BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25903_g9_i1 len=468 path=[16701:0-32 2373:33-46 2387:47-101
2442:102-203 2544:204-205 2546:206-235 19470:236-239 2580:240-265
2606:266-296 2637:297-412 2753:413-439 16512:440-467]

Length=468
                                                                      Score     E

ref|XP_006342275.1|  PREDICTED: uncharacterized protein LOC102591855  96.7    6e-20   
ref|XP_009614682.1|  PREDICTED: uncharacterized protein LOC104107...  94.4    4e-19   
ref|XP_009614681.1|  PREDICTED: uncharacterized protein LOC104107...  94.4    4e-19   
ref|XP_009614684.1|  PREDICTED: uncharacterized protein LOC104107...  94.0    4e-19   
ref|XP_009614683.1|  PREDICTED: uncharacterized protein LOC104107...  94.0    4e-19   
ref|XP_009763965.1|  PREDICTED: uncharacterized protein LOC104215...  94.0    4e-19   
ref|XP_009763957.1|  PREDICTED: uncharacterized protein LOC104215...  94.0    4e-19   
ref|XP_010321574.1|  PREDICTED: uncharacterized protein LOC101250...  89.0    3e-17   
ref|XP_009619909.1|  PREDICTED: uncharacterized protein LOC104111...  82.0    7e-15   
ref|XP_009619906.1|  PREDICTED: uncharacterized protein LOC104111...  82.0    7e-15   
ref|XP_009619908.1|  PREDICTED: uncharacterized protein LOC104111...  81.6    7e-15   
ref|XP_009619907.1|  PREDICTED: uncharacterized protein LOC104111...  81.6    7e-15   
ref|XP_009619904.1|  PREDICTED: uncharacterized protein LOC104111...  81.6    7e-15   
ref|XP_009629768.1|  PREDICTED: uncharacterized protein LOC104119870  81.6    7e-15   
ref|XP_009783944.1|  PREDICTED: uncharacterized protein LOC104232...  80.9    1e-14   
ref|XP_009783941.1|  PREDICTED: uncharacterized protein LOC104232...  80.9    2e-14   
ref|XP_009783942.1|  PREDICTED: uncharacterized protein LOC104232...  80.9    2e-14   
ref|XP_009783943.1|  PREDICTED: uncharacterized protein LOC104232...  80.9    2e-14   
ref|XP_011093852.1|  PREDICTED: uncharacterized protein LOC105173...  79.0    5e-14   
ref|XP_006342290.1|  PREDICTED: uncharacterized protein LOC102600311  76.3    2e-13   
ref|XP_011093848.1|  PREDICTED: uncharacterized protein LOC105173...  76.6    4e-13   
ref|XP_010694898.1|  PREDICTED: uncharacterized protein LOC104907...  74.7    2e-12   
ref|XP_010694908.1|  PREDICTED: uncharacterized protein LOC104907...  74.7    2e-12   
ref|XP_010694923.1|  PREDICTED: ankyrin repeat-containing protein...  72.4    8e-12   
emb|CDP03066.1|  unnamed protein product                              72.4    9e-12   
ref|XP_010694915.1|  PREDICTED: ankyrin repeat-containing protein...  72.0    1e-11   
ref|XP_011093853.1|  PREDICTED: alpha-latrocrustotoxin-Lt1a-like ...  72.0    1e-11   
ref|XP_011093854.1|  PREDICTED: alpha-latrocrustotoxin-Lt1a-like ...  71.6    2e-11   
emb|CDP03068.1|  unnamed protein product                              69.7    2e-11   
ref|XP_004288981.1|  PREDICTED: serine/threonine-protein phosphat...  69.3    3e-11   
ref|XP_010090147.1|  Ankyrin repeat-containing protein                70.5    4e-11   
ref|XP_010321572.1|  PREDICTED: uncharacterized protein LOC101249...  68.2    2e-10   
ref|XP_010321571.1|  PREDICTED: uncharacterized protein LOC101249...  67.4    5e-10   
ref|XP_010321570.1|  PREDICTED: uncharacterized protein LOC101249...  67.4    5e-10   
ref|XP_010276715.1|  PREDICTED: uncharacterized protein LOC104611...  66.6    9e-10   
gb|EYU25856.1|  hypothetical protein MIMGU_mgv1a004842mg              65.9    1e-09   
ref|XP_009359765.1|  PREDICTED: ankyrin repeat-containing protein...  66.2    1e-09   
ref|XP_010276714.1|  PREDICTED: uncharacterized protein LOC104611...  64.3    5e-09   
ref|XP_010276713.1|  PREDICTED: uncharacterized protein LOC104611...  63.9    6e-09   
gb|EYU45771.1|  hypothetical protein MIMGU_mgv1a020520mg              60.8    6e-09   
ref|XP_011078078.1|  PREDICTED: uncharacterized protein LOC105161921  63.9    7e-09   
gb|KEH33962.1|  ankyrin repeat protein                                60.1    1e-08   
gb|KDP43902.1|  hypothetical protein JCGZ_20912                       62.0    3e-08   
gb|KDP43899.1|  hypothetical protein JCGZ_20909                       61.6    3e-08   
emb|CAN63937.1|  hypothetical protein VITISV_038214                   59.3    4e-08   Vitis vinifera
ref|XP_010090149.1|  hypothetical protein L484_027381                 60.8    5e-08   
ref|XP_010644718.1|  PREDICTED: uncharacterized protein LOC104877...  60.1    5e-08   
ref|XP_010644720.1|  PREDICTED: uncharacterized protein LOC100248044  60.1    1e-07   
ref|XP_010644762.1|  PREDICTED: ankyrin-3-like                        56.6    2e-07   
emb|CBI25037.3|  unnamed protein product                              59.3    2e-07   
emb|CBI35219.3|  unnamed protein product                              59.3    2e-07   
ref|XP_010658756.1|  PREDICTED: uncharacterized protein LOC100254093  59.3    2e-07   
ref|XP_008245179.1|  PREDICTED: uncharacterized protein LOC103343293  59.3    2e-07   
ref|XP_007221374.1|  hypothetical protein PRUPE_ppa017822mg           58.9    3e-07   
ref|XP_007221394.1|  hypothetical protein PRUPE_ppa019130mg           57.8    4e-07   
ref|XP_011045520.1|  PREDICTED: uncharacterized protein LOC105140407  58.5    4e-07   
ref|XP_002513462.1|  ankyrin repeat-containing protein, putative      58.2    5e-07   Ricinus communis
ref|XP_010646108.1|  PREDICTED: uncharacterized protein LOC100254...  58.2    6e-07   
ref|XP_010646113.1|  PREDICTED: uncharacterized protein LOC100254...  58.2    6e-07   
ref|XP_007146563.1|  hypothetical protein PHAVU_006G051200g           57.8    7e-07   
gb|EYU45768.1|  hypothetical protein MIMGU_mgv1a024309mg              57.4    8e-07   
ref|XP_010644719.1|  PREDICTED: uncharacterized protein LOC104877...  56.2    9e-07   
ref|XP_010644712.1|  PREDICTED: uncharacterized protein LOC100265216  57.0    1e-06   
ref|XP_003533714.1|  PREDICTED: uncharacterized protein LOC100803...  55.5    1e-06   
gb|KDP43903.1|  hypothetical protein JCGZ_20913                       56.6    2e-06   
ref|XP_010644716.1|  PREDICTED: uncharacterized protein LOC104877...  55.8    2e-06   
ref|XP_010644715.1|  PREDICTED: uncharacterized protein LOC104877...  55.8    2e-06   
emb|CAN79870.1|  hypothetical protein VITISV_011483                   55.5    2e-06   Vitis vinifera
gb|EPS64453.1|  hypothetical protein M569_10326                       55.8    2e-06   
ref|XP_008245178.1|  PREDICTED: uncharacterized protein LOC103343292  54.3    5e-06   
ref|XP_007012652.1|  Ankyrin repeat-containing-like protein           54.7    6e-06   
ref|XP_008245504.1|  PREDICTED: uncharacterized protein LOC103343633  53.1    1e-05   
emb|CAN68876.1|  hypothetical protein VITISV_001418                   53.1    1e-05   Vitis vinifera
emb|CBI14824.3|  unnamed protein product                              52.8    1e-05   
ref|XP_007012653.1|  Ankyrin repeat-containing-like protein           52.4    1e-05   
ref|XP_007204827.1|  hypothetical protein PRUPE_ppa004153mg           53.5    1e-05   
ref|XP_006431545.1|  hypothetical protein CICLE_v10003295mg           53.1    2e-05   
ref|XP_010647591.1|  PREDICTED: uncharacterized protein LOC104878688  52.8    2e-05   
ref|XP_001892420.1|  hypothetical protein                             51.2    3e-05   Brugia malayi [agent of lymphatic filariasis]
ref|XP_011082647.1|  PREDICTED: uncharacterized protein LOC105165364  52.8    3e-05   
ref|XP_008231967.1|  PREDICTED: uncharacterized protein LOC103331136  52.4    3e-05   
ref|XP_007147852.1|  hypothetical protein PHAVU_006G160200g           52.4    4e-05   
ref|XP_005090287.1|  PREDICTED: microtubule-associated protein fu...  52.8    4e-05   
ref|XP_005090285.1|  PREDICTED: microtubule-associated protein fu...  52.8    4e-05   
ref|XP_005090280.1|  PREDICTED: microtubule-associated protein fu...  52.8    4e-05   
ref|XP_005090278.1|  PREDICTED: microtubule-associated protein fu...  52.8    4e-05   
ref|XP_005090276.1|  PREDICTED: microtubule-associated protein fu...  52.8    4e-05   
ref|XP_005090292.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090291.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090286.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090284.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090283.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090282.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090281.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090279.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090277.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090274.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090273.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
ref|XP_005090272.1|  PREDICTED: microtubule-associated protein fu...  52.4    4e-05   
emb|CDP00886.1|  unnamed protein product                              52.0    4e-05   
ref|XP_005090299.1|  PREDICTED: microtubule-associated protein fu...  52.4    5e-05   
ref|XP_010666171.1|  PREDICTED: uncharacterized protein LOC104883360  51.6    5e-05   
emb|CBI27188.3|  unnamed protein product                              52.0    6e-05   
ref|XP_010648914.1|  PREDICTED: uncharacterized protein LOC100260982  51.6    6e-05   
emb|CAN68568.1|  hypothetical protein VITISV_029434                   52.0    6e-05   Vitis vinifera
ref|XP_001663655.1|  ankyrin 2,3/unc44                                52.0    7e-05   Aedes aegypti
ref|XP_008317343.1|  PREDICTED: ankyrin-2-like isoform X7             52.0    7e-05   
ref|XP_008317397.1|  PREDICTED: ankyrin-3-like isoform X14            52.0    7e-05   
ref|XP_006427804.1|  hypothetical protein CICLE_v10025204mg           51.6    7e-05   
ref|XP_008317284.1|  PREDICTED: ankyrin-2-like isoform X1             52.0    7e-05   
ref|XP_008317365.1|  PREDICTED: ankyrin-2-like isoform X10            52.0    7e-05   
ref|XP_008317359.1|  PREDICTED: ankyrin-2-like isoform X9             52.0    7e-05   
ref|XP_008317350.1|  PREDICTED: ankyrin-2-like isoform X8             52.0    7e-05   
ref|XP_008317379.1|  PREDICTED: ankyrin-2-like isoform X12            51.6    7e-05   
ref|XP_008317373.1|  PREDICTED: ankyrin-2-like isoform X11            51.6    7e-05   
gb|KHN47383.1|  NF-kappa-B inhibitor cactus                           51.6    7e-05   
ref|XP_008317324.1|  PREDICTED: ankyrin-2-like isoform X6             51.6    7e-05   
ref|XP_008317404.1|  PREDICTED: ankyrin-3-like isoform X15            51.6    7e-05   
ref|XP_008317316.1|  PREDICTED: ankyrin-2-like isoform X5             51.6    7e-05   
ref|XP_008317311.1|  PREDICTED: ankyrin-2-like isoform X4             51.6    7e-05   
ref|XP_001321709.1|  hypothetical protein                             51.6    7e-05   Trichomonas vaginalis G3
ref|XP_008317292.1|  PREDICTED: ankyrin-2-like isoform X2             51.6    7e-05   
ref|XP_008317389.1|  PREDICTED: ankyrin-2-like isoform X13            51.6    7e-05   
ref|XP_008317300.1|  PREDICTED: ankyrin-2-like isoform X3             51.6    7e-05   
ref|XP_008317410.1|  PREDICTED: ankyrin-2-like isoform X16            51.6    8e-05   
ref|XP_006464617.1|  PREDICTED: uncharacterized protein LOC102609031  51.2    8e-05   
ref|XP_008317418.1|  PREDICTED: ankyrin-2-like isoform X17            51.6    8e-05   
ref|XP_003173365.1|  hypothetical protein MGYG_03539                  51.6    8e-05   
emb|CDP11119.1|  unnamed protein product                              51.2    8e-05   
ref|XP_008186879.1|  PREDICTED: ankyrin-3-like isoform X5             51.6    8e-05   
ref|XP_001896802.1|  ankyrin repeat domain protein 28                 50.8    9e-05   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003240699.1|  PREDICTED: ankyrin-3-like isoform X4             51.6    9e-05   
ref|XP_010644761.1|  PREDICTED: uncharacterized protein LOC100244544  49.3    9e-05   
ref|XP_008186871.1|  PREDICTED: ankyrin-3-like isoform X3             51.6    9e-05   
ref|XP_011078079.1|  PREDICTED: uncharacterized protein LOC105161...  51.2    9e-05   
ref|XP_008244947.1|  PREDICTED: ankyrin repeat-containing protein...  50.8    9e-05   
ref|XP_003541685.2|  PREDICTED: alpha-latroinsectotoxin-Lt1a-like     51.2    9e-05   
ref|XP_005357312.1|  PREDICTED: ankyrin-2                             51.6    9e-05   
ref|XP_008186865.1|  PREDICTED: ankyrin-3-like isoform X1             51.2    9e-05   
gb|KHN47382.1|  NF-kappa-B inhibitor cactus                           51.2    1e-04   
ref|XP_008186869.1|  PREDICTED: ankyrin-3-like isoform X2             51.2    1e-04   
ref|XP_011078080.1|  PREDICTED: uncharacterized protein LOC105161...  50.8    1e-04   
ref|XP_008333674.1|  PREDICTED: ankyrin-1-like                        51.2    1e-04   
ref|XP_010804245.1|  PREDICTED: ankyrin-2-like                        49.7    1e-04   
gb|KFW64599.1|  Ankyrin-2                                             51.2    1e-04   
ref|XP_008481818.1|  PREDICTED: ankyrin-3-like                        50.1    1e-04   
ref|XP_006630115.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin-2-like   51.2    1e-04   
gb|KDO42502.1|  hypothetical protein CISIN_1g048248mg                 50.4    1e-04   
gb|EYU23779.1|  hypothetical protein MIMGU_mgv1a023821mg              49.3    1e-04   
gb|ADD82930.1|  transient receptor potential cation channel subfa...  50.8    1e-04   Crotalus atrox
ref|XP_007651903.1|  PREDICTED: ankyrin-2 isoform X1                  50.8    1e-04   
ref|XP_008433094.1|  PREDICTED: ankyrin-2 isoform X12                 50.8    1e-04   
gb|AEW26664.1|  transient receptor potential cation channel subfa...  50.8    1e-04   
ref|XP_008235416.1|  PREDICTED: NF-kappa-B inhibitor alpha-like       50.1    1e-04   
gb|AEW26673.1|  transient receptor potential cation channel subfa...  50.8    1e-04   
gb|ERE90297.1|  ankyrin-2                                             50.8    1e-04   
gb|KFB49171.1|  hypothetical protein ZHAS_00017329                    50.8    1e-04   
ref|XP_006809580.1|  PREDICTED: ankyrin-2-like                        50.8    1e-04   
ref|XP_007540814.1|  PREDICTED: ankyrin-2-like                        50.8    1e-04   
ref|XP_008831955.1|  PREDICTED: ankyrin-2 isoform X8                  50.8    1e-04   
ref|XP_420641.4|  PREDICTED: ankyrin-2                                50.8    1e-04   Gallus gallus [bantam]
ref|XP_007621736.1|  PREDICTED: ankyrin-2 isoform X2                  50.8    1e-04   
ref|XP_008433112.1|  PREDICTED: ankyrin-2 isoform X28                 50.8    1e-04   
ref|XP_008433110.1|  PREDICTED: ankyrin-2 isoform X26                 50.8    1e-04   
ref|XP_007200210.1|  hypothetical protein PRUPE_ppa015632mg           50.4    1e-04   
gb|KHN88579.1|  E3 ubiquitin-protein ligase MIB2                      50.4    1e-04   
pdb|4RLY|A  Chain A, Crystal Structure Of Ankb Ankyrin Repeats (r...  50.1    1e-04   
ref|XP_319063.4|  AGAP009937-PA                                       50.8    1e-04   Anopheles gambiae str. PEST
ref|XP_008433111.1|  PREDICTED: ankyrin-2 isoform X27                 50.8    1e-04   
ref|XP_008433091.1|  PREDICTED: ankyrin-2 isoform X9                  50.8    1e-04   
ref|XP_006427790.1|  hypothetical protein CICLE_v10027281mg           50.1    1e-04   
ref|XP_006487671.1|  PREDICTED: ankyrin repeat and KH domain-cont...  49.7    1e-04   
ref|XP_007231144.1|  PREDICTED: ankyrin-2-like                        50.8    1e-04   
ref|XP_002934298.2|  PREDICTED: ankyrin-2                             50.8    2e-04   
ref|XP_009305120.1|  PREDICTED: ankyrin-2-like isoform X11            50.8    2e-04   
ref|XP_009305094.1|  PREDICTED: ankyrin-2-like isoform X5             50.8    2e-04   
ref|XP_010387610.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_006002281.1|  PREDICTED: ankyrin-3 isoform X11                 50.4    2e-04   
gb|ERE90299.1|  ankyrin-2                                             50.8    2e-04   
ref|XP_001304541.1|  ankyrin repeat protein                           50.4    2e-04   Trichomonas vaginalis G3
ref|XP_008286054.1|  PREDICTED: ankyrin-2-like isoform X2             50.4    2e-04   
gb|ELK07592.1|  Ankyrin-2                                             50.4    2e-04   
ref|XP_009238545.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
gb|KDO77348.1|  hypothetical protein CISIN_1g003814mg                 50.4    2e-04   
ref|XP_006448683.1|  hypothetical protein CICLE_v10014428mg           50.4    2e-04   
ref|XP_008831961.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_008831960.1|  PREDICTED: ankyrin-2 isoform X13                 50.4    2e-04   
ref|XP_008831952.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
gb|ERE90298.1|  ankyrin-2                                             50.4    2e-04   
ref|XP_006002278.1|  PREDICTED: ankyrin-3 isoform X8                  50.4    2e-04   
ref|XP_008831958.1|  PREDICTED: ankyrin-2 isoform X11                 50.4    2e-04   
ref|XP_008831957.1|  PREDICTED: ankyrin-2 isoform X10                 50.4    2e-04   
ref|XP_008831951.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_008831949.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_010736826.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_006002280.1|  PREDICTED: ankyrin-3 isoform X10                 50.4    2e-04   
ref|XP_010387609.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_006002273.1|  PREDICTED: ankyrin-3 isoform X3                  50.4    2e-04   
ref|XP_006002271.1|  PREDICTED: ankyrin-3 isoform X1                  50.4    2e-04   
ref|XP_006002272.1|  PREDICTED: ankyrin-3 isoform X2                  50.4    2e-04   
ref|XP_007997806.1|  PREDICTED: ankyrin-2 isoform X35                 50.4    2e-04   
ref|XP_009238544.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
gb|KDO77347.1|  hypothetical protein CISIN_1g003814mg                 50.4    2e-04   
ref|XP_008433109.1|  PREDICTED: ankyrin-2 isoform X25                 50.4    2e-04   
ref|XP_008433090.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_006930757.1|  PREDICTED: ankyrin-1 isoform X2                  50.4    2e-04   
ref|XP_006002277.1|  PREDICTED: ankyrin-3 isoform X7                  50.4    2e-04   
ref|XP_006002275.1|  PREDICTED: ankyrin-3 isoform X5                  50.4    2e-04   
ref|XP_003966779.1|  PREDICTED: ankyrin-2-like                        50.4    2e-04   
ref|XP_009238548.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_006002274.1|  PREDICTED: ankyrin-3 isoform X4                  50.4    2e-04   
ref|XP_010639801.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_004867679.1|  PREDICTED: ankyrin-2 isoform X22                 50.4    2e-04   
ref|XP_004896379.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_004867664.1|  PREDICTED: ankyrin-2 isoform X7                  50.4    2e-04   
ref|XP_004867663.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_004798040.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_004748090.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_007097107.1|  PREDICTED: ankyrin-1 isoform X3                  50.4    2e-04   
ref|XP_009238547.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_006002279.1|  PREDICTED: ankyrin-3 isoform X9                  50.4    2e-04   
ref|XP_007097106.1|  PREDICTED: ankyrin-1 isoform X2                  50.4    2e-04   
ref|XP_006500955.1|  PREDICTED: ankyrin-2 isoform X21                 50.4    2e-04   
ref|XP_006500939.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_007997775.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_005555811.1|  PREDICTED: ankyrin-2 isoform X35                 50.4    2e-04   
ref|XP_005555780.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_010856809.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin-2        50.4    2e-04   
ref|XP_006714250.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_008433107.1|  PREDICTED: ankyrin-2 isoform X24                 50.4    2e-04   
ref|XP_006930758.1|  PREDICTED: ankyrin-1 isoform X3                  50.4    2e-04   
ref|XP_006930756.1|  PREDICTED: ankyrin-1 isoform X1                  50.4    2e-04   
ref|XP_008831959.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
dbj|GAM22814.1|  hypothetical protein SAMD00019534_059890             50.4    2e-04   
ref|XP_008831956.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_008831950.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_006500941.1|  PREDICTED: ankyrin-2 isoform X7                  50.4    2e-04   
ref|XP_008773510.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_009205708.1|  PREDICTED: ankyrin-2 isoform X38                 50.4    2e-04   
