BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25903_g5_i4 len=1459 path=[11976:0-169 5506:170-587 1157:588-588
1158:589-612 19526:613-616 19530:617-629 7184:630-758 3844:759-774
19665:775-784 19750:785-785 19751:786-799 19765:800-800
17298:801-894 9469:895-912 19851:913-914 19853:915-929 20118:930-997
13660:998-1021 15226:1022-1324 15529:1325-1458]

Length=1459
                                                                      Score     E

gb|EYU25856.1|  hypothetical protein MIMGU_mgv1a004842mg                347   8e-110   
ref|XP_011078078.1|  PREDICTED: uncharacterized protein LOC105161921    343   1e-105   
ref|XP_006342275.1|  PREDICTED: uncharacterized protein LOC102591855    324   3e-98    
ref|XP_010321575.1|  PREDICTED: uncharacterized protein LOC101250...    320   3e-97    
ref|XP_010321574.1|  PREDICTED: uncharacterized protein LOC101250...    319   2e-96    
ref|XP_009629768.1|  PREDICTED: uncharacterized protein LOC104119870    314   3e-96    
ref|XP_010321571.1|  PREDICTED: uncharacterized protein LOC101249...    316   1e-95    
ref|XP_010321570.1|  PREDICTED: uncharacterized protein LOC101249...    310   6e-93    
ref|XP_010321572.1|  PREDICTED: uncharacterized protein LOC101249...    307   1e-92    
ref|XP_009783944.1|  PREDICTED: uncharacterized protein LOC104232...    303   2e-90    
ref|XP_009619908.1|  PREDICTED: uncharacterized protein LOC104111...    302   3e-90    
ref|XP_009619909.1|  PREDICTED: uncharacterized protein LOC104111...    302   3e-90    
ref|XP_009619907.1|  PREDICTED: uncharacterized protein LOC104111...    302   4e-90    
ref|XP_009619906.1|  PREDICTED: uncharacterized protein LOC104111...    302   5e-90    
ref|XP_009619904.1|  PREDICTED: uncharacterized protein LOC104111...    302   5e-90    
ref|XP_009783943.1|  PREDICTED: uncharacterized protein LOC104232...    301   7e-90    
ref|XP_009783942.1|  PREDICTED: uncharacterized protein LOC104232...    301   1e-89    
ref|XP_009783941.1|  PREDICTED: uncharacterized protein LOC104232...    301   1e-89    
ref|XP_011093854.1|  PREDICTED: alpha-latrocrustotoxin-Lt1a-like ...    297   4e-89    
ref|XP_011093853.1|  PREDICTED: alpha-latrocrustotoxin-Lt1a-like ...    298   5e-89    
ref|XP_010694915.1|  PREDICTED: ankyrin repeat-containing protein...    294   2e-88    
ref|XP_010694908.1|  PREDICTED: uncharacterized protein LOC104907...    287   1e-85    
ref|XP_010694923.1|  PREDICTED: ankyrin repeat-containing protein...    286   2e-85    
ref|XP_010694898.1|  PREDICTED: uncharacterized protein LOC104907...    287   2e-85    
gb|EYU28334.1|  hypothetical protein MIMGU_mgv1a023484mg                271   4e-83    
emb|CDP03067.1|  unnamed protein product                                268   9e-82    
ref|XP_010655716.1|  PREDICTED: ankyrin-2-like isoform X4               275   1e-80    
ref|XP_010655715.1|  PREDICTED: ankyrin repeat-containing protein...    275   4e-80    
ref|XP_011093852.1|  PREDICTED: uncharacterized protein LOC105173...    273   5e-80    
ref|XP_011093848.1|  PREDICTED: uncharacterized protein LOC105173...    273   8e-80    
ref|XP_010644720.1|  PREDICTED: uncharacterized protein LOC100248044    271   9e-80    
ref|XP_010655713.1|  PREDICTED: uncharacterized protein LOC100256...    275   1e-79    
gb|EYU28337.1|  hypothetical protein MIMGU_mgv11b016979mg               262   2e-79    
emb|CBI30987.3|  unnamed protein product                                271   1e-78    
ref|XP_009783297.1|  PREDICTED: ankyrin repeat-containing protein...    268   2e-78    
ref|XP_009628820.1|  PREDICTED: ankyrin repeat-containing protein...    267   3e-78    
ref|XP_010644722.1|  PREDICTED: uncharacterized protein LOC100258...    260   5e-78    
ref|XP_009783296.1|  PREDICTED: ankyrin repeat-containing protein...    268   6e-78    
ref|XP_009628819.1|  PREDICTED: uncharacterized protein LOC104119...    268   6e-78    
ref|XP_010644721.1|  PREDICTED: uncharacterized protein LOC100258...    260   1e-77    
ref|XP_009783291.1|  PREDICTED: ankyrin repeat-containing protein...    268   1e-77    
ref|XP_009628816.1|  PREDICTED: uncharacterized protein LOC104119...    267   2e-77    
ref|XP_010644712.1|  PREDICTED: uncharacterized protein LOC100265216    265   9e-77    
ref|XP_007012652.1|  Ankyrin repeat-containing-like protein             262   1e-76    
ref|XP_010256492.1|  PREDICTED: ankyrin repeat-containing protein...    254   2e-76    
ref|XP_002513462.1|  ankyrin repeat-containing protein, putative        261   4e-76    Ricinus communis
emb|CDP03066.1|  unnamed protein product                                262   4e-76    
ref|XP_010260577.1|  PREDICTED: ankyrin repeat-containing protein...    255   1e-75    
ref|XP_010244047.1|  PREDICTED: uncharacterized protein LOC104587959    259   1e-75    
ref|XP_009783300.1|  PREDICTED: uncharacterized protein LOC104231...    265   2e-75    
ref|XP_009783301.1|  PREDICTED: uncharacterized protein LOC104231...    264   5e-75    
ref|XP_009790151.1|  PREDICTED: uncharacterized protein LOC104237...    259   1e-74    
ref|XP_010644786.1|  PREDICTED: uncharacterized protein LOC100250...    249   2e-74    
ref|XP_010644785.1|  PREDICTED: uncharacterized protein LOC100250...    250   2e-74    
ref|XP_009610229.1|  PREDICTED: ankyrin repeat-containing protein...    259   2e-74    
ref|XP_010276714.1|  PREDICTED: uncharacterized protein LOC104611...    257   2e-74    
ref|XP_010276715.1|  PREDICTED: uncharacterized protein LOC104611...    256   3e-74    
gb|KDO77352.1|  hypothetical protein CISIN_1g003814mg                   256   3e-74    
ref|XP_010260576.1|  PREDICTED: ankyrin repeat-containing protein...    252   6e-74    
ref|XP_007138825.1|  hypothetical protein PHAVU_009G240400g             258   1e-73    
ref|XP_010276713.1|  PREDICTED: uncharacterized protein LOC104611...    256   1e-73    
ref|XP_007024884.1|  Ankyrin repeat-containing protein, putative ...    258   1e-73    
ref|XP_009610228.1|  PREDICTED: ankyrin repeat-containing protein...    256   2e-73    
emb|CAN68331.1|  hypothetical protein VITISV_030161                     251   3e-73    Vitis vinifera
ref|XP_010260578.1|  PREDICTED: ankyrin repeat-containing protein...    254   4e-73    
ref|XP_006448683.1|  hypothetical protein CICLE_v10014428mg             255   8e-73    
gb|KDO77348.1|  hypothetical protein CISIN_1g003814mg                   254   2e-72    
ref|XP_006468495.1|  PREDICTED: ankyrin repeat-containing protein...    254   2e-72    
ref|XP_010244048.1|  PREDICTED: uncharacterized protein LOC104587960    257   2e-72    
emb|CDP11284.1|  unnamed protein product                                244   3e-72    
ref|XP_006365060.1|  PREDICTED: ankyrin repeat-containing protein...    253   4e-72    
ref|XP_006468494.1|  PREDICTED: ankyrin repeat-containing protein...    254   5e-72    
gb|KDO77347.1|  hypothetical protein CISIN_1g003814mg                   254   5e-72    
ref|XP_010317038.1|  PREDICTED: ankyrin repeat-containing protein...    253   5e-72    
ref|XP_009628824.1|  PREDICTED: uncharacterized protein LOC104119112    248   1e-71    
gb|KDP43902.1|  hypothetical protein JCGZ_20912                         248   3e-71    
ref|XP_007024885.1|  Ankyrin repeat-containing protein, putative ...    251   4e-71    
emb|CAN70302.1|  hypothetical protein VITISV_032663                     239   1e-70    Vitis vinifera
ref|XP_008356256.1|  PREDICTED: ankyrin repeat-containing protein...    248   1e-70    
gb|KCW75498.1|  hypothetical protein EUGRSUZ_E04257                     241   2e-70    
ref|XP_002322392.1|  ankyrin repeat family protein                      249   2e-70    Populus trichocarpa [western balsam poplar]
ref|XP_007048308.1|  Ankyrin repeat family protein isoform 3            246   5e-70    
ref|XP_007048306.1|  Ankyrin repeat family protein isoform 1            246   7e-70    
ref|XP_009349120.1|  PREDICTED: ankyrin repeat-containing protein...    247   8e-70    
emb|CBI35215.3|  unnamed protein product                                246   8e-70    
ref|XP_010244728.1|  PREDICTED: uncharacterized protein LOC104588485    246   1e-69    
gb|KDP43903.1|  hypothetical protein JCGZ_20913                         244   1e-69    
ref|XP_007048311.1|  Ankyrin repeat family protein                      244   2e-69    
ref|XP_006464617.1|  PREDICTED: uncharacterized protein LOC102609031    244   3e-69    
ref|XP_011032352.1|  PREDICTED: uncharacterized protein LOC105131...    244   4e-69    
ref|XP_010648914.1|  PREDICTED: uncharacterized protein LOC100260982    246   4e-69    
ref|XP_006427804.1|  hypothetical protein CICLE_v10025204mg             243   4e-69    
ref|XP_008219093.1|  PREDICTED: ankyrin repeat-containing protein...    243   6e-69    
ref|XP_011000169.1|  PREDICTED: ankyrin repeat-containing protein...    246   7e-69    
ref|XP_011032351.1|  PREDICTED: uncharacterized protein LOC105131...    244   9e-69    
ref|XP_009790150.1|  PREDICTED: ankyrin repeat-containing protein...    244   1e-68    
