLTSPPEWLTFPS  181

Query  1141  TIMPRNFEMERVFNDAYIDGGN-VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             ++  R++E + ++   + +  + + D  R+  T  G  A+ VRSC E E E++ + +++V
Sbjct  182   SVAFRSYEAKIMYPGIFGENASGIRDAERIAKTGCGCQAIAVRSCTEFEGEYMDVYQKLV  241

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              K  IP+GLLP      E+ +     W  I EWLD QE  SVV+V FGSE K  ++EV E
Sbjct  242   SKQVIPIGLLPPE--KPEKREITDGTWNTIFEWLDNQEHESVVFVGFGSECKLTKDEVYE  299

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             IA GLELS+LPF W  RK   +A  ++  LP  F  +T  +G++   WAPQL++LSH S+
Sbjct  300   IAYGLELSKLPFLWALRKPNWAA-TDLDVLPPEFNNKTSEKGIVSIGWAPQLELLSHPSI  358

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GG L HSGW SV+E L++   LI+ PF+ DQG+  RLLVEK +   + R E DGSFSR  
Sbjct  359   GGSLFHSGWGSVIETLQYGHCLIVLPFIADQGLNARLLVEKGLAVEVDRKE-DGSFSRHD  417

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +A+SLR+ MV E G     + K        ++   +Y+N+ + YL
Sbjct  418   IAKSLRLAMVSEEGSQLKTRAKDAATIFQNRKLHQDYINRFVKYL  462



>ref|XP_010661830.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Vitis 
vinifera]
Length=473

 Score =   359 bits (922),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 200/466 (43%), Positives = 284/466 (61%), Gaps = 9/466 (2%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             +  +H+VMLPW AFGH+IP+  LA  +A+ G ++  VSTPRNIQRLPK  P+L   I  +
Sbjct  2     TGKMHVVMLPWSAFGHMIPFFHLAIAIAKAGIRVSLVSTPRNIQRLPKPPPNLSSLIKFV  61

Query  1486  GLPLPQVEN---LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFAS  1316
              LP P +EN   LPE AE+T+D+P++K++YLK A D LQ     ++   SPDW+I DF S
Sbjct  62    ELPFPVMENGSILPEGAEATVDMPFEKIQYLKAALDLLQHPFKQYVADTSPDWIIIDFFS  121

Query  1315  FRLVPIMEKLSIPSVYFSIFTASINAIFFPQ-SAVIDGVDS-PVEPKHTTSKPKWVPFET  1142
               +  I  +  +P VYFS+F+AS  A   P  S V DG       P+  TS P+W+ F +
Sbjct  122   HWVSSIAREHGVPLVYFSVFSASTLAFLGPAYSLVGDGRRRLRPSPESMTSPPEWISFPS  181

Query  1141  TIMPRNFEMERVFNDAYIDGGN-VSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             ++  + +E + V++  + D  +  +D  R    +    AV VRSC E E E+L L   ++
Sbjct  182   SVAFKGYEAKAVYSGFFTDNASGTTDAARYVEIINSCQAVAVRSCVEYEGEYLNLLGNLM  241

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
             GKP IPVGLLP    +  E      +W E  +WL++Q+  SVV+V FGSE K  +++V E
Sbjct  242   GKPVIPVGLLPPEKPEGREIQINDGSWGENFKWLNEQKPKSVVFVGFGSECKLTKDQVHE  301

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             IA GLELS+LPF W  RK   + + +   LP GF +RT GRG++C  WAPQ++IL H S+
Sbjct  302   IAYGLELSELPFLWALRKPNWAIE-DADALPSGFSDRTSGRGMVCMGWAPQMEILEHPSI  360

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GG L HSGW SV+E L+F   L++ P + DQG+  RLLVEK +   + R E DG+FSR+ 
Sbjct  361   GGSLFHSGWGSVIETLQFAHCLVVLPIIIDQGLNARLLVEKGLAVEVERRE-DGTFSRED  419

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfe-keKQDNYVNKLLDYL  290
             + +SLR+ MV E G+      K   A   + K  QD+Y+   ++YL
Sbjct  420   ITKSLRLAMVSEEGEKLRIHAKGAAAIFGDPKLHQDHYIGGFVEYL  465



>ref|XP_006852904.1| hypothetical protein AMTR_s00033p00224400 [Amborella trichopoda]
 gb|ERN14371.1| hypothetical protein AMTR_s00033p00224400 [Amborella trichopoda]
Length=467

 Score =   359 bits (921),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 190/462 (41%), Positives = 288/462 (62%), Gaps = 8/462 (2%)
 Frame = -3

Query  1660  TLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGL  1481
              LH+ +L + AFGH+IP+LEL+K+LA++G+K+ F+STPRNI RLPK+ P+L   I+L+  
Sbjct  5     VLHVAVLSFSAFGHLIPFLELSKILAQKGHKVSFISTPRNIDRLPKIPPNLATLINLVKF  64

Query  1480  PLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVP  1301
              LP    LPE+AE+T+DLP +K+++L  A+D+L + +  F+   SPDW+IHD  +     
Sbjct  65    ELPPTHGLPENAEATMDLPIEKLQFLTAAYDKLHEPIENFVSEESPDWLIHDLFAPWAPC  124

Query  1300  IMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNF  1121
             +  K  IPS + S+FTAS    F P   ++ G    + P+     P+WVPF + +  R  
Sbjct  125   LAAKFGIPSCFCSVFTASTLVFFGPPDGLV-GAHQRLTPESYAKAPEWVPFPSIVALRMH  183

Query  1120  EMERVFN-DAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPV  944
             E  RV      ++   +S   R  +T++G   V VRSCYE E ++L+L  E+ GKP +P 
Sbjct  184   EAARVSQLGNKVEASGMSSHQRFAMTIEGCDFVAVRSCYEFEGKYLELLRELYGKPVLPF  243

Query  943   GLLPT--TAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             GL+P+         +      +  I  WLD++ KGS+V+V FG+ET+ + +EV E+A GL
Sbjct  244   GLVPSPPVEKRGAGEGGNGNEYSRIFSWLDEKAKGSIVFVGFGTETRLSMDEVHEMAFGL  303

Query  769   ELSQLPFFWVYRK-QRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             ELS LPF W+ +K Q G    ++  LP+GFE R   RGV+   WAPQ ++L+H ++GG L
Sbjct  304   ELSGLPFVWLLKKPQEGCEGMDL--LPQGFETRISNRGVVHVGWAPQAQLLAHPAIGGCL  361

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
              HSGW SV+EAL++   LI+ PF+ DQG+  +LLVEK +   I R++ DGSF++++VA+ 
Sbjct  362   FHSGWGSVIEALQWGHTLIVLPFVFDQGLNAKLLVEKGIALEIERNK-DGSFTKEAVAKG  420

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             LR  MVEE G+    K ++ +A   ++   D Y+N  + YL 
Sbjct  421   LRQAMVEEEGEPLRVKAREAEAIFADRGLHDRYMNDFIKYLQ  462



>gb|EPS70335.1| hypothetical protein M569_04423, partial [Genlisea aurea]
Length=461

 Score =   357 bits (915),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 188/435 (43%), Positives = 272/435 (63%), Gaps = 17/435 (4%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHIVM PW A GH+ P+  L+K LA RG++I F+STPRNIQRL ++   L   ID +  P
Sbjct  6     LHIVMFPWFAAGHLRPFFRLSKTLARRGHRISFISTPRNIQRLGEIPDDLSHLIDFVVFP  65

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP--DWVIHDFASFRLV  1304
             +P VE+L  D ES++D+P+ K + LKIA D L++ +  FLQ +SP  DW+++D+AS  L 
Sbjct  66    MPTVEHLAPDCESSMDVPHQKQQLLKIALDLLENPIRNFLQEMSPRPDWILYDYASHWLP  125

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSA-VIDGVDSPVEPKHTTSKPKWVPFETTI---  1136
              + +++ I   +FS+F A+  A   P S+ ++D   S V  +  T  P W+PF++ +   
Sbjct  126   RVAQEIGISKAFFSLFPAAFMAFLGPTSSGLLDQNCSRVTAEDYTVVPHWIPFKSNMAFR  185

Query  1135  ---MPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
                M +N E +    +AY  G   SD  R G+T++G+  + +RSC   EPEW +L   + 
Sbjct  186   LHEMTKNMEKDAAGENAYNSG--TSDSVRFGLTIQGSDIMILRSCTAFEPEWFELIHHLY  243

Query  964   G-KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP IP G+LP    ++  + D    W++I++WL+KQ+  S+VYVA G+E     EEV 
Sbjct  244   NQKPVIPTGVLPVELDEEVAEFDSDEDWIQIRDWLNKQKDDSLVYVALGTEAVLTHEEVQ  303

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             E+A GLE S LPF WV    RG+   ++  LP GF +R   RG + + WAPQ  ILS   
Sbjct  304   ELAFGLEQSGLPFLWVL--NRGN---QIETLPNGFAKRVEERGRVYSKWAPQATILSRPC  358

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VGGFLTH GW+SV E+L + + LI+ P + DQG+I RLLV+K +G  I R+ENDGSFSR 
Sbjct  359   VGGFLTHCGWNSVTESLCYGRVLILFPVMNDQGLIARLLVDKRVGVEIPRNENDGSFSRH  418

Query  427   SVAESLRVVMVEEHG  383
              VA++L++ MV + G
Sbjct  419   QVADALKMAMVSDRG  433



>ref|XP_010430764.1| PREDICTED: UDP-glycosyltransferase 91A1-like [Camelina sativa]
Length=440

 Score =   355 bits (912),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 277/462 (60%), Gaps = 37/462 (8%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             + + LH+ M PWLAFGH++P+LEL+ L+ E+G+                           
Sbjct  10    DETKLHVAMFPWLAFGHLVPHLELSMLMVEKGHT--------------------------  43

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
               LP    +NLPE AE+T D+P+D V YLKIAFD L+  +  FL++  PDW++ DFA + 
Sbjct  44    --LPFAGHKNLPEAAEATTDVPFDLVPYLKIAFDGLRAPLTEFLKSSKPDWLLQDFAPYW  101

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             L PI  +L I + +F  F      I  P        +    P+   + PKWVPFET +  
Sbjct  102   LPPIASRLGIKNAFFGAFNCGFFGILKPPGF----EEYRKSPEDFVTMPKWVPFETPVFF  157

Query  1129  RNFEMERVFNDAYIDG--GNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
             + FE +  FN A ++   GN+ DL R+   + G   + +RSC E E EWL+L +++  KP
Sbjct  158   QLFESKAFFNGAVVESTEGNIPDLDRIAGVLDGCDIIVIRSCNEYETEWLELLQDLHRKP  217

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVG+LP      +E      AWL  K+WLD ++  SVVYV+FG+E KP+Q E   IAL
Sbjct  218   VIPVGVLPPK---LDETFKDTDAWLSTKKWLDSRKTNSVVYVSFGTEAKPSQSEFNSIAL  274

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS LPFFWV R +RG  D E  +LPEGFEERT  RG++   W  QL+ L+HDS+G  
Sbjct  275   GLELSGLPFFWVLRTRRGPLDTEPLELPEGFEERTADRGMVWRGWVEQLRTLNHDSIGLV  334

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             L+HSGW++++EA++F K ++M  F+  QG   R+  EK++G+ I RDE  GSF+++ VA+
Sbjct  335   LSHSGWNTLIEAVRFAKPMVMIGFVYGQGFNARVAEEKKIGHMILRDETTGSFTKEDVAK  394

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +LR+VM  E GKV+ E VK MK    + + QD YV+  LDYL
Sbjct  395   ALRLVMDGEEGKVYRESVKDMKGVFGDMDTQDRYVDSFLDYL  436



>ref|XP_007134315.1| hypothetical protein PHAVU_010G036900g [Phaseolus vulgaris]
 gb|ESW06309.1| hypothetical protein PHAVU_010G036900g [Phaseolus vulgaris]
Length=437

 Score =   355 bits (911),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 195/434 (45%), Positives = 267/434 (62%), Gaps = 40/434 (9%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA +   LHIV+ PWLAFGHI+P+ ELAKL+A++G+KI F+STPRNI RLPK+  +L P 
Sbjct  1     MAEQREKLHIVVFPWLAFGHILPFFELAKLIAQKGHKISFISTPRNIHRLPKVPENLQPL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             +DLI LPLP+V+ LPE+AE+T+D+PY  + YLK+AFD L+  +  FL+   P W+I+DFA
Sbjct  61    VDLIELPLPRVDKLPENAEATVDIPYHIIPYLKLAFDGLEQPLTKFLERCKPHWIIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              + L PI  KL I  V F+IF+AS    F                K + S  K++P E  
Sbjct  121   PYWLPPISSKLGISCVSFNIFSASCMYYF----------SDIFTRKESESSRKYIPEE--  168

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
                         N+    G  VSD++R+  T  GA  +  RSC E+E E L+L E +  K
Sbjct  169   -----------HNENNESG--VSDVFRVLTTFNGAQFIASRSCMEIEGEPLKLCESIYRK  215

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
               IPVGLLP +      +D     W  I  WLDKQEKGSV+YVAFGSE   + E+  EI 
Sbjct  216   TVIPVGLLPPS--LQFSEDSNDENWNTILNWLDKQEKGSVIYVAFGSEVTLSDEDFTEIT  273

Query  778   LGLELSQLPFFWVYRKQRGSA----DAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
             +G+E+S  PFFWV +KQ  S+    D  V            G+G++ T+WAPQ++ILSH 
Sbjct  274   MGIEMSGFPFFWVLKKQNTSSVELQDVVVN---------NSGKGMVWTTWAPQVRILSHK  324

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             S+GGFLTH GWSSV+E+L+    L+M PF  DQ I    + EK +G  + R+++ G F+R
Sbjct  325   SIGGFLTHCGWSSVIESLQIGCPLVMLPFQSDQFINAGFMEEKRVGVKVQRNKHCGKFTR  384

Query  430   DSVAESLRVVMVEE  389
             +S+A +LR VM+E+
Sbjct  385   ESLAIALRSVMLEK  398



>ref|XP_004485550.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Cicer arietinum]
 gb|AGU14092.1| UDP-glycosyltransferase [Cicer arietinum]
Length=478

 Score =   357 bits (915),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 194/463 (42%), Positives = 289/463 (62%), Gaps = 10/463 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   LH+VMLPWLA GHI PY E+AK+LA++G+ +  +++P+NI  +PK    L P I L
Sbjct  14    EHKPLHVVMLPWLAMGHIYPYFEVAKILAQKGHTVTLINSPKNIDHIPKTPKTLQPFIKL  73

Query  1489  IGLPLPQVENLPEDAESTLDL-PYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
             + LPLPQ+ENLP+  EST+D+  ++  RYLK+A++ LQ  +   L+T  PDWV +DFAS 
Sbjct  74    VKLPLPQIENLPQGVESTMDITSHNMNRYLKLAYEGLQHDVTEILKTSKPDWVFYDFASG  133

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              L PI + L+I   +++I T + N  FF      D V S  + +     PK+VPFETTI 
Sbjct  134   WLAPIAKSLNISCAHYNI-TPAWNKCFFDPPK--DQVKSSFKLEDMCGPPKFVPFETTIH  190

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              + +E+ R F     + G ++  + L           +R+  ELE EWL    +    P 
Sbjct  191   LKPYEIIRAFTALKDESGGMAG-FDLNKAYSSCDLFLLRTSRELEGEWLDYISDRYEVPV  249

Query  952   IPVGLLP-TTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
             +PVGLLP +    D+E+++    W++IK+WLD +E  SVVY+ FGSE K +Q+++ E+A 
Sbjct  250   VPVGLLPPSMQIRDDEEEENDPDWVKIKDWLDTRESSSVVYIGFGSELKLSQQDLTELAY  309

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             G+ELS LPFFW  +  +        +LPEGFE+RT+ RG++  +WAPQLKIL+H ++GG 
Sbjct  310   GIELSGLPFFWALKNLKEGT----LELPEGFEDRTKERGIVWKTWAPQLKILAHGAIGGC  365

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             ++H G  SV+E L F   L+  P+L DQ + +R+LVEKE+   + R E DGSF+RDSVA 
Sbjct  366   MSHCGSGSVIEKLHFGHVLVTLPYLLDQCLFSRVLVEKEVAIEVPRSEQDGSFTRDSVAH  425

Query  415   SLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             +LR+ +V+E G  + +  K+M      K+  ++YV+ L+  LH
Sbjct  426   TLRLAIVDEEGSAYRDNAKEMGKVFRSKDLHNHYVDDLIAALH  468



>ref|XP_007051734.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
 gb|EOX95891.1| UDP-Glycosyltransferase superfamily protein, putative [Theobroma 
cacao]
Length=470

 Score =   356 bits (913),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 196/463 (42%), Positives = 283/463 (61%), Gaps = 12/463 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LH+VMLPW AFGH+IP+ +L+  LA+ G K+ F+STPRNIQRLPK+ P L   ID++ LP
Sbjct  5     LHVVMLPWSAFGHLIPFFQLSIALAKAGVKVSFISTPRNIQRLPKVPPTLATLIDIVALP  64

Query  1477  LPQVEN--LPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             LP ++N  LPE AE+T+D+P +K+ YLKIA+D LQ  +  F+    PDWV  D  S+ + 
Sbjct  65    LPVLDNQLLPEGAEATVDIPSEKIPYLKIAYDLLQHPVKQFISDQRPDWVFTDVISYWVA  124

Query  1303  PIMEKLSIPSVYFSIFTASINAIF----FPQSAVIDGVDSPVEPKHTTSKPKWVPFETTI  1136
                ++  IP + FS+  AS NA F    FP +A  +G      P+  T   +W  F++++
Sbjct  125   EAAQEKQIPVINFSVCPASTNAFFLQKDFPVAAAQEGTKP--SPESLTKPLEWGNFQSSV  182

Query  1135  MPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
               R+FE    +   Y  +   ++D  R+   +  ++A+ +R+C E E E+L   +E+ GK
Sbjct  183   SYRSFEATGTYKGLYTQNASGITDNERVIRVILASNAMAIRTCPEYESEYLNKCKEITGK  242

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
               IP+GLL      +E       +W E  EWLD Q+  SVV+V FGSE K ++E+V EIA
Sbjct  243   QVIPIGLL-LPEKPEEVKRITDKSWSENFEWLDGQKPKSVVFVGFGSECKLSKEQVHEIA  301

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
              GLELS LPF W  RK   + D +   LP GF + TRGRGV+C  WAPQL+IL H S+GG
Sbjct  302   HGLELSGLPFLWALRKPDWATD-DHDALPPGFSDGTRGRGVVCIGWAPQLEILGHPSIGG  360

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
              L H+GW S++E L+F   L++ P + DQ +  RLLVEK +   + R  NDGSF+R  +A
Sbjct  361   SLFHAGWGSIIETLQFGHCLVVLPLIIDQPLNARLLVEKGLAVEVERS-NDGSFTRADIA  419