ref|XP_006714257.1|  PREDICTED: ankyrin-2 isoform X16                 50.4    2e-04   
ref|XP_009205672.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
gb|AEW26660.1|  transient receptor potential cation channel subfa...  50.4    2e-04   
ref|XP_005082896.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_006002276.1|  PREDICTED: ankyrin-3 isoform X6                  50.4    2e-04   
ref|XP_008831953.1|  PREDICTED: ankyrin-2 isoform X7                  50.4    2e-04   
ref|XP_008831948.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_008831947.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_008759700.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin-2 is...  50.4    2e-04   
ref|XP_001362375.3|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   Monodelphis domestica
ref|XP_005310084.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_007668355.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
ref|XP_007097105.1|  PREDICTED: ankyrin-1 isoform X1                  50.4    2e-04   
ref|XP_007668347.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_010950922.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
dbj|BAE38580.1|  unnamed protein product                              50.1    2e-04   Mus musculus [mouse]
gb|KFM62264.1|  Ankyrin-2                                             50.4    2e-04   
ref|XP_009305090.1|  PREDICTED: ankyrin-2-like isoform X3             50.4    2e-04   
ref|XP_010074862.1|  PREDICTED: ankyrin-3-like                        48.5    2e-04   
gb|KGB38341.1|  Ankyrin-2                                             50.4    2e-04   
ref|XP_007236243.1|  PREDICTED: ankyrin-1-like isoform X6             50.4    2e-04   
ref|XP_009238546.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_010950942.1|  PREDICTED: ankyrin-2 isoform X23                 50.4    2e-04   
ref|XP_007895288.1|  PREDICTED: ankyrin-3 isoform X3                  50.4    2e-04   
ref|XP_005639342.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_007895305.1|  PREDICTED: ankyrin-3 isoform X7                  50.4    2e-04   
ref|XP_009663718.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_007895302.1|  PREDICTED: ankyrin-3 isoform X5                  50.4    2e-04   
ref|XP_007895295.1|  PREDICTED: ankyrin-3 isoform X4                  50.4    2e-04   
ref|XP_004658582.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_007895279.1|  PREDICTED: ankyrin-3 isoform X2                  50.4    2e-04   
ref|XP_007895270.1|  PREDICTED: ankyrin-3 isoform X1                  50.4    2e-04   
ref|XP_005555792.1|  PREDICTED: ankyrin-2 isoform X16                 50.4    2e-04   
ref|XP_008516274.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
gb|KFP42326.1|  Ankyrin-2                                             50.4    2e-04   
gb|KDO77352.1|  hypothetical protein CISIN_1g003814mg                 50.1    2e-04   
ref|XP_007997796.1|  PREDICTED: ankyrin-2 isoform X26                 50.4    2e-04   
ref|XP_006500946.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
ref|XP_007997786.1|  PREDICTED: ankyrin-2 isoform X16                 50.4    2e-04   
ref|XP_007895304.1|  PREDICTED: ankyrin-3 isoform X6                  50.4    2e-04   
ref|XP_005555802.1|  PREDICTED: ankyrin-2 isoform X26                 50.4    2e-04   
ref|XP_007997793.1|  PREDICTED: ankyrin-2 isoform X23                 50.4    2e-04   
ref|XP_007997791.1|  PREDICTED: ankyrin-2 isoform X21                 50.4    2e-04   
ref|XP_005555801.1|  PREDICTED: ankyrin-2 isoform X25                 50.4    2e-04   
ref|XP_007997788.1|  PREDICTED: ankyrin-2 isoform X18                 50.4    2e-04   
ref|XP_007997783.1|  PREDICTED: ankyrin-2 isoform X13                 50.4    2e-04   
ref|XP_007997778.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_007997777.1|  PREDICTED: ankyrin-2 isoform X7                  50.4    2e-04   
ref|XP_007997776.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_007997774.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_007997773.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_007997771.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_009205686.1|  PREDICTED: ankyrin-2 isoform X17                 50.4    2e-04   
ref|XP_008433088.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_008161435.1|  PREDICTED: ankyrin-3 isoform X3                  50.4    2e-04   
ref|XP_007236244.1|  PREDICTED: ankyrin-1-like isoform X7             50.1    2e-04   
gb|EOB01978.1|  Ankyrin-2                                             50.4    2e-04   
ref|XP_005465266.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_005151627.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_006500961.1|  PREDICTED: ankyrin-2 isoform X27                 50.4    2e-04   
ref|XP_004748104.1|  PREDICTED: ankyrin-2 isoform X19                 50.4    2e-04   
sp|Q8C8R3.2|ANK2_MOUSE  RecName: Full=Ankyrin-2; Short=ANK-2; Alt...  50.4    2e-04   
ref|XP_006500960.1|  PREDICTED: ankyrin-2 isoform X26                 50.4    2e-04   
gb|EHB10447.1|  Ankyrin-2                                             50.4    2e-04   
ref|XP_008953657.1|  PREDICTED: ankyrin-2 isoform X7                  50.4    2e-04   
prf||2003319A  ankyrin B:ISOTYPE=440kD                                50.4    2e-04
emb|CAB42644.1|  ankyrin B (440 kDa)                                  50.4    2e-04   
ref|XP_003985120.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
gb|EAX06288.1|  ankyrin 2, neuronal, isoform CRA_b                    50.4    2e-04   
ref|XP_004748103.1|  PREDICTED: ankyrin-2 isoform X18                 50.4    2e-04   
tpg|DAA28911.1|  TPA: ankyrin 2, neuronal-like                        50.4    2e-04   
ref|XP_006881143.1|  PREDICTED: ankyrin-2-like isoform X1             50.4    2e-04   
ref|XP_003798213.1|  PREDICTED: ankyrin-2 isoform 1                   50.4    2e-04   
ref|XP_007938929.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
gb|EDL12269.1|  ankyrin 2, brain, isoform CRA_b                       50.4    2e-04   
ref|XP_004040349.1|  PREDICTED: ankyrin-2 isoform 1                   50.4    2e-04   
ref|XP_003830086.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|NP_001139.3|  ankyrin-2 isoform 1                                 50.4    2e-04   
ref|XP_004896390.1|  PREDICTED: ankyrin-2 isoform X16                 50.4    2e-04   
ref|XP_004748102.1|  PREDICTED: ankyrin-2 isoform X17                 50.4    2e-04   
ref|XP_008953656.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_004896389.1|  PREDICTED: ankyrin-2 isoform X15                 50.4    2e-04   
ref|XP_004896388.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_009205700.1|  PREDICTED: ankyrin-2 isoform X30                 50.4    2e-04   
ref|XP_004896387.1|  PREDICTED: ankyrin-2 isoform X13                 50.4    2e-04   
ref|XP_006500959.1|  PREDICTED: ankyrin-2 isoform X25                 50.4    2e-04   
ref|XP_006500958.1|  PREDICTED: ankyrin-2 isoform X24                 50.4    2e-04   
ref|XP_004896386.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
ref|XP_006500956.1|  PREDICTED: ankyrin-2 isoform X22                 50.4    2e-04   
ref|XP_004896385.1|  PREDICTED: ankyrin-2 isoform X11                 50.4    2e-04   
ref|XP_010639802.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_004896384.1|  PREDICTED: ankyrin-2 isoform X10                 50.4    2e-04   
ref|XP_004896383.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_004867681.1|  PREDICTED: ankyrin-2 isoform X24                 50.4    2e-04   
ref|XP_004867680.1|  PREDICTED: ankyrin-2 isoform X23                 50.4    2e-04   
ref|XP_010639807.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_007997805.1|  PREDICTED: ankyrin-2 isoform X34                 50.4    2e-04   
ref|XP_010639800.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_009205699.1|  PREDICTED: ankyrin-2 isoform X29                 50.4    2e-04   
ref|XP_006500954.1|  PREDICTED: ankyrin-2 isoform X20                 50.4    2e-04   
ref|XP_004896382.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_006500953.1|  PREDICTED: ankyrin-2 isoform X19                 50.4    2e-04   
ref|XP_007997795.1|  PREDICTED: ankyrin-2 isoform X25                 50.4    2e-04   
ref|XP_004867678.1|  PREDICTED: ankyrin-2 isoform X21                 50.4    2e-04   
ref|XP_006500952.1|  PREDICTED: ankyrin-2 isoform X18                 50.4    2e-04   
ref|XP_007997794.1|  PREDICTED: ankyrin-2 isoform X24                 50.4    2e-04   
ref|XP_006500951.1|  PREDICTED: ankyrin-2 isoform X17                 50.4    2e-04   
ref|XP_004896381.1|  PREDICTED: ankyrin-2 isoform X7                  50.4    2e-04   
ref|XP_004867677.1|  PREDICTED: ankyrin-2 isoform X20                 50.4    2e-04   
ref|XP_004867676.1|  PREDICTED: ankyrin-2 isoform X19                 50.4    2e-04   
ref|XP_004896380.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_004406875.1|  PREDICTED: ankyrin-2 isoform 1                   50.4    2e-04   
ref|XP_006500950.1|  PREDICTED: ankyrin-2 isoform X16                 50.4    2e-04   
ref|XP_004896378.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_004896377.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_004867675.1|  PREDICTED: ankyrin-2 isoform X18                 50.4    2e-04   
ref|XP_004896376.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_008953653.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_004896375.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_007997792.1|  PREDICTED: ankyrin-2 isoform X22                 50.4    2e-04   
ref|XP_004867674.1|  PREDICTED: ankyrin-2 isoform X17                 50.4    2e-04   
ref|XP_004748101.1|  PREDICTED: ankyrin-2 isoform X16                 50.4    2e-04   
ref|XP_006500948.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_004867673.1|  PREDICTED: ankyrin-2 isoform X16                 50.4    2e-04   
ref|XP_004867672.1|  PREDICTED: ankyrin-2 isoform X15                 50.4    2e-04   
ref|XP_006500947.1|  PREDICTED: ankyrin-2 isoform X13                 50.4    2e-04   
ref|XP_004867671.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_007997790.1|  PREDICTED: ankyrin-2 isoform X20                 50.4    2e-04   
ref|XP_004867670.1|  PREDICTED: ankyrin-2 isoform X13                 50.4    2e-04   
ref|XP_009205698.1|  PREDICTED: ankyrin-2 isoform X28                 50.4    2e-04   
ref|XP_006500944.1|  PREDICTED: ankyrin-2 isoform X10                 50.4    2e-04   
ref|XP_004867669.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
ref|XP_010639799.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_006500943.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_007997787.1|  PREDICTED: ankyrin-2 isoform X17                 50.4    2e-04   
ref|XP_004867668.1|  PREDICTED: ankyrin-2 isoform X11                 50.4    2e-04   
ref|XP_007997785.1|  PREDICTED: ankyrin-2 isoform X15                 50.4    2e-04   
ref|XP_007997784.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_004798050.1|  PREDICTED: ankyrin-2 isoform X15                 50.4    2e-04   
ref|XP_004748100.1|  PREDICTED: ankyrin-2 isoform X15                 50.4    2e-04   
ref|XP_004867667.1|  PREDICTED: ankyrin-2 isoform X10                 50.4    2e-04   
ref|XP_004867666.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_006500942.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_004867665.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_006872320.1|  PREDICTED: ankyrin-2-like                        50.4    2e-04   
ref|XP_010639798.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_004867662.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_004867661.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_004867659.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_004867658.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_006500940.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_007997781.1|  PREDICTED: ankyrin-2 isoform X11                 50.4    2e-04   
ref|XP_006500938.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_005555800.1|  PREDICTED: ankyrin-2 isoform X24                 50.4    2e-04   
ref|XP_007997780.1|  PREDICTED: ankyrin-2 isoform X10                 50.4    2e-04   
ref|XP_007997779.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_006500937.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_006500936.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_004798049.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_004748099.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_006500935.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_005263002.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_007997772.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_004798046.1|  PREDICTED: ankyrin-2 isoform X11                 50.4    2e-04   
ref|XP_004798045.1|  PREDICTED: ankyrin-2 isoform X10                 50.4    2e-04   
ref|XP_004748096.1|  PREDICTED: ankyrin-2 isoform X11                 50.4    2e-04   
ref|XP_004748095.1|  PREDICTED: ankyrin-2 isoform X10                 50.4    2e-04   
ref|XP_007088246.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_008953652.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_009205707.1|  PREDICTED: ankyrin-2 isoform X37                 50.4    2e-04   
ref|XP_005555810.1|  PREDICTED: ankyrin-2 isoform X34                 50.4    2e-04   
ref|XP_001095353.2|  PREDICTED: ankyrin-2 isoform 11                  50.4    2e-04   
ref|XP_005555799.1|  PREDICTED: ankyrin-2 isoform X23                 50.4    2e-04   
ref|XP_004594606.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_009205697.1|  PREDICTED: ankyrin-2 isoform X27                 50.4    2e-04   
ref|XP_009205696.1|  PREDICTED: ankyrin-2 isoform X26                 50.4    2e-04   
ref|XP_004798042.1|  PREDICTED: ankyrin-2 isoform X7                  50.4    2e-04   
ref|XP_004748092.1|  PREDICTED: ankyrin-2 isoform X7                  50.4    2e-04   
ref|XP_004798041.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_004748091.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_004798039.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_004748089.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_005555798.1|  PREDICTED: ankyrin-2 isoform X22                 50.4    2e-04   
ref|XP_004798037.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_004748087.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_004798036.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_004748086.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_005555797.1|  PREDICTED: ankyrin-2 isoform X21                 50.4    2e-04   
ref|XP_004480940.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin-2-like   50.4    2e-04   
ref|XP_009205694.1|  PREDICTED: ankyrin-2 isoform X24                 50.4    2e-04   
ref|XP_005555796.1|  PREDICTED: ankyrin-2 isoform X20                 50.4    2e-04   
ref|XP_008266084.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin-2        50.4    2e-04   
ref|XP_010338366.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_009205693.1|  PREDICTED: ankyrin-2 isoform X23                 50.4    2e-04   
ref|XP_009205692.1|  PREDICTED: ankyrin-2 isoform X22                 50.4    2e-04   
ref|XP_008516281.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_005555795.1|  PREDICTED: ankyrin-2 isoform X19                 50.4    2e-04   
ref|XP_009205691.1|  PREDICTED: ankyrin-2 isoform X21                 50.4    2e-04   
ref|XP_005555794.1|  PREDICTED: ankyrin-2 isoform X18                 50.4    2e-04   
ref|XP_009205690.1|  PREDICTED: ankyrin-2 isoform X20                 50.4    2e-04   
ref|XP_005555793.1|  PREDICTED: ankyrin-2 isoform X17                 50.4    2e-04   
ref|XP_009205689.1|  PREDICTED: ankyrin-2 isoform X19                 50.4    2e-04   
ref|XP_005555791.1|  PREDICTED: ankyrin-2 isoform X15                 50.4    2e-04   
ref|XP_005555790.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_005555789.1|  PREDICTED: ankyrin-2 isoform X13                 50.4    2e-04   
ref|XP_005555788.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
ref|XP_005555787.1|  PREDICTED: ankyrin-2 isoform X11                 50.4    2e-04   
ref|XP_009205685.1|  PREDICTED: ankyrin-2 isoform X16                 50.4    2e-04   
ref|XP_009205684.1|  PREDICTED: ankyrin-2 isoform X15                 50.4    2e-04   
ref|XP_009205683.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_009205682.1|  PREDICTED: ankyrin-2 isoform X13                 50.4    2e-04   
ref|XP_009205681.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
ref|XP_009205680.1|  PREDICTED: ankyrin-2 isoform X11                 50.4    2e-04   
ref|XP_005555786.1|  PREDICTED: ankyrin-2 isoform X10                 50.4    2e-04   
ref|XP_005555785.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_005555784.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_009205679.1|  PREDICTED: ankyrin-2 isoform X10                 50.4    2e-04   
ref|XP_009205678.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_005555782.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_009205677.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_005555781.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_009205674.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_008953651.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_005555779.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_006917840.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin-2        50.4    2e-04   
ref|XP_009205671.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_005555778.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_005555777.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_009205669.1|  PREDICTED: ankyrin-2 isoform X1                  50.4    2e-04   
ref|XP_007236241.1|  PREDICTED: ankyrin-1-like isoform X4             50.1    2e-04   
ref|XP_007236239.1|  PREDICTED: ankyrin-1-like isoform X2             50.1    2e-04   
ref|XP_008495655.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_007154752.1|  hypothetical protein PHAVU_003G144700g           50.1    2e-04   
gb|EHH53917.1|  hypothetical protein EGM_14632                        50.4    2e-04   
gb|EHH26136.1|  hypothetical protein EGK_16033                        50.4    2e-04   
ref|XP_003269382.1|  PREDICTED: ankyrin-2 isoform 1                   50.4    2e-04   
ref|XP_007668349.1|  PREDICTED: ankyrin-2 isoform X6                  50.4    2e-04   
ref|XP_006500957.1|  PREDICTED: ankyrin-2 isoform X23                 50.4    2e-04   
ref|XP_008953655.1|  PREDICTED: ankyrin-2 isoform X4                  50.4    2e-04   
ref|XP_009087779.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_008687671.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_006500949.1|  PREDICTED: ankyrin-2 isoform X15                 50.4    2e-04   
ref|XP_005397141.1|  PREDICTED: ankyrin-2 isoform X5                  50.4    2e-04   
ref|XP_006500945.1|  PREDICTED: ankyrin-2 isoform X11                 50.4    2e-04   
ref|XP_007997789.1|  PREDICTED: ankyrin-2 isoform X19                 50.4    2e-04   
ref|XP_010950932.1|  PREDICTED: ankyrin-2 isoform X14                 50.4    2e-04   
ref|XP_004867660.1|  PREDICTED: ankyrin-2 isoform X3                  50.4    2e-04   
ref|XP_007997782.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
ref|XP_004798048.1|  PREDICTED: ankyrin-2 isoform X13                 50.4    2e-04   
ref|XP_004748098.1|  PREDICTED: ankyrin-2 isoform X13                 50.4    2e-04   
ref|XP_004798047.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
ref|XP_004748097.1|  PREDICTED: ankyrin-2 isoform X12                 50.4    2e-04   
ref|XP_006970463.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_004798044.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_004748094.1|  PREDICTED: ankyrin-2 isoform X9                  50.4    2e-04   
ref|XP_008991089.1|  PREDICTED: ankyrin-2                             50.4    2e-04   
ref|XP_004798043.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_004748093.1|  PREDICTED: ankyrin-2 isoform X8                  50.4    2e-04   
ref|XP_009205695.1|  PREDICTED: ankyrin-2 isoform X25                 50.4    2e-04   
ref|XP_005397138.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   
ref|XP_005262999.1|  PREDICTED: ankyrin-2 isoform X2                  50.4    2e-04   