ref|XP_010655714.1|  PREDICTED: ankyrin repeat-containing protein...    244   2e-68    
emb|CDP11257.1|  unnamed protein product                                243   2e-68    
ref|XP_010658755.1|  PREDICTED: uncharacterized protein LOC100245...    244   3e-68    
ref|XP_002311025.2|  hypothetical protein POPTR_0008s02380g             234   3e-68    Populus trichocarpa [western balsam poplar]
ref|XP_010658754.1|  PREDICTED: uncharacterized protein LOC100245...    244   4e-68    
emb|CDP04746.1|  unnamed protein product                                241   8e-68    
ref|XP_006342272.1|  PREDICTED: uncharacterized protein LOC102590607    229   9e-68    
ref|XP_006586979.1|  PREDICTED: receptor-interacting serine/threo...    240   3e-67    
ref|XP_010058027.1|  PREDICTED: ankyrin repeat-containing protein...    239   9e-67    
ref|XP_007221248.1|  hypothetical protein PRUPE_ppa026067mg             229   1e-66    
gb|KHN44023.1|  Ankyrin repeat-containing protein                       239   1e-66    
ref|XP_002311029.2|  hypothetical protein POPTR_0008s02410g             229   1e-66    Populus trichocarpa [western balsam poplar]
ref|XP_007224368.1|  hypothetical protein PRUPE_ppa020961mg             238   1e-66    
ref|XP_011022999.1|  PREDICTED: ankyrin repeat-containing protein...    237   1e-66    
ref|XP_011022998.1|  PREDICTED: ankyrin repeat-containing protein...    236   2e-66    
emb|CBI27188.3|  unnamed protein product                                244   3e-66    
ref|XP_006382837.1|  hypothetical protein POPTR_0005s05920g             234   6e-66    
emb|CAN68568.1|  hypothetical protein VITISV_029434                     243   7e-66    Vitis vinifera
emb|CBI35217.3|  unnamed protein product                                230   8e-66    
ref|XP_002309894.2|  hypothetical protein POPTR_0007s03780g             233   1e-65    Populus trichocarpa [western balsam poplar]
ref|XP_007221373.1|  hypothetical protein PRUPE_ppa017363mg             226   2e-65    
ref|XP_009377222.1|  PREDICTED: uncharacterized protein LOC103965855    233   3e-65    
gb|KDO48318.1|  hypothetical protein CISIN_1g047454mg                   225   5e-65    
ref|XP_010251695.1|  PREDICTED: ankyrin repeat-containing protein...    233   5e-65    
ref|XP_007221399.1|  hypothetical protein PRUPE_ppa021053mg             224   5e-65    
ref|XP_011078080.1|  PREDICTED: uncharacterized protein LOC105161...    232   7e-65    
gb|KDP29847.1|  hypothetical protein JCGZ_18422                         231   8e-65    
ref|XP_011078079.1|  PREDICTED: uncharacterized protein LOC105161...    232   1e-64    
ref|XP_007221269.1|  hypothetical protein PRUPE_ppa027206mg             231   2e-64    
ref|XP_007221266.1|  hypothetical protein PRUPE_ppa019896mg             231   3e-64    
ref|XP_010658753.1|  PREDICTED: ankyrin repeat-containing protein...    233   3e-64    
ref|XP_006487673.1|  PREDICTED: ankyrin repeat-containing protein...    222   3e-64    
ref|XP_008231968.1|  PREDICTED: uncharacterized protein LOC103331138    222   4e-64    
ref|XP_002509751.1|  protein binding protein, putative                  222   5e-64    Ricinus communis
ref|XP_007216069.1|  hypothetical protein PRUPE_ppa017939mg             222   6e-64    
ref|XP_010465977.1|  PREDICTED: uncharacterized protein LOC104746241    230   7e-64    
ref|XP_011032835.1|  PREDICTED: uncharacterized protein LOC105131...    229   9e-64    
ref|XP_010242785.1|  PREDICTED: uncharacterized protein LOC104587044    231   1e-63    
ref|XP_002311032.2|  hypothetical protein POPTR_0008s02420g             226   2e-63    Populus trichocarpa [western balsam poplar]
ref|XP_002517233.1|  ankyrin repeat-containing protein, putative        227   3e-63    Ricinus communis
ref|XP_011032834.1|  PREDICTED: uncharacterized protein LOC105131...    229   3e-63    
ref|XP_009614681.1|  PREDICTED: uncharacterized protein LOC104107...    229   4e-63    
ref|XP_009614682.1|  PREDICTED: uncharacterized protein LOC104107...    229   4e-63    
ref|XP_010487790.1|  PREDICTED: uncharacterized protein LOC104765727    228   4e-63    
ref|XP_008231973.1|  PREDICTED: ankyrin repeat-containing protein...    219   5e-63    
gb|KDO48313.1|  hypothetical protein CISIN_1g0069422mg                  220   6e-63    
gb|KDP30536.1|  hypothetical protein JCGZ_15245                         228   8e-63    
ref|XP_007221403.1|  hypothetical protein PRUPE_ppa022028mg             219   8e-63    
ref|XP_009359765.1|  PREDICTED: ankyrin repeat-containing protein...    226   8e-63    
ref|XP_008342267.1|  PREDICTED: ankyrin repeat-containing protein...    220   9e-63    
ref|XP_009614683.1|  PREDICTED: uncharacterized protein LOC104107...    228   1e-62    
ref|XP_006431547.1|  hypothetical protein CICLE_v10003659mg             222   3e-62    
ref|XP_007221371.1|  hypothetical protein PRUPE_ppa015563mg             217   3e-62    
ref|XP_010090147.1|  Ankyrin repeat-containing protein                  225   4e-62    
ref|XP_008440794.1|  PREDICTED: ankyrin repeat-containing protein...    224   4e-62    
ref|XP_006466150.1|  PREDICTED: uncharacterized protein LOC102617019    224   6e-62    
ref|XP_008235975.1|  PREDICTED: uncharacterized protein LOC103334783    225   1e-61    
gb|KDO65032.1|  hypothetical protein CISIN_1g0061731mg                  218   1e-61    
ref|XP_008230430.1|  PREDICTED: ankyrin repeat-containing protein...    222   2e-61    
ref|XP_008230427.1|  PREDICTED: uncharacterized protein LOC103329708    224   2e-61    
ref|XP_011032833.1|  PREDICTED: uncharacterized protein LOC105131524    225   2e-61    
ref|XP_008362322.1|  PREDICTED: ankyrin repeat-containing protein...    216   3e-61    
gb|KDP35850.1|  hypothetical protein JCGZ_10331                         222   3e-61    
ref|XP_008231511.1|  PREDICTED: uncharacterized protein LOC103330686    223   4e-61    
ref|XP_008341407.1|  PREDICTED: uncharacterized protein LOC103404...    222   4e-61    
ref|XP_010242786.1|  PREDICTED: uncharacterized protein LOC104587045    223   6e-61    
gb|KDP25715.1|  hypothetical protein JCGZ_23936                         218   6e-61    
ref|XP_010256489.1|  PREDICTED: uncharacterized protein LOC104596860    224   7e-61    
ref|XP_008341406.1|  PREDICTED: uncharacterized protein LOC103404...    221   8e-61    
gb|KDP43897.1|  hypothetical protein JCGZ_20907                         214   8e-61    
ref|XP_006381090.1|  hypothetical protein POPTR_0006s06170g             214   1e-60    
gb|EPS64453.1|  hypothetical protein M569_10326                         218   2e-60    
ref|XP_006487634.1|  PREDICTED: uncharacterized protein LOC102628573    221   2e-60    
ref|XP_008231516.1|  PREDICTED: ankyrin repeat-containing protein...    218   3e-60    
ref|XP_006297262.1|  hypothetical protein CARUB_v10013276mg             219   3e-60    
emb|CBI37570.3|  unnamed protein product                                213   3e-60    
ref|XP_006465922.1|  PREDICTED: uncharacterized protein LOC102626928    220   3e-60    
ref|XP_008245179.1|  PREDICTED: uncharacterized protein LOC103343293    221   3e-60    
ref|XP_009614684.1|  PREDICTED: uncharacterized protein LOC104107...    220   3e-60    
emb|CAN68156.1|  hypothetical protein VITISV_036768                     211   3e-60    Vitis vinifera
ref|XP_010419743.1|  PREDICTED: uncharacterized protein LOC104705430    220   4e-60    
ref|XP_002311023.2|  hypothetical protein POPTR_0008s02350g             219   7e-60    Populus trichocarpa [western balsam poplar]
gb|EYU45770.1|  hypothetical protein MIMGU_mgv1a026656mg                212   8e-60    
gb|EYU28332.1|  hypothetical protein MIMGU_mgv1a003521mg                217   1e-59    
ref|XP_002275383.2|  PREDICTED: uncharacterized protein LOC100245...    219   1e-59    Vitis vinifera
ref|XP_008380086.1|  PREDICTED: uncharacterized protein LOC103443078    216   1e-59    
ref|XP_004288982.1|  PREDICTED: ankyrin repeat-containing protein...    210   1e-59    
dbj|BAB01793.1|  unnamed protein product                                218   1e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006431545.1|  hypothetical protein CICLE_v10003295mg             214   2e-59    
ref|XP_008360874.1|  PREDICTED: ankyrin repeat-containing protein...    215   4e-59    
ref|XP_007221398.1|  hypothetical protein PRUPE_ppa020222mg             216   4e-59    
ref|XP_010658756.1|  PREDICTED: uncharacterized protein LOC100254093    218   4e-59    
gb|KDP43899.1|  hypothetical protein JCGZ_20909                         216   4e-59    
ref|XP_007036277.1|  Ankyrin repeat family protein, putative isof...    218   4e-59    
emb|CAN62183.1|  hypothetical protein VITISV_044401                     217   4e-59    Vitis vinifera
ref|XP_009350923.1|  PREDICTED: ankyrin repeat-containing protein...    209   6e-59    
ref|XP_010656436.1|  PREDICTED: ankyrin repeat-containing protein...    216   7e-59    
emb|CBI35219.3|  unnamed protein product                                217   9e-59    