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             ++LR+ MV E G+    + K++      +  Q NY N+ ++YL
Sbjct  420   KALRLAMVSEEGENLRVRAKEVAEVFGNRNLQHNYFNRFVEYL  462



>ref|XP_007148434.1| hypothetical protein PHAVU_006G208300g [Phaseolus vulgaris]
 gb|ESW20428.1| hypothetical protein PHAVU_006G208300g [Phaseolus vulgaris]
Length=478

 Score =   355 bits (911),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 198/462 (43%), Positives = 288/462 (62%), Gaps = 17/462 (4%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI MLPWLA GHI PY E+AK+LA++G+ + F+++P+NI R+PK    L P I L+ LP
Sbjct  21    LHIAMLPWLAMGHIYPYFEVAKILAQKGHHVTFINSPKNIDRIPKAPKTLRPFITLVRLP  80

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP V++LPE AEST+D+P  K  +LK A++ LQD +A  L+T  PDWV +DFA+  + PI
Sbjct  81    LPHVQHLPEGAESTMDIPSTKNCFLKKAYEGLQDPVAELLKTSKPDWVFYDFAAAWVTPI  140

Query  1297  MEKLSIPSVYFSIFTASINAIFF--PQSAVID-GVDSPVEPKHTTSKPKWVPFETTIMPR  1127
              + L+IP  +++I T + N +FF  P+  + D  +++   P      P W+PF TT+  R
Sbjct  141   AKSLNIPCAHYNI-TPAYNKVFFDPPKDKMKDYSIETICGP------PTWLPFPTTLRLR  193

Query  1126  NFEMERVFN-DAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
              +E  R    +   + G  +D + L           +R+  ELE EWL         P +
Sbjct  194   PYEFLRALQRNRDQETGEKAD-FDLNKAYSSCDLFLLRTSRELEGEWLDYLAGNYKVPVV  252

Query  949   PVGLL-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             PVGLL P+    D E++D+   W+ IKEWLD +E  SVVY+ FGSE K +QE++ E+A G
Sbjct  253   PVGLLPPSMQIRDAEEEDENPDWVTIKEWLDAKESSSVVYIGFGSELKLSQEDLTELANG  312

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             +ELS LPFFW  +  +      V +LPEGFEERT+ RGV+  SWAPQLKIL+H ++GG +
Sbjct  313   IELSGLPFFWALKNLKEG----VLELPEGFEERTKDRGVVWKSWAPQLKILAHGAIGGCM  368

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             +H G  SV+E L F   L+  P+L DQ + +R+L EK++   + R E DGSF+RDSVA++
Sbjct  369   SHCGSGSVIEKLHFGHALVTLPYLLDQALFSRVLEEKKVAIEVPRSEKDGSFTRDSVAKT  428

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             LR  +V+E G    +  K+M      +E  ++Y++ L+  LH
Sbjct  429   LRFAIVDEEGSSLRKNAKEMGKLFSSEELHNHYIDDLIAALH  470



>ref|XP_003593142.1| Glucosyltransferase [Medicago truncatula]
 gb|ACT34899.1| GT4 [Medicago truncatula]
 gb|AES63393.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=473

 Score =   355 bits (910),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 193/471 (41%), Positives = 288/471 (61%), Gaps = 12/471 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHIVMLPWLA GHI PY E+AK+LA +G+ + F+++P+NI ++PK    + P I L+ LP
Sbjct  14    LHIVMLPWLAMGHIYPYFEVAKILASKGHTVTFINSPKNIDQMPKTPKTIEPFIKLVRLP  73

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP +E LP  AE+T+D+P +  +YL++A+  LQD +   L+T  PDWV +D+ +  L PI
Sbjct  74    LPHIEQLPPGAENTMDIPINMNKYLELAYQGLQDDVTEILKTSKPDWVFYDYGTVWLAPI  133

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
              + L+I SV++SI T + N  FF +    D + +  E +      KW+PF+TTI  + +E
Sbjct  134   AKSLNIASVHYSI-TPAWNICFFDRPK--DQIKTNFEIQDICGPHKWLPFQTTIHLKPYE  190

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
             + R F     + GN+ D   L         + +R+  ELE EWL    E    P +PVGL
Sbjct  191   LIRAFTALRDESGNMPD-SGLNNAYSSCDLLLLRTSRELEGEWLDYISEQYNVPVVPVGL  249

Query  937   L-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELS  761
             + P+    D+E+++    W++IK WLD +E  SVVY+ FGSE K +QE++ E+A G+ELS
Sbjct  250   IPPSMQIRDDEEEENNPDWVKIKGWLDSRESSSVVYIGFGSELKLSQEDLTELAYGIELS  309

Query  760   QLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSG  581
              L FFW  +  +        +LPEGFEERT+ RG++  +WAPQLKIL+H ++GG ++H G
Sbjct  310   GLSFFWTLKNLKEG----TLELPEGFEERTKERGIVWKTWAPQLKILAHGAIGGCMSHCG  365

Query  580   WSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVV  401
               SV+E + F   L+  P+L DQ + +R LVEKE+   + R E DGSF+RDSVA SLR+ 
Sbjct  366   SGSVIEKVHFGHVLVTLPYLLDQCLFSRALVEKEVAVEVPRSEEDGSFTRDSVAHSLRLA  425

Query  400   MVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPSGSHK  248
             +V+E G  F    K++      K+  + Y++   D++ A      PS S+ 
Sbjct  426   IVDEEGSSFRNNAKELGKVFSSKDIHNQYID---DFIAALYKYRVPSNSNN  473



>ref|XP_009151459.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Brassica rapa]
Length=453

 Score =   351 bits (900),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 272/465 (58%), Gaps = 13/465 (3%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M      +H+ M PWLA GH++P+  ++KLLA++G+K+ F+STPRNI+RLP L   L   
Sbjct  1     MERGEGAMHVAMFPWLAMGHLLPFFRMSKLLAQKGHKVSFISTPRNIERLPNLPSSLSSF  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  +  PL         +E ++D+ Y K   LK AFD LQ  +  FLQ  SPDWVI+D+A
Sbjct  61    ITFVSFPLVPFPGSTPGSECSMDVTYSKQPSLKSAFDLLQKPLTEFLQEESPDWVIYDYA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             +  L P+  +L I   +FSIF A+      P S +++GV S   P+  T  P W+PF++ 
Sbjct  121   AHWLPPVAAELGISKAFFSIFNAASLCFLGPPSLLLEGVRS--TPEDFTVVPPWIPFQSN  178

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R  E+  V +    D   VSD  R G ++  + AVFV +    EPEWL L +++  K
Sbjct  179   MAYRYHEVTLVGDKRGKDTNGVSDSARFGYSISESDAVFVHTSTGFEPEWLGLLKDLYRK  238

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P  P G LPT     E++ +    W+ IK+WLDKQ   SVVYVA G+E      E  E+A
Sbjct  239   PVFPTGFLPTDT---EDEVEGDKTWVGIKKWLDKQSINSVVYVALGTEASLPPAEFTELA  295

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
              GLE S++PFFWV R +        +++ +G+ ER  GRG++   W PQ+KILSH SVGG
Sbjct  296   HGLEKSEVPFFWVIRNE--------SQILDGYVERVAGRGMVNVGWVPQVKILSHSSVGG  347

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH GW+S+VE L F +  I+ P L +QG+ TRLL  K +G  I RDE  GSF  DSVA
Sbjct  348   FLTHCGWNSLVEGLGFGRVPILFPVLNEQGLNTRLLEGKGLGVEIPRDEEKGSFDSDSVA  407

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
              S+R+ MV++ G+    K K M       ++   YV++L+ Y+ +
Sbjct  408   HSVRLAMVDDAGESIRAKTKLMMGLFGNMDENSRYVDELIGYMRS  452



>gb|KHN33503.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=471

 Score =   352 bits (902),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 203/471 (43%), Positives = 284/471 (60%), Gaps = 13/471 (3%)
 Frame = -3

Query  1684  SAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLV  1505
             S   S +  LH+VM PWLA GH+ P  E++K+LA++G+ +  VSTP+ I RLPKL   L 
Sbjct  4     SVSVSSNKPLHVVMFPWLAMGHVYPCFEVSKILAQKGHYVTLVSTPKIIDRLPKLPQTLS  63

Query  1504  PNIDLIGLPL-PQVE--NLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWV  1334
             P + L  L L P ++  +LP+DA+ST+D+P +K+ YLK+A+D LQ+ +   L+T +PDWV
Sbjct  64    PFVKLSKLLLSPHIDKNHLPQDADSTMDIPSNKLYYLKLAYDALQEPVFEVLKTSNPDWV  123

Query  1333  IHDFASFRLVPIMEKLSIPSVYFSIFTASINAIF-FPQSAVIDGVDSP-VEPKHTTSKPK  1160
              +DFA+  +  + + L I S YFS   A     F  P+  + D   +    P+     PK
Sbjct  124   FYDFAASWIPQLAKTLKIHSAYFSPCPAWTICFFDTPKQQLGDAAAANRSNPEDYYGPPK  183

Query  1159  WVPFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQL  980
             WVPF T I  R +E+ ++  D  ++    S ++ L     G     +RS  +LE EWL  
Sbjct  184   WVPFPTKIGLRPYEVRKLLEDIKVNETGASPVFDLNTANSGCDMFVIRSSRDLEQEWLDY  243

Query  979   AEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQ  800
               E   KP +PVGLLP       +++D    WL+IK WLD Q+  SVVY+AFGSE K +Q
Sbjct  244   LAEFYHKPVVPVGLLP--PLRGSDEEDNSPDWLQIKAWLDTQKGSSVVYIAFGSEVKLSQ  301

Query  799   EEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKIL  620
             E + E+ALG+ELS L FFWV RK        V  L EGFE+RT+ RGV+  +WAPQ KIL
Sbjct  302   ENLNELALGIELSGLSFFWVLRK------GSVEFLREGFEDRTKDRGVVWKTWAPQPKIL  355

Query  619   SHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGS  440
             +H SVGG LTH G  S++E L F   L+M PFL DQ + +R++ EK++G  I R+E DGS
Sbjct  356   AHASVGGCLTHCGSGSMIENLIFGHVLVMLPFLLDQALYSRVMEEKKVGIEIPRNEQDGS  415

Query  439   FSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             F+R SVA++LR+ MVEE G  +    K++  K   KE  D Y+   +  LH
Sbjct  416   FTRSSVAKALRLAMVEEEGSAYRNNAKELGKKFSNKELDDQYIEDFIASLH  466



>ref|XP_008811282.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=466

 Score =   351 bits (901),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 209/463 (45%), Positives = 277/463 (60%), Gaps = 20/463 (4%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHIV+ PWLAFGH+IP+LEL+K LA+RG+ I+F+STPRNI RLP +   L+P ID I +P
Sbjct  6     LHIVLFPWLAFGHLIPFLELSKSLAKRGHHIFFISTPRNIHRLPNIPLPLLPLIDFISIP  65

Query  1477  LPQVENLPE-DAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSP--DWVIHDFASFRL  1307
             LP  ++LP+ DAE+T DLP  KV +LK AFD+L   +A FL+  SP  DW+I DFA + L
Sbjct  66    LPPSDDLPDHDAEATADLPPHKVPHLKKAFDKLDQPVAEFLEQASPKPDWIICDFAPYWL  125

Query  1306  VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPR  1127
              PI  KL+ P  YF+ F +  +A     SA          P+  T+ P+W+PF T +  R
Sbjct  126   PPIASKLNTPCAYFNTFPSFSSAF----SAAWQR-----SPEQLTATPEWIPFPTKVAYR  176

Query  1126  NFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
               E        +     VSD YR    V+    + VR C E + EWL +  E+  KP +P
Sbjct  177   LHEARSFAKLVHDSASGVSDEYRFNSVVRCCDLMAVRGCMEFDGEWLNVLPELYEKPIVP  236

Query  946   VGLLPTTAYdd----eedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             +GLLP +A D       +         + +WL+KQ   SVVYV+ GSE   + E V E+A
Sbjct  237   LGLLPPSADDRPDGENTNGMANTGHGNVVKWLNKQTPESVVYVSLGSEATLSNELVHELA  296

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
              GLELS LPF W  R++R     EV  LP+GFE+R  GRGVI   W PQL+IL+  SVGG
Sbjct  297   FGLELSGLPFLWALRRKR----EEVELLPKGFEDRIAGRGVIAMGWMPQLEILACSSVGG  352

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             F TH GWSSVVE L F   LI+ P   DQGI  R++VEK++G  + RDE  GSF+R++VA
Sbjct  353   FFTHCGWSSVVEGLAFGHPLILLPVFGDQGINARVMVEKKLGLEVERDEETGSFTREAVA  412

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
               +R VMVE+ GK   E  K+M+      +    YV+  + YL
Sbjct  413   NVVRSVMVEDEGKKLRETAKRMREVFSNNDIHGRYVDAFVHYL  455



>ref|XP_003547595.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Glycine 
max]
Length=479

 Score =   352 bits (902),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 203/471 (43%), Positives = 284/471 (60%), Gaps = 13/471 (3%)
 Frame = -3

Query  1684  SAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLV  1505
             S   S +  LH+VM PWLA GH+ P  E++K+LA++G+ +  VSTP+ I RLPKL   L 
Sbjct  12    SVSVSSNKPLHVVMFPWLAMGHVYPCFEVSKILAQKGHYVTLVSTPKIIDRLPKLPQTLS  71

Query  1504  PNIDLIGLPL-PQVE--NLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWV  1334
             P + L  L L P ++  +LP+DA+ST+D+P +K+ YLK+A+D LQ+ +   L+T +PDWV
Sbjct  72    PFVKLTKLLLSPHIDKNHLPQDADSTMDIPSNKLYYLKLAYDALQEPVFEVLKTSNPDWV  131

Query  1333  IHDFASFRLVPIMEKLSIPSVYFSIFTASINAIF-FPQSAVIDGVDSP-VEPKHTTSKPK  1160
              +DFA+  +  + + L I S YFS   A     F  P+  + D   +    P+     PK
Sbjct  132   FYDFAASWIPQLAKTLKIHSAYFSPCPAWTICFFDTPKQQLGDAAAANRSNPEDYYGPPK  191

Query  1159  WVPFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQL  980
             WVPF T I  R +E+ ++  D  ++    S ++ L     G     +RS  +LE EWL  
Sbjct  192   WVPFPTKIGLRPYEVRKLLEDIKVNETGASPVFDLNTANSGCDMFVIRSSRDLEQEWLDY  251

Query  979   AEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQ  800
               E   KP +PVGLLP       +++D    WL+IK WLD Q+  SVVY+AFGSE K +Q
Sbjct  252   LAEFYHKPVVPVGLLP--PLRGSDEEDNSPDWLQIKAWLDTQKGSSVVYIAFGSEVKLSQ  309

Query  799   EEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKIL  620
             E + E+ALG+ELS L FFWV RK        V  L EGFE+RT+ RGV+  +WAPQ KIL
Sbjct  310   ENLNELALGIELSGLSFFWVLRK------GSVEFLREGFEDRTKDRGVVWKTWAPQPKIL  363

Query  619   SHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGS  440
             +H SVGG LTH G  S++E L F   L+M PFL DQ + +R++ EK++G  I R+E DGS
Sbjct  364   AHASVGGCLTHCGSGSMIENLIFGHVLVMLPFLLDQALYSRVMEEKKVGIEIPRNEQDGS  423

Query  439   FSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             F+R SVA++LR+ MVEE G  +    K++  K   KE  D Y+   +  LH
Sbjct  424   FTRSSVAKALRLAMVEEEGSAYRNNAKELGKKFSNKELDDQYIEDFIASLH  474



>ref|XP_002878624.1| At2g22590/T9I22.3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54883.1| At2g22590/T9I22.3 [Arabidopsis lyrata subsp. lyrata]
Length=450

 Score =   350 bits (899),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 213/487 (44%), Positives = 297/487 (61%), Gaps = 59/487 (12%)
 Frame = -3

Query  1690  QFSAMASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIW--------------FVS  1553
              F     + + LH+VM PWLAFGH++PYLEL+KL+A++G++                 +S
Sbjct  3     NFKYNNGDETKLHVVMSPWLAFGHMVPYLELSKLIAQKGHRALNFRKDLVASKSFGPALS  62

Query  1552  TPRNIQRL-PKLHPHLVPNIDLIGLPLPQVEN-LPEDAESTLDLPYDKVRYLKIAFDELQ  1379
             TPRNI RL P+L  +L   I+ + LPLP  +N LPED E+T D+P++ + YLKIAF+ L+
Sbjct  63    TPRNIDRLLPRLPENLSSIINFVKLPLPVGDNKLPEDGEATTDVPFELIPYLKIAFNGLK  122

Query  1378  DSMAAFLQTLSPDWVIHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVD  1199
               +  FL++  PDWV+ DFA+F L PI            + TA        +S  ++  D
Sbjct  123   VPVTEFLESSKPDWVLQDFAAFWLPPIS----------PLSTAR-------RSGFLNRRD  165

Query  1198  SPVEPKHTTSKPKWVPFETTIMPRNFEMERVFND--AYIDGGNVSDLYRLGVTVKGASAV  1025
             S   P      PKWVPFET +  + FE   +F    A    GN+SD++R G         
Sbjct  166   SKSTP------PKWVPFETPVAFKLFECRYIFRGFMAETTEGNISDIHRAG---------  210

Query  1024  FVRSCYELEPEWLQLAEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKG  845
                     E EWL L +++  KP IPVG+LP      EE  +    WL +K+WLD ++  
Sbjct  211   ------GYEAEWLGLMQDLHRKPVIPVGVLPPKP---EEKFEDTDTWLTVKKWLDLRKSK  261

Query  844   SVVYVAFGSETKPNQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRG  665
             SVVYVAFGSE KP+Q E+ EIALGLELS LPFFWV + +RG  D E  +L EGFEERT  
Sbjct  262   SVVYVAFGSEAKPSQTELNEIALGLELSGLPFFWVLKNRRGPWDTEPVELLEGFEERTAD  321

Query  664   RGVICTSWAPQLKILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVE  485
             RG++   W  QL+ LSHDS+G  LTH GW +++EA++F K + M  F+ DQG+  R++ E
Sbjct  322   RGMVWRGWVEQLRTLSHDSIGLVLTHPGWGTIIEAVRFAKPMAMLVFVYDQGLNARVIEE  381

Query  484   KEMGYAIARDENDGSFSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNK  305
             K++GY I RDE +G F+++SVA+SLR+VM E+ G+V+ E VK+MK    + ++QD+YV+ 
Sbjct  382   KKIGYMIPRDETEGFFTKESVAKSLRLVMEEDEGEVYRENVKEMKGVFGDMDRQDHYVDS  441

Query  304   LLDYLHA  284
              LDYL A
Sbjct  442   FLDYLVA  448



>ref|XP_011092703.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Sesamum 
indicum]
Length=470