>ref|XP_006342275.1| PREDICTED: uncharacterized protein LOC102591855 [Solanum tuberosum]
Length=764

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 58/131 (44%), Positives = 76/131 (58%), Gaps = 9/131 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELP-DEALLLRNRKGLAPLHLAARYGNIGVAE  248
            L TALHVA    G+    F   VEKLVA +  DE + +++  G  PLH AAR+GN+  A+
Sbjct  192  LQTALHVAVGVKGKKGKHF---VEKLVATIENDEDIAIQDSLGDTPLHYAARFGNLDAAK  248

Query  247  VLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGAT  68
            +L+ RNS L +     GL P+HYAA+    S DV+ YFL +TK     Q+ PY G SG  
Sbjct  249  ILVSRNSCLPHIACFGGLYPIHYAAEYGYVSVDVFAYFLSITK-----QSAPYIGRSGVR  303

Query  67   ILVNLIKSKFY  35
            +L  LI S  Y
Sbjct  304  LLYRLIHSDLY  314



>ref|XP_009614682.1| PREDICTED: uncharacterized protein LOC104107554 isoform X2 [Nicotiana 
tomentosiformis]
Length=711

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALH+A        + F   VE LVA + D AL +++  G  PLH AAR+GN+  A++
Sbjct  173  LQTALHIAVGAKKNDNAKF--FVENLVASMADYALAVKDSFGETPLHYAARFGNLDAAKI  230

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RNS+L +  S+ GL P+H AA+   +  D+ RYF  VTKD       PY G +G  +
Sbjct  231  LVNRNSNLAHVASKNGLYPIHVAAEYGYKHVDLVRYFFSVTKD-----LAPYTGRNGVRL  285

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  286  LYRLIWSDLY  295



>ref|XP_009614681.1| PREDICTED: uncharacterized protein LOC104107554 isoform X1 [Nicotiana 
tomentosiformis]
Length=712

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALH+A        + F   VE LVA + D AL +++  G  PLH AAR+GN+  A++
Sbjct  174  LQTALHIAVGAKKNDNAKF--FVENLVASMADYALAVKDSFGETPLHYAARFGNLDAAKI  231

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RNS+L +  S+ GL P+H AA+   +  D+ RYF  VTKD       PY G +G  +
Sbjct  232  LVNRNSNLAHVASKNGLYPIHVAAEYGYKHVDLVRYFFSVTKD-----LAPYTGRNGVRL  286

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  287  LYRLIWSDLY  296



>ref|XP_009614684.1| PREDICTED: uncharacterized protein LOC104107554 isoform X4 [Nicotiana 
tomentosiformis]
Length=677

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALH+A        + F   VE LVA + D AL +++  G  PLH AAR+GN+  A++
Sbjct  174  LQTALHIAVGAKKNDNAKF--FVENLVASMADYALAVKDSFGETPLHYAARFGNLDAAKI  231

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RNS+L +  S+ GL P+H AA+   +  D+ RYF  VTKD       PY G +G  +
Sbjct  232  LVNRNSNLAHVASKNGLYPIHVAAEYGYKHVDLVRYFFSVTKD-----LAPYTGRNGVRL  286

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  287  LYRLIWSDLY  296



>ref|XP_009614683.1| PREDICTED: uncharacterized protein LOC104107554 isoform X3 [Nicotiana 
tomentosiformis]
Length=710

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 74/130 (57%), Gaps = 7/130 (5%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALH+A        + F   VE LVA + D AL +++  G  PLH AAR+GN+  A++
Sbjct  174  LQTALHIAVGAKKNDNAKF--FVENLVASMADYALAVKDSFGETPLHYAARFGNLDAAKI  231

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RNS+L +  S+ GL P+H AA+   +  D+ RYF  VTKD       PY G +G  +
Sbjct  232  LVNRNSNLAHVASKNGLYPIHVAAEYGYKHVDLVRYFFSVTKD-----LAPYTGRNGVRL  286

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  287  LYRLIWSDLY  296



>ref|XP_009763965.1| PREDICTED: uncharacterized protein LOC104215763 isoform X2 [Nicotiana 
sylvestris]
Length=723

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 74/128 (58%), Gaps = 8/128 (6%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALH+A      +A  F   VE LVA + D+AL +++  G  PLH AAR+GN+  A++L+
Sbjct  178  TALHIAVTSKNDNAKFF---VENLVALMADDALSVKDSFGETPLHYAARFGNLDAAKILV  234

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
             RNS+L +  S+ GL P+H AA+   +S D+  YF  VT D       PY G +G  +L 
Sbjct  235  NRNSNLAHVASKNGLYPIHVAAEYGYKSVDLVHYFFSVTND-----LAPYTGRTGVRLLY  289

Query  58   NLIKSKFY  35
             LI S  Y
Sbjct  290  RLICSDLY  297



>ref|XP_009763957.1| PREDICTED: uncharacterized protein LOC104215763 isoform X1 [Nicotiana 
sylvestris]
Length=724

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 74/128 (58%), Gaps = 8/128 (6%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALH+A      +A  F   VE LVA + D+AL +++  G  PLH AAR+GN+  A++L+
Sbjct  179  TALHIAVTSKNDNAKFF---VENLVALMADDALSVKDSFGETPLHYAARFGNLDAAKILV  235

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
             RNS+L +  S+ GL P+H AA+   +S D+  YF  VT D       PY G +G  +L 
Sbjct  236  NRNSNLAHVASKNGLYPIHVAAEYGYKSVDLVHYFFSVTND-----LAPYTGRTGVRLLY  290

Query  58   NLIKSKFY  35
             LI S  Y
Sbjct  291  RLICSDLY  298



>ref|XP_010321574.1| PREDICTED: uncharacterized protein LOC101250994 isoform X1 [Solanum 
lycopersicum]
Length=766

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 75/131 (57%), Gaps = 9/131 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELP-DEALLLRNRKGLAPLHLAARYGNIGVAE  248
            L T LHVA    G+    F   VEKLVA +  DE + +++  G  PLH AAR+GN+  A+
Sbjct  190  LQTTLHVAVGIKGKKGKHF---VEKLVATIENDEDIAIQDSLGDTPLHYAARFGNLDAAK  246

Query  247  VLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGAT  68
            +L+ RNS L Y    +GL P+HYAA+    S DV+ YFL +T+     ++ PY   SG  
Sbjct  247  ILLSRNSRLPYIHCLRGLYPIHYAAEYGYISVDVFAYFLSITE-----ESIPYADLSGVR  301

Query  67   ILVNLIKSKFY  35
            +L  LI S  Y
Sbjct  302  LLNRLIHSDLY  312



>ref|XP_009619909.1| PREDICTED: uncharacterized protein LOC104111831 isoform X5 [Nicotiana 
tomentosiformis]
Length=728

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALHVA      +A  F   VEKLVA + D+ L + +  G  PLH AAR+GN+  A++
Sbjct  156  LQTALHVAVGAKNDNAKHF---VEKLVASMADDPLDMTDCLGSTPLHYAARFGNLHAAKI  212

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RN  L  N    GL P+H AA+    S DVY Y L VT        + Y G SG  +
Sbjct  213  LVARNKDLP-NIGCDGLFPIHDAAEYGYNSMDVYIYLLGVTT-----VLDSYTGSSGIRL  266

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  267  LRRLIHSDMY  276



>ref|XP_009619906.1| PREDICTED: uncharacterized protein LOC104111831 isoform X2 [Nicotiana 
tomentosiformis]
Length=751

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALHVA      +A  F   VEKLVA + D+ L + +  G  PLH AAR+GN+  A++
Sbjct  156  LQTALHVAVGAKNDNAKHF---VEKLVASMADDPLDMTDCLGSTPLHYAARFGNLHAAKI  212

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RN  L  N    GL P+H AA+    S DVY Y L VT        + Y G SG  +
Sbjct  213  LVARNKDLP-NIGCDGLFPIHDAAEYGYNSMDVYIYLLGVTT-----VLDSYTGSSGIRL  266

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  267  LRRLIHSDMY  276



>ref|XP_009619908.1| PREDICTED: uncharacterized protein LOC104111831 isoform X4 [Nicotiana 
tomentosiformis]
Length=737

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALHVA      +A  F   VEKLVA + D+ L + +  G  PLH AAR+GN+  A++
Sbjct  156  LQTALHVAVGAKNDNAKHF---VEKLVASMADDPLDMTDCLGSTPLHYAARFGNLHAAKI  212

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RN  L  N    GL P+H AA+    S DVY Y L VT        + Y G SG  +
Sbjct  213  LVARNKDLP-NIGCDGLFPIHDAAEYGYNSMDVYIYLLGVTT-----VLDSYTGSSGIRL  266

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  267  LRRLIHSDMY  276



>ref|XP_009619907.1| PREDICTED: uncharacterized protein LOC104111831 isoform X3 [Nicotiana 
tomentosiformis]
Length=744

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALHVA      +A  F   VEKLVA + D+ L + +  G  PLH AAR+GN+  A++
Sbjct  156  LQTALHVAVGAKNDNAKHF---VEKLVASMADDPLDMTDCLGSTPLHYAARFGNLHAAKI  212

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RN  L  N    GL P+H AA+    S DVY Y L VT        + Y G SG  +
Sbjct  213  LVARNKDLP-NIGCDGLFPIHDAAEYGYNSMDVYIYLLGVTT-----VLDSYTGSSGIRL  266

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  267  LRRLIHSDMY  276



>ref|XP_009619904.1| PREDICTED: uncharacterized protein LOC104111831 isoform X1 [Nicotiana 
tomentosiformis]
Length=755

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALHVA      +A  F   VEKLVA + D+ L + +  G  PLH AAR+GN+  A++
Sbjct  156  LQTALHVAVGAKNDNAKHF---VEKLVASMADDPLDMTDCLGSTPLHYAARFGNLHAAKI  212

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RN  L  N    GL P+H AA+    S DVY Y L VT        + Y G SG  +
Sbjct  213  LVARNKDLP-NIGCDGLFPIHDAAEYGYNSMDVYIYLLGVTT-----VLDSYTGSSGIRL  266

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  267  LRRLIHSDMY  276



>ref|XP_009629768.1| PREDICTED: uncharacterized protein LOC104119870 [Nicotiana tomentosiformis]
Length=591

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 70/131 (53%), Gaps = 9/131 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAEL-PDEALLLRNRKGLAPLHLAARYGNIGVAE  248
              TALHVA      +A  F   VEKLV  + PD+ L + +  G  PLH AAR+GN+  A+
Sbjct  15   FQTALHVAVGAKNDNAKHF---VEKLVDSMAPDDPLDMGDCNGDTPLHYAARFGNLDAAK  71

Query  247  VLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGAT  68
            +L+ RN +L    SE  L P+H AA+    S D+Y Y L VT        +PY G SG  
Sbjct  72   ILVGRNKNLPNIGSEGDLYPIHDAAEYGFNSVDIYAYLLGVTT-----VLDPYTGSSGIR  126

Query  67   ILVNLIKSKFY  35
            +L  LI S  Y
Sbjct  127  LLRRLIHSDMY  137



>ref|XP_009783944.1| PREDICTED: uncharacterized protein LOC104232428 isoform X4 [Nicotiana 
sylvestris]
Length=724

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALHVA      +A  F   VEKLVA + D+ L + +  G  PLH AAR+GN+  A++
Sbjct  156  LQTALHVAVGAKNDNAKHF---VEKLVASMEDDPLDMTDCLGSTPLHYAARFGNLHAAKL  212

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RN  L  N    GL P+H AA+    S DVY Y L VT        + Y G SG  +
Sbjct  213  LVARNKDLP-NIGCDGLYPIHDAAEYGYNSMDVYTYLLGVTT-----VLDSYTGTSGIRL  266

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  267  LRRLIHSDMY  276



>ref|XP_009783941.1| PREDICTED: uncharacterized protein LOC104232428 isoform X1 [Nicotiana 
sylvestris]
Length=751

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALHVA      +A  F   VEKLVA + D+ L + +  G  PLH AAR+GN+  A++
Sbjct  156  LQTALHVAVGAKNDNAKHF---VEKLVASMEDDPLDMTDCLGSTPLHYAARFGNLHAAKL  212

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RN  L  N    GL P+H AA+    S DVY Y L VT        + Y G SG  +
Sbjct  213  LVARNKDLP-NIGCDGLYPIHDAAEYGYNSMDVYTYLLGVTT-----VLDSYTGTSGIRL  266

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  267  LRRLIHSDMY  276



>ref|XP_009783942.1| PREDICTED: uncharacterized protein LOC104232428 isoform X2 [Nicotiana 
sylvestris]
Length=740

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALHVA      +A  F   VEKLVA + D+ L + +  G  PLH AAR+GN+  A++
Sbjct  156  LQTALHVAVGAKNDNAKHF---VEKLVASMEDDPLDMTDCLGSTPLHYAARFGNLHAAKL  212

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RN  L  N    GL P+H AA+    S DVY Y L VT        + Y G SG  +
Sbjct  213  LVARNKDLP-NIGCDGLYPIHDAAEYGYNSMDVYTYLLGVTT-----VLDSYTGTSGIRL  266

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  267  LRRLIHSDMY  276



>ref|XP_009783943.1| PREDICTED: uncharacterized protein LOC104232428 isoform X3 [Nicotiana 
sylvestris]
Length=733

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALHVA      +A  F   VEKLVA + D+ L + +  G  PLH AAR+GN+  A++
Sbjct  156  LQTALHVAVGAKNDNAKHF---VEKLVASMEDDPLDMTDCLGSTPLHYAARFGNLHAAKL  212

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ RN  L  N    GL P+H AA+    S DVY Y L VT        + Y G SG  +
Sbjct  213  LVARNKDLP-NIGCDGLYPIHDAAEYGYNSMDVYTYLLGVTT-----VLDSYTGTSGIRL  266

Query  64   LVNLIKSKFY  35
            L  LI S  Y
Sbjct  267  LRRLIHSDMY  276



>ref|XP_011093852.1| PREDICTED: uncharacterized protein LOC105173694 isoform X2 [Sesamum 
indicum]
Length=630

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 11/132 (8%)
 Frame = -3

Query  424  LDTALHVAAKGDGR-HASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAE  248
            L+T LH+A    GR  ASSF   VEKLV  +P +AL L+ +     LH AA+YGNI  A+
Sbjct  60   LETVLHIAV---GRSEASSF---VEKLVELMPTDALSLKTKFSETALHYAAKYGNIKAAK  113

Query  247  VLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGAT  68
             L+  +  L +  ++  LLPLH AA      +++  + L VT+D+E    N +E   G T
Sbjct  114  YLVVSDPGLPHIWNDTNLLPLHLAA--LFGHKEMVLFLLTVTRDNE--VPNAFEDQPGIT  169

Query  67   ILVNLIKSKFYG  32
            +L++++ S FYG
Sbjct  170  LLISIVHSAFYG  181



>ref|XP_006342290.1| PREDICTED: uncharacterized protein LOC102600311 [Solanum tuberosum]
Length=408

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 69/133 (52%), Gaps = 8/133 (6%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPD-EALLLRNRKGLAPLHLAARYGNIGVAE  248
            L TALH+A        +     VEKLVA + + E L  ++  G A LH AAR+GN+  AE
Sbjct  172  LQTALHLAVGVKSEKGNKH--FVEKLVASIENKEDLARKDCFGEAALHYAARFGNLDAAE  229

Query  247  VLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGAT  68
            ++++RN  L +     G  P+HYAA     S DV+ YFL VT+D       PY   SG  
Sbjct  230  IIVKRNPRLPHIACMYGTYPIHYAASYGYVSVDVFAYFLRVTED-----PAPYTNLSGVK  284

Query  67   ILVNLIKSKFYGM  29
            +L  L+ S  Y  
Sbjct  285  LLYALVSSDLYDF  297



>ref|XP_011093848.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
 ref|XP_011093849.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
 ref|XP_011093850.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
 ref|XP_011093851.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
Length=649

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 51/131 (39%), Positives = 76/131 (58%), Gaps = 11/131 (8%)
 Frame = -3

Query  424  LDTALHVAAKGDGR-HASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAE  248
            L+T LH+A    GR  ASSF   VEKLV  +P +AL L+ +     LH AA+YGNI  A+
Sbjct  60   LETVLHIAV---GRSEASSF---VEKLVELMPTDALSLKTKFSETALHYAAKYGNIKAAK  113

Query  247  VLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGAT  68
             L+  +  L +  ++  LLPLH AA      +++  + L VT+D+E    N +E   G T
Sbjct  114  YLVVSDPGLPHIWNDTNLLPLHLAA--LFGHKEMVLFLLTVTRDNE--VPNAFEDQPGIT  169

Query  67   ILVNLIKSKFY  35
            +L++++ S FY
Sbjct  170  LLISIVHSAFY  180



>ref|XP_010694898.1| PREDICTED: uncharacterized protein LOC104907637 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010694904.1| PREDICTED: uncharacterized protein LOC104907637 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 73/130 (56%), Gaps = 10/130 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A    G++       VEKLV  +  E L L ++ G   L +AA  GN   AE+L
Sbjct  75   ETALHIAV-STGKNLD----FVEKLVRRMSPEELALTDQNGETALSMAAIVGNTEAAELL  129

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            + +N  L  N + K   PLH+AAQ     + +  Y LD+T+ D D   +P+ G SG  +L
Sbjct  130  VSKNPDL-PNIASKSGFPLHWAAQ--YGQKPMLLYLLDITRKDMD--PSPFSGESGVKLL  184

Query  61   VNLIKSKFYG  32
            +++I ++FYG
Sbjct  185  ISIITAEFYG  194



>ref|XP_010694908.1| PREDICTED: uncharacterized protein LOC104907637 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=610

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 73/130 (56%), Gaps = 10/130 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A    G++       VEKLV  +  E L L ++ G   L +AA  GN   AE+L
Sbjct  46   ETALHIAV-STGKNLD----FVEKLVRRMSPEELALTDQNGETALSMAAIVGNTEAAELL  100

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            + +N  L  N + K   PLH+AAQ     + +  Y LD+T+ D D   +P+ G SG  +L
Sbjct  101  VSKNPDL-PNIASKSGFPLHWAAQYG--QKPMLLYLLDITRKDMD--PSPFSGESGVKLL  155

Query  61   VNLIKSKFYG  32
            +++I ++FYG
Sbjct  156  ISIITAEFYG  165



>ref|XP_010694923.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=586

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 76/139 (55%), Gaps = 10/139 (7%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A    G++       VEKLV  +  E L L ++ G   L +AA  GN   AE+L
Sbjct  75   ETALHIAV-STGKNLD----FVEKLVRRMSPEELALTDQNGETALSMAAIVGNTEAAELL  129

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            + +N  L  N + K   PLH+AAQ     + +  Y LD+T+ D D   +P+ G SG  +L
Sbjct  130  VSKNPDL-PNIASKSGFPLHWAAQ--YGQKPMLLYLLDITRKDMD--PSPFSGESGVKLL  184

Query  61   VNLIKSKFYGMYELSIRAV  5
            +++I ++FY +  + +  +
Sbjct  185  ISIITAEFYDLATMELNGL  203



>emb|CDP03066.1| unnamed protein product [Coffea canephora]
Length=626

 Score = 72.4 bits (176),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 49/129 (38%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A    GR+ +     V++LV  +P  AL + N+     LHLAAR GN   A++L
Sbjct  60   ETALHIAV---GRNEAY--RFVDELVRLMPPNALSVTNKFNETALHLAARCGNTEAAKLL  114

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            + R+  L Y  S+  LLPLH AA      ++   Y L VT +  D + +P+ G SG T+L
Sbjct  115  VNRDPDLPYVWSDTKLLPLHLAA--LFSHKETLIYLLTVTSN--DAEPSPFVGQSGITLL  170