emb|CBI37569.3|  unnamed protein product                                217   9e-59    
ref|XP_008244948.1|  PREDICTED: ankyrin repeat-containing protein...    207   1e-58    
emb|CAN71662.1|  hypothetical protein VITISV_001405                     215   2e-58    Vitis vinifera
ref|XP_009344351.1|  PREDICTED: ankyrin repeat-containing protein...    213   2e-58    
ref|XP_008348005.1|  PREDICTED: ankyrin repeat-containing protein...    213   2e-58    
ref|XP_004287295.1|  PREDICTED: uncharacterized protein LOC101314594    219   2e-58    
ref|XP_010649391.1|  PREDICTED: uncharacterized protein LOC100250...    216   2e-58    
ref|XP_010649394.1|  PREDICTED: uncharacterized protein LOC100250...    216   2e-58    
ref|XP_007048310.1|  Ankyrin repeat family protein, putative            216   2e-58    
ref|NP_188497.1|  ankyrin repeat-containing protein                     214   3e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006431560.1|  hypothetical protein CICLE_v10003198mg             215   3e-58    
ref|XP_006426655.1|  hypothetical protein CICLE_v10025100mg             214   3e-58    
ref|XP_006431544.1|  hypothetical protein CICLE_v10003264mg             207   3e-58    
ref|XP_009377835.1|  PREDICTED: ankyrin repeat-containing protein...    213   4e-58    
ref|XP_002885271.1|  predicted protein                                  213   4e-58    
ref|XP_010649401.1|  PREDICTED: uncharacterized protein LOC100245...    213   4e-58    
ref|XP_010649399.1|  PREDICTED: uncharacterized protein LOC100245...    214   4e-58    
ref|XP_008355241.1|  PREDICTED: ankyrin repeat-containing protein...    213   5e-58    
ref|XP_008229278.1|  PREDICTED: ankyrin repeat-containing protein...    209   5e-58    
ref|XP_008355240.1|  PREDICTED: ankyrin repeat-containing protein...    213   5e-58    
ref|XP_008391125.1|  PREDICTED: ankyrin repeat-containing protein...    213   7e-58    
emb|CDP04741.1|  unnamed protein product                                207   7e-58    
ref|XP_009344349.1|  PREDICTED: ankyrin repeat-containing protein...    213   7e-58    
ref|XP_010649397.1|  PREDICTED: uncharacterized protein LOC100245...    214   7e-58    
emb|CAN72586.1|  hypothetical protein VITISV_001920                     205   7e-58    Vitis vinifera
ref|XP_010694148.1|  PREDICTED: ankyrin repeat-containing protein...    213   9e-58    
ref|XP_006448678.1|  hypothetical protein CICLE_v10014877mg             211   1e-57    
ref|XP_011020233.1|  PREDICTED: ankyrin repeat-containing protein...    212   1e-57    
ref|XP_010649396.1|  PREDICTED: uncharacterized protein LOC100245...    214   1e-57    
ref|XP_010665689.1|  PREDICTED: ankyrin repeat-containing protein...    213   1e-57    
ref|XP_006379474.1|  hypothetical protein POPTR_0008s02390g             209   1e-57    
ref|XP_008341404.1|  PREDICTED: ankyrin repeat-containing protein...    205   1e-57    
ref|XP_006431561.1|  hypothetical protein CICLE_v10003229mg             211   1e-57    
ref|XP_009763965.1|  PREDICTED: uncharacterized protein LOC104215...    214   1e-57    
ref|XP_009763957.1|  PREDICTED: uncharacterized protein LOC104215...    214   1e-57    
ref|XP_010649395.1|  PREDICTED: uncharacterized protein LOC100245...    214   1e-57    
gb|KDO41012.1|  hypothetical protein CISIN_1g021201mg                   204   2e-57    
ref|XP_011020234.1|  PREDICTED: ankyrin repeat-containing protein...    210   2e-57    
ref|XP_004291593.1|  PREDICTED: ankyrin repeat-containing protein...    211   2e-57    
ref|XP_006431563.1|  hypothetical protein CICLE_v10003303mg             210   2e-57    
ref|XP_006490203.1|  PREDICTED: ankyrin repeat-containing protein...    212   2e-57    
ref|XP_006490206.1|  PREDICTED: ankyrin repeat-containing protein...    212   2e-57    
ref|XP_007221263.1|  hypothetical protein PRUPE_ppa008654mg             204   2e-57    
ref|XP_006490204.1|  PREDICTED: ankyrin repeat-containing protein...    212   2e-57    
ref|XP_006490205.1|  PREDICTED: ankyrin repeat-containing protein...    212   2e-57    
ref|XP_004296497.1|  PREDICTED: ankyrin repeat-containing protein...    213   3e-57    
ref|XP_006494240.1|  PREDICTED: ankyrin repeat-containing protein...    204   3e-57    
ref|XP_006487636.1|  PREDICTED: uncharacterized protein LOC102628...    213   3e-57    
gb|KDO48316.1|  hypothetical protein CISIN_1g004089mg                   213   3e-57    
ref|XP_010665688.1|  PREDICTED: ankyrin repeat-containing protein...    212   3e-57    
ref|XP_006487635.1|  PREDICTED: uncharacterized protein LOC102628...    213   3e-57    
ref|XP_008229295.1|  PREDICTED: ankyrin repeat-containing protein...    203   4e-57    
gb|KDO48317.1|  hypothetical protein CISIN_1g004089mg                   213   4e-57    
ref|XP_009346492.1|  PREDICTED: ankyrin repeat-containing protein...    211   5e-57    
ref|XP_008244945.1|  PREDICTED: cytochrome P450 71B34-like              208   6e-57    
gb|KCW75495.1|  hypothetical protein EUGRSUZ_E04253                     203   6e-57    
ref|XP_008337866.1|  PREDICTED: ankyrin repeat-containing protein...    208   7e-57    
emb|CDP04740.1|  unnamed protein product                                212   8e-57    
ref|XP_010277704.1|  PREDICTED: uncharacterized protein LOC104612086    211   9e-57    
ref|XP_004500133.1|  PREDICTED: uncharacterized protein LOC101507721    209   9e-57    
ref|XP_008245505.1|  PREDICTED: ankyrin repeat-containing protein...    201   9e-57    
ref|XP_007099534.1|  Ankyrin repeat family protein, putative isof...    209   1e-56    
ref|XP_010090151.1|  Ankyrin repeat-containing protein                  212   1e-56    
ref|XP_007204827.1|  hypothetical protein PRUPE_ppa004153mg             207   1e-56    
ref|XP_009344348.1|  PREDICTED: ankyrin repeat-containing protein...    207   2e-56    
ref|XP_009377164.1|  PREDICTED: ankyrin repeat-containing protein...    201   2e-56    
ref|XP_007207550.1|  hypothetical protein PRUPE_ppa017666mg             207   3e-56    
ref|XP_006431550.1|  hypothetical protein CICLE_v10003521mg             206   3e-56    
ref|XP_007221374.1|  hypothetical protein PRUPE_ppa017822mg             208   4e-56    
ref|XP_010665704.1|  PREDICTED: ankyrin repeat-containing protein...    209   5e-56    
ref|XP_010665509.1|  PREDICTED: ankyrin repeat-containing protein...    205   5e-56    
ref|XP_004289303.1|  PREDICTED: ankyrin repeat-containing protein...    209   5e-56    
ref|XP_004153885.1|  PREDICTED: ankyrin repeat-containing protein...    209   7e-56    
ref|XP_008229250.1|  PREDICTED: ankyrin repeat-containing protein...    206   9e-56    
ref|XP_009344346.1|  PREDICTED: ankyrin repeat-containing protein...    207   9e-56    
ref|XP_009344347.1|  PREDICTED: ankyrin repeat-containing protein...    207   9e-56    
emb|CAN72296.1|  hypothetical protein VITISV_009095                     200   1e-55    Vitis vinifera
ref|XP_008440571.1|  PREDICTED: ankyrin repeat-containing protein...    209   1e-55    
ref|XP_008440580.1|  PREDICTED: ankyrin repeat-containing protein...    208   1e-55    
ref|XP_006494238.1|  PREDICTED: uncharacterized protein LOC102615306    207   2e-55    
ref|XP_006428079.1|  hypothetical protein CICLE_v10027269mg             206   2e-55    
ref|XP_007036661.1|  Ankyrin repeat family protein, putative            207   2e-55    
gb|KDO40245.1|  hypothetical protein CISIN_1g037778mg                   205   3e-55    
ref|XP_006431557.1|  hypothetical protein CICLE_v10003926mg             198   3e-55    
ref|XP_010658798.1|  PREDICTED: ankyrin repeat-containing protein...    198   4e-55    
ref|XP_002311027.2|  hypothetical protein POPTR_0008s02390g             199   6e-55    
ref|XP_010059716.1|  PREDICTED: uncharacterized protein LOC104447703    207   6e-55    
emb|CDP04745.1|  unnamed protein product                                207   6e-55    
gb|KDO77346.1|  hypothetical protein CISIN_1g044420mg                   203   7e-55    
ref|XP_007099533.1|  Ankyrin repeat family protein, putative isof...    206   7e-55    
ref|XP_010550279.1|  PREDICTED: ankyrin repeat-containing protein...    205   7e-55    
ref|XP_010665694.1|  PREDICTED: ankyrin repeat-containing protein...    206   8e-55    
ref|XP_007099504.1|  Ankyrin repeat family protein, putative isof...    205   8e-55    
ref|XP_008357275.1|  PREDICTED: ankyrin repeat-containing protein...    198   1e-54    
ref|XP_007099505.1|  Ankyrin repeat family protein, putative isof...    204   1e-54    
ref|XP_003617408.1|  Ankyrin repeat-containing protein                  203   2e-54    
ref|XP_006464318.1|  PREDICTED: ankyrin repeat-containing protein...    204   2e-54    
ref|XP_009145869.1|  PREDICTED: uncharacterized protein LOC103869...    204   2e-54    
ref|XP_004291592.1|  PREDICTED: ankyrin repeat-containing protein...    203   3e-54    
ref|XP_007207536.1|  hypothetical protein PRUPE_ppa015617mg             199   3e-54    
ref|XP_004506665.1|  PREDICTED: uncharacterized protein LOC101497...    202   3e-54    
ref|XP_007036275.1|  Ankyrin repeat family protein, putative isof...    204   3e-54    