 Score =   351 bits (900),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 183/461 (40%), Positives = 288/461 (62%), Gaps = 5/461 (1%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E    HI+M PWLAFGH+IP+LEL+K LA +G  + +VSTPRN+QRLP +  +L   + L
Sbjct  2     EGGKYHIMMFPWLAFGHMIPFLELSKRLAAKGIFVSYVSTPRNLQRLPPIALNLEGKVKL  61

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             + +P+PQV+ LPE+ E+T+D+  +++ YLK A+D L +     LQT+ PD ++ DFA + 
Sbjct  62    VEIPMPQVDGLPENCEATVDIQLEQIPYLKKAYDRLAEPFERLLQTVRPDLILIDFAPYW  121

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             ++ I  K  I + +FS++TA+  A   P + +  G   P  P+H T  P W+PF + I  
Sbjct  122   ILEIAAKFGIRTAFFSVYTAATLAYLGPPAELKSGKRRPT-PEHFTRPPDWIPFPSLIAH  180

Query  1129  R-NFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
             R ++    + N  + D   +S   R    ++  S V VRS   +E E++ L +E+  +P 
Sbjct  181   RPDYAPRMMRNTHFPDASGMSSGQRAAKILEECSFVVVRSSEAVEGEYIGLIQELYKRPV  240

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             +P+G+L     +++ +    ++W    +WL+ Q+  SV++V FGSE K   E++ E+A  
Sbjct  241   LPIGVLAPVPEENKNNTAINSSWSHTHQWLEGQKPKSVLFVGFGSEYKMPVEQIHELAYS  300

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LELS+LPF W+ RK +G   +++  LP GF  RT  +GV+   WAPQL+IL+H ++GG L
Sbjct  301   LELSRLPFLWILRKPQGVDSSDL--LPPGFANRTLSQGVVLLGWAPQLEILAHPAIGGCL  358

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
              HSGW +++E+L F   L++ P + DQG+  +LLVEKE+GY + R+E DGSFSRD VAES
Sbjct  359   FHSGWGTIIESLGFGHPLVLLPMIADQGLNAKLLVEKEVGYEVPRNE-DGSFSRDVVAES  417

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             +R V++   G+    +   M++     E QDNY+NK +++L
Sbjct  418   IRRVVIAPEGEQLRLRAAHMRSVFDNHESQDNYINKFIEHL  458



>ref|XP_007134316.1| hypothetical protein PHAVU_010G037000g [Phaseolus vulgaris]
 gb|ESW06310.1| hypothetical protein PHAVU_010G037000g [Phaseolus vulgaris]
Length=438

 Score =   349 bits (895),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 200/477 (42%), Positives = 282/477 (59%), Gaps = 46/477 (10%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M  +   LHI++ PWLAFGHI+P+ ELAKL+A++G+KI F+STPRNI RLPK+  +L P 
Sbjct  1     MGEQREKLHIMVFPWLAFGHIVPFFELAKLIAQKGHKISFISTPRNIHRLPKVPENLQPL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             +DLI LPLP+V+ LPE+AE+T+D+P+  + YLK+AFD L+  +  FL+   P W+I+DFA
Sbjct  61    VDLIELPLPRVDKLPENAEATVDIPHHIIPYLKLAFDGLEQPLTKFLERSKPHWIIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              + L PI  KL I  V F IF+A         S +    D     +  + + K +P E  
Sbjct  121   PYWLPPISSKLGISCVSFCIFSA---------SGMYSFSDFFTRKESESPRSKGIPEE--  169

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
                         N+   D   VSD++R   T  GA  +  RSC E+E E L+L E +  K
Sbjct  170   -----------HNEN--DESGVSDVFRFLTTFNGAQVIASRSCMEIEGEPLKLCESIYRK  216

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
               IPVGLLP +      +D     W  I  WLDKQEKGSV+YVAFG+E   + E+  EI 
Sbjct  217   TVIPVGLLPPS--LQFSEDSNDENWNTILNWLDKQEKGSVIYVAFGTEVTLSDEDFTEIT  274

Query  778   LGLELSQLPFFWVYRKQRGS----ADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
             +G+E+S  PFFWV +KQ  S     D  V            G+G++ T+WAPQ++ILSH 
Sbjct  275   MGIEMSGFPFFWVLKKQNTSRVELQDVVVN---------NSGKGMVWTTWAPQVRILSHK  325

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             S+GGFLTH GWSSV+E+L+    L+M PF  DQ I    + EK +G  + R+E+ G F+R
Sbjct  326   SIGGFLTHCGWSSVIESLQIGCPLVMLPFQSDQFINAGFMEEKRVGVKVQRNEHCGKFTR  385

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPS  260
             +S+A +LR VM+EE    +  + ++M     +KE    Y++  +DY+     IH P+
Sbjct  386   ESLAIALRSVMLEE---TYRSEAQEMSKIFGDKELHQKYIDHFVDYME----IHMPA  435



>emb|CDY54711.1| BnaA09g52430D [Brassica napus]
Length=443

 Score =   349 bits (895),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 201/467 (43%), Positives = 274/467 (59%), Gaps = 60/467 (13%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA  +  LH+ + PWLA GH+IPYL+L+KL+A +G+ + F+STPRNI RLPK      P+
Sbjct  28    MAEPNHKLHVAVFPWLALGHMIPYLQLSKLIATKGHTVSFISTPRNIARLPK-----TPS  82

Query  1498  IDLIGLPLPQV--ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHD  1325
             I+ + LPLP     NLPE+AEST D+P   + YLK AFD L +  + FLQ   PDW+++D
Sbjct  83    INFVSLPLPHAVDNNLPENAESTTDVPETHIAYLKKAFDGLSEPFSQFLQASKPDWIVYD  142

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPF  1148
                + + PI EKL +    F  F A SI  I  P S +I+G D    P+ T         
Sbjct  143   ILHYWVPPIAEKLGVRRALFCTFNAASIIVIDGPSSIMINGRD----PRKT---------  189

Query  1147  ETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
                                     ++D YR G+   G+  + +R+C ELEPEW+QL  E+
Sbjct  190   ------------------------LNDSYRTGLASAGSEVIAIRTCTELEPEWIQLLGEI  225

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
              GKP IP+GLLP  A DD+ D        +I+EWLD+Q   SVVYVA G+E   +++E+ 
Sbjct  226   QGKPVIPIGLLPAKATDDDVD-------DDIREWLDRQRAKSVVYVALGTEVTVSEKEIQ  278

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
              +A GLELS LPFFW  RK           LP+GFEER +GRGV+   WAPQ +ILSH S
Sbjct  279   GLAHGLELSGLPFFWTIRKAS-------VFLPDGFEERVKGRGVVRAEWAPQGRILSHGS  331

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VGGF+TH GW SVVE L F   LIM P   DQ ++ R+L    +G  I R+E DGSF+  
Sbjct  332   VGGFVTHCGWGSVVEGLSFGVPLIMFPCNLDQPLVARMLAGMNIGREIPRNELDGSFTSV  391

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkakl-fekeKQDNYVNKLLDYL  290
             SV E++R+V+VEE GK++ +  + M+  +   +  QD YV+  + +L
Sbjct  392   SVVETIRLVVVEEEGKIYRDNAESMQKNVFGNRRLQDQYVDSFIKFL  438



>ref|XP_004161742.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Cucumis sativus]
 gb|KGN60273.1| hypothetical protein Csa_3G892740 [Cucumis sativus]
Length=469

 Score =   349 bits (896),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 195/465 (42%), Positives = 290/465 (62%), Gaps = 11/465 (2%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M++ S  LH+ + PWLAFGH+IP+  LA  LA++G K+ F+STPRN++R+ K+ PHL   
Sbjct  1     MSNSSDVLHVAVFPWLAFGHLIPFARLAICLAQKGFKVSFISTPRNLRRILKISPHLSSV  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             + L+G+ LP V+ LP  AE++ D+PY+K + LK AFD L+  +A  L+ L+PDW+I+D+A
Sbjct  61    VSLVGVSLPPVDGLPVAAEASSDVPYNKQQLLKKAFDSLEPQLADLLRDLNPDWIIYDYA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             S  + P+  +L I SV+FS+FTA   A   P S + +G  S    +   + P+W+P  + 
Sbjct  121   SHWISPLAAELGISSVFFSLFTAGFLAFLGPPSELSNGGGSRSTVEDFMNDPEWMPHGSN  180

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             +  R  E++   + A  +    +D  R GV+++ + AV VRS  ELEPE   L  ++  K
Sbjct  181   LRFRYHELKTSLDGAIGNESGTTDSVRFGVSIEESVAVAVRSSPELEPESFDLLTKLYQK  240

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P IP+G LP    D EE  +      +I+EWL KQ+  SV+YV+FG+E    QE+V E+A
Sbjct  241   PVIPIGFLPPLMEDVEELSE------DIEEWLKKQKANSVLYVSFGTEAFLRQEDVTELA  294

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
              GLE S++PF W+ R    S   E   LP GF+ER  GRG++   W  Q+K+LSH+SVGG
Sbjct  295   YGLEQSEIPFLWILRT---SHRNESEMLPAGFKERVSGRGLVHEGWISQVKVLSHNSVGG  351

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
              LTH GW+SV+E L F + +IM P + DQG+  R++ +K +G  I R+E DGSF+RDSV+
Sbjct  352   CLTHCGWNSVIEGLGFGRVVIMCPVVNDQGLNARIMEKKMVGIEIERNERDGSFTRDSVS  411

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDN--YVNKLLDYL  290
             ES+R  M E  G     + + M+ K        N  +++KL+D+L
Sbjct  412   ESVRSAMAEGSGGGKLLRERAMEMKGLFGNGDKNERHLDKLVDFL  456



>ref|XP_004489092.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Cicer arietinum]
Length=456

 Score =   348 bits (894),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 202/475 (43%), Positives = 294/475 (62%), Gaps = 30/475 (6%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M  + + LHI + P+LAFGHI P   L+KLLA++G++I F+STPRNI+RLPKL  +L  +
Sbjct  1     MEDQPTKLHIAVFPYLAFGHITPAFHLSKLLAQKGHRISFISTPRNIKRLPKLPTNLQTS  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             +++I L LP V+NLP+ AE+T+D+P   V YLK A D L++ +  FL+T +PD +I+DF 
Sbjct  61    LEIIELKLPHVDNLPDHAEATMDIPTHIVPYLKKALDGLKEPLTKFLETSTPDCIIYDFG  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWV---PF  1148
              + L PI+ KL I  +Y SI++    + FF    V        E     SK K V   PF
Sbjct  121   PYWLPPILSKLGIFHIYVSIYSG-FGSYFFANLFVT----KSGERHFDESKTKAVALKPF  175

Query  1147  ETTIMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             E          E+   D +++     VSD +R   T+ GA  + VRSC E+E E L L E
Sbjct  176   E----------EKYLGDKHLEKNESGVSDAFRFQQTLFGADLLLVRSCMEIEGESLTLLE  225

Query  973   EVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
              +  KP IP+GLLP++    E+  +    W +I++WLD  EK SV+YVAFGSE   + E+
Sbjct  226   NLYKKPVIPIGLLPSSLDFSEDKSNDDDNWCKIRKWLDTHEKNSVIYVAFGSEAFISDED  285

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
               EIALGLELS  PF +V + +    +       + F+ R    G++ T+W PQL+IL+H
Sbjct  286   FTEIALGLELSGFPFLFVIKNKNSDDNRH-----DWFKNRL-NNGLVWTNWVPQLRILAH  339

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
             +SVGGFLTH GWSSV+E+++    LIM P   +QG+I RL+ EK +G  +AR+++DG F+
Sbjct  340   ESVGGFLTHCGWSSVIESVQVGCPLIMLPLANEQGLIARLMEEKMVGVKVARNDHDGKFN  399

Query  433   RDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLD----YLHAA  281
             RDSVA++LR VM +E GKV+  KV++M     + E QD Y++  +D    ++HA+
Sbjct  400   RDSVAKALRSVMDKEEGKVYRSKVEEMSKIFGDMELQDKYIDDFVDSVKFHMHAS  454



>ref|NP_001240857.1| soyasaponin III rhamnosyltransferase [Glycine max]
 sp|D4Q9Z5.1|SGT3_SOYBN RecName: Full=Soyasaponin III rhamnosyltransferase; AltName: 
Full=Soyasaponin glycosyltransferase 3; AltName: Full=UDP-rhamnose:soyasaponin 
III-rhamnosyltransferase [Glycine max]
 dbj|BAI99585.1| UDP-rhamnose:soyasaponin III-rhamnosyltransferase [Glycine max]
 gb|KHN26727.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=472

 Score =   349 bits (896),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 188/465 (40%), Positives = 282/465 (61%), Gaps = 13/465 (3%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             S    LH+ MLPWLA GHI PY E+AK+LA++G+ + F+++P+NI R+PK   HL P I 
Sbjct  10    SNDKPLHVAMLPWLAMGHIYPYFEVAKILAQKGHFVTFINSPKNIDRMPKTPKHLEPFIK  69

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
             L+ LPLP++E+LPE AEST+D+P  K  +LK A++ LQ +++  L+T +PDWV++DFA+ 
Sbjct  70    LVKLPLPKIEHLPEGAESTMDIPSKKNCFLKKAYEGLQYAVSKLLKTSNPDWVLYDFAAA  129

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFF--PQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              ++PI +  +IP  +++I T + N +FF  P+  + D   + +        P W+PF TT
Sbjct  130   WVIPIAKSYNIPCAHYNI-TPAFNKVFFDPPKDKMKDYSLASI-----CGPPTWLPFTTT  183

Query  1138  IMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
             I  R +E  R +     +       + L           +R+  ELE +WL         
Sbjct  184   IHIRPYEFLRAYEGTKDEETGERASFDLNKAYSSCDLFLLRTSRELEGDWLDYLAGNYKV  243

Query  958   PTIPVGLL-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             P +PVGLL P+    D E++D    W+ IK+WLD QE  SVVY+ FGSE K +QE++ E+
Sbjct  244   PVVPVGLLPPSMQIRDVEEEDNNPDWVRIKDWLDTQESSSVVYIGFGSELKLSQEDLTEL  303

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             A G+ELS LPFFW  +  +      V +LPEGFEERT+ RG++  +WAPQLKIL+H ++G
Sbjct  304   AHGIELSNLPFFWALKNLKEG----VLELPEGFEERTKERGIVWKTWAPQLKILAHGAIG  359

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSV  422
             G ++H G  SV+E + F   L+  P+L DQ + +R+L EK++   + R E DGSF+R  V
Sbjct  360   GCMSHCGSGSVIEKVHFGHVLVTLPYLLDQCLFSRVLEEKQVAVEVPRSEKDGSFTRVDV  419

Query  421   AESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             A++LR  +V+E G    E  K+M      +E  + Y+   +D L 
Sbjct  420   AKTLRFAIVDEEGSALRENAKEMGKVFSSEELHNKYIQDFIDALQ  464



>gb|KCW66654.1| hypothetical protein EUGRSUZ_F00432 [Eucalyptus grandis]
Length=446

 Score =   348 bits (893),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 182/415 (44%), Positives = 258/415 (62%), Gaps = 7/415 (2%)
 Frame = -3

Query  1627  FGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLPLPQVENLPED  1448
              GH+IP+  L+K LA+RG+KI F+STPRN+QRLPK+  +L P I+LI LP P + NL   
Sbjct  1     MGHLIPFFHLSKHLAQRGHKISFISTPRNLQRLPKIPQNLSPLINLIPLPFPHIPNLTPH  60

Query  1447  AESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPIMEKLSIPSVY  1268
             AES++D  + K + LKIA D+LQ ++  FL++   DW+I+DFAS  L     +L I   +
Sbjct  61    AESSIDTSFSKQQLLKIAIDKLQPAITCFLESSQLDWIIYDFASHWLPSTAAELGIHRCF  120

Query  1267  FSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFEMERVFNDAYI  1088
               +F A++  +  P + +I G D     +     P+W+PFE+ I+  +   +   +  YI
Sbjct  121   CGLFNAAVLCLIGPPTVLIGGSDPRTTIEDFLRVPEWIPFESDIVFHHQVNQH--SSEYI  178

Query  1087  DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGLLPTTAYddee  908
                   D  R+GVT++ +  V VR+C E EPEW+ L  ++  KP +P+G LP     +++
Sbjct  179   --SETPDTVRMGVTIRDSEVVAVRTCVEFEPEWIDLLRDLYQKPLVPIGFLPPC--MEDD  234

Query  907   dddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQLPFFWVYRKQ  728
             +D     W+ IK WLD+Q   SVVYVA G+E   +QEEV E+ALGLE S+L FFWV R  
Sbjct  235   EDVNDMKWVSIKAWLDEQRLNSVVYVALGTEGVLSQEEVTELALGLEKSELSFFWVLRNP  294

Query  727   RGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTHSGWSSVVEALKFE  548
               S    +  LP GF +   GRG++CT WAPQ++ILSHDSVGGFLTH GW+S++E L F 
Sbjct  295   PESTQKAIDMLPNGFLQGVEGRGMVCTDWAPQVQILSHDSVGGFLTHCGWNSIIEGLAFG  354

Query  547   KKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLRVVMVEEHG  383
             + L++ P   DQG   RLL  K +G  + R E DG F+ D+VAE LR  MV++ G
Sbjct  355   RVLMLFPMTTDQGPNARLLQGKGLGIEVTRKE-DGMFTSDAVAELLRFAMVDDFG  408



>ref|XP_002458815.1| hypothetical protein SORBIDRAFT_03g040830 [Sorghum bicolor]
 gb|EES03935.1| hypothetical protein SORBIDRAFT_03g040830 [Sorghum bicolor]
Length=473

 Score =   349 bits (895),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 182/440 (41%), Positives = 270/440 (61%), Gaps = 17/440 (4%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +   ++H+V+LPWLAFGHI+P+ ELAK +A +G+++   STPRN +RL ++ P L   I 
Sbjct  4     ANGGSMHVVLLPWLAFGHILPFTELAKRIARQGHRVTLFSTPRNTRRLIRIPPELAGQIR  63

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFLQTLSP---DWVIH  1328
             ++ + LP+VE LPEDAE+++DLP D +R YL++A+D    D+++A LQ   P   DWV+ 
Sbjct  64    VVDIALPRVERLPEDAEASIDLPSDDLRPYLRVAYDAAFADNLSAILQEPGPERPDWVVI  123

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSKPKWVP  1151
             D+A++       +  +P  + S+F A+  + + P   ++  G  +  +P+  T  P +VP
Sbjct  124   DYAAYWAPAAAARHGVPCAFLSLFGAATLSFYGPPEGLMGRGKYARTKPEDLTVVPDYVP  183

Query  1150  FETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             F TT+  R FE   +FN    D   VS+ +R  V++  +  V +RS  E E EWLQ+ ++
Sbjct  184   FPTTVAHRVFEARELFNGLVPDDSGVSEGHRFAVSIGESQVVGIRSRPEFESEWLQVLDK  243