Query  61   VNLIKSKFY  35
              ++ S FY
Sbjct  171  NVVVTSGFY  179



>ref|XP_010694915.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=597

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 72/129 (56%), Gaps = 10/129 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A    G++       VEKLV  +  E L L ++ G   L +AA  GN   AE+L
Sbjct  75   ETALHIAV-STGKNLD----FVEKLVRRMSPEELALTDQNGETALSMAAIVGNTEAAELL  129

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            + +N  L  N + K   PLH+AAQ     + +  Y LD+T+ D D   +P+ G SG  +L
Sbjct  130  VSKNPDL-PNIASKSGFPLHWAAQ--YGQKPMLLYLLDITRKDMD--PSPFSGESGVKLL  184

Query  61   VNLIKSKFY  35
            +++I ++FY
Sbjct  185  ISIITAEFY  193



>ref|XP_011093853.1| PREDICTED: alpha-latrocrustotoxin-Lt1a-like isoform X1 [Sesamum 
indicum]
Length=678

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/132 (38%), Positives = 78/132 (59%), Gaps = 10/132 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEAL-LLRNRKGLAPLHLAARYGNIGVAEV  245
            +TALH+A  G G+ A +F   V++L+  +P EAL  LR++ G   LH AA +GN+  A++
Sbjct  101  ETALHIAV-GTGK-AKNF---VKELLELIPTEALATLRDQAGQTALHYAAIFGNVEAAKL  155

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ ++  L    S   LLP+H AA     ++D+  Y L VT+DD D   NP+   SG  +
Sbjct  156  LVSKDPGLTNTPSNTFLLPIHLAA--LYANKDMVSYLLTVTRDDID--PNPFADKSGVDL  211

Query  64   LVNLIKSKFYGM  29
            L  +I ++FY +
Sbjct  212  LNLVILAEFYDL  223



>ref|XP_011093854.1| PREDICTED: alpha-latrocrustotoxin-Lt1a-like isoform X2 [Sesamum 
indicum]
Length=648

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 78/132 (59%), Gaps = 10/132 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEAL-LLRNRKGLAPLHLAARYGNIGVAEV  245
            +TALH+A  G G+ A +F   V++L+  +P EAL  LR++ G   LH AA +GN+  A++
Sbjct  101  ETALHIAV-GTGK-AKNF---VKELLELIPTEALATLRDQAGQTALHYAAIFGNVEAAKL  155

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ ++  L    S   LLP+H AA     ++D+  Y L VT+DD D   NP+   SG  +
Sbjct  156  LVSKDPGLTNTPSNTFLLPIHLAA--LYANKDMVSYLLTVTRDDID--PNPFADKSGVDL  211

Query  64   LVNLIKSKFYGM  29
            L  +I ++FY +
Sbjct  212  LNLVILAEFYDL  223



>emb|CDP03068.1| unnamed protein product [Coffea canephora]
Length=332

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 71/132 (54%), Gaps = 8/132 (6%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L+T LH+A         + + V E L    P+    LR++ G  PLH AA +GN+  A++
Sbjct  86   LETVLHIAVGT----VMAINFVKELLELIQPEILPSLRDQAGQTPLHYAAIFGNVEAAKL  141

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            L+ R+ ++    S  G LP+H AA     ++D   Y L VT+DD   Q NP+   SGA +
Sbjct  142  LVNRSPAMTNAPSNTGFLPIHLAA--GYANKDAVSYLLTVTRDDI--QPNPFRDESGAEL  197

Query  64   LVNLIKSKFYGM  29
            L  +I ++FY +
Sbjct  198  LNLMIIAEFYDL  209



>ref|XP_004288981.1| PREDICTED: serine/threonine-protein phosphatase 6 regulatory 
ankyrin repeat subunit B-like [Fragaria vesca subsp. vesca]
Length=321

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 8/128 (6%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALHV+A          S  VEKLV  +P + L   +  G   LH AA  GN+  A+ L+
Sbjct  111  TALHVSA------CECHSEFVEKLVKLMPADELAAHDEMGFTALHYAAIGGNLRSAKALL  164

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
            + N  L  +   KG  PLH AA    E +++  Y L VT D+E G   P+ G   A ++ 
Sbjct  165  KENPKLAQSVDIKGRTPLHLAATFASECKELVWYLLLVTTDEEPGH--PFTGSWAANLMN  222

Query  58   NLIKSKFY  35
             LI S F+
Sbjct  223  VLIASGFH  230



>ref|XP_010090147.1| Ankyrin repeat-containing protein [Morus notabilis]
 gb|EXB38944.1| Ankyrin repeat-containing protein [Morus notabilis]
Length=644

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 8/123 (7%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALHVAA G+GR        VEKL A +P EAL ++++ G   LH AA  G++  A  L+
Sbjct  101  TALHVAA-GEGRWE-----FVEKLAAIMPVEALAMQDQAGYTALHHAAIAGSMKTAVALV  154

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
            +RN SL       GL PL  AA+    S ++  Y   VT+D+E G   P+ GP    +++
Sbjct  155  KRNPSLTNVLDGSGLTPLLVAARYLYGSYEILWYLTLVTQDEEPGL--PFTGPHAMELVL  212

Query  58   NLI  50
             L+
Sbjct  213  MLV  215



>ref|XP_010321572.1| PREDICTED: uncharacterized protein LOC101249269 isoform X3 [Solanum 
lycopersicum]
Length=688

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 50/131 (38%), Positives = 64/131 (49%), Gaps = 8/131 (6%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRK-GLAPLHLAARYGNIGVAE  248
            L T LH+A     R        VEKLVA + ++  L R    G   LH AAR+GN+  AE
Sbjct  169  LQTTLHLAV--GVRSEKGNKHFVEKLVASIENKHDLARKDCFGETALHYAARFGNLDAAE  226

Query  247  VLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGAT  68
            ++I+RN  L + +      P+H AA     S DVY YFL V +D       PY   SG  
Sbjct  227  IIIKRNPRLPHISCMYDTYPIHSAASCGYVSVDVYAYFLRVMQD-----PAPYTNLSGVK  281

Query  67   ILVNLIKSKFY  35
            +L  LI S  Y
Sbjct  282  LLYALIYSNLY  292



>ref|XP_010321571.1| PREDICTED: uncharacterized protein LOC101249269 isoform X2 [Solanum 
lycopersicum]
Length=721

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 69/136 (51%), Gaps = 18/136 (13%)
 Frame = -3

Query  424  LDTALHVAA-----KGDGRHASSFSLVVEKLVAELPDEALLLR-NRKGLAPLHLAARYGN  263
            L T LH+A      KG+ +H       VEKLVA + ++  L R +  G   LH AAR+GN
Sbjct  169  LQTTLHLAVGVRSEKGN-KH------FVEKLVASIENKHDLARKDCFGETALHYAARFGN  221

Query  262  IGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEG  83
            +  AE++I+RN  L + +      P+H AA     S DVY YFL V +D       PY  
Sbjct  222  LDAAEIIIKRNPRLPHISCMYDTYPIHSAASCGYVSVDVYAYFLRVMQDPA-----PYTN  276

Query  82   PSGATILVNLIKSKFY  35
             SG  +L  LI S  Y
Sbjct  277  LSGVKLLYALIYSNLY  292



>ref|XP_010321570.1| PREDICTED: uncharacterized protein LOC101249269 isoform X1 [Solanum 
lycopersicum]
Length=737

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 69/136 (51%), Gaps = 18/136 (13%)
 Frame = -3

Query  424  LDTALHVAA-----KGDGRHASSFSLVVEKLVAELPDEALLLR-NRKGLAPLHLAARYGN  263
            L T LH+A      KG+ +H       VEKLVA + ++  L R +  G   LH AAR+GN
Sbjct  169  LQTTLHLAVGVRSEKGN-KH------FVEKLVASIENKHDLARKDCFGETALHYAARFGN  221

Query  262  IGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEG  83
            +  AE++I+RN  L + +      P+H AA     S DVY YFL V +D       PY  
Sbjct  222  LDAAEIIIKRNPRLPHISCMYDTYPIHSAASCGYVSVDVYAYFLRVMQDPA-----PYTN  276

Query  82   PSGATILVNLIKSKFY  35
             SG  +L  LI S  Y
Sbjct  277  LSGVKLLYALIYSNLY  292



>ref|XP_010276715.1| PREDICTED: uncharacterized protein LOC104611391 isoform X3 [Nelumbo 
nucifera]
Length=592

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 46/128 (36%), Positives = 70/128 (55%), Gaps = 11/128 (9%)
 Frame = -3

Query  412  LHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRR  233
            LHVAA   GR     +  V+KL+  +  E L L++      L  A R GN+ +A++L+ +
Sbjct  70   LHVAALA-GR-----TEFVKKLLDSMTAEQLGLKDDNKCTALTYAVRSGNVEIAKLLVGK  123

Query  232  NSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVNL  53
            N +L    +EKG  P+  AA   L  + +  + L VTKD++ G   P+ G  GA ILVN 
Sbjct  124  NDNLTQIQNEKGWFPILEAA--ILCQKGMLNFLLSVTKDEDGG---PFRGKKGALILVNA  178

Query  52   IKSKFYGM  29
            + + FYG+
Sbjct  179  LYADFYGV  186



>gb|EYU25856.1| hypothetical protein MIMGU_mgv1a004842mg [Erythranthe guttata]
Length=507

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 55/103 (53%), Gaps = 4/103 (4%)
 Frame = -3

Query  337  LPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQNTLE  158
            +PDE+L L +  G   LH+AAR GN   A++LI R   LLY  S  G  P H AA++   
Sbjct  2    MPDESLALTDELGFNALHVAARTGNTAAAKILIHRLEDLLYMKSNYGFFPAHEAAKSA--  59

Query  157  SEDVYRYFLDVTKDDEDGQANPYEGPSGATILVNLIKSKFYGM  29
              D     +  TKD  D + NP  G +G ++L  +I + F+ +
Sbjct  60   QRDTLLLLISHTKD--DFEPNPCAGANGVSLLNAIIDADFFDI  100



>ref|XP_009359765.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like, 
partial [Pyrus x bretschneideri]
Length=613

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 72/135 (53%), Gaps = 11/135 (8%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALHVAA  +G      S  VEKLV  +P + L +++  G  PLH AA  G++  A+ L+
Sbjct  41   TALHVAA-SEGH-----SEFVEKLVKRVPRDVLEMQDEMGFTPLHYAAIGGSLRSAKALL  94

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
              N  L       G  PL  AA    E++++  YFL VT ++E G  +P+ G   A ++ 
Sbjct  95   MENLKLAQCVDADGRTPLLLAATFASENKELVWYFLLVTTNEEPG--HPFTGHCAANLVN  152

Query  58   NLIKSKFYGMYELSI  14
             LI S   G +E+S+
Sbjct  153  MLIAS---GFHEISL  164



>ref|XP_010276714.1| PREDICTED: uncharacterized protein LOC104611391 isoform X2 [Nelumbo 
nucifera]
Length=595

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 68/126 (54%), Gaps = 11/126 (9%)
 Frame = -3

Query  412  LHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRR  233
            LHVAA   GR     +  V+KL+  +  E L L++      L  A R GN+ +A++L+ +
Sbjct  23   LHVAALA-GR-----TEFVKKLLDSMTAEQLGLKDDNKCTALTYAVRSGNVEIAKLLVGK  76

Query  232  NSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVNL  53
            N +L    +EKG  P+  AA   L  + +  + L VTKD++ G   P+ G  GA ILVN 
Sbjct  77   NDNLTQIQNEKGWFPILEAA--ILCQKGMLNFLLSVTKDEDGG---PFRGKKGALILVNA  131

Query  52   IKSKFY  35
            + + FY
Sbjct  132  LYADFY  137



>ref|XP_010276713.1| PREDICTED: uncharacterized protein LOC104611391 isoform X1 [Nelumbo 
nucifera]
Length=642

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 68/126 (54%), Gaps = 11/126 (9%)
 Frame = -3

Query  412  LHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRR  233
            LHVAA   GR     +  V+KL+  +  E L L++      L  A R GN+ +A++L+ +
Sbjct  70   LHVAALA-GR-----TEFVKKLLDSMTAEQLGLKDDNKCTALTYAVRSGNVEIAKLLVGK  123

Query  232  NSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVNL  53
            N +L    +EKG  P+  AA   L  + +  + L VTKD++ G   P+ G  GA ILVN 
Sbjct  124  NDNLTQIQNEKGWFPILEAA--ILCQKGMLNFLLSVTKDEDGG---PFRGKKGALILVNA  178

Query  52   IKSKFY  35
            + + FY
Sbjct  179  LYADFY  184



>gb|EYU45771.1| hypothetical protein MIMGU_mgv1a020520mg, partial [Erythranthe 
guttata]
Length=139

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 64/130 (49%), Gaps = 10/130 (8%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            T LHV+ K   R        VE +V+   DE   LR   G  PLH+AA  GN  VA++L 
Sbjct  1    TCLHVSIKV-SRSIGFVQQFVETIVSG--DELANLRTSYGSTPLHIAAEVGNTVVADILC  57

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
            R+   L Y        P+H AA+N  E   + R  + VT ++E     PY+   G  ++ 
Sbjct  58   RKMPRLPYIQDYNEDFPVHTAAKN--EHAAILRLLIGVTTEEE-----PYQNKGGLRLIS  110

Query  58   NLIKSKFYGM  29
            + I ++F+G+
Sbjct  111  DTIHAQFFGI  120



>ref|XP_011078078.1| PREDICTED: uncharacterized protein LOC105161921 [Sesamum indicum]
Length=763

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 76/128 (59%), Gaps = 9/128 (7%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALHVA  G G+ A  F   VEKLVA +P+E++ + +  G  PL +AA  GN+  A +++
Sbjct  203  TALHVAV-GTGK-AIHF---VEKLVAAMPEESISVMDDIGGTPLSVAAAVGNVAAATIIV  257

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
             R  + LY  ++ G  PL  AA      +D+ +Y + +TKDD D   NPY G +G  +LV
Sbjct  258  NRMPTSLYVPNDFGNFPLQIAA--LYAQKDMLKYLISITKDDCD--LNPYAGLAGLRLLV  313

Query  58   NLIKSKFY  35
             +I ++F+
Sbjct  314  YVIDAEFF  321



>gb|KEH33962.1| ankyrin repeat protein [Medicago truncatula]
Length=189

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (49%), Gaps = 9/129 (7%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALHVAA G   +      +VEKLV  +P   L   +  G   LH  A   ++   + L+
Sbjct  69   TALHVAAVGAQWN------LVEKLVEYMPANMLTELDFMGCTCLHYVAMGESVNAVKALV  122

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
             +N S+   T  KG  PL Y+  +T    ++ RY L  T D+  G   P+ GPS + ++ 
Sbjct  123  AKNPSVTQVTDFKGFTPLIYSLTST-RHRNMVRYLLMNTTDERPGC--PFSGPSASQLVA  179

Query  58   NLIKSKFYG  32
             L  S F+G
Sbjct  180  LLTASGFHG  188



>gb|KDP43902.1| hypothetical protein JCGZ_20912 [Jatropha curcas]
Length=562

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 72/131 (55%), Gaps = 10/131 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +T LHVA  G G H+ +F   ++ L+ +LP +AL ++N  G   LH AA  GN  VA +L
Sbjct  45   ETVLHVAI-GAG-HSIAF---IQYLIEKLPADALEIKNYNGSTYLHHAAICGNKEVAMLL  99

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            + +N  L   T+++  +PL  AAQ     ++   + L  TKD+     +P+ G SG  +L
Sbjct  100  VEKNPKLTQATNDENQVPLCEAAQ--YGHKETVSFLLSATKDE---HPSPFAGESGVKLL  154

Query  61   VNLIKSKFYGM  29
              LI + FY +
Sbjct  155  RYLIIADFYDI  165



>gb|KDP43899.1| hypothetical protein JCGZ_20909 [Jatropha curcas]
Length=594

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 71/131 (54%), Gaps = 10/131 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DT LHVA  G G H+ +F   ++ L+ +LP +AL ++N+ G   LH AA  GN  VA +L
Sbjct  45   DTVLHVAI-GAG-HSIAF---IQYLIEKLPADALEIKNQNGSTYLHYAAISGNKEVAMLL  99

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            + +N  L    +    +PL  AAQ     ++   + L VTKD+     +P+ G SG  ++
Sbjct  100  VEKNPKLTQARNFNNYVPLCEAAQ--YGHKETVNFLLSVTKDE---HPSPFAGESGVELV  154

Query  61   VNLIKSKFYGM  29
              LI + FY +
Sbjct  155  RYLIIADFYDI  165



>emb|CAN63937.1| hypothetical protein VITISV_038214 [Vitis vinifera]
Length=216

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 66/128 (52%), Gaps = 10/128 (8%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEKLV  +P EAL LR+  G   L  AAR GNI   ++L++
Sbjct  65   LHIAVELGEARMG-----FVEKLVEFMPSEALALRDSDGATALFNAARAGNIKAVKLLVK  119

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVN  56
             N SL    +   L+PLH A +     +++  Y L VT+D+E     P+    G+ +L  
Sbjct  120  NNPSLPNICNHGYLVPLHSALR--YGHKELTLYLLSVTRDNE--HPYPFSNSPGSELLRR  175

Query  55   LIKSKFYG  32
             +   F+G
Sbjct  176  ALMVGFHG  183



>ref|XP_010090149.1| hypothetical protein L484_027381 [Morus notabilis]
 gb|EXB38946.1| hypothetical protein L484_027381 [Morus notabilis]
Length=416

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 66/127 (52%), Gaps = 9/127 (7%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALHVAA      +   +  +EKLV  +  EA+   + +G   LH+AA  G++G A  L+
Sbjct  99   TALHVAA------SEGHTEFLEKLVGLMSTEAMAAGDMEGQTALHIAAISGSLGAAVALV  152

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
            +RN  L      KG  PL  AA+    SE V+ Y    T D+E G+  P+ GP  A ++ 
Sbjct  153  KRNPRLTGVVDHKGYTPLVLAARYASGSELVW-YLTLTTTDEEPGR--PFTGPLAADLVH  209

Query  58   NLIKSKF  38
             LI S +
Sbjct  210  MLISSGY  216



>ref|XP_010644718.1| PREDICTED: uncharacterized protein LOC104877648 isoform X3 [Vitis 
vinifera]
Length=294

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 66/134 (49%), Gaps = 11/134 (8%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEK V  +P EAL LR+  G   L  AAR GNI   ++L+ 
Sbjct  147  LHIAVELGEARMD-----FVEKFVEFMPSEALALRDSDGATTLFNAARAGNIKAVKLLVN  201

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVN  56
            RN SL          PLH A +     +++  Y L VT+DD D   +P+    G  +L  
Sbjct  202  RNPSLPNICQRHNFAPLHSAVR--YGHKELTSYLLSVTRDDVD--PSPFADKPGFELLYR  257

Query  55   LIKSKFYG-MYELS  17
             +   F+G +Y LS
Sbjct  258  ALMVGFHGELYLLS  271



>ref|XP_010644720.1| PREDICTED: uncharacterized protein LOC100248044 [Vitis vinifera]
Length=581

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 60/118 (51%), Gaps = 10/118 (8%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEKLV  +P EAL LR+  G   L  AAR GNI  A++L+ 
Sbjct  2    LHIAVELGEARMG-----FVEKLVEFVPREALALRDSDGATALFKAARAGNIKAAKLLVN  56

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            +N SL    S   L PLH A +     +++  Y   VT+DD D    P+    G  +L
Sbjct  57   KNPSLPNICSHSNLAPLHSAVRYG--HKELTLYLFSVTRDDVD--PYPFSNSPGIELL  110



>ref|XP_010644762.1| PREDICTED: ankyrin-3-like [Vitis vinifera]
Length=162

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 58/117 (50%), Gaps = 10/117 (9%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEKLV  LP EAL LR+  G+  L  AAR GNI   ++L+ 
Sbjct  46   LHIAVELGEARMG-----FVEKLVEFLPSEALALRDSDGVTALFNAARAGNIKAVKLLVN  100

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            +N SL          PLH A +     +++  Y L VT+D+E     P+    G T 
Sbjct  101  KNPSLPNICQRDNFAPLHSAVR--YGHKELTLYLLSVTRDNE--PPYPFSNSPGFTF  153