ref|XP_004506664.1|  PREDICTED: uncharacterized protein LOC101497...    202   4e-54    
ref|XP_007216945.1|  hypothetical protein PRUPE_ppa016309mg             202   5e-54    
ref|XP_007036288.1|  Ankyrin repeat family protein                      202   5e-54    
ref|XP_010665512.1|  PREDICTED: ankyrin repeat-containing protein...    202   6e-54    
ref|XP_007036274.1|  Ankyrin repeat family protein, putative isof...    202   6e-54    
emb|CDP04744.1|  unnamed protein product                                204   7e-54    
gb|AES70441.2|  ankyrin repeat protein                                  199   8e-54    
ref|XP_004293065.1|  PREDICTED: ankyrin repeat-containing protein...    202   1e-53    
ref|XP_008364280.1|  PREDICTED: ankyrin repeat-containing protein...    192   1e-53    
ref|XP_003600190.1|  hypothetical protein MTR_3g055310                  199   1e-53    
gb|KEH33947.1|  ankyrin repeat protein                                  199   1e-53    
ref|XP_008341710.1|  PREDICTED: uncharacterized protein LOC103404560    194   1e-53    
ref|XP_008363461.1|  PREDICTED: ankyrin repeat-containing protein...    194   2e-53    
ref|XP_010256236.1|  PREDICTED: uncharacterized protein LOC104596682    196   2e-53    
ref|XP_011023002.1|  PREDICTED: ankyrin repeat-containing protein...    200   3e-53    
gb|KEH33949.1|  ankyrin repeat protein                                  198   3e-53    
ref|XP_006494237.1|  PREDICTED: ankyrin repeat-containing protein...    201   3e-53    
ref|XP_010109847.1|  Ankyrin repeat-containing protein                  199   3e-53    
ref|XP_006602166.1|  PREDICTED: uncharacterized protein LOC102660751    199   5e-53    
gb|KHN28408.1|  Ankyrin repeat-containing protein                       199   5e-53    
emb|CAN72916.1|  hypothetical protein VITISV_014583                     201   5e-53    
ref|XP_007203639.1|  hypothetical protein PRUPE_ppa004188mg             197   6e-53    
ref|XP_004171684.1|  PREDICTED: uncharacterized protein LOC101226258    191   6e-53    
ref|XP_008341399.1|  PREDICTED: uncharacterized protein LOC103404281    200   8e-53    
gb|KDO41013.1|  hypothetical protein CISIN_1g021201mg                   191   1e-52    
ref|XP_004308737.1|  PREDICTED: uncharacterized protein LOC101304047    200   1e-52    
gb|KEH33948.1|  ankyrin repeat protein                                  194   1e-52    
ref|XP_008229257.1|  PREDICTED: ankyrin repeat-containing protein...    198   1e-52    
gb|KDO39991.1|  hypothetical protein CISIN_1g0055561mg                  198   2e-52    
ref|XP_004161981.1|  PREDICTED: ankyrin repeat-containing protein...    197   2e-52    
ref|XP_008354421.1|  PREDICTED: ankyrin repeat-containing protein...    192   2e-52    
ref|XP_010665693.1|  PREDICTED: ankyrin repeat-containing protein...    199   2e-52    
ref|XP_007213190.1|  hypothetical protein PRUPE_ppa026120mg             198   2e-52    
ref|XP_004145199.1|  PREDICTED: uncharacterized protein LOC101215460    197   3e-52    
gb|KGN50436.1|  hypothetical protein Csa_5G174620                       197   4e-52    
ref|XP_009349331.1|  PREDICTED: ankyrin repeat-containing protein...    192   4e-52    
ref|XP_006448682.1|  hypothetical protein CICLE_v10018102mg             197   4e-52    
ref|XP_007146563.1|  hypothetical protein PHAVU_006G051200g             197   4e-52    
ref|XP_008229901.1|  PREDICTED: ankyrin repeat-containing protein...    197   4e-52    
ref|XP_010520659.1|  PREDICTED: uncharacterized protein LOC104799718    191   4e-52    
ref|XP_007207788.1|  hypothetical protein PRUPE_ppa025725mg             190   5e-52    
ref|XP_004145197.1|  PREDICTED: ankyrin repeat-containing protein...    197   5e-52    
emb|CBI35222.3|  unnamed protein product                                198   5e-52    
ref|XP_007216370.1|  hypothetical protein PRUPE_ppa019187mg             198   5e-52    
ref|XP_010658761.1|  PREDICTED: ankyrin repeat-containing protein...    198   6e-52    
ref|XP_008244947.1|  PREDICTED: ankyrin repeat-containing protein...    194   6e-52    
ref|XP_008467210.1|  PREDICTED: ankyrin repeat-containing protein...    196   8e-52    
ref|XP_004153952.1|  PREDICTED: uncharacterized protein LOC101208435    192   8e-52    
gb|KDP45109.1|  hypothetical protein JCGZ_18551                         196   9e-52    
ref|XP_010248105.1|  PREDICTED: ankyrin repeat-containing protein...    187   1e-51    
ref|XP_010543607.1|  PREDICTED: uncharacterized protein LOC104816462    196   1e-51    
ref|XP_008440652.1|  PREDICTED: ankyrin repeat-containing protein...    196   1e-51    
ref|XP_010248129.1|  PREDICTED: ankyrin repeat-containing protein...    186   2e-51    
gb|KDP37872.1|  hypothetical protein JCGZ_06379                         186   2e-51    
ref|XP_009361709.1|  PREDICTED: ankyrin repeat-containing protein...    187   2e-51    
ref|XP_009357118.1|  PREDICTED: uncharacterized protein LOC103947878    196   2e-51    
ref|XP_008440666.1|  PREDICTED: ankyrin repeat-containing protein...    195   2e-51    
ref|XP_002862767.1|  hypothetical protein ARALYDRAFT_333222             189   2e-51    
ref|XP_007036273.1|  Ankyrin repeat family protein, putative isof...    196   3e-51    
ref|XP_010248103.1|  PREDICTED: ankyrin repeat-containing protein...    186   3e-51    
ref|XP_006487672.1|  PREDICTED: uncharacterized protein LOC102622008    196   3e-51    
ref|XP_008440674.1|  PREDICTED: ankyrin repeat-containing protein...    195   3e-51    
emb|CAN81449.1|  hypothetical protein VITISV_011174                     196   4e-51    
ref|XP_009347689.1|  PREDICTED: ankyrin repeat-containing protein...    188   4e-51    
ref|XP_008242231.1|  PREDICTED: ankyrin repeat-containing protein...    194   7e-51    
ref|XP_008348268.1|  PREDICTED: uncharacterized protein LOC103411410    188   8e-51    
ref|XP_008242230.1|  PREDICTED: ankyrin repeat-containing protein...    194   9e-51    
ref|XP_008390055.1|  PREDICTED: ankyrin repeat-containing protein...    190   1e-50    
ref|XP_004288337.1|  PREDICTED: uncharacterized protein LOC101314411    194   1e-50    
ref|XP_009366066.1|  PREDICTED: ankyrin repeat-containing protein...    184   2e-50    
ref|XP_010543609.1|  PREDICTED: ankyrin repeat-containing protein...    192   2e-50    
ref|XP_002523649.1|  hypothetical protein RCOM_0892190                  183   2e-50    
ref|XP_008440640.1|  PREDICTED: uncharacterized protein LOC103484...    191   3e-50    
ref|XP_007207987.1|  hypothetical protein PRUPE_ppa015117mg             191   3e-50    
ref|XP_004164876.1|  PREDICTED: ankyrin repeat-containing protein...    192   3e-50    
ref|XP_004153946.1|  PREDICTED: ankyrin repeat-containing protein...    192   3e-50    
gb|KGN64472.1|  hypothetical protein Csa_1G058070                       192   4e-50    
ref|XP_008440631.1|  PREDICTED: uncharacterized protein LOC103484...    191   5e-50    
ref|XP_009357068.1|  PREDICTED: uncharacterized protein LOC103947...    192   6e-50    
gb|KEH37408.1|  ankyrin repeat plant-like protein                       190   6e-50    
ref|XP_008229300.1|  PREDICTED: uncharacterized protein LOC103328...    183   7e-50    
ref|XP_008440605.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    191   9e-50    
ref|XP_004163109.1|  PREDICTED: ankyrin repeat-containing protein...    190   2e-49    
gb|KEH33946.1|  ankyrin repeat protein                                  184   2e-49    
ref|XP_010520180.1|  PREDICTED: uncharacterized protein LOC104799378    191   2e-49    
ref|XP_004145192.1|  PREDICTED: uncharacterized protein LOC101213772    190   2e-49    
gb|EYU43670.1|  hypothetical protein MIMGU_mgv1a022389mg                188   3e-49    
gb|KCW75497.1|  hypothetical protein EUGRSUZ_E04256                     187   3e-49    
ref|XP_004145202.1|  PREDICTED: uncharacterized protein LOC101216177    193   3e-49    
ref|XP_004164877.1|  PREDICTED: uncharacterized LOC101218503            189   4e-49    
ref|XP_004304131.1|  PREDICTED: uncharacterized protein LOC101315069    189   5e-49    
ref|XP_006406578.1|  hypothetical protein EUTSA_v10022283mg             188   5e-49    
ref|XP_008440732.1|  PREDICTED: ankyrin repeat-containing protein...    189   6e-49    
ref|XP_010552927.1|  PREDICTED: uncharacterized protein LOC104823186    188   9e-49    
ref|XP_007217839.1|  hypothetical protein PRUPE_ppa025911mg             186   1e-48    
gb|KDO57164.1|  hypothetical protein CISIN_1g045240mg                   181   1e-48    
ref|XP_008359245.1|  PREDICTED: uncharacterized protein LOC103422959    181   2e-48    
ref|XP_004173283.1|  PREDICTED: ankyrin repeat-containing protein...    184   2e-48    
ref|XP_006847732.1|  hypothetical protein AMTR_s00149p00090550          184   2e-48    
ref|XP_008368491.1|  PREDICTED: uncharacterized protein LOC103432100    187   3e-48    
ref|XP_008368496.1|  PREDICTED: uncharacterized protein LOC103432108    181   3e-48    
ref|XP_004143703.1|  PREDICTED: uncharacterized protein LOC101207503    190   3e-48    