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP IPVGL P     D    +          WLD+Q +GSVVY AFGSE K    ++
Sbjct  244   LYQKPVIPVGLFPPPPTQDIAGHEATL------RWLDRQARGSVVYAAFGSEAKLTSAQL  297

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAE----VTKLPEGFEERTRGRGVICTSWAPQLKI  623
               IALGLE S LPF W +R      DAE       LPEGFEER  GRG++C  W PQ ++
Sbjct  298   QTIALGLEASGLPFIWAFRPP-ADGDAEPGQGTGGLPEGFEERVNGRGLVCRGWVPQPRL  356

Query  622   LSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDG  443
             L+H+SVGGFLTH+GW+S+ E L    ++++ P + DQG+  RLLVEK++G  + RDE+DG
Sbjct  357   LAHESVGGFLTHAGWNSISEGLSRGVRMVLLPLMFDQGLNARLLVEKKIGIEVERDEDDG  416

Query  442   SFSRDSVAESLRVVMVEEHG  383
             +F+   +A++LR  M E  G
Sbjct  417   TFAPKDIADALRTAMAENQG  436



>dbj|BAJ84800.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   349 bits (895),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 186/437 (43%), Positives = 263/437 (60%), Gaps = 12/437 (3%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNI  1496
             A++   +H+VMLPWLAFGH++P+ E AK +A +G+++  +S PRN +RL  + P L   I
Sbjct  3     ANDGGKMHVVMLPWLAFGHVLPFTEFAKRVARQGHRVTLLSAPRNTRRLIDIPPGLAGLI  62

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFLQT-LSPDWVIHD  1325
              ++ +PLP+V+ LPE AE+T+DLP D +R  L+ AFD   +  ++  LQ    PDWV+ D
Sbjct  63    RVVHVPLPRVDGLPEHAEATIDLPSDHLRPCLRRAFDAAFERELSRLLQEEAKPDWVLVD  122

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIF-FPQSAVIDGVDSPVEPKHTTSKPKWVPF  1148
             +AS+       +  +P  + S+F A+  + F  P++ +  G  +  EP H T  P++VPF
Sbjct  123   YASYWAPTAAARHGVPCAFLSLFGAAALSFFGTPETLLGIGRHAKTEPAHLTVVPEYVPF  182

Query  1147  ETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
              TT+  R +E   +F    + D   VS+ YR   T++G   V +RS  E EPEWL+L  E
Sbjct  183   PTTVAYRGYEARELFEPGMVPDDSGVSEGYRFAKTIEGCQLVGIRSSSEFEPEWLRLLGE  242

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP IPVGL P    DD    +          WLD Q   SVVY AFGSE K    ++
Sbjct  243   LYRKPVIPVGLFPPAPQDDVAGHEATL------RWLDGQAPSSVVYAAFGSEVKLTGAQL  296

Query  790   VEIALGLELSQLPFFWVYRKQRGS-ADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
               IALGLE S LPF W +R    +   A    LPEGFEER  GRGV+C  W PQ+K L+H
Sbjct  297   QRIALGLEASGLPFIWAFRAPTSTETGAASGGLPEGFEERLAGRGVVCRGWVPQVKFLAH  356

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
              SVGGFLTH+GW+S+ E L    +L++ P + +QG+  R +V+K +G  +ARDE DGSF+
Sbjct  357   ASVGGFLTHAGWNSIAEGLAHGVRLVLLPLVFEQGLNARNIVDKNIGVEVARDEQDGSFA  416

Query  433   RDSVAESLRVVMVEEHG  383
                +A +LR VMVE+ G
Sbjct  417   AGDIAAALRRVMVEDEG  433



>dbj|BAJ99561.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   348 bits (894),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 186/437 (43%), Positives = 263/437 (60%), Gaps = 12/437 (3%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNI  1496
             A++   +H+VMLPWLAFGH++P+ E AK +A +G+++  +S PRN +RL  + P L   I
Sbjct  3     ANDGGKMHVVMLPWLAFGHVLPFTEFAKRVARQGHRVTLLSAPRNTRRLIDIPPGLAGLI  62

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFLQT-LSPDWVIHD  1325
              ++ +PLP+V+ LPE AE+T+DLP D +R  L+ AFD   +  ++  LQ    PDWV+ D
Sbjct  63    RVVHVPLPRVDGLPEHAEATIDLPSDHLRPCLRRAFDAAFERELSRLLQEEAKPDWVLVD  122

Query  1324  FASFRLVPIMEKLSIPSVYFSIFTASINAIF-FPQSAVIDGVDSPVEPKHTTSKPKWVPF  1148
             +AS+       +  +P  + S+F A+  + F  P++ +  G  +  EP H T  P++VPF
Sbjct  123   YASYWAPTAAARHGVPCAFLSLFGAAALSFFGTPETLLGIGRHAKTEPAHLTVVPEYVPF  182

Query  1147  ETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
              TT+  R +E   +F    + D   VS+ YR   T++G   V +RS  E EPEWL+L  E
Sbjct  183   PTTVAYRGYEARELFEPGMVPDDSGVSEGYRFAKTIEGCQLVGIRSSSEFEPEWLRLLGE  242

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP IPVGL P    DD    +          WLD Q   SVVY AFGSE K    ++
Sbjct  243   LYRKPVIPVGLFPPAPQDDVAGHEATL------RWLDGQAPSSVVYAAFGSEVKLTGAQL  296

Query  790   VEIALGLELSQLPFFWVYRKQRGS-ADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
               IALGLE S LPF W +R    +   A    LPEGFEER  GRGV+C  W PQ+K L+H
Sbjct  297   QRIALGLEASGLPFIWAFRAPTSTETGAASGGLPEGFEERLAGRGVVCRGWVPQVKFLAH  356

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
              SVGGFLTH+GW+S+ E L    +L++ P + +QG+  R +V+K +G  +ARDE DGSF+
Sbjct  357   ASVGGFLTHAGWNSIAEGLAHGVRLVLLPLVFEQGLNARNIVDKNIGVEVARDEQDGSFA  416

Query  433   RDSVAESLRVVMVEEHG  383
                +A +LR VMVE+ G
Sbjct  417   AGDIAAALRRVMVEDEG  433



>ref|XP_010277530.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Nelumbo nucifera]
Length=481

 Score =   349 bits (895),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 189/463 (41%), Positives = 283/463 (61%), Gaps = 6/463 (1%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             ++ LH+V++PWLAFGH+IP+L+L+  LA+ G ++ F+STPRN+QRLPK+ P+L   +  +
Sbjct  3     NNNLHVVIVPWLAFGHLIPFLQLSMALAKAGIRVSFISTPRNVQRLPKVPPNLAALVRFV  62

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
              L LP VE LP  AE+T+D+  D++++LK A+D L+  +  F+   SPDW+I DF  F +
Sbjct  63    ELRLPTVEGLPLGAEATVDVSMDEIQHLKTAYDLLRHQVKQFVANESPDWIIQDFIPFWV  122

Query  1306  VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSP--VEPKHTTSKPKWVPFETTIM  1133
               I  +  +P + FS+++A+      P   + +   +     P+     P+WV F +++ 
Sbjct  123   AEIAREYGVPLITFSVYSAATLGFHGPLDYLTNDGHAKYWTSPESMMFPPEWVTFPSSVA  182

Query  1132  PRNFEMERVFNDAY-IDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKP  956
              R  E    F   +  +  +++D  R+ V V+   AV +RSC E EP++L L E++  +P
Sbjct  183   FRRHEANAAFAGFFGQNASSITDNERVVVAVEACQAVAIRSCTEYEPDYLNLVEKIWRRP  242

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              IPVGLLP  A    E  +++  W +I +WLD ++  +VV+VAFGSE K ++++V EIA 
Sbjct  243   VIPVGLLP-PAPSSTEAKEREGEWGKIFKWLDGEKPRTVVFVAFGSECKLSRDQVYEIAH  301

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS LPF W  RK   + D E   LP  F  RT GRGV+C  WAPQL+IL H S+GG 
Sbjct  302   GLELSNLPFLWALRKPTWAVD-EDDALPSEFRRRTEGRGVVCMGWAPQLEILGHPSIGGS  360

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             L HSGW S++E L+    L++ PF+ DQG+  R LVEK +   + R E DG F    VAE
Sbjct  361   LFHSGWGSIIETLQHGHALVVLPFVADQGLNARQLVEKGLAVEVERSEEDGRFEGSDVAE  420

Query  415   SLRVVMVEEHGkvfaekvkkmkak-lfekeKQDNYVNKLLDYL  290
             +L+ VMV+E G+    +   M+A     K  QD+Y+  L+ YL
Sbjct  421   ALKKVMVDEGGESLRARAASMRAVFGDVKLHQDHYIGGLVQYL  463



>ref|XP_004485549.1| PREDICTED: soyasaponin III rhamnosyltransferase-like [Cicer arietinum]
 gb|AGU14124.1| UDP-glycosyltransferase [Cicer arietinum]
Length=471

 Score =   348 bits (893),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 282/462 (61%), Gaps = 9/462 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LH+VM PWLA GH+ P  E++K+LA+ G  +  +STP  I RLPKL   L   I LI LP
Sbjct  9     LHVVMFPWLAMGHMYPCFEVSKILAQNGFFVTILSTPSIINRLPKLPQTLSQFIHLIKLP  68

Query  1477  L-PQVE--NLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
             L P ++  +LP++A+ST D+P +K+ YLK A+D LQ S++  L+  +PDWV  DFA+  L
Sbjct  69    LSPHIDTNHLPQNADSTSDIPSNKLYYLKQAYDSLQQSVSDVLKNSNPDWVFFDFAACWL  128

Query  1306  VPIMEKLSIPSVYFSIFTA-SINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
               I   ++I   YFS   A SI     P+  + D        +     PKW+PF T I  
Sbjct  129   PQIARSMNISCAYFSPCPAWSICFFDTPKQQLGDVESIRKNDEDYYGPPKWIPFPTKIGL  188

Query  1129  RNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
             R++E++++  D  ++    S ++ L  T  G     +RS  +LEPEWL    E   KP I
Sbjct  189   RSYEVKKLLEDVKVNETGASPVFDLNKTNSGCDMFVIRSSRDLEPEWLDFLGEFYNKPVI  248

Query  949   PVGLLP-TTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             PVGLLP +    D ++ D    W++IKEWLD Q+  SVVY+AFG+E K +QE + E+ALG
Sbjct  249   PVGLLPPSMQISDFDEVDNSPDWIQIKEWLDTQKGSSVVYIAFGAEVKLSQENINELALG  308

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             +ELS LPFFWV R  +  +     +LP GFE RT+  G++  +WAPQ KIL+H SVGG L
Sbjct  309   IELSGLPFFWVLRDVKNGS----IELPNGFEHRTKDHGLVWKNWAPQPKILAHGSVGGCL  364

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH G  S++E+L F   L+M PFL DQ + +R++ EK++G  I R+E DGSF+R+SVA++
Sbjct  365   THCGSGSMIESLYFGHVLVMLPFLLDQALYSRVMQEKKVGIEIVRNEQDGSFTRNSVAKA  424

Query  412   LRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLH  287
             LR  MV+E G  + +  K+M  K   K+  + Y+   +  L+
Sbjct  425   LRFAMVDEEGSAYRKNAKEMGKKYSNKDLHNQYIENFISSLY  466



>ref|XP_003593144.1| Glucosyltransferase [Medicago truncatula]
 gb|AES63395.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=472

 Score =   348 bits (893),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 195/483 (40%), Positives = 291/483 (60%), Gaps = 14/483 (3%)
 Frame = -3

Query  1687  FSAMASESST--LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHP  1514
               ++A+E S   LHIVMLPWLA GHI PY E+AK+LA +G+ + F+++P+NI ++PK   
Sbjct  1     MGSIANEDSNKPLHIVMLPWLAMGHIYPYFEVAKILASKGHTVTFINSPKNIDQMPKTPK  60

Query  1513  HLVPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWV  1334
              + P I L+ LPLP +E LP  AE+T+D+  +  R+LK A++ LQD +   L+T  PDWV
Sbjct  61    TIEPFIKLVRLPLPHIEQLPPGAENTMDIQPNMNRFLKQAYEGLQDDVTEILKTSKPDWV  120

Query  1333  IHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWV  1154
              +DFAS  L PI + L+I + +++I T + N  FF      D V +  + +     PKWV
Sbjct  121   FYDFASGWLAPIAKSLNIAAAHYNI-TPAWNKCFFDPPK--DQVKTNFKLEDMCGPPKWV  177

Query  1153  PFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             PF+TTI  + +E+ R F     + G ++  + L           +R+  ELE EWL    
Sbjct  178   PFQTTIHLKPYEIIRAFTALRNESGGIAG-FDLNKAYSSCDLFLLRTSRELEGEWLDYIS  236

Query  973   EVVGKPTIPVGLL-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQE  797
             E    P +PVGLL P+    D+E+++    W++IK WLD +E  SVVY+ FGSE K +Q 
Sbjct  237   EQYKVPVVPVGLLPPSMQIRDDEEEENNPDWVKIKGWLDSRESSSVVYIGFGSELKLSQN  296

Query  796   EVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
             ++ E+A G+ELS L FFW  +  +        +LPEGFEERT+ RG++  +WAPQLKIL+
Sbjct  297   DLTELAHGIELSGLSFFWALKNLKEG----TLELPEGFEERTKERGIVWKTWAPQLKILA  352

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H ++GG ++H G  SV+E + F   L+  P+L DQ + +R LVEK +   + R E DGSF
Sbjct  353   HGAIGGCMSHCGSGSVIEKVHFGHVLVTLPYLLDQCLFSRALVEKGVAVEVPRSEEDGSF  412

Query  436   SRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPSG  257
             +RDSVA SLR+ +V+E G  F    K++      K+  + Y++ L+  L+      +PS 
Sbjct  413   TRDSVAHSLRLAIVDEEGSSFRNNAKELGKVFSSKDIHNQYIDDLIAALY---KYRNPSN  469

Query  256   SHK  248
             S+ 
Sbjct  470   SNN  472



>ref|XP_006852901.1| hypothetical protein AMTR_s00033p00222830 [Amborella trichopoda]
 gb|ERN14368.1| hypothetical protein AMTR_s00033p00222830 [Amborella trichopoda]
Length=469

 Score =   348 bits (892),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 192/467 (41%), Positives = 284/467 (61%), Gaps = 10/467 (2%)
 Frame = -3

Query  1669  ESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDL  1490
             E   +H+VM+PWLAFGH+IP+ EL+K LA++G  + F+STPRN+QRLP   P L P I+L
Sbjct  2     ERENVHVVMVPWLAFGHMIPFFELSKALAQKGITVSFISTPRNLQRLPPTPPELAPQINL  61

Query  1489  IGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
             +G PLP VE LP++AE+T D+P  KV YLK A+D L+      +  +SPDW++ DFA + 
Sbjct  62    VGFPLPSVEGLPKNAEATTDIPLKKVPYLKKAYDGLRAPFEELVAKVSPDWIVVDFAPYW  121

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
                I  K  +P  +F+  + +      P  + + G+            P+W+ F +TI  
Sbjct  122   ATSIASKYGVPCCWFNAVSTAFTVFLGPPHS-LKGLCRTTTVDELMVVPEWITFPSTIAF  180

Query  1129  RNFE----MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
             R  E    +++V  + + +G  VSD YR+   ++G   V  R+  E + +++ L E++  
Sbjct  181   RRHEAQAFLQQVLTNLH-NGSGVSDWYRVQSILEGCRVVAFRTGKEFDGDYIDLFEKLYE  239

Query  961   KPTIPVGLLPTTAYddeedddk---kaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             K   P+G LP +  + E +D+    +  W    EWLD Q   SVV+V FGSE + + E+V
Sbjct  240   KSVFPLGFLPPSQAEREGNDNSWIDENKWSTAFEWLDAQPLRSVVFVGFGSECRLSIEQV  299

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              EIA GLELS+LPF W  RK   + D  +  LP+GFE RT  +G+IC  WAPQ +I +H 
Sbjct  300   HEIAYGLELSKLPFVWALRKPFETHDG-LEILPKGFEGRTERQGIICIGWAPQQRIFAHP  358

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSR  431
             S+GG L HSGW S++EAL     LI+ PF+ DQGI  RLL EK++G+ + R+E+DGSF++
Sbjct  359   SIGGCLFHSGWGSIIEALSHGLALILLPFIIDQGINARLLGEKKLGFEVERNEDDGSFTK  418

Query  430   DSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              S+A++LR VMVEE G+    K ++MK     KE  D Y++   ++L
Sbjct  419   VSIAKALRFVMVEEEGEPLRVKAREMKPIFGNKELSDMYLDGFANFL  465



>ref|XP_007012761.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY30380.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=542

 Score =   350 bits (897),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 193/429 (45%), Positives = 270/429 (63%), Gaps = 14/429 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI M PWLA+GHI+P+LE++K LA++G++I ++STP+NI RLPKL  HL  NI  I + 
Sbjct  81    LHIAMFPWLAYGHIMPFLEVSKFLAQKGHRISYISTPKNISRLPKLPAHLSSNISFIEIS  140

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LPQV  LP   EST ++P  KV YLK A D+L+  +  FL+T   +W+IHDF    L  +
Sbjct  141   LPQVHGLPPGVESTAEIPIQKVPYLKKACDKLEVPLTEFLKTSHVNWIIHDFMPHWLPGV  200

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
                  I  V+FSIF A++ A F P SA+I   D    P+  T  P+W+ +   I  +  E
Sbjct  201   AIPFGINLVFFSIFNATLLAFFGPPSALIG--DHRKRPEDFTVVPEWIDYPCNIAFKLHE  258

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
             M  V +   +D  +VSD  RLG  ++G   V +RSC E E + +QL +++  KP +PVGL
Sbjct  259   M--VSHQECMD--DVSDSQRLGQVIQGCQFVILRSCTEFESDQIQLLKKLYQKPVVPVGL  314

Query  937   LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQ  758
             LP +      ++    +W +IK+WLD++ + SV YVA GSE   +QE + E+A G+  S 
Sbjct  315   LPPS--LPSNEEKSHESWEDIKKWLDRKGEKSVFYVALGSEVSLSQESMHELAFGIYKSN  372

Query  757   LPFFWVYRKQ---RGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
             LPF WV R +    G    ++  +P+GFEER   RG++   WAPQL+IL+H SVGGFLTH
Sbjct  373   LPFIWVVRNRPLVEGQMGQDI--IPQGFEERVSDRGLVLKDWAPQLRILAHSSVGGFLTH  430

Query  586   SGWSSVVEALKFEKKLIM-RPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
              GWSS++EALKF + LI+      DQG+  RLL  K++G  I R+E DGSF+ D VA+++
Sbjct  431   CGWSSIIEALKFGRPLILFSGASSDQGLNARLLHGKKVGLEIERNELDGSFTSDLVAQTI  490