>emb|CBI25037.3| unnamed protein product [Vitis vinifera]
Length=418

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 8/103 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+A   +G+ A      VEK+V ++ ++A +++N+ G  PLHLAA  GN+ + + +
Sbjct  49   DTALHIAVL-EGKEAE-----VEKMVYQIGEDARMIKNKMGNTPLHLAASIGNVSMCKCI  102

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDD  113
              RN+ L+   ++K   PL  AA      +D +   L++ +D 
Sbjct  103  ANRNARLVGARNKKNETPLFLAALQG--KKDAFLCLLEICRDQ  143



>emb|CBI35219.3| unnamed protein product [Vitis vinifera]
Length=750

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 9/128 (7%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A +    H      VVE+LV +L  + L   N +G  PL LAA  G   +A+ +
Sbjct  190  ETALHIAVRAG--HVK----VVEELVKKLSPKDLKQENNEGRTPLALAALNGFKEIAQCM  243

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            I++N+ L     ++G+LP+  A       ++V R   + T   E G     EG +GAT+L
Sbjct  244  IKKNTELTSILDKEGILPVVRACNRG--KKEVTRLLYNYTPPKEQGPKKG-EGKNGATLL  300

Query  61   VNLIKSKF  38
            V  I +KF
Sbjct  301  VYCIATKF  308



>ref|XP_010658756.1| PREDICTED: uncharacterized protein LOC100254093 [Vitis vinifera]
 ref|XP_010658757.1| PREDICTED: uncharacterized protein LOC100254093 [Vitis vinifera]
Length=756

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 67/128 (52%), Gaps = 9/128 (7%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A +    H      VVE+LV +L  + L   N +G  PL LAA  G   +A+ +
Sbjct  190  ETALHIAVRAG--HVK----VVEELVKKLSPKDLKQENNEGRTPLALAALNGFKEIAQCM  243

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            I++N+ L     ++G+LP+  A       ++V R   + T   E G     EG +GAT+L
Sbjct  244  IKKNTELTSILDKEGILPVVRACNRG--KKEVTRLLYNYTPPKEQGPKKG-EGKNGATLL  300

Query  61   VNLIKSKF  38
            V  I +KF
Sbjct  301  VYCIATKF  308



>ref|XP_008245179.1| PREDICTED: uncharacterized protein LOC103343293 [Prunus mume]
Length=705

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 70/136 (51%), Gaps = 11/136 (8%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TAL++A + +  H      +VE+LV  + +E L + +  G   L LAA+ GNI + E ++
Sbjct  150  TALYMATELEHEH------IVEELVQLMSEEDLEITDNYGWTALALAAQRGNIKMVECMV  203

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
             ++  +L  T+ + L P+  A+ N  +  DV  Y   VT  ++     P +GP GA ++ 
Sbjct  204  GKSKKILSITTNQNLTPILLASNN--DQWDVVHYLYSVTPIED---LMPEKGPYGAALIY  258

Query  58   NLIKSKFYGMYELSIR  11
              I  + +GM    IR
Sbjct  259  YFITGRKFGMARELIR  274



>ref|XP_007221374.1| hypothetical protein PRUPE_ppa017822mg [Prunus persica]
 gb|EMJ22573.1| hypothetical protein PRUPE_ppa017822mg [Prunus persica]
Length=620

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 42/121 (35%), Positives = 66/121 (55%), Gaps = 12/121 (10%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A + +  H      +VE+LV  + +E L L++ +G   L LAA+ GNI + E +
Sbjct  148  NTALHMATELEHEH------IVEELVQLMSEEDLELKDNEGWTALALAAQRGNIKMVECM  201

Query  241  IRRNSSLL-YNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
            +R++  +L   T E    P+ +A+ N  E  DV  Y   VT   +     P +GP GAT+
Sbjct  202  VRKSKKILSIPTEEDNKTPILHASIN--EHWDVVDYLYSVTPLQD---LMPEKGPYGATL  256

Query  64   L  62
            L
Sbjct  257  L  257



>ref|XP_007221394.1| hypothetical protein PRUPE_ppa019130mg [Prunus persica]
 gb|EMJ22593.1| hypothetical protein PRUPE_ppa019130mg [Prunus persica]
Length=312

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 70/139 (50%), Gaps = 12/139 (9%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALHVA + +  H      +VE+LV  + +E L + +  G   L LAA  GN+ + E +
Sbjct  146  DTALHVATELEHEH------IVEELVQLMSEEDLEITDNNGWTALALAADTGNVKMVECM  199

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            +R++  LL   ++    P+  A+ +  E  DV  Y   VT   +     P +GP GA +L
Sbjct  200  VRKSKKLLSIPTDSDKTPILCASVS--EQWDVVHYLYSVTPLQD---LIPEKGPYGAALL  254

Query  61   VNLIKSKFYGM-YELSIRA  8
             + I    +G+ +EL  R 
Sbjct  255  HDFIIGMKFGIAWELIQRC  273



>ref|XP_011045520.1| PREDICTED: uncharacterized protein LOC105140407 [Populus euphratica]
Length=972

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 72/138 (52%), Gaps = 14/138 (10%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLR--NRKGLAPLHLAARYGNIGVAE  248
            DT LHVAA+       S S  +  LV      A LLR  NRKG  PLH+A  +GN  VA+
Sbjct  91   DTILHVAAR-----EGSVSHTIRDLVK---SNAFLLRMKNRKGNTPLHIAVIHGNKEVAK  142

Query  247  VLIRRNSSLLYNTSEKGLLPLHYAAQNTLES---EDVYRYFLDVTKDDEDGQANPYEGPS  77
             LI R+  + Y++++ G  PL+ A +N   S   +D+      +  + EDG +     P 
Sbjct  143  FLISRDPEVAYDSNKTGRSPLYLAVENRDRSGILDDLLNTEAPIPTEREDGDSLGML-PQ  201

Query  76   GATILVNLIKSKFYGMYE  23
            G +I+  ++K++  G+ +
Sbjct  202  GKSIVHAVVKNRMLGILQ  219



>ref|XP_002513462.1| ankyrin repeat-containing protein, putative [Ricinus communis]
 gb|EEF48865.1| ankyrin repeat-containing protein, putative [Ricinus communis]
Length=590

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 69/131 (53%), Gaps = 10/131 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            + AL+VA      H+  F   V+ +V  + ++ +   NR G   LH AA  GN+  A++L
Sbjct  44   EIALYVAITAG--HSIEF---VQNIVNLMSEDLIGTVNRDGNNALHAAAMVGNLEAAKIL  98

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            +++N +L    +     PLHYAA  +   ++  R+ L VT+D+     +P+    G  +L
Sbjct  99   VKKNPTLTQGRNVLNATPLHYAA--SYAHQETVRFLLPVTRDE---YPSPFTDKDGVRLL  153

Query  61   VNLIKSKFYGM  29
             +LI + FYG+
Sbjct  154  NSLITADFYGL  164



>ref|XP_010646108.1| PREDICTED: uncharacterized protein LOC100254555 isoform X1 [Vitis 
vinifera]
 ref|XP_010646110.1| PREDICTED: uncharacterized protein LOC100254555 isoform X1 [Vitis 
vinifera]
 ref|XP_010646111.1| PREDICTED: uncharacterized protein LOC100254555 isoform X1 [Vitis 
vinifera]
 ref|XP_010646112.1| PREDICTED: uncharacterized protein LOC100254555 isoform X1 [Vitis 
vinifera]
Length=774

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+A   +G+ A      VEK+V ++ ++A +++N+ G  PLHLAA  GN+ + + +
Sbjct  49   DTALHIAVL-EGKEAE-----VEKMVYQIGEDARMIKNKMGNTPLHLAASIGNVSMCKCI  102

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKD  116
              RN+ L+   ++K   PL  AA      +D +   L++ +D
Sbjct  103  ANRNARLVGARNKKNETPLFLAALQG--KKDAFLCLLEICRD  142



>ref|XP_010646113.1| PREDICTED: uncharacterized protein LOC100254555 isoform X2 [Vitis 
vinifera]
Length=773

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 59/102 (58%), Gaps = 8/102 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+A   +G+ A      VEK+V ++ ++A +++N+ G  PLHLAA  GN+ + + +
Sbjct  49   DTALHIAVL-EGKEAE-----VEKMVYQIGEDARMIKNKMGNTPLHLAASIGNVSMCKCI  102

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKD  116
              RN+ L+   ++K   PL  AA      +D +   L++ +D
Sbjct  103  ANRNARLVGARNKKNETPLFLAALQG--KKDAFLCLLEICRD  142



>ref|XP_007146563.1| hypothetical protein PHAVU_006G051200g [Phaseolus vulgaris]
 gb|ESW18557.1| hypothetical protein PHAVU_006G051200g [Phaseolus vulgaris]
Length=617

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 9/128 (7%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALHVAA G G+       +VEKLV  +P + L   +  G   LH  A   +   AE L+
Sbjct  58   TALHVAAVG-GQWP-----IVEKLVQHVPAQVLEELDLMGCTCLHYVAMGESRSAAEALV  111

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
             +N SL   T  KG  PL Y+  +    E V+ YF+  T D+  G  +P+ GPS   ++ 
Sbjct  112  AKNPSLTQLTDFKGFTPLIYSITSARCKEMVW-YFVLNTTDERPG--SPFTGPSAGQLIA  168

Query  58   NLIKSKFY  35
             L  + F+
Sbjct  169  LLTAAGFH  176



>gb|EYU45768.1| hypothetical protein MIMGU_mgv1a024309mg [Erythranthe guttata]
Length=446

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 63/130 (48%), Gaps = 10/130 (8%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            T LHV+ K   R        VE +V+   DE   LR   G  PLH+AA  GN   A+++ 
Sbjct  46   TCLHVSIKVS-RSIGFVQQFVETMVSG--DELANLRTGCGSTPLHIAAEVGNTVAADIMC  102

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
            R+   L Y        P+H AA+N  E   + R  + +T ++E     PY+   G  ++ 
Sbjct  103  RKMPRLPYIQDYNEDFPVHTAAKN--EHAAILRLLIGITTEEE-----PYQNKGGLRLIS  155

Query  58   NLIKSKFYGM  29
            + I ++F+G+
Sbjct  156  DTIHAQFFGI  165



>ref|XP_010644719.1| PREDICTED: uncharacterized protein LOC104877648 isoform X4 [Vitis 
vinifera]
Length=289

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 8/102 (8%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEKLV  +P EAL LR+  G+  L  AAR GNI   ++L+ 
Sbjct  147  LHIAVELGEARMG-----FVEKLVEFMPSEALALRDSDGVTALFNAARAGNIKAVKLLVN  201

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDE  110
            +N SL          PLH A +     +++  Y L VT+D+E
Sbjct  202  KNPSLPNICQRDNFAPLHSAVR--YGHKELTLYLLSVTRDNE  241



>ref|XP_010644712.1| PREDICTED: uncharacterized protein LOC100265216 [Vitis vinifera]
Length=659

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 58/118 (49%), Gaps = 10/118 (8%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEKLV  +P EAL LR+  G   L  AAR GNI   ++L+ 
Sbjct  88   LHIAVELGEARMG-----FVEKLVEFMPSEALALRDSDGATALFNAARAGNIKAVKLLVN  142

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            +N SL          PLH A +     +++  Y L VT+DDE     P+    G  +L
Sbjct  143  KNPSLPNICQRDNFAPLHSAVRYG--HKELTLYLLSVTRDDEP--PYPFSNSPGFELL  196



>ref|XP_003533714.1| PREDICTED: uncharacterized protein LOC100803921 isoform X1 [Glycine 
max]
Length=231

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 46/82 (56%), Gaps = 6/82 (7%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            T LHVAA+ +  H       V++LV  L DE L L++RKG     LAA  GN+ + +V+ 
Sbjct  81   TLLHVAAEANQLH------FVKELVKLLSDEDLELQDRKGNTAFCLAAASGNVRIVKVMA  134

Query  238  RRNSSLLYNTSEKGLLPLHYAA  173
            RRNS L       GL PLH AA
Sbjct  135  RRNSRLPTIRRGDGLTPLHMAA  156



>gb|KDP43903.1| hypothetical protein JCGZ_20913 [Jatropha curcas]
Length=587

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (49%), Gaps = 18/129 (14%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DT LHVA K               L+ +LP +AL ++N  G   LH AA  GN  VA +L
Sbjct  45   DTVLHVAIKA-------------YLIEKLPADALEIKNYNGSTYLHHAAICGNKEVAMLL  91

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            + +N  L   T++   +PL  AAQ     ++   + L  TKD+     +P+ G SG  ++
Sbjct  92   VEKNPKLTQATNDHNQVPLCDAAQ--YGHKETVSFLLSATKDE---YPSPFAGESGVQLV  146

Query  61   VNLIKSKFY  35
              LI + FY
Sbjct  147  RYLIIADFY  155



>ref|XP_010644716.1| PREDICTED: uncharacterized protein LOC104877648 isoform X2 [Vitis 
vinifera]
 ref|XP_010644717.1| PREDICTED: uncharacterized protein LOC104877648 isoform X2 [Vitis 
vinifera]
Length=304

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 63/129 (49%), Gaps = 10/129 (8%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEKLV  +P EAL LR+  G+  L  AAR GNI   ++L+ 
Sbjct  125  LHIAVELGEARMG-----FVEKLVEFMPSEALALRDSDGVTALFNAARAGNIKAVKLLVN  179

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVN  56
            +N SL          PLH A +     +++  Y L VT+D+E     P+    G  +L  
Sbjct  180  KNPSLPNICQRDNFAPLHSAVR--YGHKELTLYLLSVTRDNE--PPYPFSNSPGFELLRR  235

Query  55   LIKSKFYGM  29
             +   F+ +
Sbjct  236  ALMVGFHDV  244



>ref|XP_010644715.1| PREDICTED: uncharacterized protein LOC104877648 isoform X1 [Vitis 
vinifera]
Length=326

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 8/102 (8%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEKLV  +P EAL LR+  G+  L  AAR GNI   ++L+ 
Sbjct  147  LHIAVELGEARMG-----FVEKLVEFMPSEALALRDSDGVTALFNAARAGNIKAVKLLVN  201

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDE  110
            +N SL          PLH A +     +++  Y L VT+D+E
Sbjct  202  KNPSLPNICQRDNFAPLHSAVR--YGHKELTLYLLSVTRDNE  241



>emb|CAN79870.1| hypothetical protein VITISV_011483 [Vitis vinifera]
Length=289

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (53%), Gaps = 4/99 (4%)
 Frame = -3

Query  358  VEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHY  179
            VEKLV  +P E L LR+  G   L  AAR GNI  A++L+ +  SL  +     L PLH 
Sbjct  125  VEKLVEFMPSEELDLRDSDGATALTSAARAGNIKAAKLLVNKKPSLPNSCQRNNLAPLHS  184

Query  178  AAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            A +     +++  Y L VT+DD D   +P+    G  +L
Sbjct  185  AVR--YGHKELTLYLLGVTRDDVD--PSPFSKSPGFKLL  219



>gb|EPS64453.1| hypothetical protein M569_10326, partial [Genlisea aurea]
Length=555

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 61/118 (52%), Gaps = 7/118 (6%)
 Frame = -3

Query  358  VEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHY  179
            + KLVA +P EAL L +      LH  A  GN+  A +L+ +N+ L   ++  GLLP+H 
Sbjct  63   IRKLVALMPPEALALTDYFNSTALHAVAVLGNVRAARILVGKNADLPMLSNVDGLLPVHL  122

Query  178  AAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVNLIKSKFYGMYELSIRAV  5
            A         +  Y L  TK+  DG  +P++   G T++   + +   G Y+L++ AV
Sbjct  123  ATMRG--HRKMTLYLLSATKN--DGGVSPFQDAGGPTLVQFAVTA---GFYDLALYAV  173



>ref|XP_008245178.1| PREDICTED: uncharacterized protein LOC103343292 [Prunus mume]
Length=300

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 64/121 (53%), Gaps = 11/121 (9%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A   +  H      +VE+LV  + +E L L ++ G   L +AA  GN+ + E +
Sbjct  141  NTALHMATDFEHEH------IVEELVQLMSEEDLELTDKWGWTALAVAANRGNLKMVECM  194

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            +R++  +L   +++ + P+  A+ N  E  DV  Y   VT   +     P +GP GA +L
Sbjct  195  VRKSMKILCIPTKENITPIILASLN--EQWDVVHYLYSVTPLQD---LMPEKGPYGAGLL  249

Query  61   V  59
            +
Sbjct  250  L  250



>ref|XP_007012652.1| Ankyrin repeat-containing-like protein [Theobroma cacao]
 gb|EOY30271.1| Ankyrin repeat-containing-like protein [Theobroma cacao]
Length=558

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 66/127 (52%), Gaps = 9/127 (7%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALHVA  G G+ A+ F   V KLV  +  E L + N+  +  L +AA  GN   A++L+ 
Sbjct  50   ALHVAV-GTGK-ANDF---VTKLVKGMSPEDLEIANQSKVTALTIAAAIGNTDAAKLLVS  104

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVN  56
             N +L +        P+H AAQ+    ++   Y L VT+DD   Q +P+E  SG  +L  
Sbjct  105  INPNLPHIQDGDEGFPVHRAAQSG--HKETLVYLLKVTRDDV--QPSPFENNSGVWLLRQ  160

Query  55   LIKSKFY  35
            +I   FY
Sbjct  161  IIFVGFY  167



>ref|XP_008245504.1| PREDICTED: uncharacterized protein LOC103343633 [Prunus mume]
Length=313

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 70/139 (50%), Gaps = 11/139 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TAL++A + +  H      +VE+LV  + +E L + +  G   L +AA+ GNI + E +
Sbjct  147  NTALYMATELEHEH------IVEELVQLMFEEDLEITDNDGWTALAVAAQRGNIKMVECM  200

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            + ++  +L  T+ + L P+  A+    +  DV  Y   VT  ++     P +GP GA ++
Sbjct  201  VGKSKKILGITTNQNLTPILLAS--IYDQWDVVHYLYSVTPIED---LMPEKGPYGAGLI  255

Query  61   VNLIKSKFYGMYELSIRAV  5
               I  + +GM    IR  
Sbjct  256  YYFITGRKFGMARELIRCC  274



>emb|CAN68876.1| hypothetical protein VITISV_001418 [Vitis vinifera]
Length=327

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = -3

Query  358  VEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHY  179
            VEKLV  +P EAL L++  G   L  AA  GNI  A++L+ +N SL    S   L+PLH 
Sbjct  161  VEKLVEFMPSEALSLQDSDGATALFTAAMAGNIKAAKLLVDKNPSLPNICSYGNLVPLHS  220

Query  178  AAQNTLESEDVYRYFLDVTKDD  113
            A +     +++  Y L VT+DD
Sbjct  221  ALK--YGHKELTSYLLSVTRDD  240



>emb|CBI14824.3| unnamed protein product [Vitis vinifera]
Length=258

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 58/118 (49%), Gaps = 10/118 (8%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEKLV  +P EAL L++  G   L  AAR GNI   ++L+ 
Sbjct  66   LHIAVELGEARMG-----FVEKLVKFMPSEALALQDSDGATALFNAARAGNIKAVKLLVN  120

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            +N SL          PLH A +     +++  Y L VT+DD+     P+    G  +L
Sbjct  121  KNPSLPNICQRDNFAPLHSAIR--YGHKELTLYLLSVTRDDK--HPYPFSNLPGIELL  174



>ref|XP_007012653.1| Ankyrin repeat-containing-like protein [Theobroma cacao]
 gb|EOY30272.1| Ankyrin repeat-containing-like protein [Theobroma cacao]
Length=217

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 65/131 (50%), Gaps = 8/131 (6%)
 Frame = -3

Query  424  LDTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            L TALH+A  G G++       V  L+   P EAL L N      L +AA  GN+ VA +
Sbjct  60   LSTALHIAV-GTGKNID----FVRNLIDLKPVEALELTNDSNSTSLTVAAMVGNLEVARL  114

Query  244  LIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDD-EDGQANPYEGPSGAT  68
            L+ RN +L Y      ++PLH A Q     +++  + L VT+++ E    +PY   SG  
Sbjct  115  LVERNPNLPYIRDNNEVVPLHRAVQ--YGHKNLVSFLLGVTRNEIEPTYPSPYADESGLM  172