gb|KHN40430.1|  Ankyrin repeat-containing protein                       186   4e-48    
ref|XP_009343383.1|  PREDICTED: uncharacterized protein LOC103935349    183   6e-48    
ref|XP_008391127.1|  PREDICTED: ankyrin repeat-containing protein...    184   9e-48    
ref|XP_008230428.1|  PREDICTED: uncharacterized protein LOC103329709    185   1e-47    
ref|XP_009627277.1|  PREDICTED: uncharacterized protein LOC104117...    185   1e-47    
ref|XP_008379536.1|  PREDICTED: uncharacterized protein LOC103442515    186   1e-47    
ref|XP_006365062.1|  PREDICTED: ankyrin repeat-containing protein...    184   1e-47    
ref|XP_009627275.1|  PREDICTED: uncharacterized protein LOC104117...    185   1e-47    
ref|XP_009113887.1|  PREDICTED: ankyrin repeat-containing protein...    180   2e-47    
ref|XP_006284892.1|  hypothetical protein CARUB_v10006184mg             183   2e-47    
ref|XP_004145193.1|  PREDICTED: ankyrin repeat-containing protein...    184   2e-47    
ref|XP_010092701.1|  Splicing factor 3B subunit 4                       184   2e-47    
ref|XP_009627274.1|  PREDICTED: uncharacterized protein LOC104117...    184   2e-47    
ref|XP_006572953.1|  PREDICTED: uncharacterized protein LOC100811748    184   2e-47    
ref|XP_008391126.1|  PREDICTED: ankyrin repeat-containing protein...    183   2e-47    
ref|XP_009343381.1|  PREDICTED: ankyrin repeat-containing protein...    184   2e-47    
ref|XP_008440786.1|  PREDICTED: ankyrin repeat-containing protein...    184   3e-47    
ref|XP_009145870.1|  PREDICTED: uncharacterized protein LOC103869...    183   3e-47    
ref|XP_009357064.1|  PREDICTED: ankyrin repeat-containing protein...    184   3e-47    
ref|XP_009357063.1|  PREDICTED: uncharacterized protein LOC103947...    184   3e-47    
ref|XP_009357062.1|  PREDICTED: uncharacterized protein LOC103947...    184   3e-47    
ref|XP_007215442.1|  hypothetical protein PRUPE_ppa006277mg             179   4e-47    
ref|XP_004304130.1|  PREDICTED: ankyrin repeat-containing protein...    178   6e-47    
ref|XP_008341891.1|  PREDICTED: uncharacterized protein LOC103404...    182   6e-47    
ref|XP_008341890.1|  PREDICTED: uncharacterized protein LOC103404...    182   6e-47    
ref|XP_009346494.1|  PREDICTED: ankyrin repeat-containing protein...    182   7e-47    
ref|XP_009343380.1|  PREDICTED: uncharacterized protein LOC103935...    183   7e-47    
gb|KDP37317.1|  hypothetical protein JCGZ_06771                         181   7e-47    
ref|XP_008388249.1|  PREDICTED: ankyrin repeat-containing protein...    174   8e-47    
ref|XP_008344975.1|  PREDICTED: ankyrin repeat-containing protein...    176   8e-47    
gb|KHN29416.1|  Ankyrin repeat-containing protein                       183   9e-47    
ref|XP_009357066.1|  PREDICTED: uncharacterized protein LOC103947...    183   1e-46    
emb|CDX92259.1|  BnaA05g21480D                                          182   1e-46    
ref|XP_009357061.1|  PREDICTED: uncharacterized protein LOC103947825    182   1e-46    
ref|XP_009346493.1|  PREDICTED: ankyrin repeat-containing protein...    181   1e-46    
gb|KDO57160.1|  hypothetical protein CISIN_1g040056mg                   180   2e-46    
ref|XP_006587876.1|  PREDICTED: uncharacterized protein LOC102666856    182   2e-46    
ref|XP_003517655.1|  PREDICTED: uncharacterized protein LOC100808539    182   2e-46    
ref|XP_007216914.1|  hypothetical protein PRUPE_ppa019047mg             181   2e-46    
emb|CDX99328.1|  BnaC05g34430D                                          181   2e-46    
ref|XP_008341889.1|  PREDICTED: uncharacterized protein LOC103404...    181   2e-46    
ref|XP_006432672.1|  hypothetical protein CICLE_v10000862mg             179   2e-46    
ref|XP_002873166.1|  hypothetical protein ARALYDRAFT_908361             180   3e-46    
ref|XP_008341888.1|  PREDICTED: uncharacterized protein LOC103404...    181   3e-46    
ref|XP_008368494.1|  PREDICTED: ankyrin repeat-containing protein...    172   4e-46    
ref|XP_010423545.1|  PREDICTED: uncharacterized protein LOC104708649    180   4e-46    
ref|XP_008359726.1|  PREDICTED: uncharacterized protein LOC103423425    172   5e-46    
ref|XP_004153067.1|  PREDICTED: ankyrin repeat-containing protein...    180   5e-46    
ref|XP_004153308.1|  PREDICTED: uncharacterized protein LOC101218503    179   6e-46    
gb|KFK24911.1|  hypothetical protein AALP_AA8G041000                    180   7e-46    
ref|XP_007022427.1|  Ankyrin repeat family protein, putative            179   7e-46    
ref|XP_004233910.2|  PREDICTED: uncharacterized protein LOC101247887    179   8e-46    
emb|CDY36169.1|  BnaC04g37250D                                          179   8e-46    
emb|CDY13083.1|  BnaA09g17340D                                          179   8e-46    
ref|XP_011096899.1|  PREDICTED: ankyrin repeat-containing protein...    179   1e-45    
ref|XP_006398925.1|  hypothetical protein EUTSA_v10012899mg             179   1e-45    
emb|CDY11300.1|  BnaA03g01360D                                          179   1e-45    
ref|XP_003547429.2|  PREDICTED: uncharacterized protein LOC100814943    176   1e-45    
ref|XP_003612733.1|  Ankyrin repeat-containing protein                  172   2e-45    
gb|KDP25714.1|  hypothetical protein JCGZ_23935                         169   2e-45    
ref|XP_009130833.1|  PREDICTED: uncharacterized protein LOC103855580    178   2e-45    
ref|XP_007158230.1|  hypothetical protein PHAVU_002G135000g             179   2e-45    
gb|KHN47695.1|  Ankyrin repeat and death domain-containing protei...    177   3e-45    
ref|XP_008230435.1|  PREDICTED: ankyrin repeat-containing protein...    175   3e-45    
ref|XP_008440848.1|  PREDICTED: ankyrin repeat-containing protein...    177   3e-45    
ref|XP_004153711.1|  PREDICTED: ankyrin repeat-containing protein...    172   4e-45    
ref|XP_007154752.1|  hypothetical protein PHAVU_003G144700g             177   4e-45    
ref|XP_008230404.1|  PREDICTED: uncharacterized protein LOC103329682    177   5e-45    
ref|XP_011096897.1|  PREDICTED: ankyrin repeat-containing protein...    176   5e-45    
ref|XP_002873164.1|  hypothetical protein ARALYDRAFT_325107             177   6e-45    
ref|XP_006432670.1|  hypothetical protein CICLE_v10003360mg             175   6e-45    
gb|AES95682.2|  ankyrin repeat protein                                  175   8e-45    
ref|XP_004145188.1|  PREDICTED: ankyrin repeat-containing protein...    176   9e-45    
emb|CDY61717.1|  BnaC09g51990D                                          176   1e-44    
ref|XP_007030435.1|  Ankyrin repeat family protein, putative            176   1e-44    
ref|XP_006431552.1|  hypothetical protein CICLE_v10003296mg             175   1e-44    
ref|XP_004171826.1|  PREDICTED: ankyrin repeat-containing protein...    176   1e-44    
ref|XP_007041075.1|  Ankyrin repeat family protein, putative            176   1e-44    
ref|XP_010452369.1|  PREDICTED: uncharacterized protein LOC104734476    174   2e-44    
ref|XP_007011009.1|  Ankyrin repeat family protein                      172   2e-44    
ref|XP_010666126.1|  PREDICTED: uncharacterized protein LOC104883327    169   2e-44    
ref|XP_004145185.1|  PREDICTED: ankyrin repeat-containing protein...    171   2e-44    
ref|XP_004298105.1|  PREDICTED: uncharacterized protein LOC101309050    170   2e-44    
ref|XP_010051488.1|  PREDICTED: ankyrin repeat-containing protein...    169   4e-44    
ref|XP_006287230.1|  hypothetical protein CARUB_v10000416mg             175   4e-44    
ref|XP_006427500.1|  hypothetical protein CICLE_v10026492mg             165   4e-44    
ref|XP_002873163.1|  predicted protein                                  174   4e-44    
ref|XP_003612716.1|  hypothetical protein MTR_5g028100                  171   4e-44    
gb|KCW82143.1|  hypothetical protein EUGRSUZ_C03534                     174   5e-44    
ref|NP_196090.1|  Ankyrin repeat family protein                         174   6e-44    
ref|XP_006287208.1|  hypothetical protein CARUB_v10000386mg             174   6e-44    
ref|XP_002873160.1|  predicted protein                                  174   7e-44    
ref|NP_198430.1|  Ankyrin repeat family protein                         168   1e-43    
ref|XP_003612724.1|  Ankyrin repeat-containing protein                  168   1e-43    
ref|XP_004145182.1|  PREDICTED: ankyrin repeat-containing protein...    168   1e-43    
gb|KHN24819.1|  Ankyrin-1                                               172   1e-43    
ref|XP_007158239.1|  hypothetical protein PHAVU_002G135800g             172   2e-43    
ref|XP_004306367.1|  PREDICTED: uncharacterized protein LOC101301611    167   2e-43    
ref|XP_007154755.1|  hypothetical protein PHAVU_003G144900g             172   2e-43    
gb|AFK48305.1|  unknown                                                 163   2e-43    
ref|XP_010275877.1|  PREDICTED: uncharacterized protein LOC104610...    172   3e-43    
ref|XP_007011047.1|  Ankyrin repeat family protein isoform 2            172   3e-43    