Query  409   RVVMVEEHG  383
             R VMVE  G
Sbjct  491   RQVMVEPEG  499



>ref|XP_008378602.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Malus domestica]
Length=487

 Score =   347 bits (891),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 271/431 (63%), Gaps = 6/431 (1%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             + LH+V+ PWLA GH IP+  L+ L+A++G+ + FVSTPRN+ RLP++  HL   I+L+ 
Sbjct  18    AALHVVVFPWLAMGHXIPFFHLSTLIAQKGHTVSFVSTPRNLSRLPRIPFHLSSLINLVS  77

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             LPLP++ NLP DAES+ D+P+ K + LK AFD LQ  + AFL++  PDWVI+D+    L 
Sbjct  78    LPLPRLPNLPNDAESSTDVPFHKQQLLKTAFDMLQPPLTAFLESSRPDWVIYDYTPHWLP  137

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
                 +L +   +F  F A+  +   P S +I+G D   + +  T  PKWVP E+ +  R 
Sbjct  138   ATAARLGVSRAFFCCFNAACMSYIGPPSLLINGQDGRTKAEDFTVVPKWVPLESDMAYRL  197

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWL----QLAEEVVGKP  956
              E+ +    +  D     D  R GV ++ +  VF+RS  ELEPEWL    QL  EV  KP
Sbjct  198   HEIAKWVEISSGDESITPDTVRFGVAIEESDVVFIRSSEELEPEWLNLMRQLYREVKVKP  257

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +PVG LP     +EE  +    W  IKEWLDKQ   SVVYVA G+E   +QEE+ E+AL
Sbjct  258   VVPVGFLPPN--IEEEASEFDETWGGIKEWLDKQRVNSVVYVALGTEATLSQEELTELAL  315

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
             GLELS +PFFWV R    S  +    LP GF ER +GRGV+   WAPQ++ILSHDSVGGF
Sbjct  316   GLELSGVPFFWVLRNPPESTQSVSEMLPPGFVERVKGRGVVHLGWAPQVRILSHDSVGGF  375

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH GW+S++E L F + L+  P + DQG+  RL   K +G  I R+E DGSF+ DSVAE
Sbjct  376   LTHCGWNSMIEGLVFGRVLMFFPMVNDQGLNARLGNGKGLGVEIPRNERDGSFAGDSVAE  435

Query  415   SLRVVMVEEHG  383
              +R+ MV++ G
Sbjct  436   LVRLAMVDDSG  446



>ref|XP_006451091.1| hypothetical protein CICLE_v10010307mg [Citrus clementina]
 gb|ESR64331.1| hypothetical protein CICLE_v10010307mg [Citrus clementina]
Length=467

 Score =   346 bits (888),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 186/428 (43%), Positives = 269/428 (63%), Gaps = 13/428 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI M PWLA+GHI+P+ ++A  LAE+G+ + ++STP+NI RLP++  +L   +  I LP
Sbjct  9     LHIAMFPWLAYGHIMPFFQVAMFLAEKGHHVSYISTPKNIDRLPQIPTNLSSRLSYIQLP  68

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LPQ++ LPE AEST +LP  KV YLK A D LQ  +  FLQ    +W+IHDF S  L P+
Sbjct  69    LPQLDGLPEGAESTAELPIHKVPYLKKAHDLLQLPLTNFLQDSRVNWIIHDFISHWLPPV  128

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
               +L + SV+FSI++A+      P S VI G     +P+  T  P+W+ F++ +  + +E
Sbjct  129   AAQLGVNSVFFSIYSAATLCFTGPPSDVIAGRRQ--KPEDFTVVPEWIDFQSNLAFKPYE  186

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
                + N   +D  +VSD  R    ++    V +RSC E EP+ L+L  +++ KP +PVGL
Sbjct  187   T--LINQDGMD-DSVSDYLRAAFVLQDCRVVILRSCAEFEPDALRLLGKMLQKPVLPVGL  243

Query  937   LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQ  758
             L  +     +D      W  +K+WLD +E  SVVY AFG+E   +QE + E+A GLE S 
Sbjct  244   LAPS----LQDSAAGEHWPVLKDWLDSKENNSVVYAAFGTEMTLSQELLHELAYGLEKSG  299

Query  757   LPFFWVYRKQRGSADAEVT---KLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
             LPF W+  K R   + E      LP GF++R  G G++ T WAPQL+IL+H S+GGFLTH
Sbjct  300   LPFIWII-KNRPLVEGESGLDHLLPPGFQDRVSGTGLVWTDWAPQLRILAHPSIGGFLTH  358

Query  586   SGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLR  407
             SGWSSV+EAL   + LI+ P   D G++ RL+  + +G  + R+E DGSF+RDSVA+ +R
Sbjct  359   SGWSSVIEALGLGRPLILLPGSSDTGLVARLMHSRRLGLEVERNEQDGSFTRDSVADCIR  418

Query  406   VVMVEEHG  383
              V+V++ G
Sbjct  419   RVVVDQEG  426



>ref|XP_003564684.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Brachypodium 
distachyon]
Length=476

 Score =   347 bits (889),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 190/470 (40%), Positives = 276/470 (59%), Gaps = 15/470 (3%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M + S  +H+VMLPWLAFGHI+P+ E AK +A +G+++   STPRN +RL  +   L   
Sbjct  1     MDTMSGGMHVVMLPWLAFGHILPFTEFAKRVARQGHRVTLFSTPRNTRRLIDIPEGLAAR  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFL---QTLSPDWV  1334
             I ++ + LP+VE LPE AE++ DLP D +R  L+ A+D   Q  ++  L   QT  PDWV
Sbjct  61    IRVVDITLPRVERLPEHAEASFDLPSDDLRPCLRRAYDAAFQRELSRLLHEDQTPRPDWV  120

Query  1333  IHDFASFRLVPIMEKLSIPSVYFSIFTASINAIF-FPQSAVIDGVDSPVEPKHTTSKPKW  1157
             + D+A++    +  +  +P  + S+F A+    F  P +    G  +  EP H T  P++
Sbjct  121   LIDYAAYWAPEVAARHGVPCAFLSLFGAAALGFFGTPDALTGTGEHAKTEPAHFTVVPEY  180

Query  1156  VPFETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQL  980
             VPF TT+  R +E   +F    + D   VS+ YR   +++G+  V +RS  E+EPEWLQL
Sbjct  181   VPFPTTVCYRGYEAREMFEPGMVPDDSGVSEGYRFAKSIEGSQLVGIRSSVEIEPEWLQL  240

Query  979   AEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQ  800
               ++  KP IPVGL P     +    +      E   WLD     +VVY AFGSE K   
Sbjct  241   LGQLYQKPVIPVGLFPPPPQQNISGHE------ETLRWLDGHAPSTVVYAAFGSEAKLTS  294

Query  799   EEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKIL  620
              ++  IALGLE S LPF W +R+    AD     LPEGFEER  GRG++C  W PQ++ L
Sbjct  295   AQLRRIALGLEQSGLPFVWAFREPADGADG--CCLPEGFEERVEGRGLVCRGWVPQVRFL  352

Query  619   SHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGS  440
             +H SVGGFLTH+GW+S+ E L    +L++ P + +QG+  R LV+K++G  +ARDE DGS
Sbjct  353   AHGSVGGFLTHAGWNSIAEGLARGVRLVLLPLIFEQGLNARHLVDKKVGVEVARDEQDGS  412

Query  439   FSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             F+   +A +LR VMV++ G+V   KV+++     + E  D  V   L +L
Sbjct  413   FAAQDIAAALRKVMVDDEGEVSGAKVRELAQVFGDDEVNDQCVRDFLSHL  462



>ref|XP_010030919.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
 gb|KCW56939.1| hypothetical protein EUGRSUZ_I02617 [Eucalyptus grandis]
Length=469

 Score =   346 bits (888),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 183/429 (43%), Positives = 260/429 (61%), Gaps = 3/429 (1%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             S    I+M PWLAFGHI+PY ELAK LA +G  I F+STPRNIQRLP +  +L+ NI L+
Sbjct  16    SKQYEIMMFPWLAFGHILPYFELAKRLASKGIHISFISTPRNIQRLPPVPDNLIENIKLV  75

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
              +PL  V+ LPE++E+T+DLP +   YL+ A D L++++   L  +SPD ++ DF    +
Sbjct  76    QIPLTSVDGLPENSEATIDLPLECTEYLRKACDGLREALEQLLCKISPDLILFDFVQCWI  135

Query  1306  VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPR  1127
               I  K S+PS  FS + A   A   P  A ++      +P+     P W P  + +   
Sbjct  136   PQIAAKFSVPSGNFSAYAACTLAFLGP-PAELESFGRGKKPEDFAVTPDWFPLTSLVSQG  194

Query  1126  NFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTI  950
                 +++F + Y  D  ++S   R   T+ G   V VRSC E E E+L L   +  KP +
Sbjct  195   PHLAQKMFKNLYFPDKSSLSCSQRWAATLHGCEFVAVRSCSEFEGEYLNLLRGLYRKPVL  254

Query  949   PVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGL  770
             PVGLLP  + +   D    + W  I +WLDKQ + SV++V FG+E K   EE+ E+A GL
Sbjct  255   PVGLLPPLSKNKACDQATGSNWSHISKWLDKQARKSVLFVGFGTEYKMPLEEIHELAYGL  314

Query  769   ELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLT  590
             ELS++PFFW+ RK  G        LP+GF ERT  R ++   WAPQL IL H ++GG L 
Sbjct  315   ELSEMPFFWILRKPGGLEFDSSELLPDGFLERTSERSMVSIGWAPQLAILGHPAIGGCLY  374

Query  589   HSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
             HSGWSS++E+L F    I  P + DQG+  +LLVEK +G+ + R+E DGSF RD+VA+S+
Sbjct  375   HSGWSSIIESLGFGHPQITMPMVDDQGLNAKLLVEKGVGFEVPRNE-DGSFHRDAVAKSI  433

Query  409   RVVMVEEHG  383
             R+V++E+ G
Sbjct  434   RLVLLEDQG  442



>ref|XP_010061561.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=493

 Score =   347 bits (889),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 197/470 (42%), Positives = 281/470 (60%), Gaps = 13/470 (3%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
             ++ LH+ M PWLA GH IP+L LA LLA RG+++ F+STP N+ +LP++  HL   + L+
Sbjct  14    AAPLHVAMFPWLAVGHFIPFLRLATLLARRGHRVSFLSTPHNLSKLPRIPAHLSSLVALV  73

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRL  1307
              LP P    LP  A+S+ D+P    + LK AFD L  ++ +FLQ+  PDW+++D+AS  L
Sbjct  74    PLPFPDTPALPPLAQSSADVPNRHQQLLKPAFDALLPALRSFLQSSRPDWILYDYASHWL  133

Query  1306  VPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHT------TSKPKWVPFE  1145
               +  +L +P  + S+F A++ + F     +  G     +P         T+ P W+P  
Sbjct  134   PALAAELRVPHAFLSLFAAAVLSFFGSPRELASGRR--FQPGGGGDGGDFTAVPPWIPAG  191

Query  1144  TTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             + +     E+ RV   +        D  R GV++  + AV VR+C E EPEWL L  E+ 
Sbjct  192   SGLAFLPHEVARVAERSEARVETTEDGVRFGVSIGESDAVVVRTCEEFEPEWLGLLRELY  251

Query  964   G-KPTIPVGLLPTT---AYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQE  797
             G KP +PVGLLP T     D+ +D + +  W  IK+WLD QE  S VYVAFG+E      
Sbjct  252   GDKPVLPVGLLPPTDEGDDDESDDVEGRGTWEFIKDWLDGQEANSAVYVAFGTEATLTGA  311

Query  796   EVVEIALGLELSQLPFFWVYRKQRGS-ADAEVTKLPEGFEERTRGRGVICTSWAPQLKIL  620
             E+V +ALGLE+S LPFFWV R+  GS  D  +  LP GF ER +GRG+I + WAPQ KIL
Sbjct  312   ELVGLALGLEMSGLPFFWVLRRPPGSDRDEGLGSLPRGFVERVKGRGLIHSGWAPQAKIL  371

Query  619   SHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGS  440
              H+SVGGFLTH G++S+VE L   + LI  P + +QG+  RLL  K +   + RDE DGS
Sbjct  372   RHESVGGFLTHCGYNSIVEGLSLGRVLITFPVMNEQGLNARLLRAKGVAVEVPRDEMDGS  431

Query  439   FSRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             F+ +SVA ++R+ MV+E G+      ++MK     KEK D YV++ + YL
Sbjct  432   FTGESVAGAVRLAMVDEAGEPARAAAREMKGVFGNKEKNDGYVDEFVRYL  481



>ref|XP_010942592.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=465

 Score =   345 bits (885),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 211/465 (45%), Positives = 283/465 (61%), Gaps = 25/465 (5%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHIV+ PWLAFGH+IP+LEL+K LA+RG+ I+F+ST RNI RLP +   L+P IDLI +P
Sbjct  6     LHIVLFPWLAFGHLIPFLELSKSLAKRGHHIFFISTSRNIHRLPNIPLPLLPLIDLISIP  65

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLS--PDWVIHDFASFRLV  1304
             LP   +LP+DAE+T DLP  KV +LK AFD+L   +A FL+  S  PDW+I DFA   L 
Sbjct  66    LPPSHDLPDDAEATTDLPPHKVPFLKKAFDKLDQPIAEFLERASPKPDWIICDFAPHWLP  125

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
             PI  KL+IP  YF+ F +     FF  SA   G  S   P+  T  P+W+PF T +  R 
Sbjct  126   PIASKLNIPCAYFNTFPS-----FF--SAFAAGQRS---PEQLTVTPEWIPFPTKVAHRL  175

Query  1123  FE---MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              E   + ++ +D  ++   VSD YR    VKG   + +R C E + EWL L  E+  KP 
Sbjct  176   HEARSLAKLLSD--VNASGVSDNYRFNSVVKGCHLMAMRGCMEFDGEWLTLLPELYKKPI  233

Query  952   IPVGLLPTTAYdd----eedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
             +P+GLLP  A +       +         + +WL KQ   S VYV+ GSE   + E V E
Sbjct  234   VPLGLLPPLADERPDGGNTNGMANTGHGNVVKWLTKQTPESTVYVSLGSEATLSNELVHE  293

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             +A GLELS LPF W  R++      EV  LP+GFE+R   RG++   W PQL+IL+  SV
Sbjct  294   LAFGLELSGLPFLWALRRK----GEEVELLPKGFEDRIAARGMVAVDWMPQLEILACSSV  349

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             GGF THSGWSS++E L F   LI+ P   DQGI  R++VEK++G  + RDE  GSF+R++
Sbjct  350   GGFFTHSGWSSLIEGLAFGHPLILLPIFGDQGINARVMVEKKVGLEVERDEETGSFTREA  409

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             VA+ LR+VMVEE GK   E  K+M+     K+    Y++  + YL
Sbjct  410   VAKVLRLVMVEEEGKKLRETAKRMREVFGNKDIHGRYMDAFVHYL  454



>ref|XP_004489091.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Cicer arietinum]
Length=456

 Score =   345 bits (884),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 202/477 (42%), Positives = 297/477 (62%), Gaps = 28/477 (6%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M ++ + LHI + PWLAFGHI+PY  L+KLLA++G+KI F+STPRNI+RLPKL  +L  +
Sbjct  1     MENQPTKLHIAVFPWLAFGHILPYFHLSKLLAQKGHKISFISTPRNIKRLPKLPTNLQTS  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             +++I L LP++++LP+ AE+TLD+P     YL+ AFD L++ +  FL+T +PD +I+DF 
Sbjct  61    LEMIELQLPRIDHLPDHAEATLDIPRHITPYLRKAFDGLKEPLTKFLETSTPDCIIYDFT  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWV---PF  1148
              + L  I  KL I  V+FSIF   ++  FF    V+       E     SK K V   PF
Sbjct  121   PYWLPQISSKLGIFQVHFSIFCG-LSLYFFANLFVMKS----GERHFDKSKLKAVALKPF  175

Query  1147  ETTIMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             E          E+   D +++     VSD +R   T+ GA  + VRSC E+E E L L E
Sbjct  176   E----------EKYLCDKHLENNESGVSDAFRFQQTLFGADLLVVRSCMEIEGESLTLLE  225

Query  973   EVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
              +  KP IPVGLLP +    E+  +    W +I +WLDK EK SV+YVAFGS+   + E+
Sbjct  226   NLYKKPVIPVGLLPPSLDFSEDISNDDDNWCKISKWLDKHEKNSVIYVAFGSQVVISDED  285

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSH  614
               E+ +GLELS  PF +V +K+    +       + F++R+   G++ T+W PQL+IL+H
Sbjct  286   FTELTMGLELSGFPFLFVLKKKNSDDNRH-----DWFKKRS-NNGLVWTNWVPQLRILAH  339

Query  613   DSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
             +SVGGFLTH GWSSV+E+L+    LIM P   +QG+   ++ EK +G  +AR+++DG F+
Sbjct  340   ESVGGFLTHCGWSSVIESLEVGCPLIMLPLENEQGLNAIVMEEKMVGVKVARNDHDGKFN  399

Query  433   RDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL--HAASTIH  269
             RDSVA++LR VM +E GKV+  KV++M     + E QD Y++  +D L  H  ++ H
Sbjct  400   RDSVAKALRSVMDKEEGKVYRSKVEEMSKIFGDMELQDKYIDGFVDSLKFHMHASKH  456



>ref|XP_008466142.1| PREDICTED: UDP-glycosyltransferase 91C1 [Cucumis melo]
Length=463

 Score =   345 bits (884),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 185/430 (43%), Positives = 272/430 (63%), Gaps = 9/430 (2%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             S    LH+V+ PWLAFGH+IP+  LA  LA++G K+ F+STPRN++R+PK+ PHL   + 
Sbjct  2     SNGDVLHVVLFPWLAFGHLIPFARLAICLAQKGFKVSFISTPRNLRRIPKISPHLSSVVS  61

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASF  1313
             L+G+ LP  + LP  AE++ D+PY+K + LK AFD L+  +A  L+ L+PDW+I+D+AS 
Sbjct  62    LVGVSLPLFDGLPVAAEASSDVPYNKQQLLKKAFDSLESQLADLLRDLNPDWIIYDYASH  121

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIM  1133
              + P+  +L I SV+FS+FTA   A   P S + +G  S    +     P+W+   + + 
Sbjct  122   WISPLAAELRISSVFFSLFTAGFLAFLGPPSELSNGRGSRSTVEDFMEVPEWMSHGSNLR  181

Query  1132  PRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
              R  E++   + A  +    SD  R GV+++ + AV VRS  ELEPE   L  ++  KP 
Sbjct  182   FRYHELKTSLDGAIGNESGTSDSVRFGVSIEESVAVAVRSSPELEPESFDLLTKLYQKPV  241

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IP+G LP    D EE  +      +I++WL KQ+  SV+YV+FG+E   +QE+V E+A G
Sbjct  242   IPIGFLPPLTEDVEELSE------DIEQWLKKQKTNSVLYVSFGTEAFLSQEDVTELAYG  295