Query  67   ILVNLIKSKFY  35
            + + L+    +
Sbjct  173  LQLLLVFPSIW  183



>ref|XP_007204827.1| hypothetical protein PRUPE_ppa004153mg [Prunus persica]
 gb|EMJ06026.1| hypothetical protein PRUPE_ppa004153mg [Prunus persica]
Length=526

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 61/127 (48%), Gaps = 8/127 (6%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALHVAA          S  VEKLV  +P + L + +  G   LH AA  GN+  A+ L+
Sbjct  2    TALHVAA------CEGHSEFVEKLVKRVPADVLEMLDGIGYTALHYAAIGGNLRSAKALL  55

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
             +N  L       G   L  AA    E++++  Y L VTK ++ G   P  GP  A ++ 
Sbjct  56   GKNPKLTQRLDSAGRTALLLAATFASENKELVWYLLLVTKREKPGL--PSTGPLAANLVN  113

Query  58   NLIKSKF  38
             LI S F
Sbjct  114  VLIASGF  120



>ref|XP_006431545.1| hypothetical protein CICLE_v10003295mg, partial [Citrus clementina]
 gb|ESR44785.1| hypothetical protein CICLE_v10003295mg, partial [Citrus clementina]
Length=497

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 7/112 (6%)
 Frame = -3

Query  367  SLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLP  188
            + +V+ L + +  EAL  +NR G   LH  A  GN+   +VL++    L      +G LP
Sbjct  48   TCLVDNLASIVVPEALARQNRHGRTALHFCAAKGNLKAIKVLMKYKPDLTNVRDNEGTLP  107

Query  187  LHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVNLIKSKFYG  32
            +  AA      +D ++Y L  T        + Y G  GA +L NLI ++ YG
Sbjct  108  VQLAA--LYGHKDTFQYLLKETHG-----VDIYSGNDGALVLANLIHARLYG  152



>ref|XP_010647591.1| PREDICTED: uncharacterized protein LOC104878688 [Vitis vinifera]
Length=299

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 8/102 (8%)
 Frame = -3

Query  412  LHVAAK-GDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            LH+A + G+ R        VEKLV  +P EAL L++  G   L  AAR GNI   ++L+ 
Sbjct  152  LHIAVELGEARMG-----FVEKLVKFMPSEALALQDSDGATALFNAARAGNIKAVKLLVN  206

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDE  110
            +N SL          PLH A +     +++  Y L VT+DD+
Sbjct  207  KNPSLPNICQRDNFAPLHSAIR--YGHKELTLYLLSVTRDDK  246



>ref|XP_001892420.1| hypothetical protein [Brugia malayi]
Length=187

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/117 (30%), Positives = 61/117 (52%), Gaps = 11/117 (9%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            ++ALH  AK D R    + L + +  +E+P   ++++N + + P+HLAA YG++ + ++L
Sbjct  71   ESALHWIAKFDARKCCKYLLSLPRQYSEIP--WIVIKNNRQITPIHLAAHYGHVKILKML  128

Query  241  IRR---NSSLLYN--TSEKGLLPLHYAAQNT-LESEDVY---RYFLDVTKDDEDGQA  98
            ++    +S   Y       G  PLHYAA    LE  +V    +  L V + D +G  
Sbjct  129  LQSTVLDSENFYQMVNDNVGRSPLHYAACTARLECCEVLLDEKLGLPVDQKDRNGHT  185



>ref|XP_011082647.1| PREDICTED: uncharacterized protein LOC105165364 [Sesamum indicum]
Length=671

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 66/133 (50%), Gaps = 10/133 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+A   DG +A  F+ +V + V     EAL  +N+ G  PLHLAA  GN+ + E++
Sbjct  45   DTALHIAIS-DG-NADIFAELVLRTVIRTSPEALRFQNQLGNTPLHLAASLGNVKICELM  102

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQN-TLESEDVYRYFLDVTKDDEDGQANPY-EGPSGAT  68
               +S L+   +  G  P   AA N  +E+     Y L        G+   Y    +G T
Sbjct  103  ASTDSRLIGIRNRNGETPFFLAALNGRMEAFLCLHYLL------RSGEGYEYCRRKNGET  156

Query  67   ILVNLIKSKFYGM  29
            IL + I  +++ +
Sbjct  157  ILHSAISREYFDL  169



>ref|XP_008231967.1| PREDICTED: uncharacterized protein LOC103331136 [Prunus mume]
Length=349

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 13/133 (10%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+A + +  H      +VE+L+  + +E L + +  G   L LAA  GNI + E +
Sbjct  138  ETALHMATQLEHEH------IVEELMQVMSEEDLEITDNDGWTALALAASRGNIKMVECM  191

Query  241  IRRNSSLLY--NTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGAT  68
            +R++  +L         + PL  A+ N  E  D+  Y   VT   +     P +GP GA 
Sbjct  192  VRKSKKILSIPTRDRHNVTPLVLASMN--EQWDIVDYLYSVTPFQD---LMPEKGPYGAG  246

Query  67   ILVNLIKSKFYGM  29
            +L   I    +G+
Sbjct  247  LLRTFIMGMKFGI  259



>ref|XP_007147852.1| hypothetical protein PHAVU_006G160200g [Phaseolus vulgaris]
 gb|ESW19846.1| hypothetical protein PHAVU_006G160200g [Phaseolus vulgaris]
Length=603

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = -3

Query  316  LRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRY  137
            +RN KG   LHLAA  GN+G+   + +R+S L++  + +G  PL  AA +  +   +  +
Sbjct  1    MRNSKGNTTLHLAAEVGNVGMCYNMAKRDSKLIWGRNNEGETPLFLAALHGKKEAFLCLH  60

Query  136  FLDVTKDDEDGQANPYEGPSGATILVNLIKSKFYGM  29
             L    DDE+         +G TIL + I S+++G+
Sbjct  61   SLKQNHDDEEDSL--VRNSNGDTILHSAISSEYFGL  94



>ref|XP_005090287.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X16 [Aplysia californica]
Length=7941

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090285.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X14 [Aplysia californica]
Length=8254

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090280.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X9 [Aplysia californica]
Length=8438

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090278.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X7 [Aplysia californica]
Length=8472

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090276.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X5 [Aplysia californica]
Length=8481

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090292.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X21 [Aplysia californica]
Length=7565

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090291.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X20 [Aplysia californica]
Length=7622

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090286.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X15 [Aplysia californica]
Length=8172

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090284.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X13 [Aplysia californica]
Length=8307

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090283.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X12 [Aplysia californica]
Length=8351

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090282.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X11 [Aplysia californica]
Length=8368

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090281.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X10 [Aplysia californica]
Length=8434

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090279.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X8 [Aplysia californica]
Length=8469

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  60   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  119

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  120  IQRNADVNFR-AKNNITPLHVGSR  142



>ref|XP_005090277.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X6 [Aplysia californica]
Length=8477

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090274.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X3 [Aplysia californica]
Length=8490

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090273.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X2 [Aplysia californica]
Length=8490

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_005090272.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X1 [Aplysia californica]
Length=8491

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>emb|CDP00886.1| unnamed protein product [Coffea canephora]
Length=723

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 73/140 (52%), Gaps = 13/140 (9%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TALHVAA   GR  S F  VVE LV  L ++ L  R+  G   LH  A   ++G A+ ++
Sbjct  146  TALHVAASC-GR--SEF--VVE-LVKTLSEQQLEDRDTLGCTALHHVALAADVGAAKAMV  199

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATI  65
             +NS L        L PL+YAA+  +  + + +  Y   VT+D E     P+ G S A +
Sbjct  200  EKNSDLPNLGDPYRLTPLYYAAKWRHPSDGKKMVDYLHQVTEDKE--PCLPFTGYSSADL  257

Query  64   LVNLIKSKFYGMYELSIRAV  5
            +V +I S   G Y+ ++R +
Sbjct  258  IVAIISS---GSYDTALRTL  274



>ref|XP_005090299.1| PREDICTED: microtubule-associated protein futsch-like isoform 
X28 [Aplysia californica]
Length=7316

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN--RKGLAPLHLAARYGNIGVAEVL  242
            ALH+AAK D   +++  L  E+   EL  +  L+ +  + G  PLH+AA YGN  VA +L
Sbjct  82   ALHIAAKKDDVKSAALLLQNEQNSVELQTKGGLVNDTTKSGFTPLHIAAHYGNTNVANLL  141

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQ  170
            I+RN+ + +  ++  + PLH  ++
Sbjct  142  IQRNADVNFR-AKNNITPLHVGSR  164



>ref|XP_010666171.1| PREDICTED: uncharacterized protein LOC104883360 [Beta vulgaris 
subsp. vulgaris]
Length=399

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 63/138 (46%), Gaps = 17/138 (12%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+AA    R       +V  +V+    E L LRN  G     LAA  G + +A+V+
Sbjct  197  DTALHIAAVA--RRTDFAVQLVTLMVSNDSTENLRLRNNIGNTAFCLAAASGTVAIAKVM  254

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKD---DEDGQANPYEGPSGA  71
            +     L      +GL PLH AA   L   D+ +Y L +T D   D++            
Sbjct  255  VHVEPELPMIRGNEGLTPLHMAA--LLGHRDMVKYLLPLTHDYLSDKE----------LI  302

Query  70   TILVNLIKSKFYGMYELS  17
            T+ ++ I +  YGM+ + 
Sbjct  303  TLFISTINTDLYGMFSIC  320



>emb|CBI27188.3| unnamed protein product [Vitis vinifera]
Length=1855

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+AA    RH    +  VE+LV  +  + L L+N+ G   L  AA  G   +AEV+
Sbjct  210  ETALHIAAGA--RH----TRFVEELVKLMKPDDLALQNKVGNTALCFAAASGITRIAEVM  263

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDD  113
            + +N  L      KG+ PL+ AA   +  +D+ RY   VT++D
Sbjct  264  VNKNRELPMIRGSKGVTPLYMAA--LVGHKDMVRYLYSVTEED  304



>ref|XP_010648914.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648918.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648922.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648925.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648930.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
Length=768

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+AA    RH    +  VE+LV  +  + L L+N+ G   L  AA  G   +AEV+
Sbjct  210  ETALHIAA--GARH----TRFVEELVKLMKPDDLALQNKVGNTALCFAAASGITRIAEVM  263

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDD  113
            + +N  L      KG+ PL+ AA   +  +D+ RY   VT++D
Sbjct  264  VNKNRELPMIRGSKGVTPLYMAA--LVGHKDMVRYLYSVTEED  304



>emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera]
Length=1697

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 8/103 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+AA    RH    +  VE+LV  +  + L L+N+ G   L  AA  G   +AEV+
Sbjct  210  ETALHIAAGA--RH----TRFVEELVKLMKPDDLALQNKVGNTALCFAAASGITRIAEVM  263

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDD  113
            + +N  L      KG+ PL+ AA   +  +D+ RY   VT++D
Sbjct  264  VNKNRELPMIRGSKGVTPLYMAA--LVGHKDMVRYLYSVTEED  304



>ref|XP_001663655.1| ankyrin 2,3/unc44 [Aedes aegypti]
 gb|EAT34273.1| AAEL013466-PA [Aedes aegypti]
Length=1633

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AAK D   A++  L  E      PD    + ++ G  PLH+AA YGN+ VA++LI 
Sbjct  171  ALHIAAKKDDVKAATLLLENE----HNPD----VSSKSGFTPLHIAAHYGNVNVAQLLIE  222

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            + + + + T++  + PLH A +
Sbjct  223  KGADVNF-TAKHNITPLHVACK  243



>ref|XP_008317343.1| PREDICTED: ankyrin-2-like isoform X7 [Cynoglossus semilaevis]
Length=3474

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  194  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  245

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  246  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  278



>ref|XP_008317397.1| PREDICTED: ankyrin-3-like isoform X14 [Cynoglossus semilaevis]
Length=2661

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_006427804.1| hypothetical protein CICLE_v10025204mg [Citrus clementina]
 gb|ESR41044.1| hypothetical protein CICLE_v10025204mg [Citrus clementina]
Length=603

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 65/124 (52%), Gaps = 11/124 (9%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+A    GR       VV +LV  + ++ L ++N+ G   L+ AA  G   +AE L
Sbjct  83   DTALHIAVLA-GRVK-----VVGELVKRIDEKDLAIKNKNGATALNFAATGGVTKIAEYL  136

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            +R+N  LL   ++ G +P+  A+      +D+ RY    T  +E    +P +G +GA +L
Sbjct  137  VRKNRELLTIPNQHGNIPVVIAS--LYGHDDMVRYLYRETPIEE---LDPDKGTNGAMLL  191

Query  61   VNLI  50
             + I
Sbjct  192  TSCI  195



>ref|XP_008317284.1| PREDICTED: ankyrin-2-like isoform X1 [Cynoglossus semilaevis]
Length=3494

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_008317365.1| PREDICTED: ankyrin-2-like isoform X10 [Cynoglossus semilaevis]
Length=3454

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_008317359.1| PREDICTED: ankyrin-2-like isoform X9 [Cynoglossus semilaevis]
Length=3461

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_008317350.1| PREDICTED: ankyrin-2-like isoform X8 [Cynoglossus semilaevis]
Length=3463

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_008317379.1| PREDICTED: ankyrin-2-like isoform X12 [Cynoglossus semilaevis]
Length=3392

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_008317373.1| PREDICTED: ankyrin-2-like isoform X11 [Cynoglossus semilaevis]
Length=3448

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>gb|KHN47383.1| NF-kappa-B inhibitor cactus [Glycine soja]
Length=577

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 6/83 (7%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+A   DG++      VV +LV  +P+EAL ++N +    LHLAA  G++G+ E +
Sbjct  52   DTALHIAVI-DGQYD-----VVRQLVRLIPEEALRIQNERKNTALHLAASMGSVGMCECI  105

Query  241  IRRNSSLLYNTSEKGLLPLHYAA  173
                 SLL   +  G  PL  AA
Sbjct  106  ASSEPSLLNMRNLDGETPLFLAA  128



>ref|XP_008317324.1| PREDICTED: ankyrin-2-like isoform X6 [Cynoglossus semilaevis]
 ref|XP_008317335.1| PREDICTED: ankyrin-2-like isoform X6 [Cynoglossus semilaevis]
Length=3476

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  196  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  247

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  248  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  280



>ref|XP_008317404.1| PREDICTED: ankyrin-3-like isoform X15 [Cynoglossus semilaevis]
Length=2652

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 57/96 (59%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++    + ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRG--NTNMVRLLLD  298



>ref|XP_008317316.1| PREDICTED: ankyrin-2-like isoform X5 [Cynoglossus semilaevis]
Length=3480

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_008317311.1| PREDICTED: ankyrin-2-like isoform X4 [Cynoglossus semilaevis]
Length=3481

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_001321709.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAY09486.1| hypothetical protein TVAG_102350 [Trichomonas vaginalis G3]
Length=691

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 30/94 (32%), Positives = 51/94 (54%), Gaps = 9/94 (10%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYF  134
            ++  G++PLH A R GN+ V E+L+++N   + +T   GL PLHYA  N+  +++V +  
Sbjct  561  KDDNGMSPLHHACRSGNVAVTELLVQKNDVDVNDTDNNGLTPLHYAV-NSNNAKNVCKVL  619

Query  133  LDVTKDDEDGQANPYEGPSGAT--ILVNLIKSKF  38
             D       G+ NP     G    I++++ K  F
Sbjct  620  FD------SGRLNPNLASKGNERPIMISVRKCDF  647



>ref|XP_008317292.1| PREDICTED: ankyrin-2-like isoform X2 [Cynoglossus semilaevis]
Length=3490

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_008317389.1| PREDICTED: ankyrin-2-like isoform X13 [Cynoglossus semilaevis]
Length=3348

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_008317300.1| PREDICTED: ankyrin-2-like isoform X3 [Cynoglossus semilaevis]
Length=3485

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 58/98 (59%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++  NT    ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRGNT----NMVRLLLD  298



>ref|XP_008317410.1| PREDICTED: ankyrin-2-like isoform X16 [Cynoglossus semilaevis]
Length=1996

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 57/96 (59%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++    + ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRG--NTNMVRLLLD  298



>ref|XP_006464617.1| PREDICTED: uncharacterized protein LOC102609031 [Citrus sinensis]
Length=653

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 65/124 (52%), Gaps = 11/124 (9%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+A    GR       VV +LV  + ++ L ++N+ G   L+ AA  G   +AE L
Sbjct  83   DTALHIAVLA-GRVK-----VVGELVKRIDEKDLAIKNKNGATALNFAATGGVTKIAEYL  136

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            +R+N  LL   ++ G +P+  A+      +D+ RY    T  +E    +P +G +GA +L
Sbjct  137  VRKNRELLTIPNQHGNIPVVIAS--LYGHDDMVRYLYRETPIEE---LDPDKGTNGAMLL  191

Query  61   VNLI  50
             + I
Sbjct  192  TSCI  195



>ref|XP_008317418.1| PREDICTED: ankyrin-2-like isoform X17 [Cynoglossus semilaevis]
Length=1987

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 57/96 (59%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  214  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLS  265

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G++PLH A++    + ++ R  LD
Sbjct  266  RGAAVDF-TARNGIIPLHVASKRG--NTNMVRLLLD  298



>ref|XP_003173365.1| hypothetical protein MGYG_03539 [Microsporum gypseum CBS 118893]
 gb|EFR00535.1| hypothetical protein MGYG_03539 [Microsporum gypseum CBS 118893]
Length=1176

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 6/84 (7%)
 Frame = -3

Query  421  DTALHVAA-KGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEV  245
            +T LH+AA +G         +V+ ++ A +  E     NRKGL PLHLAA  G+ GV + 
Sbjct  626  NTPLHLAAEQGHEDVVQKLLMVITEMKASIKWE-----NRKGLTPLHLAAYVGHEGVVKS  680

Query  244  LIRRNSSLLYNTSEKGLLPLHYAA  173
            LI   + +   TS  G  PLH+AA
Sbjct  681  LITAGADIEATTSTFGWTPLHFAA  704



>emb|CDP11119.1| unnamed protein product [Coffea canephora]
Length=452

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 66/143 (46%), Gaps = 18/143 (13%)
 Frame = -3

Query  421  DTALHVAAK---GDGRHASSFSLVVEKLVAELPD----EALLLRNRKGLAPLHLAARYGN  263
            DTALH+A      D   A+  + VV  LV  LP     E L ++N KG  PLHLAA  G+
Sbjct  49   DTALHIAVSSFHADQIDANGQAKVVSDLVESLPPDQAVEILKVQNDKGDTPLHLAAALGS  108

Query  262  IGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQN-----TLESEDVYRYFLDVTKDDEDGQA  98
              +   + R++  L+   + KG  PL  AA +      L+   +YR      K  E+   
Sbjct  109  ATICSCIARKDHVLISERNLKGETPLFMAAHHGKMEAFLQLHKLYR------KSAEEPDD  162

Query  97   NPYEGPSGATILVNLIKSKFYGM  29
              Y    G TIL + I  +++ +
Sbjct  163  RLYRRNDGDTILHSAISGEYFAL  185



>ref|XP_008186879.1| PREDICTED: ankyrin-3-like isoform X5 [Acyrthosiphon pisum]
Length=1688

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AAK D   A+S  L  +      PD    + ++ G  PLH+AA YGN  VA +L++
Sbjct  200  ALHIAAKKDDTKATSLLLQND----HNPD----VTSKSGFTPLHIAAHYGNNNVASMLVQ  251

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R + + + T++  + PLH AA+
Sbjct  252  RGADVNF-TAKHNITPLHVAAK  272



>ref|XP_001896802.1| ankyrin repeat domain protein 28 [Brugia malayi]
Length=313

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (53%), Gaps = 11/116 (9%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            ++ALH  AK D R    + L + +  +E+P   ++++N + + P+HLAA YG++ + ++L
Sbjct  71   ESALHWIAKFDARKCCKYLLSLPRQYSEIP--WIVIKNNRQITPIHLAAHYGHVKILKML  128