>gb|EYU25856.1| hypothetical protein MIMGU_mgv1a004842mg [Erythranthe guttata]
Length=507

 Score =   347 bits (889),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 223/418 (53%), Positives = 281/418 (67%), Gaps = 15/418 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKR---SIYYCI  175
             + F+D+AL LVG++   T    L  G   L  I   +   +  A F+FW+R   S Y+ +
Sbjct  95    ADFFDIALHLVGKYPH-TARIELPYGNSALKRIALKESAFLGVARFNFWERFISSTYFYL  153

Query  176   SKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLR  355
               +S      V ++   K I  K +MH QA +L+KCLC  + +LN Y +   +  +A++ 
Sbjct  154   RAHS------VPRI---KVIHDKKMMHHQALELVKCLCKHMGSLN-YTEAAPIYREAMIT  203

Query  356   AVHLDIAEVVLSIVEAYPTMAYCSDHNDLN-ILHIAIENRCENIFNLIRGTSVLVHNLQD  532
             A  + I EV+  IVEA+P   Y       + I H+A +NRCE ++NLI  TS   H   D
Sbjct  204   AARVGIHEVIEVIVEAFPAAIYNRHATTKHFIFHLAAQNRCEKVYNLIYQTSGHKHQYAD  263

Query  533   TINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKT  712
               + +GN +++LAA LAP HKLNLVSGAALQMQRELQWFKEV+K   PY     +  GKT
Sbjct  264   AKDSSGNTLLHLAAGLAPPHKLNLVSGAALQMQRELQWFKEVEKFVHPYTKERPNYAGKT  323

Query  713   PEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSS  892
             P+M FTE H+ LKIEGEKWMKDTA SCTIAAALI TVVFAAAITVPGGN    G PIF  
Sbjct  324   PKMVFTEEHKDLKIEGEKWMKDTANSCTIAAALIATVVFAAAITVPGGNESTTGYPIFLK  383

Query  893   HNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILM  1072
               AF +FA+S+A SLFT+ TSLL+FLS+LTSRYAE+DFLYALP RL IGL TLF SI+ M
Sbjct  384   SGAFVLFAVSDAVSLFTSTTSLLMFLSILTSRYAEEDFLYALPKRLCIGLFTLFVSILFM  443

Query  1073  MTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
               AFS+T+YLVFG N  W+ + V ALA LPI+SFVLLQFPLLV ++SSTYG GIF ++
Sbjct  444   TIAFSATLYLVFGLNNRWVVMPVAALACLPISSFVLLQFPLLVDVISSTYGRGIFGKQ  501



>ref|XP_011078078.1| PREDICTED: uncharacterized protein LOC105161921 [Sesamum indicum]
Length=763

 Score =   343 bits (881),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 218/442 (49%), Positives = 292/442 (66%), Gaps = 30/442 (7%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             ++F+++AL LV ++ D+     L      L  I       ++   F+FW+R I YC+S  
Sbjct  318   AEFFEIALYLVKKYPDLAR-LKLPDNTSALKKITAKKSVFVSEQRFNFWQRCISYCVSME  376

Query  185   SASTQNF---------------------------VSQLLLWKSIPKKILMHQQATDLLKC  283
             + S   F                           V  L   KSI +K L+ QQA +++KC
Sbjct  377   TISRPQFTKGCDIESMAQNSQTVFQSLQGMLLNVVDGLGAIKSIKEKTLLKQQALEVVKC  436