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             LE S++PF W+ R    S   E   LP GF+ER  GRG++   W  Q+K+LSHDSVGG L
Sbjct  296   LEQSEIPFLWILRT---SHRNESEMLPAGFKERISGRGLVHEGWISQVKVLSHDSVGGCL  352

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
             TH GW+S++E L + + +IM P + DQG+  R+L ++ +G  I R+E DGSF+R+SV+ES
Sbjct  353   THCGWNSIIEGLGYGRVMIMCPVVNDQGLNARILEKEMVGIEIERNERDGSFTRESVSES  412

Query  412   LRVVMVEEHG  383
             +R  M E  G
Sbjct  413   VRSAMAEGSG  422



>ref|NP_001044898.1| Os01g0865400 [Oryza sativa Japonica Group]
 dbj|BAC01201.1| putative UDP-glucosyltransferase [Oryza sativa Japonica Group]
 dbj|BAF06812.1| Os01g0865400 [Oryza sativa Japonica Group]
Length=473

 Score =   345 bits (884),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 195/466 (42%), Positives = 278/466 (60%), Gaps = 15/466 (3%)
 Frame = -3

Query  1666  SSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLI  1487
               ++H+VMLPWLAFGHI+P+ E AK +A +G+++   STPRN +RL  + P L   I ++
Sbjct  7     GGSMHVVMLPWLAFGHILPFAEFAKRVARQGHRVTLFSTPRNTRRLIDVPPSLAGRIRVV  66

Query  1486  GLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFLQTLSP---DWVIHDF  1322
              +PLP+VE+LPE AE+T+DLP + +R YL+ A+DE     ++  LQ   P   DWV+ D+
Sbjct  67    DIPLPRVEHLPEHAEATIDLPSNDLRPYLRRAYDEAFSRELSRLLQETGPSRPDWVLADY  126

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSKPKWVPFE  1145
             A++       +  +P  + S+F A+    F P   +   G  +  EP H T+ P++VPF 
Sbjct  127   AAYWAPAAASRHGVPCAFLSLFGAAALCFFGPAETLQGRGPYAKTEPAHLTAVPEYVPFP  186

Query  1144  TTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
             TT+  R  E   +F  + I D   VS+ YR   +++G   V VRS  E EPEWL+L  E+
Sbjct  187   TTVAFRGNEARELFKPSLIPDESGVSESYRFSQSIEGCQLVAVRSNQEFEPEWLELLGEL  246

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP IP+G+ P     D    +      E   WLD+QE  SVVY AFGSE K   E++ 
Sbjct  247   YQKPVIPIGMFPPPPPQDVAGHE------ETLRWLDRQEPNSVVYAAFGSEVKLTAEQLQ  300

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
              IALGLE S+LPF W +R    + D +   LP GF+ER  GRGV+C  W PQ+K L+H S
Sbjct  301   RIALGLEASELPFIWAFRAPPDAGDGD--GLPGGFKERVNGRGVVCRGWVPQVKFLAHAS  358

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VGGFLTH+GW+S+ E L    +L++ P + +QG+  R L EK++   +ARDE+DGSF+ +
Sbjct  359   VGGFLTHAGWNSIAEGLANGVRLVLLPLMFEQGLNARQLAEKKVAVEVARDEDDGSFAAN  418

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
              + ++LR VMV E G  F  KVK++     + E  D YV   L  L
Sbjct  419   DIVDALRRVMVGEEGDEFGVKVKELAKVFGDDEVNDRYVRDFLKCL  464



>gb|AFK37289.1| unknown [Medicago truncatula]
Length=472

 Score =   345 bits (884),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 194/483 (40%), Positives = 290/483 (60%), Gaps = 14/483 (3%)
 Frame = -3

Query  1687  FSAMASESST--LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHP  1514
               ++A+E S   LHIVMLPWLA GHI PY E+AK+LA +G+ + F+++P+NI ++PK   
Sbjct  1     MGSIANEDSNKPLHIVMLPWLAMGHIYPYFEVAKILASKGHTVTFINSPKNIDQMPKTPK  60

Query  1513  HLVPNIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWV  1334
              + P I L+ LPLP +E LP  AE+T+D+  +  R+LK A++ LQD +   L+T  PDWV
Sbjct  61    TIEPFIKLVRLPLPHIEQLPPGAENTMDIQPNMNRFLKQAYEGLQDDVTEILKTSKPDWV  120

Query  1333  IHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWV  1154
              +DFAS  L PI + L+I + +++I T + N  FF      D V +  + +     PKWV
Sbjct  121   FYDFASGWLAPIAKSLNIAAAHYNI-TPAWNKCFFDPPK--DQVKTNFKLEDMCGPPKWV  177

Query  1153  PFETTIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             PF+TTI  + +E+ R F     +   ++  + L           +R+  ELE EWL    
Sbjct  178   PFQTTIHLKPYEIIRAFTALRNESRGIAG-FDLDKAYSSCDLFLLRTSRELEGEWLDYIS  236

Query  973   EVVGKPTIPVGLL-PTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQE  797
             E    P +PVGLL P+    D+E+++    W++IK WLD +E  SVVY+ FGSE K +Q 
Sbjct  237   EQYKVPVVPVGLLPPSMQIRDDEEEENNPDWVKIKGWLDSRESSSVVYIGFGSELKLSQN  296

Query  796   EVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
             ++ E+A G+ELS L FFW  +  +        +LPEGFEERT+ RG++  +WAPQLKIL+
Sbjct  297   DLTELAHGIELSGLSFFWALKNLKEG----TLELPEGFEERTKERGIVWKTWAPQLKILA  352

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H ++GG ++H G  SV+E + F   L+  P+L DQ + +R LVEK +   + R E DGSF
Sbjct  353   HGAIGGCMSHCGSGSVIEKVHFGHVLVTLPYLLDQCLFSRALVEKGVAVEVPRSEEDGSF  412

Query  436   SRDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAASTIHHPSG  257
             +RDSVA SLR+ +V+E G  F    K++      K+  + Y++ L+  L+      +PS 
Sbjct  413   TRDSVAHSLRLAIVDEEGSSFRNNAKELGKVFSSKDIHNQYIDDLIAALY---KYRNPSN  469

Query  256   SHK  248
             S+ 
Sbjct  470   SNN  472



>ref|NP_001150609.1| anthocyanidin 3-O-glucosyltransferase [Zea mays]
 gb|ACG39738.1| anthocyanidin 3-O-glucosyltransferase [Zea mays]
Length=472

 Score =   344 bits (883),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/437 (41%), Positives = 269/437 (62%), Gaps = 14/437 (3%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             +   ++H+VMLPWLAFGHI+P+ ELAK +A +G+++   STPRN +RL ++ P L  +I 
Sbjct  4     ANGGSMHVVMLPWLAFGHILPFTELAKRIARQGHRVTLFSTPRNTRRLIRIPPELAGHIR  63

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFLQTLSP---DWVIH  1328
             ++ + LP+VE LPED E+++DLP D +R YL++A+D    D ++A LQ   P   DWV+ 
Sbjct  64    VVDIALPRVERLPEDCEASIDLPSDDLRPYLRVAYDAAFADKLSAILQEPRPERPDWVLI  123

Query  1327  DFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSKPKWVP  1151
             D+A++       +  +P  + S+F A+  + + P   ++  G  +  +P+  T  P +VP
Sbjct  124   DYAAYWAPAAAARHGVPCAFLSLFGAATLSFYGPPEGLMGRGKYARTKPEDLTVVPDYVP  183

Query  1150  FETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAE  974
             F TT+  R FE   +F    + D   VS+ +R GV++  +  V +RS  ELE EWLQ+  
Sbjct  184   FPTTVAHRGFEARELFKPGLVPDDSGVSEGHRFGVSIGESQIVGIRSRTELESEWLQVLG  243

Query  973   EVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEE  794
             ++  KP IP+GL P     D    +          WLD+Q +GSVVY AFGSE K    +
Sbjct  244   KLYKKPVIPIGLFPPPPTQDIAGHEATL------RWLDRQAQGSVVYAAFGSEAKLTSAQ  297

Query  793   VVEIALGLELSQLPFFWVYRKQRGSADAEVTK-LPEGFEERTRGRGVICTSWAPQLKILS  617
             +  IALGLE S LPF W +R    +A  + T  LPEGF+ER  GRG++C  W PQ ++L+
Sbjct  298   LQTIALGLEASGLPFLWAFRPPTDAAPGQGTGGLPEGFKERVNGRGLVCRGWVPQPRLLA  357

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H+SVGGFLTH+GW+S+ E L     +++ P + DQG+  RLLV+K++G  + RDE+DG+F
Sbjct  358   HESVGGFLTHAGWNSIAEGLSRGVTMVLLPLMFDQGLNARLLVDKKIGIEVERDEDDGTF  417

Query  436   SRDSVAESLRVVMVEEH  386
             +   +A++LR  M E  
Sbjct  418   APKDIADALRTAMAENQ  434



>gb|EEE55719.1| hypothetical protein OsJ_04191 [Oryza sativa Japonica Group]
Length=464

 Score =   344 bits (882),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 195/463 (42%), Positives = 277/463 (60%), Gaps = 15/463 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             +H+VMLPWLAFGHI+P+ E AK +A +G+++   STPRN +RL  + P L   I ++ +P
Sbjct  1     MHVVMLPWLAFGHILPFAEFAKRVARQGHRVTLFSTPRNTRRLIDVPPSLAGRIRVVDIP  60

Query  1477  LPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFLQTLSP---DWVIHDFASF  1313
             LP+VE+LPE AE+T+DLP + +R YL+ A+DE     ++  LQ   P   DWV+ D+A++
Sbjct  61    LPRVEHLPEHAEATIDLPSNDLRPYLRRAYDEAFSRELSRLLQETGPSRPDWVLADYAAY  120

Query  1312  RLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSKPKWVPFETTI  1136
                    +  +P  + S+F A+    F P   +   G  +  EP H T+ P++VPF TT+
Sbjct  121   WAPAAASRHGVPCAFLSLFGAAALCFFGPAETLQGRGPYAKTEPAHLTAVPEYVPFPTTV  180

Query  1135  MPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGK  959
               R  E   +F  + I D   VS+ YR   +++G   V VRS  E EPEWL+L  E+  K
Sbjct  181   AFRGNEARELFKPSLIPDESGVSESYRFSQSIEGCQLVAVRSNQEFEPEWLELLGELYQK  240

Query  958   PTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIA  779
             P IP+G+ P     D    +      E   WLD+QE  SVVY AFGSE K   E++  IA
Sbjct  241   PVIPIGMFPPPPPQDVAGHE------ETLRWLDRQEPNSVVYAAFGSEVKLTAEQLQRIA  294

Query  778   LGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGG  599
             LGLE S+LPF W +R    + D +   LP GF+ER  GRGV+C  W PQ+K L+H SVGG
Sbjct  295   LGLEASELPFIWAFRAPPDAGDGD--GLPGGFKERVNGRGVVCRGWVPQVKFLAHASVGG  352

Query  598   FLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVA  419
             FLTH+GW+S+ E L    +L++ P + +QG+  R L EK++   +ARDE+DGSF+ + + 
Sbjct  353   FLTHAGWNSIAEGLANGVRLVLLPLMFEQGLNARQLAEKKVAVEVARDEDDGSFAANDIV  412

Query  418   ESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             ++LR VMV E G  F  KVK++     + E  D YV   L  L
Sbjct  413   DALRRVMVGEEGDEFGVKVKELAKVFGDDEVNDRYVRDFLKCL  455



>ref|XP_007012764.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY30383.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=465

 Score =   343 bits (881),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 190/429 (44%), Positives = 268/429 (62%), Gaps = 14/429 (3%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LHI M PWLA+GHI+P+LE++K LA +G++I ++STP+NI RLPKL  HL  NI  I + 
Sbjct  7     LHIAMFPWLAYGHIMPFLEVSKFLARKGHRISYISTPKNISRLPKLPAHLSSNISFIEIS  66

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LPQV  LP   EST ++P  KV YLK A D+L+  +  FL+T   +W+IHDF    L  +
Sbjct  67    LPQVHGLPPGVESTAEIPIQKVPYLKKACDKLEVPLTEFLKTSHVNWIIHDFMPHWLPGV  126

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRNFE  1118
                  I  V+FSI  A++ A   P SA+I   D    P+  T  PKW+ +   I+ +  E
Sbjct  127   AIPFGINLVFFSICNATLLAFLGPPSALIG--DHRKRPEDFTVVPKWIDYPCNIVLKLHE  184

Query  1117  MERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIPVGL  938
             M  V +   ++  +VSD  R+G  ++G   V +RSC E E + +QL +++  KP +PVGL
Sbjct  185   M--VSHQECME--DVSDFQRIGQVIQGCQFVTLRSCVEFESDQIQLLKKLYQKPVVPVGL  240

Query  937   LPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLELSQ  758
             LP +      ++    +W +IK+WLD++ + SV YVA GSE   +QE + E+A G+  S 
Sbjct  241   LPPS--LPSNEEKSHESWEDIKKWLDRKGEKSVFYVALGSEVSLSQESMHELAFGIYKSN  298

Query  757   LPFFWVYRKQ---RGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
             LPF WV R +    G    ++  +P+GFEER   RG++   WAPQL+IL+H SVGGFLTH
Sbjct  299   LPFIWVVRNRPLVEGQMGQDI--IPQGFEERVSDRGLVLKDWAPQLRILAHSSVGGFLTH  356

Query  586   SGWSSVVEALKFEKKLIM-RPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESL  410
              GWSS++EALKF + LI+      DQG+  RLL  K++G  I R+E DGSF+ D VA+++
Sbjct  357   CGWSSIIEALKFGRPLILFSGASSDQGLNARLLHGKKVGLEIERNELDGSFTSDLVAQTI  416

Query  409   RVVMVEEHG  383
             R VMVE  G
Sbjct  417   RQVMVEPEG  425



>ref|NP_001147674.1| anthocyanidin 3-O-glucosyltransferase [Zea mays]
 gb|ACG28334.1| anthocyanidin 3-O-glucosyltransferase [Zea mays]
Length=475

 Score =   343 bits (880),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 183/436 (42%), Positives = 264/436 (61%), Gaps = 14/436 (3%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNI  1496
             A  SS++H+VMLPWLAFGHI+P+ ELAK +A +G+++   STPRN +RL ++ P L  NI
Sbjct  3     ARSSSSMHVVMLPWLAFGHILPFTELAKRIARQGHRVTLFSTPRNTRRLIRIPPELAGNI  62

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFLQT---LSPDWVI  1331
              ++ + LP+VE LPED+E+++DLP D +R YL++A+D    D ++A LQ      PDWV+
Sbjct  63    RVVDITLPRVERLPEDSEASIDLPSDDLRPYLRVAYDAAFADKLSAILQEPWPQRPDWVV  122

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSKPKWV  1154
              D+A++       +  +P  + S+F A+  + + P   ++  G  +  +P+  T  P +V
Sbjct  123   IDYAAYWAPAAAARHGVPCAFLSLFGAAALSFYGPPEGLMGRGKYARTKPEDLTVVPDYV  182

Query  1153  PFETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLA  977
             PF TT+  R  E    F      D   VS+ YR G  ++ +  V +RS  E EPEWLQ+ 
Sbjct  183   PFPTTVAYRGLEAREFFTPVLAPDESGVSEGYRFGKCIEQSQLVGIRSSAEFEPEWLQVV  242

Query  976   EEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQE  797
               +  KP IPVGL P     D              +WLD Q + SVVY AFGSE K    
Sbjct  243   SGLYQKPVIPVGLFPPPPTQDIGSHKAAL------QWLDGQARRSVVYAAFGSEAKLTSA  296

Query  796   EVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
             ++  IALGLE S LPF W +R Q   A+   + LPEGFEER  GRG++C  W PQ + L+
Sbjct  297   QLQAIALGLEASGLPFLWAFR-QPTDANEGKSGLPEGFEERINGRGLVCRGWVPQARFLA  355

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H+SVGGFLTH+GW+S++E L    +L++ P + DQG+  R L EK++   + RDE DGSF
Sbjct  356   HESVGGFLTHAGWNSIIEGLARGVRLVLLPLMFDQGLNARHLTEKKISVEVPRDEEDGSF  415

Query  436   SRDSVAESLRVVMVEE  389
             +   +A +LR V+V+E
Sbjct  416   APKDIAAALRRVLVDE  431



>tpg|DAA56691.1| TPA: anthocyanidin 3-O-glucosyltransferase [Zea mays]
Length=512

 Score =   344 bits (883),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 181/442 (41%), Positives = 272/442 (62%), Gaps = 15/442 (3%)
 Frame = -3

Query  1684  SAMA-SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHL  1508
             SAM  +   ++H+VMLPWLAFGHI+P+ ELAK +A +G+++   STPRN +RL ++ P L
Sbjct  39    SAMGDANGGSMHVVMLPWLAFGHILPFTELAKRIARQGHRVTLFSTPRNTRRLIRIPPEL  98

Query  1507  VPNIDLIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFD-ELQDSMAAFLQTLSP---  1343
               +I ++ + LP+VE LPED E+++DLP D +R YL++A+D    D ++A L+   P   
Sbjct  99    AGHIRVVDIALPRVERLPEDCEASIDLPSDDLRPYLRVAYDTAFADKLSAILKEPGPERP  158

Query  1342  DWVIHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSK  1166
             DWV+ D+A++       K  +P  + S+F A+  + + P   ++  G  +  +P+  T  
Sbjct  159   DWVLIDYAAYWAPAAAAKHGVPCAFLSLFGAATLSFYGPPEGLMGRGKYARTKPEDLTVV  218

Query  1165  PKWVPFETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEW  989
             P +VPF TT+  R+FE   +F    + D   VS+ +R GV++  +  V +RS  ELE EW
Sbjct  219   PDYVPFPTTVAHRSFEARELFKPGLVPDDSGVSEGHRFGVSIGESQIVGIRSRTELESEW  278

Query  988   LQLAEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETK  809
             LQ+  ++  KP IP+GL P     D    +          WLD+Q +GSVVY AFGSE K
Sbjct  279   LQVLGKLYKKPVIPIGLFPPPPTQDIAGHEATL------RWLDRQAQGSVVYAAFGSEAK  332

Query  808   PNQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTK-LPEGFEERTRGRGVICTSWAPQ  632
                 ++  IALGLE S LPF W +R    +A  + T  LPEGFEER   RG++C  W PQ
Sbjct  333   LTSAQLQTIALGLEASGLPFLWAFRPPADAAPGQGTGGLPEGFEERVNDRGLVCRGWVPQ  392

Query  631   LKILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDE  452
              ++L+H+SVGGFLTH+GW+S+ E L     +++ P + DQG+  RLLV+K++G  + RDE
Sbjct  393   PRLLAHESVGGFLTHAGWNSIAEGLSRGVTMVLLPLMFDQGLNARLLVDKKIGIEVERDE  452