Query  241  IRR---NSSLLYN--TSEKGLLPLHYAAQNT-LESEDVY---RYFLDVTKDDEDGQ  101
            ++    +S   Y       G  PLHYAA    LE  +V    +  L V + D +G 
Sbjct  129  LQSTVLDSENFYQMVNDNVGRSPLHYAACTARLECCEVLLDEKLGLPVDQKDRNGH  184



>ref|XP_003240699.1| PREDICTED: ankyrin-3-like isoform X4 [Acyrthosiphon pisum]
Length=1691

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AAK D   A+S  L  +      PD    + ++ G  PLH+AA YGN  VA +L++
Sbjct  200  ALHIAAKKDDTKATSLLLQND----HNPD----VTSKSGFTPLHIAAHYGNNNVASMLVQ  251

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R + + + T++  + PLH AA+
Sbjct  252  RGADVNF-TAKHNITPLHVAAK  272



>ref|XP_010644761.1| PREDICTED: uncharacterized protein LOC100244544 [Vitis vinifera]
Length=170

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (54%), Gaps = 4/99 (4%)
 Frame = -3

Query  358  VEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHY  179
            VE+LV  +P + L L++  G   L  A R  NI   ++L+ ++ SLL   ++  L+PLH 
Sbjct  4    VEQLVDFMPIDKLALKDSDGATALFNAVRADNIKAVKLLVNKSPSLLNTCNQGNLVPLHS  63

Query  178  AAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATIL  62
            A +     +++  Y L VT+DD D   +P+    G  +L
Sbjct  64   ALR--YGHKELTLYLLSVTRDDVD--PSPFADKPGVILL  98



>ref|XP_008186871.1| PREDICTED: ankyrin-3-like isoform X3 [Acyrthosiphon pisum]
Length=1697

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AAK D   A+S  L  +      PD    + ++ G  PLH+AA YGN  VA +L++
Sbjct  200  ALHIAAKKDDTKATSLLLQND----HNPD----VTSKSGFTPLHIAAHYGNNNVASMLVQ  251

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R + + + T++  + PLH AA+
Sbjct  252  RGADVNF-TAKHNITPLHVAAK  272



>ref|XP_011078079.1| PREDICTED: uncharacterized protein LOC105161922 isoform X1 [Sesamum 
indicum]
Length=667

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 57/110 (52%), Gaps = 4/110 (4%)
 Frame = -3

Query  358  VEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHY  179
            + KL+  +  EAL L +  G   LH  A  GNI  A + + +N +LL   +  G LP+H 
Sbjct  122  IRKLLHFMQPEALALTDYFGNTALHAVAVLGNIQAARLFVEQNRNLLNIWNIDGCLPIHL  181

Query  178  AAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVNLIKSKFYGM  29
            AA       ++  Y   VT++D++ +  P+   +GAT++   + S FY +
Sbjct  182  AAMRG--HREMTLYLFSVTREDKNLE--PFNEAAGATLVHFALTSGFYDL  227



>ref|XP_008244947.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=498

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 41/134 (31%), Positives = 68/134 (51%), Gaps = 13/134 (10%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            TAL +A   +  H      +VE+LV  + +E L L +  G   L +AA  GN+ + E ++
Sbjct  64   TALRMAIDLEHEH------IVEELVQLMSEEDLELTDNWGWTALAVAANRGNLKMVECMV  117

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILV  59
            R++  +L +   + + P+  A+ N  E  DV  Y   VT   +     P +GP G+T+L 
Sbjct  118  RKSKKIL-SIPIRNMTPIILASMN--EQWDVVHYLYSVTPLQD---LRPEKGPYGSTLLT  171

Query  58   N-LIKSKFYGMYEL  20
            + +I  KF   +EL
Sbjct  172  SFIIGMKFGSAWEL  185



>ref|XP_003541685.2| PREDICTED: alpha-latroinsectotoxin-Lt1a-like [Glycine max]
Length=737

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 6/83 (7%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+A   DG++      VV +LV  +P+EAL ++N +    LHLAA  G++G+ E +
Sbjct  52   DTALHIAVI-DGQYD-----VVRQLVRLIPEEALRIQNERKNTALHLAASMGSVGMCECI  105

Query  241  IRRNSSLLYNTSEKGLLPLHYAA  173
                 SLL   +  G  PL  AA
Sbjct  106  ASSEPSLLNMRNLDGETPLFLAA  128



>ref|XP_005357312.1| PREDICTED: ankyrin-2 [Microtus ochrogaster]
Length=4070

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 29/83 (35%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +S+ + T+  G+ PLH A++
Sbjct  269  NRGASVDF-TARNGITPLHVASK  290



>ref|XP_008186865.1| PREDICTED: ankyrin-3-like isoform X1 [Acyrthosiphon pisum]
Length=1721

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AAK D   A+S  L  +      PD    + ++ G  PLH+AA YGN  VA +L++
Sbjct  200  ALHIAAKKDDTKATSLLLQND----HNPD----VTSKSGFTPLHIAAHYGNNNVASMLVQ  251

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R + + + T++  + PLH AA+
Sbjct  252  RGADVNF-TAKHNITPLHVAAK  272



>gb|KHN47382.1| NF-kappa-B inhibitor cactus [Glycine soja]
Length=713

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 6/83 (7%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+A   DG++      VV +LV  +P+EAL ++N +    LHLAA  G++G+ E +
Sbjct  28   DTALHIAVI-DGQYD-----VVRQLVRLIPEEALRIQNERKNTALHLAASMGSVGMCECI  81

Query  241  IRRNSSLLYNTSEKGLLPLHYAA  173
                 SLL   +  G  PL  AA
Sbjct  82   ASSEPSLLNMRNLDGETPLFLAA  104



>ref|XP_008186869.1| PREDICTED: ankyrin-3-like isoform X2 [Acyrthosiphon pisum]
Length=1715

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AAK D   A+S  L  +      PD    + ++ G  PLH+AA YGN  VA +L++
Sbjct  200  ALHIAAKKDDTKATSLLLQND----HNPD----VTSKSGFTPLHIAAHYGNNNVASMLVQ  251

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R + + + T++  + PLH AA+
Sbjct  252  RGADVNF-TAKHNITPLHVAAK  272



>ref|XP_011078080.1| PREDICTED: uncharacterized protein LOC105161922 isoform X2 [Sesamum 
indicum]
 ref|XP_011078081.1| PREDICTED: uncharacterized protein LOC105161922 isoform X2 [Sesamum 
indicum]
Length=626

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 57/110 (52%), Gaps = 4/110 (4%)
 Frame = -3

Query  358  VEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHY  179
            + KL+  +  EAL L +  G   LH  A  GNI  A + + +N +LL   +  G LP+H 
Sbjct  81   IRKLLHFMQPEALALTDYFGNTALHAVAVLGNIQAARLFVEQNRNLLNIWNIDGCLPIHL  140

Query  178  AAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVNLIKSKFYGM  29
            AA       ++  Y   VT++D++ +  P+   +GAT++   + S FY +
Sbjct  141  AAMRG--HREMTLYLFSVTREDKNLE--PFNEAAGATLVHFALTSGFYDL  186



>ref|XP_008333674.1| PREDICTED: ankyrin-1-like [Cynoglossus semilaevis]
Length=1619

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D    ++       L+   P+  +L  ++ G  PLH+AA YGN+ VA++L+ 
Sbjct  180  ALHIAARNDDTRTAAV------LLQNDPNPGVL--SKTGFTPLHIAAHYGNLNVAQLLLN  231

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T + G+ PLH A++
Sbjct  232  RGANVNF-TPKNGITPLHIASR  252



>ref|XP_010804245.1| PREDICTED: ankyrin-2-like [Bos taurus]
Length=206

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 52/83 (63%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRK-GLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R  + G  PLH+AA YGN+ VA +L+
Sbjct  69   ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  127

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  128  NRGAAVDF-TARNGITPLHVASK  149



>gb|KFW64599.1| Ankyrin-2, partial [Pygoscelis adeliae]
Length=1372

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  66   ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  117

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  118  RGAAVDF-TARNGITPLHVASK  138



>ref|XP_008481818.1| PREDICTED: ankyrin-3-like, partial [Diaphorina citri]
Length=261

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 55/96 (57%), Gaps = 9/96 (9%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            T LHVA K  G+ A     +VE L+++  +  +  + R GL PLH AAR G+  V ++LI
Sbjct  173  TPLHVACKW-GKVA-----MVELLISKGAN--IEAKTRDGLTPLHCAARSGHDNVIDILI  224

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFL  131
             + ++ LY+ ++ GL PLH A+Q   +  +  R  L
Sbjct  225  EKGAA-LYSKTKNGLAPLHMASQGDHDHNNSTRCTL  259


 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AAK D   A++  L++E       D +  +++     PLH+AA YGN  +AE+LI+
Sbjct  108  ALHIAAKKDDCKAAA--LLLEN------DHSPDVKSNSHFTPLHIAAHYGNTNIAELLIQ  159

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            ++++ + N ++  + PLH A +
Sbjct  160  KHAN-VNNQAKHNITPLHVACK  180



>ref|XP_006630115.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin-2-like [Lepisosteus oculatus]
Length=3979

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 56/96 (58%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  211  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  262

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  263  RGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  295



>gb|KDO42502.1| hypothetical protein CISIN_1g048248mg, partial [Citrus sinensis]
Length=316

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 72/146 (49%), Gaps = 23/146 (16%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+AA+          ++V +++    D  + + N K   P+H+AAR GN G A++ 
Sbjct  39   DTALHIAAR------FGHEILVMEILKHQSD-LVSVPNHKSETPMHVAARAGNFGAAQIF  91

Query  241  IRRNSS---------LLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQAN--  95
            +R + +         +L    E+G  PLH    N +   D    F  + KD E  + N  
Sbjct  92   MRPHGNGNNTGTFDDILRKRDEEGNTPLH----NAVRKCDGKMAFTMIKKDPEPIRYNNK  147

Query  94   PYEGPSGATILVN-LIKSKFYGMYEL  20
              +GP+  T+L + +IKS+F  M ++
Sbjct  148  AKQGPNNLTLLHSAIIKSQFVVMAKI  173



>gb|EYU23779.1| hypothetical protein MIMGU_mgv1a023821mg, partial [Erythranthe 
guttata]
Length=191

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (57%), Gaps = 9/97 (9%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DT LH+AA G GR  +  +L +E+L   +P    +L NR GL P+ LA + G+      +
Sbjct  37   DTPLHLAA-GQGR--TQLALEIERL---MPSFGRML-NRDGLTPVDLALQQGHRETVRAM  89

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFL  131
            ++ +  L+     +G+ PLHYAA+  ++  D+ + FL
Sbjct  90   VKLDPELVRVQGREGITPLHYAAE--MDDADLLKDFL  124



>gb|ADD82930.1| transient receptor potential cation channel subfamily A member 
1 [Crotalus atrox]
Length=1111

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = -3

Query  352  KLVAELPDEALLLR-NRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYA  176
            +L+  + D  LL   +RKG+ PLHLAA+YG+  V ++L+++ +  L+N+  KG  PLH+A
Sbjct  470  RLLESMDDTRLLNEGDRKGMTPLHLAAQYGHEKVTQLLLKKGA--LFNSDYKGWTPLHHA  527

Query  175  A  173
            A
Sbjct  528  A  528



>ref|XP_007651903.1| PREDICTED: ankyrin-2 isoform X1, partial [Cricetulus griseus]
Length=3927

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  133  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  184

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  185  RGAAVDF-TARNGITPLHVASK  205



>ref|XP_008433094.1| PREDICTED: ankyrin-2 isoform X12 [Poecilia reticulata]
Length=3511

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 57/98 (58%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  210  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  261

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G+ PLH A++  NT    ++ R  LD
Sbjct  262  RGAAVDF-TARNGITPLHVASKRGNT----NMVRLLLD  294



>gb|AEW26664.1| transient receptor potential cation channel subfamily A member 
1 [Trimeresurus stejnegeri]
Length=1043

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = -3

Query  352  KLVAELPDEALLLR-NRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYA  176
            +L+  + D  LL   +RKG+ PLHLAA+YG+  V ++L+++ +  L+N+  KG  PLH+A
Sbjct  413  RLLESMEDTRLLNEGDRKGMTPLHLAAQYGHEKVTQLLLKKGA--LFNSDYKGWTPLHHA  470

Query  175  A  173
            A
Sbjct  471  A  471



>ref|XP_008235416.1| PREDICTED: NF-kappa-B inhibitor alpha-like [Prunus mume]
Length=278

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 45/83 (54%), Gaps = 6/83 (7%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALHVA   +          VE+LV  +  + L +RN +G  PLH+AA  GN+ + E +
Sbjct  50   DTALHVAVSDNQEEH------VEELVKLVSTDELQIRNEQGNTPLHIAATMGNVRMCECI  103

Query  241  IRRNSSLLYNTSEKGLLPLHYAA  173
             + +  L+Y  +++   PL  AA
Sbjct  104  AKHHPLLVYAFNKENETPLFLAA  126



>gb|AEW26673.1| transient receptor potential cation channel subfamily A member 
1 [Ovophis monticola]
Length=1043

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = -3

Query  352  KLVAELPDEALLLR-NRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYA  176
            +L+  + D  LL   +RKG+ PLHLAA+YG+  V ++L+++ +  L+N+  KG  PLH+A
Sbjct  413  RLLESMEDTRLLNEGDRKGMTPLHLAAQYGHEKVTQLLLKKGA--LFNSDYKGWTPLHHA  470

Query  175  A  173
            A
Sbjct  471  A  471



>gb|ERE90297.1| ankyrin-2 [Cricetulus griseus]
Length=4086

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  344  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  395

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  396  RGAAVDF-TARNGITPLHVASK  416



>gb|KFB49171.1| hypothetical protein ZHAS_00017329 [Anopheles sinensis]
Length=2185

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AAK D   A+   L  E      PD    + ++ G  PLH+AA YGN+ VA++LI 
Sbjct  184  ALHIAAKKDDVKAAKLLLENE----HNPD----VSSKSGFTPLHIAAHYGNVNVAQLLIE  235

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            + + + + T++  + PLH A +
Sbjct  236  KGADVNF-TAKHNITPLHVACK  256



>ref|XP_006809580.1| PREDICTED: ankyrin-2-like, partial [Neolamprologus brichardi]
Length=3111

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 57/98 (58%), Gaps = 15/98 (15%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  151  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  202

Query  235  RNSSLLYNTSEKGLLPLHYAAQ--NTLESEDVYRYFLD  128
            R +++ + T+  G+ PLH A++  NT    ++ R  LD
Sbjct  203  RGAAVDF-TARNGITPLHVASKRGNT----NMVRLLLD  235



>ref|XP_007540814.1| PREDICTED: ankyrin-2-like [Poecilia formosa]
Length=3271

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 56/96 (58%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  218  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  269

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  270  RGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  302



>ref|XP_008831955.1| PREDICTED: ankyrin-2 isoform X8 [Nannospalax galili]
Length=3985

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  210  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  261

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  262  RGAAVDF-TARNGITPLHVASK  282


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  302  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  348



>ref|XP_420641.4| PREDICTED: ankyrin-2 [Gallus gallus]
Length=4067

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  276  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  327

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  328  RGAAVDF-TARNGITPLHVASK  348



>ref|XP_007621736.1| PREDICTED: ankyrin-2 isoform X2 [Cricetulus griseus]
Length=3928

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  174  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  225

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  226  RGAAVDF-TARNGITPLHVASK  246



>ref|XP_008433112.1| PREDICTED: ankyrin-2 isoform X28 [Poecilia reticulata]
Length=3473

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 56/96 (58%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  218  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  269

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  270  RGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  302



>ref|XP_008433110.1| PREDICTED: ankyrin-2 isoform X26 [Poecilia reticulata]
Length=3486

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 56/96 (58%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  218  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  269

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  270  RGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  302



>ref|XP_007200210.1| hypothetical protein PRUPE_ppa015632mg [Prunus persica]
 gb|EMJ01409.1| hypothetical protein PRUPE_ppa015632mg [Prunus persica]
Length=724

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 6/83 (7%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALHVA   DG+        VE+LV  +    L +RN +G  PLH+AA  GN+ + E +
Sbjct  50   DTALHVAVS-DGQEEH-----VEELVKLVSTNELQIRNERGNTPLHIAAAMGNVRMCECI  103

Query  241  IRRNSSLLYNTSEKGLLPLHYAA  173
             + +  L+Y  +++   PL  AA
Sbjct  104  AKHHPLLVYAFNKENETPLFLAA  126



>gb|KHN88579.1| E3 ubiquitin-protein ligase MIB2 [Toxocara canis]
Length=591

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            +TALH+ AK +     + S ++ +L++ +  E L++ NR GL PL +A   G   V E +
Sbjct  430  NTALHILAKME--EVPTRSAMIHRLLSNVKVEQLIV-NRDGLTPLQVAVVAGQAKVVESV  486

Query  241  IRRNSSLLYNTSEKGLLPLHYAA  173
            IR   SLL +   + +LPLH AA
Sbjct  487  IRMRPSLLVSEGCEAMLPLHLAA  509



>pdb|4RLY|A Chain A, Crystal Structure Of Ankb Ankyrin Repeats (r1-r9) In 
Complex With Nav1.2 Ankyrin Binding Domain
Length=329

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 52/83 (63%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRK-GLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R  + G  PLH+AA YGN+ VA +L+
Sbjct  197  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  255

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  256  NRGAAVDF-TARNGITPLHVASK  277



>ref|XP_319063.4| AGAP009937-PA [Anopheles gambiae str. PEST]
 gb|EAA14062.4| AGAP009937-PA [Anopheles gambiae str. PEST]
Length=1520

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AAK D   A+   L  E      PD    + ++ G  PLH+AA YGN+ VA++LI 
Sbjct  169  ALHIAAKKDDVKAAKLLLENE----HNPD----VSSKSGFTPLHIAAHYGNVNVAQLLIE  220

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            + + + + T++  + PLH A +
Sbjct  221  KGADVNF-TAKHNITPLHVACK  241



>ref|XP_008433111.1| PREDICTED: ankyrin-2 isoform X27 [Poecilia reticulata]
Length=3478

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 56/96 (58%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  210  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  261

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  262  RGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  294



>ref|XP_008433091.1| PREDICTED: ankyrin-2 isoform X9 [Poecilia reticulata]
Length=3519

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 56/96 (58%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  218  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  269

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  270  RGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  302



>ref|XP_006427790.1| hypothetical protein CICLE_v10027281mg, partial [Citrus clementina]
 gb|ESR41030.1| hypothetical protein CICLE_v10027281mg, partial [Citrus clementina]
Length=367

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 72/146 (49%), Gaps = 23/146 (16%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+AA+          ++V +++    D  + + N K   P+H+AAR GN G A++ 
Sbjct  3    DTALHIAAR------FGHEILVMEILKHQSD-LVSVPNHKSETPMHVAARAGNFGAAQIF  55

Query  241  IRRNSS---------LLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDEDGQAN--  95
            +R + +         +L    E+G  PLH    N +   D    F  + KD E  + N  
Sbjct  56   MRPHGNGNNTGTFDDILRKRDEEGNTPLH----NAVRKCDGKMAFTMIKKDPEPIRYNNK  111

Query  94   PYEGPSGATILVN-LIKSKFYGMYEL  20
              +GP+  T+L + +IKS+F  M ++
Sbjct  112  AKQGPNNLTLLHSAIIKSQFVVMAKI  137



>ref|XP_006487671.1| PREDICTED: ankyrin repeat and KH domain-containing protein mask-like 
[Citrus sinensis]
Length=219

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 56/114 (49%), Gaps = 7/114 (6%)
 Frame = -3

Query  367  SLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLP  188
            + +++KL +++  + L   +  G   L+  A  GN+   +VL++ N  L    S+   LP
Sbjct  112  TCLLDKLASKVDQQTLARLDEHGHTALYQCAGKGNLRALKVLVKYNPDLTTIRSKGDHLP  171

Query  187  LHYAAQNTLESEDVYRYFLDVTKDDEDGQANPYEGPSGATILVNLIKSKFYGMY  26
            +H AA      +D +RY L+VT        + Y G  GA +L  LI +  YG Y
Sbjct  172  VHNAAYKG--HKDTFRYLLEVTH-----GVDIYSGNDGARVLSYLIDANLYGQY  218