Query  284   LCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYC-SDHNDLNILHIA  460
             LC E++ L+ + +   +  DA++ A  L I EVV  IV  +P+  YC +  ++  I H+A
Sbjct  437   LCKEIELLS-FMEAKDIYFDAIMVAAQLGIHEVVEEIVGTFPSAIYCLTPGSNQYIFHVA  495

Query  461   IENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQREL  640
             +ENR ++++NLI   S   H   D  + NGN++++LA KLAP HKLN +SGAALQMQ E+
Sbjct  496   VENRSKHVYNLIYQMSDHKHLYSDLQDSNGNNLLHLAGKLAPPHKLNEISGAALQMQHEI  555

Query  641   QWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivt  820
             QW+KEV+    P+    ++  GK+P+M FTE H++LK EGEKWMKDT+ SCTIAAALI T
Sbjct  556   QWYKEVENFVHPHSRERLNYAGKSPKMVFTEEHKILKEEGEKWMKDTSNSCTIAAALIAT  615

Query  821   vvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQ  1000
             V+FAAAITVPGGN  +NG PIFS ++AF +FAIS+A SLFT+ATSLL+FL++LTSRYAE+
Sbjct  616   VMFAAAITVPGGNDSSNGFPIFSGNSAFIMFAISDAVSLFTSATSLLMFLAILTSRYAEE  675

Query  1001  DFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVL  1180
             DFLY LP RLIIGL TLF SI  MM AFS+T+YLVFG+ +SW+ I V  LA LP+TSFVL
Sbjct  676   DFLYVLPKRLIIGLGTLFLSITFMMVAFSATLYLVFGRKESWVLIPVGVLACLPVTSFVL  735

Query  1181  LQFPLLVALVSSTYGPGIFSQR  1246
             LQFPLLV LV STYGPGIF ++
Sbjct  736   LQFPLLVDLVYSTYGPGIFGKQ  757



>ref|XP_006342275.1| PREDICTED: uncharacterized protein LOC102591855 [Solanum tuberosum]
Length=764

 Score =   324 bits (831),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 223/453 (49%), Positives = 296/453 (65%), Gaps = 43/453 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             S  YD A ELV  + D+  + +   G   L  +   +   ++ ++ +FW++ +YYC+  N
Sbjct  311   SDLYDFARELVEDYPDLAKYDS--EGKSALKELAMKEFTFLSGSHLNFWQQLVYYCVPVN  368

Query  185   SAST---------------------------QNFVSQL--LLW----------KSIPKKI  247
             S S                            +  + +L  L++          K I KK 
Sbjct  369   STSRSRQRRPNANDLENDSQMVKTKYVRIYFRTVIKKLHTLIFGVLEIVVPPLKHIRKKK  428

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             L+H  A    +CLC++++TLND  +V S+ S  LL A   D  E+V  I   +P++AYC 
Sbjct  429   LIHHNAVKYAECLCEKIETLND-KEVDSIVSRPLLDAACYDTYELVEIIFRKFPSLAYCY  487

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             D +  NI HIAIE+RCEN+FNLI   S L H L  +++ +GN +++LA K+A Q+KLNLV
Sbjct  488   DQDSKNIFHIAIEHRCENVFNLICQMSQLRHQLMVSVDSSGNTVLHLAGKMA-QNKLNLV  546

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SG ALQMQRELQWFKEV+KI  P +   ++     P + FT+ H  LK++GEKWMKDT++
Sbjct  547   SGPALQMQRELQWFKEVKKIVPPLYWESLNGEKNAPYVVFTDEHEKLKVDGEKWMKDTSS  606

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             SCTIAAALI T+ FAAAITVPGGN    GLPIFS + AF +FAISNAASLFT++TSLLVF
Sbjct  607   SCTIAAALIATIAFAAAITVPGGNEQQTGLPIFSGNIAFIIFAISNAASLFTSSTSLLVF  666

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
             LSVLTSRYAE+DFL+ LP  LI+GL+TLF SI  MM +FS+T+YLVFG+ KSW+ + V  
Sbjct  667   LSVLTSRYAEEDFLHTLPRSLILGLLTLFLSITSMMISFSATVYLVFGEKKSWVLVPVAT  726

Query  1148  LASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +A LPITSFVLLQFPLLVAL+SSTYG GIF ++
Sbjct  727   MACLPITSFVLLQFPLLVALISSTYGAGIFGKK  759



>ref|XP_010321575.1| PREDICTED: uncharacterized protein LOC101250994 isoform X2 [Solanum 
lycopersicum]
Length=700

 Score =   320 bits (820),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 221/457 (48%), Positives = 292/457 (64%), Gaps = 45/457 (10%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI---  175
             S  YD A +LV  + D+  +     G   L  +   +   ++ ++ +FW++ +YYC+   
Sbjct  243   SDLYDFARQLVEDYLDLAKYDL--DGKSALKELAMKEFTFLSGSHLNFWQQLLYYCVPVK  300

Query  176   --------SKNSASTQNFV--SQLLLWKS-----------------------------IP  238
                       N+   +N V  SQ++  KS                             I 
Sbjct  301   LTSRSRQRKPNANDLENVVNNSQMVKTKSVRIYIRNVIKTLHSLLFNFVEILVPPLKNIR  360

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMA  418
             KK  +H  A    +CLC +++ LND  +V S+ S  LL A   D  E+V  IV  +P++A
Sbjct  361   KKKSIHHYAVMYAECLCKKIERLND-KEVDSIVSRPLLDAACYDTYELVEIIVRRFPSLA  419

Query  419   YCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
             YC D +  NILHIAIE RCEN+FNL+R  S   H L  + + + N++++LA  LAP++KL
Sbjct  420   YCYDRDSKNILHIAIEYRCENVFNLVRRMSQFRHQLMISTDSSNNNVLHLAGMLAPRNKL  479

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
             NLVSG ALQMQRELQWFKEV+KI  P +   ++  G  P   FT+ H  LK++GEKWMKD
Sbjct  480   NLVSGPALQMQRELQWFKEVKKIVPPLYWEFLNGEGDAPYAVFTDKHEKLKVDGEKWMKD  539

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             T++SCT AAALI T+ FAAAITVPGGN   +GLPIFS + AF +FAISNAASLFT++TSL
Sbjct  540   TSSSCTTAAALIATIAFAAAITVPGGNEQQSGLPIFSWNIAFIIFAISNAASLFTSSTSL  599

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             LVFLS+LTSRYAE+DFL+ LP  LI+GL+TLF SI  MM +FSST+YLVFGQ KSW+ + 
Sbjct  600   LVFLSILTSRYAEEDFLHTLPRSLILGLLTLFLSITSMMISFSSTVYLVFGQKKSWVLLP  659

Query  1139  VPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             V  +A LPITSFVLLQFPLL+AL+SSTYG GIF ++ 
Sbjct  660   VATMACLPITSFVLLQFPLLIALISSTYGDGIFKKKS  696



>ref|XP_010321574.1| PREDICTED: uncharacterized protein LOC101250994 isoform X1 [Solanum 
lycopersicum]
Length=766

 Score =   319 bits (818),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 221/457 (48%), Positives = 292/457 (64%), Gaps = 45/457 (10%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI---  175
             S  YD A +LV  + D+  +     G   L  +   +   ++ ++ +FW++ +YYC+   
Sbjct  309   SDLYDFARQLVEDYLDLAKYDL--DGKSALKELAMKEFTFLSGSHLNFWQQLLYYCVPVK  366

Query  176   --------SKNSASTQNFV--SQLLLWKS-----------------------------IP  238
                       N+   +N V  SQ++  KS                             I 
Sbjct  367   LTSRSRQRKPNANDLENVVNNSQMVKTKSVRIYIRNVIKTLHSLLFNFVEILVPPLKNIR  426

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMA  418
             KK  +H  A    +CLC +++ LND  +V S+ S  LL A   D  E+V  IV  +P++A
Sbjct  427   KKKSIHHYAVMYAECLCKKIERLND-KEVDSIVSRPLLDAACYDTYELVEIIVRRFPSLA  485

Query  419   YCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
             YC D +  NILHIAIE RCEN+FNL+R  S   H L  + + + N++++LA  LAP++KL
Sbjct  486   YCYDRDSKNILHIAIEYRCENVFNLVRRMSQFRHQLMISTDSSNNNVLHLAGMLAPRNKL  545

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
             NLVSG ALQMQRELQWFKEV+KI  P +   ++  G  P   FT+ H  LK++GEKWMKD
Sbjct  546   NLVSGPALQMQRELQWFKEVKKIVPPLYWEFLNGEGDAPYAVFTDKHEKLKVDGEKWMKD  605

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             T++SCT AAALI T+ FAAAITVPGGN   +GLPIFS + AF +FAISNAASLFT++TSL
Sbjct  606   TSSSCTTAAALIATIAFAAAITVPGGNEQQSGLPIFSWNIAFIIFAISNAASLFTSSTSL  665