Query  451   NDGSFSRDSVAESLRVVMVEEH  386
             +DG+F+   +A++LR  M E  
Sbjct  453   DDGTFAPKDIADALRTAMAENQ  474



>gb|AES79436.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=434

 Score =   340 bits (873),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 195/474 (41%), Positives = 285/474 (60%), Gaps = 44/474 (9%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M  +   LHI + PWLAFGHI P+ EL+KL+A++G+KI F+STPRNI+RLPKL  +L P 
Sbjct  1     MEDDPKKLHIAVFPWLAFGHISPFFELSKLIAQKGHKISFISTPRNIERLPKLPSNLQPL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             ++ + L LP ++ LPE AE+T+D+P     YLK AFD LQ  +  FL+  +PD VI+DFA
Sbjct  61    VNFVELSLPHIDQLPEHAEATMDIPSHIGSYLKKAFDGLQQPLVEFLEKSNPDCVIYDFA  120

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
              + L P++ K  I S+YFSIF+A              G+   VE                
Sbjct  121   PYWLPPVLSKFGILSIYFSIFSAI-------------GMSFGVE---------------F  152

Query  1138  IMPRNFEMERVFNDAYIDGG--NVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             ++ ++ + E + +D Y++     V+D++R+   + GA  +  RSC E+E ++L+L E + 
Sbjct  153   LVGKSNDEENIISDVYLEQNESGVTDMFRVKKILFGADFIAARSCMEIEGKYLELIENLC  212

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
              K  IPVGLLP +      ++     W  I +WLDK EK SVVYVAFGSE   + EE  E
Sbjct  213   KKKVIPVGLLPPS--LQIGEEKNDENWDTILKWLDKHEKRSVVYVAFGSEVILSDEEFTE  270

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             IA GLELS  P+ W+ + Q         K     E ++  +G+I ++WAPQL+IL+H+S+
Sbjct  271   IAKGLELSSFPYLWILKNQ--------VKDDWLVENQSNKKGLIWSNWAPQLRILAHESI  322

Query  604   GGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             G FLTH GWS+V+E+L+    LIM PF  +Q ++ RL+ E+ +G  + R  NDG F+RDS
Sbjct  323   GRFLTHCGWSTVIESLQVGCPLIMLPFHNEQSLVARLMEERMVGVMVQR--NDGKFTRDS  380

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDY--LHAASTIH  269
             VA++LR VMVEE G+ +  K  +M     +KE    Y++  +DY  LH ++T H
Sbjct  381   VAKALRSVMVEEEGESYRNKAVEMSKIFGDKELHQKYLDDFVDYMELHISATKH  434



>ref|XP_003548650.2| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Glycine max]
 gb|KHN46707.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=483

 Score =   342 bits (877),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 185/462 (40%), Positives = 281/462 (61%), Gaps = 10/462 (2%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             + +H+VMLPW AFGH+IP+ +L+  LA+ G  + F+STP+NIQRLPK+  +L   +DL+ 
Sbjct  17    NAIHVVMLPWSAFGHLIPFFKLSIALAKAGVHVSFISTPKNIQRLPKIPSNLAHLVDLVQ  76

Query  1483  LPLPQV--ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFR  1310
              PLP +  E+LPE AE+T+D+P +K+ YLK+A+D+LQ ++  F+    P+W+I DF+   
Sbjct  77    FPLPSLDKEHLPEGAEATVDIPSEKIEYLKLAYDKLQHAVKQFVANQLPNWIICDFSPHW  136

Query  1309  LVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMP  1130
             +V I+ +  +  +++++ +A    ++ P         +P+ P+  T+ P+WV F +++  
Sbjct  137   IVDIVHEFQVKLIFYNVLSAPALTVWGPPGTR----KTPLSPESLTAPPEWVTFPSSVAY  192

Query  1129  RNFEMERVFNDAY-IDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPT  953
             R  E   +   A  ++   VSD  RL      + AV  RSCYE+E E+L   +++VGKP 
Sbjct  193   RIHEAIALCAGANPVNASGVSDFERLHKVFNASEAVIFRSCYEIEGEYLNAYQKLVGKPV  252

Query  952   IPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALG  773
             IP+GLLP  + +   +        +I EWLD+Q   SVV+V FGSE K N+++V EIA G
Sbjct  253   IPIGLLPADSEERGREIIDGRTSGKIFEWLDEQASKSVVFVGFGSELKLNKDQVFEIAYG  312

Query  772   LELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFL  593
             +E  +LPF W  RK   + + E   LP GF ERT  RGV+C  W PQ +IL+H S+GG L
Sbjct  313   IEEYELPFIWALRKPSWAINDE-DFLPFGFIERTSNRGVVCMGWIPQQEILAHPSIGGSL  371

Query  592   THSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAES  413
              HSGW SV+E L+F   L++ PF+ DQ +  R LVEK +   + R+E DGSF+R+ +A S
Sbjct  372   FHSGWGSVIETLQFGHILVVLPFIIDQPLNARFLVEKGLAIEVKRNE-DGSFTRNDIATS  430

Query  412   LRVVMVEEHGkvfaekv-kkmkaklfekeKQDNYVNKLLDYL  290
             LR  MV E GK       +        K  QD+Y+ + + +L
Sbjct  431   LRQAMVLEEGKKIRINTGEAAAIVGNLKLHQDHYIAEFVQFL  472



>ref|XP_008807755.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Phoenix 
dactylifera]
Length=473

 Score =   342 bits (876),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 282/469 (60%), Gaps = 5/469 (1%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             MA     LHI MLPWLAFGH+IPYL LA  LA  G+++ F+S+PRN +RLPK+ PHL P 
Sbjct  1     MAMGEQRLHIAMLPWLAFGHMIPYLHLAFALATAGHRVSFLSSPRNNRRLPKIPPHLTPL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             I  + LPLP+V+ LPE+AE+T+D+P DK   LKIA+D LQ+ +  FL   SPD ++HDF 
Sbjct  61    IAFVDLPLPRVDGLPEEAEATVDVPADKGPLLKIAYDFLQNPVKKFLADESPDVILHDFL  120

Query  1318  SFRLVPIMEKLSI-PSVYFSIFTASINAIFFPQSAVIDGVDSP-VEPKHTTSKPKWVPFE  1145
              + +      L + P + F+   AS      P+    +G       P+  TS P+W P  
Sbjct  121   PYWVPAAARDLGVLPVLLFAFNAASTGFTGPPEVLAEEGRRRRWPSPESMTSPPEWFPPG  180

Query  1144  TTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEV  968
             +T+  R  E E+ +++ +  +   ++D+ R  + V+G +A+ +R+C E E E+L +   +
Sbjct  181   STVAFRRREAEQFYSEVFTTNTSGIADVERFRLAVEGCTAIALRTCPEYEGEYLDVLRRI  240

Query  967   VGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVV  788
               KP  PVGL+P  A       D+   W +I  WLD Q   SVV+V+FGSE K ++ EV 
Sbjct  241   YRKPVFPVGLIPL-ATSPAASADRHGRWGQIFGWLDAQPPKSVVFVSFGSEYKLSESEVR  299

Query  787   EIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDS  608
             E+A GLELS + F W  R+       +   LP+GF  RT GRG +C  WAPQL+IL+H S
Sbjct  300   ELAYGLELSNVRFLWALRRPAWVTGGDEEALPKGFAARTEGRGAVCFGWAPQLEILAHPS  359

Query  607   VGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             VGG L HSGW S++E L++   LI+ P + DQG+  RLLVEK +   + R  +DGS+ RD
Sbjct  360   VGGSLFHSGWGSIIETLRYGNALIVLPNIFDQGLNARLLVEKGIAVEVERG-DDGSYDRD  418

Query  427   SVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAA  281
              VA++L++VM+    +    K ++M A   +KE  D Y+ + +++L  A
Sbjct  419   GVAKALQMVMLSNEVEGLRRKAREMAAVFADKELHDRYLKEFINFLLGA  467



>ref|XP_010051441.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=461

 Score =   341 bits (875),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 202/473 (43%), Positives = 271/473 (57%), Gaps = 24/473 (5%)
 Frame = -3

Query  1678  MASESS-TLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
             M SES  +LHI M PWLA GHI P+LEL+K L+ RG+ I F+STP NI RL + HP L P
Sbjct  1     MGSESKRSLHIAMFPWLAHGHITPFLELSKFLSLRGHAISFLSTPNNIARLARSHPELPP  60

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             ++ L+  PLP+V NLP  AEST DL  D V YLK A+D L+ ++  FL     DWVIHDF
Sbjct  61    SVRLVSFPLPRVPNLPSSAESTSDLDIDLVPYLKKAYDLLEPALTRFLSGSRVDWVIHDF  120

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             AS  L     +L + SV+FS F A+  A   P S +I G     +P+  T  P W+P+E+
Sbjct  121   ASHWLPGAAARLGVTSVFFSTFNATSLAFLGPPSELISGRCQ--KPEDLTCVPAWIPYES  178

Query  1141  TIMPRNFEM---ERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             T   R  E+   +R  ++       VSDL R G T+ G   V VRSC E E E L L ++
Sbjct  179   TACLRLHEILKHQRCMDE------EVSDLCRFGHTIDGCDFVIVRSCREFESEPLSLLQQ  232

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP IPVGLL  T    +++ D    W  +K WL  + + SV+Y+A G+E   + E  
Sbjct  233   IYQKPAIPVGLL--TPAVRQDEGDDDEKWKALKSWLHTKREKSVLYIALGTEVILSHELT  290

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              E+A G+E S LPF WV R            +  GFE+R  GRG I   WAPQ +IL+H+
Sbjct  291   NELAAGIEKSGLPFVWVVRN---------GLVAPGFEQRVSGRGFIWAGWAPQTRILAHE  341

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIM-RPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
             ++GGFLTH GW+S +EAL     L++      DQG++ R L EK++G+ + RDE DG F+
Sbjct  342   AIGGFLTHCGWNSTIEALGRGLPLVLFSGGSSDQGLMARFLHEKQVGFEVPRDEADGLFT  401

Query  433   RDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAAST  275
              D VAES+R VMVE  G+      + MK      E Q+ Y+ +    L    T
Sbjct  402   GDVVAESIRRVMVEHEGEPIRATARAMKEVFGNIELQNEYLEEFAGILEKGVT  454



>gb|KHN46708.1| Putative UDP-rhamnose:rhamnosyltransferase 1 [Glycine soja]
Length=462

 Score =   341 bits (874),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 188/464 (41%), Positives = 279/464 (60%), Gaps = 11/464 (2%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             +H+VMLPW AFGH+IP+ +L+  LA+ G  + F+STP+NIQRLPK+  +L   +  + LP
Sbjct  6     IHVVMLPWSAFGHLIPFFKLSIALAKAGVHVSFISTPKNIQRLPKIPSNLAHLVHFVQLP  65

Query  1477  LPQV--ENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
             LP +  E+LPE AE+T+D+P +++ +LK+A+D+LQ  +  F+    P+W+I DF+   +V
Sbjct  66    LPSLDKEHLPEGAEATVDIPSEEIEFLKLAYDKLQHPVKQFVANQLPNWIICDFSPHWIV  125

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
              I ++  +  +++S+F+A+   IF P +        PV P+  T  P+WV F +++  R 
Sbjct  126   DIAQEFQVKLIFYSVFSAASMNIFAPSTRKF-----PVTPESLTVPPEWVTFPSSVAYRI  180

Query  1123  FEMERVFNDAY-IDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
              E       A  ++   V D  R+      + AV  RSCYE+E E+L   +++VGKP IP
Sbjct  181   HEAIPFCAGANDVNASGVRDYERMATVCCASKAVIFRSCYEIEGEYLNAFQKLVGKPVIP  240

Query  946   VGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLE  767
             +G+LP  + D E +    +   +I EWLD+Q   SVV+V FGSE K N+++V EIA G+E
Sbjct  241   IGILPADSADREREIIDGSTSGKIFEWLDEQASKSVVFVGFGSELKLNKDQVFEIAYGIE  300

Query  766   LSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
              SQLPF W  RK   + + E   LP GF ERT  RGV+C  W PQ +IL+H S+GG L H
Sbjct  301   ESQLPFLWGLRKPSWATNDE-DFLPVGFIERTSNRGVVCMGWIPQQEILAHPSIGGSLFH  359

Query  586   SGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLR  407
             SGW SV+E L+F   L++ PF+ DQ +  R LVEK +   +   E DGSF+R+ +A+SLR
Sbjct  360   SGWGSVIETLQFGHNLVVLPFIIDQPLNARFLVEKGLAIEVKMTE-DGSFTRNEIAKSLR  418

Query  406   VVMVEEHGkvfaekv-kkmkaklfekeKQDNYVNKLLDYLHAAS  278
               MV E GK       +        K  QD+Y+   + +L   S
Sbjct  419   QAMVLEEGKKLRINTGEAAAIVGNLKLHQDHYIAAFVQFLKNGS  462



>gb|KCW82044.1| hypothetical protein EUGRSUZ_C03414, partial [Eucalyptus grandis]
Length=451

 Score =   340 bits (873),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 195/437 (45%), Positives = 259/437 (59%), Gaps = 24/437 (5%)
 Frame = -3

Query  1678  MASESS-TLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
             M SES  +LHI M PWLA GHI P+LEL+K L+ RG+ I F+STP NI RL + HP L P
Sbjct  1     MGSESKRSLHIAMFPWLAHGHITPFLELSKFLSLRGHAISFLSTPNNIARLARSHPELPP  60

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             ++ L+  PLP+V NLP  AEST DL  D V YLK A+D L+ ++  FL     DWVIHDF
Sbjct  61    SVRLVSFPLPRVPNLPSSAESTSDLDIDLVPYLKKAYDLLEPALTRFLSGSRVDWVIHDF  120

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             AS  L     +L + SV+FS F A+  A   P S +I G     +P+  T  P W+P+E+
Sbjct  121   ASHWLPGAAARLGVTSVFFSTFNATSLAFLGPPSELISGRCQ--KPEDLTCVPAWIPYES  178

Query  1141  TIMPRNFEM---ERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             T   R  E+   +R  ++       VSDL R G T+ G   V VRSC E E E L L ++
Sbjct  179   TACLRLHEILKHQRCMDE------EVSDLCRFGHTIDGCDFVIVRSCREFESEPLSLLQQ  232

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP IPVGLL  T    +++ D    W  +K WL  + + SV+Y+A G+E   + E  
Sbjct  233   IYQKPAIPVGLL--TPAVRQDEGDDDEKWKALKSWLHTKREKSVLYIALGTEVILSHELT  290

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              E+A G+E S LPF WV R            +  GFE+R  GRG I   WAPQ +IL+H+
Sbjct  291   NELAAGIEKSGLPFVWVVRN---------GLVAPGFEQRVSGRGFIWAGWAPQTRILAHE  341

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIM-RPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
             ++GGFLTH GW+S +EAL     L++      DQG++ R L EK++G+ + RDE DG F+
Sbjct  342   AIGGFLTHCGWNSTIEALGRGLPLVLFSGGSSDQGLMARFLHEKQVGFEVPRDEADGLFT  401

Query  433   RDSVAESLRVVMVEEHG  383
              D VAES+R VMVE  G
Sbjct  402   GDVVAESIRRVMVEHEG  418



>ref|XP_010047533.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
 gb|KCW79476.1| hypothetical protein EUGRSUZ_C00863 [Eucalyptus grandis]
Length=449

 Score =   340 bits (872),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 189/467 (40%), Positives = 290/467 (62%), Gaps = 20/467 (4%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M ++   LH+ + PWLAFGHI+PYLE+A  LAE+G+++ F+STP+N+++LP     L P+
Sbjct  1     MDNKEKKLHVAIFPWLAFGHILPYLEVATFLAEKGHRVSFISTPKNLRKLPT---DLPPS  57

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             + L+ LPLP+V+ LP+ AEST +LP  KV YLK A+D L+ ++  FLQ    DW+IHDFA
Sbjct  58    LTLVELPLPRVDGLPDLAESTAELPIKKVPYLKKAYDMLEPAITEFLQRSGVDWIIHDFA  117

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPV-EPKHTTSKPKWVPFET  1142
             +  L  ++ ++ I S +F+I +A+  A   P S +I+G   PV  P+  T  PKW+ + +
Sbjct  118   AHWLPRVVSQIGINSAFFNITSATSPAFLGPPSLLIEG---PVPRPEDLTVVPKWIDYPS  174

Query  1141  TIMPRNFEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVG  962
              +  + +EM  + N   +D G VSD  R+G +++G+  V VRSC E E + L+L E++ G
Sbjct  175   KVRFKLYEM--LQNHDGMDPG-VSDFQRIGESIRGSKFVAVRSCPEFEADPLRLLEKLYG  231

Query  961   KPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEI  782
             KP +PVGLLP       +   +   W+E+K WLD +++ SV Y+  G+E   + E +VE+
Sbjct  232   KPVVPVGLLPPR----RKRSSEDERWVELKRWLDDKKEKSVFYIGLGTEVNISPEMIVEL  287

Query  781   ALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVG  602
             A G+E S LPF WV  ++ G  +     +P GFE +  GRG +   WAPQ +IL+H ++G
Sbjct  288   AGGIEKSGLPFVWVVGQRPGPEN-----IPPGFESQVAGRGYMWMGWAPQAEILAHPAIG  342

Query  601   GFLTHSGWSSVVEALKFEKKLIMRPFLR-DQGIITRLLVEKEMGYAIARDENDGSFSRDS  425
             G L+H GWSS +E+L   + LI+      DQG++ RL  E+ +G+ + RDE DGSF+ DS
Sbjct  343   GILSHCGWSSAIESLGQGRPLILFSGANSDQGLMGRLFEERGVGFEVPRDEADGSFTSDS  402

Query  424   VAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHA  284
             +A+++R VMVE  G+        M+      E Q+ Y+ KL   + A
Sbjct  403   LAQTIRRVMVEPEGEQVRANAWAMREIFGNYELQNKYLEKLAQVMLA  449



>ref|XP_004970691.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1-like 
[Setaria italica]
Length=472

 Score =   340 bits (873),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 183/444 (41%), Positives = 269/444 (61%), Gaps = 26/444 (6%)
 Frame = -3

Query  1672  SESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNID  1493
             ++  ++H+VMLPWLAFGHI+P+ ELAK +A +G+++  +STPRN +RL ++ P L   + 
Sbjct  4     ADGCSMHVVMLPWLAFGHILPFTELAKRIARQGHRVTLLSTPRNTRRLIRIPPALASLVR  63

Query  1492  LIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDELQDSMAAFLQTLS----------  1346
             ++ + LP+VE LPE AE+++DLP D +R YL++A+D       AF   LS          
Sbjct  64    VVDVHLPRVERLPEGAEASIDLPSDALRPYLRVAYD------TAFSHKLSDILREPGPER  117