>ref|XP_007231144.1| PREDICTED: ankyrin-2-like [Astyanax mexicanus]
Length=4144

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/97 (32%), Positives = 57/97 (59%), Gaps = 5/97 (5%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  212  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  270

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
             R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  271  NRGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  304



>ref|XP_002934298.2| PREDICTED: ankyrin-2 [Xenopus (Silurana) tropicalis]
Length=4583

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290



>ref|XP_009305120.1| PREDICTED: ankyrin-2-like isoform X11 [Danio rerio]
Length=4703

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  209  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  260

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  261  RGAAVDF-TARNGITPLHVASK  281



>ref|XP_009305094.1| PREDICTED: ankyrin-2-like isoform X5 [Danio rerio]
Length=4748

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  209  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  260

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  261  RGAAVDF-TARNGITPLHVASK  281



>ref|XP_010387610.1| PREDICTED: ankyrin-2 isoform X2 [Rhinopithecus roxellana]
Length=1967

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  206  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  257

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  258  RGAAVDF-TARNGITPLHVASK  278



>ref|XP_006002281.1| PREDICTED: ankyrin-3 isoform X11 [Latimeria chalumnae]
Length=2015

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>gb|ERE90299.1| ankyrin-2 [Cricetulus griseus]
Length=4152

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  344  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  402

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  403  NRGAAVDF-TARNGITPLHVASK  424



>ref|XP_001304541.1| ankyrin repeat protein [Trichomonas vaginalis G3]
 gb|EAX91611.1| ankyrin repeat protein, putative [Trichomonas vaginalis G3]
Length=506

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 46/84 (55%), Gaps = 9/84 (11%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLI  239
            T LH AAK + +  +      E L++   D  +  ++R GL PLH AA+Y N  +AE+LI
Sbjct  318  TPLHSAAKNNSKETA------EILISNGAD--INAKDRIGLTPLHYAAKYNNKEIAEILI  369

Query  238  RRNSSLLYNTSEKGLLPLHYAAQN  167
              N + +    E G  PLHYAA N
Sbjct  370  -SNGADINAKDEDGSTPLHYAAMN  392



>ref|XP_008286054.1| PREDICTED: ankyrin-2-like isoform X2 [Stegastes partitus]
Length=1908

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 56/96 (58%), Gaps = 11/96 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  196  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  247

Query  235  RNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
            R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  248  RGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  280



>gb|ELK07592.1| Ankyrin-2 [Pteropus alecto]
Length=3595

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  128  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  179

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  180  RGAAVDF-TARNGITPLHVASK  200



>ref|XP_009238545.1| PREDICTED: ankyrin-2 isoform X2 [Pongo abelii]
Length=1892

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  195  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  246

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  247  RGAAVDF-TARNGITPLHVASK  267



>gb|KDO77348.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
 gb|KDO77349.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
 gb|KDO77350.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
 gb|KDO77351.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
Length=715

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 55/104 (53%), Gaps = 8/104 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+AA G  R     +L V++LV  +  E L LRN+ G   L  AA  G   +AEV+
Sbjct  199  DTALHIAA-GARR-----TLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVM  252

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDE  110
            + +N  L      KG  PL  AA   L  +++  Y   VTK+++
Sbjct  253  VNKNRELPSIRGNKGATPLCMAA--LLGHKEMIWYLYSVTKEED  294



>ref|XP_006448683.1| hypothetical protein CICLE_v10014428mg [Citrus clementina]
 gb|ESR61923.1| hypothetical protein CICLE_v10014428mg [Citrus clementina]
Length=715

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 55/104 (53%), Gaps = 8/104 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+AA G  R     +L V++LV  +  E L LRN+ G   L  AA  G   +AEV+
Sbjct  199  DTALHIAA-GARR-----TLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVM  252

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDE  110
            + +N  L      KG  PL  AA   L  +++  Y   VTK+++
Sbjct  253  VNKNRELPSIRGNKGATPLCMAA--LLGHKEMIWYLYSVTKEED  294



>ref|XP_008831961.1| PREDICTED: ankyrin-2 isoform X14 [Nannospalax galili]
Length=3922

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  310  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  356



>ref|XP_008831960.1| PREDICTED: ankyrin-2 isoform X13 [Nannospalax galili]
Length=3947

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  195  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  253

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  254  NRGAAVDF-TARNGITPLHVASK  275


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  295  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  341



>ref|XP_008831952.1| PREDICTED: ankyrin-2 isoform X6 [Nannospalax galili]
Length=4002

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  174  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  232

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  233  NRGAAVDF-TARNGITPLHVASK  254


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  274  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  320



>gb|ERE90298.1| ankyrin-2 [Cricetulus griseus]
Length=4221

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  344  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  402

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  403  NRGAAVDF-TARNGITPLHVASK  424



>ref|XP_006002278.1| PREDICTED: ankyrin-3 isoform X8 [Latimeria chalumnae]
Length=2069

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_008831958.1| PREDICTED: ankyrin-2 isoform X11 [Nannospalax galili]
Length=3977

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  310  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  356



>ref|XP_008831957.1| PREDICTED: ankyrin-2 isoform X10 [Nannospalax galili]
Length=3980

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  195  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  253

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  254  NRGAAVDF-TARNGITPLHVASK  275


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  295  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  341



>ref|XP_008831951.1| PREDICTED: ankyrin-2 isoform X5 [Nannospalax galili]
Length=4005

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  310  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  356



>ref|XP_008831949.1| PREDICTED: ankyrin-2 isoform X3 [Nannospalax galili]
Length=4023

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  195  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  253

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  254  NRGAAVDF-TARNGITPLHVASK  275


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  295  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  341



>ref|XP_010736826.1| PREDICTED: ankyrin-2 [Larimichthys crocea]
Length=3473

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  198  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  249

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  250  RGAAVDF-TARNGITPLHVASK  270



>ref|XP_006002280.1| PREDICTED: ankyrin-3 isoform X10 [Latimeria chalumnae]
Length=2036

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_010387609.1| PREDICTED: ankyrin-2 isoform X1 [Rhinopithecus roxellana]
Length=2050

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  206  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  257

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  258  RGAAVDF-TARNGITPLHVASK  278



>ref|XP_006002273.1| PREDICTED: ankyrin-3 isoform X3 [Latimeria chalumnae]
Length=2090

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_006002271.1| PREDICTED: ankyrin-3 isoform X1 [Latimeria chalumnae]
Length=2102

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_006002272.1| PREDICTED: ankyrin-3 isoform X2 [Latimeria chalumnae]
Length=2091

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_007997806.1| PREDICTED: ankyrin-2 isoform X35 [Chlorocebus sabaeus]
Length=4021

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  227  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  278

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  279  RGAAVDF-TARNGITPLHVASK  299



>ref|XP_009238544.1| PREDICTED: ankyrin-2 isoform X1 [Pongo abelii]
Length=1902

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  174  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  225

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  226  RGAAVDF-TARNGITPLHVASK  246



>gb|KDO77347.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
Length=793

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 55/104 (53%), Gaps = 8/104 (8%)
 Frame = -3

Query  421  DTALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVL  242
            DTALH+AA G  R     +L V++LV  +  E L LRN+ G   L  AA  G   +AEV+
Sbjct  277  DTALHIAA-GARR-----TLFVQELVNLMTPEDLALRNKVGNTALCFAAVSGVTKIAEVM  330

Query  241  IRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLDVTKDDE  110
            + +N  L      KG  PL  AA   L  +++  Y   VTK+++
Sbjct  331  VNKNRELPSIRGNKGATPLCMAA--LLGHKEMIWYLYSVTKEED  372



>ref|XP_008433109.1| PREDICTED: ankyrin-2 isoform X25 [Poecilia reticulata]
Length=3481

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/97 (32%), Positives = 57/97 (59%), Gaps = 5/97 (5%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  218  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  276

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
             R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  277  NRGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  310



>ref|XP_008433090.1| PREDICTED: ankyrin-2 isoform X8 [Poecilia reticulata]
Length=3527

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/97 (32%), Positives = 57/97 (59%), Gaps = 5/97 (5%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  218  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  276

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
             R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  277  NRGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  310



>ref|XP_006930757.1| PREDICTED: ankyrin-1 isoform X2 [Felis catus]
Length=1854

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 10/82 (12%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEA-LLLRNRKGLAPLHLAARYGNIGVAEVL  242
            T LH+AA+ +G         VE ++A L  EA      +KG  PLH+AA+YG + VAEVL
Sbjct  446  TPLHIAAR-EGH--------VETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAEVL  496

Query  241  IRRNSSLLYNTSEKGLLPLHYA  176
            + R++       + GL PLH A
Sbjct  497  LERDAHPNAAGKQNGLTPLHVA  518



>ref|XP_006002277.1| PREDICTED: ankyrin-3 isoform X7 [Latimeria chalumnae]
Length=2069

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_006002275.1| PREDICTED: ankyrin-3 isoform X5 [Latimeria chalumnae]
Length=2080

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  190  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  241

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  242  RGAAVDF-TARNGITPLHVASK  262



>ref|XP_003966779.1| PREDICTED: ankyrin-2-like [Takifugu rubripes]
Length=2655

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  210  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  261

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  262  RGAAVDF-TARNGITPLHVASK  282



>ref|XP_009238548.1| PREDICTED: ankyrin-2 isoform X5 [Pongo abelii]
Length=3977

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  195  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  246

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  247  RGAAVDF-TARNGITPLHVASK  267



>ref|XP_006002274.1| PREDICTED: ankyrin-3 isoform X4 [Latimeria chalumnae]
Length=2087

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_010639801.1| PREDICTED: ankyrin-2 isoform X4 [Fukomys damarensis]
Length=3996

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  210  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  261

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  262  RGAAVDF-TARNGITPLHVASK  282



>ref|XP_004867679.1| PREDICTED: ankyrin-2 isoform X22 [Heterocephalus glaber]
Length=4001

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_004896379.1| PREDICTED: ankyrin-2 isoform X5 [Heterocephalus glaber]
Length=4016

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  213  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  264

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  265  RGAAVDF-TARNGITPLHVASK  285



>ref|XP_004867664.1| PREDICTED: ankyrin-2 isoform X7 [Heterocephalus glaber]
Length=4050

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_004867663.1| PREDICTED: ankyrin-2 isoform X6 [Heterocephalus glaber]
Length=4051

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  213  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  264

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  265  RGAAVDF-TARNGITPLHVASK  285



>ref|XP_004798040.1| PREDICTED: ankyrin-2 isoform X5 [Mustela putorius furo]
Length=4104

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_004748090.1| PREDICTED: ankyrin-2 isoform X5 [Mustela putorius furo]
Length=4104

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_007097107.1| PREDICTED: ankyrin-1 isoform X3 [Panthera tigris altaica]
Length=1829

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 10/82 (12%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEA-LLLRNRKGLAPLHLAARYGNIGVAEVL  242
            T LH+AA+ +G         VE ++A L  EA      +KG  PLH+AA+YG + VAEVL
Sbjct  446  TPLHIAAR-EGH--------VETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAEVL  496

Query  241  IRRNSSLLYNTSEKGLLPLHYA  176
            + R++       + GL PLH A
Sbjct  497  LERDAHPNAAGKQNGLTPLHVA  518



>ref|XP_009238547.1| PREDICTED: ankyrin-2 isoform X4 [Pongo abelii]
Length=1831

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  195  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  246

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  247  RGAAVDF-TARNGITPLHVASK  267



>ref|XP_006002279.1| PREDICTED: ankyrin-3 isoform X9 [Latimeria chalumnae]
Length=2068

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_007097106.1| PREDICTED: ankyrin-1 isoform X2 [Panthera tigris altaica]
Length=1854

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 10/82 (12%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEA-LLLRNRKGLAPLHLAARYGNIGVAEVL  242
            T LH+AA+ +G         VE ++A L  EA      +KG  PLH+AA+YG + VAEVL
Sbjct  446  TPLHIAAR-EGH--------VETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAEVL  496

Query  241  IRRNSSLLYNTSEKGLLPLHYA  176
            + R++       + GL PLH A
Sbjct  497  LERDAHPNAAGKQNGLTPLHVA  518



>ref|XP_006500955.1| PREDICTED: ankyrin-2 isoform X21 [Mus musculus]
Length=4004

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  253  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  304

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  305  RGAAVDF-TARNGITPLHVASK  325



>ref|XP_006500939.1| PREDICTED: ankyrin-2 isoform X5 [Mus musculus]
Length=4061

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  253  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  304

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  305  RGAAVDF-TARNGITPLHVASK  325



>ref|XP_007997775.1| PREDICTED: ankyrin-2 isoform X5 [Chlorocebus sabaeus]
Length=4070

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  227  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  278

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  279  RGAAVDF-TARNGITPLHVASK  299



>ref|XP_005555811.1| PREDICTED: ankyrin-2 isoform X35 [Macaca fascicularis]
Length=4126

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  227  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  278

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  279  RGAAVDF-TARNGITPLHVASK  299



>ref|XP_005555780.1| PREDICTED: ankyrin-2 isoform X4 [Macaca fascicularis]
Length=4171

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  227  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  278

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  279  RGAAVDF-TARNGITPLHVASK  299



>ref|XP_010856809.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin-2 [Bison bison bison]
Length=4189

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_006714250.1| PREDICTED: ankyrin-2 isoform X9 [Homo sapiens]
Length=4190

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  227  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  278

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  279  RGAAVDF-TARNGITPLHVASK  299



>ref|XP_008433107.1| PREDICTED: ankyrin-2 isoform X24 [Poecilia reticulata]
Length=3514

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/97 (32%), Positives = 57/97 (59%), Gaps = 5/97 (5%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  218  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  276

Query  238  RRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRYFLD  128
             R +++ + T+  G+ PLH A++    + ++ R  LD
Sbjct  277  NRGAAVDF-TARNGITPLHVASKRG--NTNMVRLLLD  310



>ref|XP_006930758.1| PREDICTED: ankyrin-1 isoform X3 [Felis catus]
Length=1829

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 10/82 (12%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEA-LLLRNRKGLAPLHLAARYGNIGVAEVL  242
            T LH+AA+ +G         VE ++A L  EA      +KG  PLH+AA+YG + VAEVL
Sbjct  446  TPLHIAAR-EGH--------VETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAEVL  496

Query  241  IRRNSSLLYNTSEKGLLPLHYA  176
            + R++       + GL PLH A
Sbjct  497  LERDAHPNAAGKQNGLTPLHVA  518



>ref|XP_006930756.1| PREDICTED: ankyrin-1 isoform X1 [Felis catus]
Length=1856

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 10/82 (12%)
 Frame = -3

Query  418  TALHVAAKGDGRHASSFSLVVEKLVAELPDEA-LLLRNRKGLAPLHLAARYGNIGVAEVL  242
            T LH+AA+ +G         VE ++A L  EA      +KG  PLH+AA+YG + VAEVL
Sbjct  446  TPLHIAAR-EGH--------VETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAEVL  496

Query  241  IRRNSSLLYNTSEKGLLPLHYA  176
            + R++       + GL PLH A
Sbjct  497  LERDAHPNAAGKQNGLTPLHVA  518



>ref|XP_008831959.1| PREDICTED: ankyrin-2 isoform X12 [Nannospalax galili]
Length=3952

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  310  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  356



>dbj|GAM22814.1| hypothetical protein SAMD00019534_059890, partial [Acytostelium 
subglobosum LB1]
Length=1234

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = -3

Query  316  LRNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQNTLESEDVYRY  137
            +++++G +PLH AA  GN+ V  +L+ + ++ +   S+ G LPLHY A++T    +V ++
Sbjct  242  VKDKQGWSPLHFAAYAGNLDVCRLLVEQGNAAVMTISKDGTLPLHYLARHTFSEAEVGKF  301



>ref|XP_008831956.1| PREDICTED: ankyrin-2 isoform X9 [Nannospalax galili]
Length=3983

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  310  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  356



>ref|XP_008831950.1| PREDICTED: ankyrin-2 isoform X4 [Nannospalax galili]
Length=4007

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  310  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  356



>ref|XP_006500941.1| PREDICTED: ankyrin-2 isoform X7 [Mus musculus]
Length=4057

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  253  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  304

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  305  RGAAVDF-TARNGITPLHVASK  325



>ref|XP_008773510.1| PREDICTED: ankyrin-2 isoform X1 [Rattus norvegicus]
Length=4114

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  212  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  270

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  271  NRGAAVDF-TARNGITPLHVASK  292



>ref|XP_009205708.1| PREDICTED: ankyrin-2 isoform X38 [Papio anubis]
Length=4126

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  227  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  278

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  279  RGAAVDF-TARNGITPLHVASK  299



>ref|XP_006714257.1| PREDICTED: ankyrin-2 isoform X16 [Homo sapiens]
Length=4145

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  227  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  278

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  279  RGAAVDF-TARNGITPLHVASK  299



>ref|XP_009205672.1| PREDICTED: ankyrin-2 isoform X4 [Papio anubis]
Length=4175

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  227  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  278

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  279  RGAAVDF-TARNGITPLHVASK  299



>gb|AEW26660.1| transient receptor potential cation channel subfamily A member 
1 [Protobothrops jerdonii]
Length=1043

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = -3

Query  352  KLVAELPDEALLLR-NRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYA  176
            +L+  + D  LL   +RKG+ PLHLAA+YG+  V ++L+++ +  L+N+  KG  PLH+A
Sbjct  413  RLLDSMDDTRLLNEGDRKGMTPLHLAAQYGHEKVTQLLLKKGA--LFNSDYKGWTPLHHA  470

Query  175  A  173
            A
Sbjct  471  A  471



>ref|XP_005082896.1| PREDICTED: ankyrin-2 [Mesocricetus auratus]
Length=3856

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  179  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  237

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  238  NRGAAVDF-TARNGITPLHVASK  259



>ref|XP_006002276.1| PREDICTED: ankyrin-3 isoform X6 [Latimeria chalumnae]
Length=2080

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKDD--TKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



>ref|XP_008831953.1| PREDICTED: ankyrin-2 isoform X7 [Nannospalax galili]
Length=3993

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  310  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  356



>ref|XP_008831948.1| PREDICTED: ankyrin-2 isoform X2 [Nannospalax galili]
Length=4033

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  310  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  356



>ref|XP_008831947.1| PREDICTED: ankyrin-2 isoform X1 [Nannospalax galili]
Length=4038

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  210  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  268

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  269  NRGAAVDF-TARNGITPLHVASK  290


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -3

Query  313  RNRKGLAPLHLAARYGNIGVAEVLIRRNSSLLYNTSEKGLLPLHYAAQ  170
            R R GL PLH AAR G+  V E+L+ R + LL  T + GL PLH AAQ
Sbjct  310  RTRDGLTPLHCAARSGHDQVVELLLERGAPLLART-KNGLSPLHMAAQ  356



>ref|XP_008759700.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin-2 isoform X2 [Rattus 
norvegicus]
Length=4078

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  212  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  270

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  271  NRGAAVDF-TARNGITPLHVASK  292



>ref|XP_001362375.3| PREDICTED: ankyrin-2 isoform X1 [Monodelphis domestica]
Length=4170

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRN-RKGLAPLHLAARYGNIGVAEVLI  239
            ALH+AA+ D   +++  L+     A++  + ++ R    G  PLH+AA YGN+ VA +L+
Sbjct  259  ALHIAARKDDTKSAAL-LLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLL  317

Query  238  RRNSSLLYNTSEKGLLPLHYAAQ  170
             R +++ + T+  G+ PLH A++
Sbjct  318  NRGAAVDF-TARNGITPLHVASK  339



>ref|XP_005310084.1| PREDICTED: ankyrin-2 isoform X4 [Chrysemys picta bellii]
Length=3960

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = -3

Query  415  ALHVAAKGDGRHASSFSLVVEKLVAELPDEALLLRNRKGLAPLHLAARYGNIGVAEVLIR  236
            ALH+AA+ D     S +L+++       D    ++++ G  PLH+AA YGN+ VA +L+ 
Sbjct  212  ALHIAARKD--DTKSAALLLQN------DHNADVQSKSGFTPLHIAAHYGNVNVATLLLN  263

Query  235  RNSSLLYNTSEKGLLPLHYAAQ  170
            R +++ + T+  G+ PLH A++
Sbjct  264  RGAAVDF-TARNGITPLHVASK  284



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512662103758