Query  1345  PDWVIHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTS  1169
             PDWV+ D+A++       +  +P  + S+F A+  + F P  A++  G  +    +  T 
Sbjct  118   PDWVLIDYAAYWAPAAAARHGVPCAFLSLFGAAALSFFGPPEALMGRGRHAKTNLEDLTV  177

Query  1168  KPKWVPFETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPE  992
              P +VPF TT+  R FE   +F    + D   VS+ YR  + ++G+  V +RS    EPE
Sbjct  178   VPDYVPFPTTVAYRAFEAREIFEPGLVPDDSGVSEGYRFAMAIQGSQLVGIRSSVGFEPE  237

Query  991   WLQLAEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSET  812
             WL++  E+  KP IPVGL P     D    +         +WL++Q   SVVY AFGSE 
Sbjct  238   WLRVLGELYQKPVIPVGLFPPPPTQDVAGHEATL------QWLNRQAPRSVVYAAFGSEA  291

Query  811   KPNQEEVVEIALGLELSQLPFFWVYRKQRGSADAEVTK-LPEGFEERTRGRGVICTSWAP  635
             K    ++  IALGLE S LPF W +R    +   E T  LPEGFEER  GRG++C  W P
Sbjct  292   KLASAQLQTIALGLEASGLPFLWAFRPPADAGIGEGTAGLPEGFEERVDGRGLVCRGWVP  351

Query  634   QLKILSHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARD  455
             Q ++L+H+SVGGFLTH+GW+S+ E L    +L++ P + DQG+ +RLLVEK++G  + RD
Sbjct  352   QARLLAHESVGGFLTHAGWNSITEGLARGVRLVLLPLMFDQGLNSRLLVEKKIGVEVERD  411

Query  454   ENDGSFSRDSVAESLRVVMVEEHG  383
             E+DGSF+   +A +LR VMVE+ G
Sbjct  412   EDDGSFTPKDIAAALRRVMVEDEG  435



>ref|XP_002458816.1| hypothetical protein SORBIDRAFT_03g040840 [Sorghum bicolor]
 gb|EES03936.1| hypothetical protein SORBIDRAFT_03g040840 [Sorghum bicolor]
Length=469

 Score =   340 bits (872),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 180/431 (42%), Positives = 260/431 (60%), Gaps = 14/431 (3%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M + S ++H+VMLPWLAFGHI+P+ ELAK +A +G+++  +STPRN +RL  + P L   
Sbjct  1     MDASSGSMHVVMLPWLAFGHILPFTELAKRIARQGHQVTILSTPRNTRRLIHIPPDLAGL  60

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFLQT---LSPDWV  1334
             + ++ + LP+VE LPEDAE+++DLP D +R YL+ A+D    D ++  LQ      PDWV
Sbjct  61    VRVVDVQLPRVERLPEDAEASIDLPSDDLRPYLRRAYDAAFADKLSDILQEPGPRKPDWV  120

Query  1333  IHDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSKPKW  1157
             I D+A+        +  +P  + S+F A+    + P  A++  G  +  +P+  T  P +
Sbjct  121   IIDYAAHWAPAAAARHGVPCAFLSLFGAAAVTFYGPAEALMGRGKHARTKPEQLTMVPDY  180

Query  1156  VPFETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQL  980
             VPF TT+  R FE    F    + D   VS+ YR    ++G+  V +RS  E EPEWLQ+
Sbjct  181   VPFPTTVAYRGFEAREFFTPVLVPDESGVSEGYRFAKCIEGSQLVGIRSSAEFEPEWLQV  240

Query  979   AEEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQ  800
                +  KP IPVGL P     D              +WLD+Q +GSVVY AFGSE K   
Sbjct  241   LGGLYRKPVIPVGLFPPPPTQDIGGHKAAL------QWLDRQARGSVVYSAFGSEAKLTS  294

Query  799   EEVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKIL  620
              ++  IALGLE S LPF W +R+   + + E + LPEGFEER  GRG++C  W PQ + L
Sbjct  295   AQLQTIALGLEASGLPFLWAFRQPVDANEGE-SGLPEGFEERVDGRGLVCRGWVPQARFL  353

Query  619   SHDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGS  440
             +H+SVGGFLTH+GW+S++E L    +L++ P + DQG+  R L EK++   + RDE DGS
Sbjct  354   AHESVGGFLTHAGWNSIIEGLARGVRLVLLPLMFDQGLNARHLTEKKISVEVPRDEEDGS  413

Query  439   FSRDSVAESLR  407
             F+   +A +LR
Sbjct  414   FAPKDIAAALR  424



>ref|XP_010905696.1| PREDICTED: putative UDP-rhamnose:rhamnosyltransferase 1 [Elaeis 
guineensis]
Length=474

 Score =   340 bits (872),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 190/459 (41%), Positives = 280/459 (61%), Gaps = 5/459 (1%)
 Frame = -3

Query  1657  LHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIGLP  1478
             LH+ +LPWLAFGH+IP+L LA  LA  G ++ F+STPRN +RLPK+ PHL   I  + LP
Sbjct  6     LHVALLPWLAFGHMIPFLHLAVALAAAGLRVSFLSTPRNNRRLPKIPPHLTSLITFVDLP  65

Query  1477  LPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLVPI  1298
             LP ++ LP+ AE+T+D+P DKV  LK A D LQD    FL   SPD+++HDF     V  
Sbjct  66    LPPIDGLPDQAEATVDIPEDKVPLLKNACDLLQDPFKDFLAQKSPDFLLHDFFHHWAVAA  125

Query  1297  MEKLSIPSVYFSIFTASINAIFFPQSAVID--GVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
                + +PSV+F +F+A+  A   P  A+++  G  S   P+  TS P+W+P  +T+  R 
Sbjct  126   AHDVGVPSVFFVVFSATATAFSGPPEALMEDGGKKSWPSPESMTSPPEWLPSGSTVAFRR  185

Query  1123  FEMERVFNDAY-IDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVVGKPTIP  947
              E E ++  A+ +    ++D+ R+ + V+G +A+ VRSC E E E+L +   +  KP IP
Sbjct  186   REAELLYLSAFAMTSMGLTDVDRMRLAVEGCAALAVRSCREYEGEYLDVVRRIFRKPVIP  245

Query  946   VGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIALGLE  767
             VGLL           D+   W  I  WLD Q   SVV+V+FGSE K  + EV E+A GLE
Sbjct  246   VGLL-PPPPPPPTGGDRDDNWGRIFGWLDDQPPKSVVFVSFGSEYKLTESEVHELAYGLE  304

Query  766   LSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGFLTH  587
             LS +PF W  R+   ++ ++   LPEGF+ RT GRGV+   WAPQL+IL+H S+GG L H
Sbjct  305   LSNVPFLWALRRPSWASGSDEEALPEGFQTRTEGRGVVSFGWAPQLEILAHPSIGGSLFH  364

Query  586   SGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAESLR  407
             SGW S++E L +   L++ P + DQG+  RLLVEK +   + R ++D  F R+ +A++L+
Sbjct  365   SGWGSIIETLGYGHALVVMPNIIDQGLNARLLVEKGIAVEVERGDDD-CFHRNEIAKALQ  423

Query  406   VVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYL  290
             + MV   G+    K ++      +++  D Y+ + +DYL
Sbjct  424   MAMVSSEGEGLRRKARETATVFADRDLHDKYIKEFVDYL  462



>tpg|DAA56689.1| TPA: anthocyanidin 3-O-glucosyltransferase [Zea mays]
Length=476

 Score =   340 bits (872),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 184/436 (42%), Positives = 265/436 (61%), Gaps = 13/436 (3%)
 Frame = -3

Query  1675  ASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNI  1496
             A  SS++H+VMLPWLAFGHI+P+ ELAK +A +G+++   STPRN +RL ++ P L  NI
Sbjct  3     ARSSSSMHVVMLPWLAFGHILPFTELAKRIARQGHRVTLFSTPRNTRRLIRIPPELAGNI  62

Query  1495  DLIGLPLPQVENLPEDAESTLDLPYDKVR-YLKIAFDE-LQDSMAAFLQT---LSPDWVI  1331
              ++ + LP+VE LPED+E+++DLP D +R YL++A+D    D ++A LQ      PDWV+
Sbjct  63    RVVDITLPRVERLPEDSEASIDLPSDDLRPYLRVAYDAAFADKLSAILQEPVPERPDWVV  122

Query  1330  HDFASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVID-GVDSPVEPKHTTSKPKWV  1154
              D+A++       +  +P  + S+F A+  + + P   ++  G  +  +P+  T  P +V
Sbjct  123   IDYAAYWAPAAAARHGVPCAFLSLFGAAALSFYGPPEGLMGRGKYARTKPEDLTVVPDYV  182

Query  1153  PFETTIMPRNFEMERVFNDAYI-DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLA  977
             PF TT+  R  E    F      D   VS+ YR G  ++ +  V +RS  E EPEWLQ+ 
Sbjct  183   PFPTTVAYRGLEAREFFTPVLAPDESGVSEGYRFGKCIEQSQLVGIRSSAEFEPEWLQVV  242

Query  976   EEVVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQE  797
               +  KP IPVGL P      +    K A      +WLD Q   SVVY AFGSE K    
Sbjct  243   SGLYQKPVIPVGLFPPPPPTQDIGSHKAAL-----QWLDGQAPRSVVYAAFGSEAKLTSA  297

Query  796   EVVEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILS  617
             ++  IALGLE S LPF W +R Q   A+   + LPEGFEER  GRG++C  W PQ + L+
Sbjct  298   QLQAIALGLEASGLPFLWAFR-QPTDANEGKSGLPEGFEERINGRGLVCRGWVPQARFLA  356

Query  616   HDSVGGFLTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSF  437
             H+SVGGFLTH+GW+S++E L    +L++ P + DQG+  R L EK++   + RDE DGSF
Sbjct  357   HESVGGFLTHAGWNSIIEGLARGVRLVLLPLMFDQGLNARHLTEKKISVEVPRDEEDGSF  416

Query  436   SRDSVAESLRVVMVEE  389
             +   +A +LR V+V+E
Sbjct  417   APKDIAAALRRVLVDE  432



>ref|XP_010049450.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
 gb|KCW82043.1| hypothetical protein EUGRSUZ_C03413 [Eucalyptus grandis]
Length=459

 Score =   339 bits (869),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 205/473 (43%), Positives = 271/473 (57%), Gaps = 26/473 (5%)
 Frame = -3

Query  1678  MASESS-TLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVP  1502
             M SES  +LHI M PWLA GHI P+LEL+K L+ RG+ + F+STP N+ RL + HP L P
Sbjct  1     MGSESKRSLHIAMFPWLAHGHITPFLELSKFLSLRGHAVSFLSTPNNVARLARAHPELPP  60

Query  1501  NIDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDF  1322
             +I L+ LPLP V NLP  AEST DL  D V YLK A+D L+ ++  FL     DWVIHDF
Sbjct  61    SIRLVSLPLPCVPNLPSSAESTSDLDIDSVPYLKKAYDLLEPALTRFLSGSRVDWVIHDF  120

Query  1321  ASFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFET  1142
             AS  L     +L + SV+FS F A+   +  P S +I G     +P+  T+ P W+P  +
Sbjct  121   ASHWLPGAAAQLGVGSVFFSTFNATALTLLGPPSELIGGRFQ--KPEDLTTVPAWIP--S  176

Query  1141  TIMPRNFEM---ERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEE  971
             T+  R  E+   +R  +D       VSD  R G  + G   V VRSC E E E L L +E
Sbjct  177   TVCLRLHEVLRHQRCMDD------EVSDFCRFGHVIDGCDFVIVRSCREFELEPLSLLQE  230

Query  970   VVGKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEV  791
             +  KP IP+GLL  T    EE  D    W  +K WLD + + SV+YVA G+E   + E  
Sbjct  231   LYQKPAIPIGLL--TPAIREEVGDDDEKWKALKSWLDTKREKSVLYVALGTEVILSHELT  288

Query  790   VEIALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHD  611
              E+A G+E S LPF WV R +          +P GFEER  GRG I   WAPQ +IL+H+
Sbjct  289   NELAAGIEKSGLPFVWVVRNRL---------VPAGFEERVSGRGFIWAGWAPQTRILAHE  339

Query  610   SVGGFLTHSGWSSVVEALKFEKKLIM-RPFLRDQGIITRLLVEKEMGYAIARDENDGSFS  434
             ++ GFLTH GW+S +EAL     L++      DQG++ R L EK++G+ + RDE DGSF+
Sbjct  340   AIVGFLTHCGWNSTIEALSRGLPLVLFSGGSSDQGLMARFLHEKQVGFEVPRDEADGSFT  399

Query  433   RDSVAESLRVVMVEEHGkvfaekvkkmkaklfekeKQDNYVNKLLDYLHAAST  275
              D VAES+R VMVE  G+      + MK      E Q+ Y+ +    L    T
Sbjct  400   GDVVAESIRRVMVEHEGEPIRATARAMKEVFGNMELQNKYLEEFAGILEKGFT  452



>ref|XP_009376199.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 91C1-like 
[Pyrus x bretschneideri]
Length=464

 Score =   338 bits (867),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/431 (42%), Positives = 249/431 (58%), Gaps = 29/431 (7%)
 Frame = -3

Query  1663  STLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPNIDLIG  1484
             + LH+V+ PWLA GH+IP+  L+ L+A++G+ + FVSTPRN+ RLPK+  HL   ++L+ 
Sbjct  18    AALHVVVFPWLAMGHLIPFFHLSTLIAQKGHTVSFVSTPRNLSRLPKIPSHLSSLVNLVS  77

Query  1483  LPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFASFRLV  1304
              PLP++ NLP DAES+ D+P+ K + LK AFD LQ  + AFL++  PDWVI+D+A   L 
Sbjct  78    FPLPRLPNLPNDAESSTDVPFHKQQLLKTAFDMLQTPLTAFLESSRPDWVIYDYAPHWLP  137

Query  1303  PIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETTIMPRN  1124
              I  +L +   +F    A+  A   P S +I G D   + +  T  PKWVPFE+ +  R 
Sbjct  138   AIAARLGVSHAFFCCVNAACLAYLGPPSVLISGQDGRTKAEDFTVVPKWVPFESDLAYRL  197

Query  1123  FEMERVFNDAYIDGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLA----EEVVGKP  956
              E+ +    +  +     D  R GV ++G+ AVFVRS  E EPEWL L      EV  KP
Sbjct  198   HEIAKWVQASSGNESGTHDTVRFGVAIEGSDAVFVRSSDEFEPEWLNLVRELYREVKVKP  257

Query  955   TIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVEIAL  776
              +P  L P     +EE  +    W  IK WLDKQ   SVVY+A G               
Sbjct  258   VVPXFLPPNI---EEEASEYDETWDGIKGWLDKQRVNSVVYIALG---------------  299

Query  775   GLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSVGGF  596
                    PFFWV R    S       LP GF ER +GRGV+   WAPQ++ILSHD VGG 
Sbjct  300   -------PFFWVLRNPPESTQPVSEMLPPGFVERVKGRGVVHLGWAPQVRILSHDLVGGL  352

Query  595   LTHSGWSSVVEALKFEKKLIMRPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRDSVAE  416
             LTH GW+S++E L F + L+  P + DQG+  RL   K +G  I R+E DGSF+RDSV E
Sbjct  353   LTHCGWNSMIEGLVFGRVLMFFPMVNDQGLNARLGNGKGLGVEIPRNERDGSFTRDSVVE  412

Query  415   SLRVVMVEEHG  383
              +R+ +V++ G
Sbjct  413   FVRLAVVDDSG  423



>ref|XP_010047534.1| PREDICTED: UDP-glycosyltransferase 91C1-like [Eucalyptus grandis]
Length=460

 Score =   337 bits (864),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 182/435 (42%), Positives = 262/435 (60%), Gaps = 17/435 (4%)
 Frame = -3

Query  1678  MASESSTLHIVMLPWLAFGHIIPYLELAKLLAERGNKIWFVSTPRNIQRLPKLHPHLVPN  1499
             M +E   LH+ M PWLA+GH++P+LE+A  LA++G+++ F+STP+N+Q+ P   P   P+
Sbjct  1     MDNEEKKLHVAMFPWLAYGHLMPFLEVATFLAQKGHRVSFISTPKNLQKFPADLP---PS  57

Query  1498  IDLIGLPLPQVENLPEDAESTLDLPYDKVRYLKIAFDELQDSMAAFLQTLSPDWVIHDFA  1319
             + L+ LPLP+V  LP+ AEST +LP++ V YLK A+D L+ ++A FL     DWVI DF 
Sbjct  58    MTLVELPLPRVHGLPDSAESTSELPHNMVPYLKKAYDMLEPAVAEFLANSDVDWVIQDFV  117

Query  1318  SFRLVPIMEKLSIPSVYFSIFTASINAIFFPQSAVIDGVDSPVEPKHTTSKPKWVPFETT  1139
             SF L     ++ + S +F IF A+      P S +ID        +  T  P+WV + T 
Sbjct  118   SFWLPQKARRVGVKSAFFCIFNATALVFAGPPSLLIDSQARVKTAEDLTVVPEWVTYPTK  177

Query  1138  IMPRNFEMERVFNDAYI--DGGNVSDLYRLGVTVKGASAVFVRSCYELEPEWLQLAEEVV  965
             +    + +  V N+  I     N S L RLG ++ G   V VR+C E E E L L +++ 
Sbjct  178   VA---YRLHEVINEEDIVDSDSNTSGLERLGRSILGCDIVAVRACSEFEAEPLSLLKKLH  234

Query  964   GKPTIPVGLLPTTAYddeedddkkaAWLEIKEWLDKQEKGSVVYVAFGSETKPNQEEVVE  785
               P +P+GLLP     ++   +    W E+K+WLD +++ SV YVA G+E   +QE + E
Sbjct  235   ASPVVPMGLLPPQ---NKRRHEGDGRWSELKQWLDDRKEKSVFYVALGTEVALSQESMHE  291

Query  784   IALGLELSQLPFFWVYRKQRGSADAEVTKLPEGFEERTRGRGVICTSWAPQLKILSHDSV  605
             +A G+E S LPF WV   +     A    +P GFE R  GRG +   WAPQL IL+H SV
Sbjct  292   LACGIEKSDLPFVWVVGPK-----ASPGTIPSGFESRVLGRGFVWVGWAPQLDILAHPSV  346

Query  604   GGFLTHSGWSSVVEALKFEKKLIM-RPFLRDQGIITRLLVEKEMGYAIARDENDGSFSRD  428
             GGFLTH GWSS++EAL   + LI+      DQG++ RL+ E+ +G+ + RD  DGSF+ D
Sbjct  347   GGFLTHCGWSSIIEALGHGRALILFSGGFSDQGLMARLMDERRVGWEVLRDSRDGSFTSD  406

Query  427   SVAESLRVVMVEEHG  383
             SVAE++R VMVE  G
Sbjct  407   SVAETIRRVMVEPEG  421



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6326231589360