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             LVFLS+LTSRYAE+DFL+ LP  LI+GL+TLF SI  MM +FSST+YLVFGQ KSW+ + 
Sbjct  666   LVFLSILTSRYAEEDFLHTLPRSLILGLLTLFLSITSMMISFSSTVYLVFGQKKSWVLLP  725

Query  1139  VPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             V  +A LPITSFVLLQFPLL+AL+SSTYG GIF ++ 
Sbjct  726   VATMACLPITSFVLLQFPLLIALISSTYGDGIFKKKS  762



>ref|XP_009629768.1| PREDICTED: uncharacterized protein LOC104119870 [Nicotiana tomentosiformis]
Length=591

 Score =   314 bits (805),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 218/456 (48%), Positives = 285/456 (63%), Gaps = 46/456 (10%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             S  YD A ELV QH D+  +         L  +   +   ++ +  ++W+  ++ C+   
Sbjct  134   SDMYDFATELVKQHPDLAKNDEHEKSA--LKELAMKEFAFLSGSRLNYWQLLLFSCVPVR  191

Query  185   SAST----------------QNFVSQL-------------------LLWKSIP------K  241
             S S                 Q F  +L                   +L K +P      +
Sbjct  192   STSRSHKRIPNDVENVTDEPQMFKPKLCERLYFRTVIKKLGALLFDVLEKCMPPLLHVRE  251

Query  242   KILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAY  421
             K   H  A    +CLC++++ L+ + +V S+ S  LL A      E+V  IV  +P++ Y
Sbjct  252   KKSKHYNAVKFAECLCEKIERLS-HEEVDSIVSRPLLEAARYGSYELVEIIVRKFPSLVY  310

Query  422   CSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLN  601
               D ND NI H+AIE+RCEN+FNL+   S   H L  + + + N +++LA KLAPQ+KLN
Sbjct  311   SIDRNDKNIFHLAIEHRCENVFNLVYQMSQHRHQLMISADSSRNTMLHLAGKLAPQNKLN  370

Query  602   LVSGAALQMQRELQWFKEVQKIALP-YFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
             LVSG ALQMQRELQWFKEV+K+  P Y+  C +E GK P + FT  H  LKI+GE+WMKD
Sbjct  371   LVSGPALQMQRELQWFKEVKKLVPPSYWEICNNE-GKIPSVVFTTEHAELKIKGEQWMKD  429

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             TA SCTIAAALI T+ FAAAITVPGGN   +GLP F+ + AF VF+ISNAASLFT++TSL
Sbjct  430   TANSCTIAAALIATIAFAAAITVPGGNDGESGLPTFARNVAFIVFSISNAASLFTSSTSL  489

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             LVFLSVLTSRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+Y+VFGQ K+++   
Sbjct  490   LVFLSVLTSRYAEEDFLYALPRSLILGLFTLFLSITLMTISFSATVYIVFGQKKAFVLAS  549

Query  1139  VPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             V  LA LPI SFVLLQFPLLVAL+SSTYG GIF ++
Sbjct  550   VATLACLPIVSFVLLQFPLLVALMSSTYGHGIFGKK  585



>ref|XP_010321571.1| PREDICTED: uncharacterized protein LOC101249269 isoform X2 [Solanum 
lycopersicum]
Length=721

 Score =   316 bits (810),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 207/434 (48%), Positives = 283/434 (65%), Gaps = 26/434 (6%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI---  175
             S  YD A+ELV +  D+  +     G   L  +   +   ++ +  +FW++ +YY +   
Sbjct  289   SNLYDFAIELVEKFPDLAKYD--RHGRSALKDLANKEFTSLDKSRLNFWEQLLYYYVPIK  346

Query  176   --------SKNSASTQN------------FVSQLLLWKSIPKKILMHQQATDLLKCLCDE  295
                       N+   +N            ++S +   K +  K  +H  A     CLC++
Sbjct  347   LTSRSLQKRPNANDLENDTQMVKTEYERIYLSIVPYLKHVRDKKSIHHNAVKYATCLCEK  406

Query  296   LKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRC  475
             L+ +N Y +V S+ +++LL A   D  E+V  I++ +P +A+  DHN  NILHIAIENRC
Sbjct  407   LENMN-YEEVDSIVANSLLDAACYDNYELVELILKKFPHLAFYEDHNGKNILHIAIENRC  465

Query  476   ENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKE  655
             +N+F L+   S ++++L    + +GN I++LA KLAPQ+KLNLVSG A QMQ ELQWFKE
Sbjct  466   KNVFKLVCQMSQILNHLVIYFDSSGNTILDLAGKLAPQNKLNLVSGPAFQMQLELQWFKE  525

Query  656   VQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaa  835
             V+KI    F   ++   K P + FTE H  LK++GEKWMKDT++SCTI A+LI T+ FAA
Sbjct  526   VKKIVPSSFWRRLNLEKKAPYVVFTEEHEKLKVDGEKWMKDTSSSCTIGASLIATIAFAA  585

Query  836   aitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYA  1015
             AITVPGGN   +G P FS   AF +F+ISNAASLFT++TSLLVFLSVLTSRYAE+DFL+ 
Sbjct  586   AITVPGGNDQNSGFPTFSGSIAFIIFSISNAASLFTSSTSLLVFLSVLTSRYAEEDFLHT  645

Query  1016  LPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPL  1195
             LP  LI+GL+TLF SI   + +FS+T+YL+FGQ K+W+ I V  +A LPITSFVLLQFPL
Sbjct  646   LPRSLIMGLLTLFLSITSTIISFSATVYLMFGQKKAWVLIPVATMACLPITSFVLLQFPL  705

Query  1196  LVALVSSTYGPGIF  1237
             LVAL+SSTYG G F
Sbjct  706   LVALISSTYGAGTF  719



>ref|XP_010321570.1| PREDICTED: uncharacterized protein LOC101249269 isoform X1 [Solanum 
lycopersicum]
Length=737

 Score =   310 bits (793),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 210/450 (47%), Positives = 285/450 (63%), Gaps = 42/450 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI---  175
             S  YD A+ELV +  D+  +     G   L  +   +   ++ +  +FW++ +YY +   
Sbjct  289   SNLYDFAIELVEKFPDLAKYD--RHGRSALKDLANKEFTSLDKSRLNFWEQLLYYYVPIK  346

Query  176   --------SKNSASTQN----------------FVSQL--LLW----------KSIPKKI  247
                       N+   +N                 + QL  LL+          K +  K 
Sbjct  347   LTSRSLQKRPNANDLENDTQMVKTEYERIYLSIVIKQLHTLLFDVLEMLVPYLKHVRDKK  406

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
              +H  A     CLC++L+ +N Y +V S+ +++LL A   D  E+V  I++ +P +A+  
Sbjct  407   SIHHNAVKYATCLCEKLENMN-YEEVDSIVANSLLDAACYDNYELVELILKKFPHLAFYE  465

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             DHN  NILHIAIENRC+N+F L+   S ++++L    + +GN I++LA KLAPQ+KLNLV
Sbjct  466   DHNGKNILHIAIENRCKNVFKLVCQMSQILNHLVIYFDSSGNTILDLAGKLAPQNKLNLV  525

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SG A QMQ ELQWFKEV+KI    F   ++   K P + FTE H  LK++GEKWMKDT++
Sbjct  526   SGPAFQMQLELQWFKEVKKIVPSSFWRRLNLEKKAPYVVFTEEHEKLKVDGEKWMKDTSS  585

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             SCTI A+LI T+ FAAAITVPGGN   +G P FS   AF +F+ISNAASLFT++TSLLVF
Sbjct  586   SCTIGASLIATIAFAAAITVPGGNDQNSGFPTFSGSIAFIIFSISNAASLFTSSTSLLVF  645

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
             LSVLTSRYAE+DFL+ LP  LI+GL+TLF SI   + +FS+T+YL+FGQ K+W+ I V  
Sbjct  646   LSVLTSRYAEEDFLHTLPRSLIMGLLTLFLSITSTIISFSATVYLMFGQKKAWVLIPVAT  705

Query  1148  LASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             +A LPITSFVLLQFPLLVAL+SSTYG G F
Sbjct  706   MACLPITSFVLLQFPLLVALISSTYGAGTF  735



>ref|XP_010321572.1| PREDICTED: uncharacterized protein LOC101249269 isoform X3 [Solanum 
lycopersicum]
Length=688

 Score =   307 bits (787),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 190/337 (56%), Positives = 247/337 (73%), Gaps = 1/337 (0%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K +  K  +H  A     CLC++L+ +N Y +V S+ +++LL A   D  E+V  I++ +
Sbjct  351   KHVRDKKSIHHNAVKYATCLCEKLENMN-YEEVDSIVANSLLDAACYDNYELVELILKKF  409

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
             P +A+  DHN  NILHIAIENRC+N+F L+   S ++++L    + +GN I++LA KLAP
Sbjct  410   PHLAFYEDHNGKNILHIAIENRCKNVFKLVCQMSQILNHLVIYFDSSGNTILDLAGKLAP  469

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
             Q+KLNLVSG A QMQ ELQWFKEV+KI    F   ++   K P + FTE H  LK++GEK
Sbjct  470   QNKLNLVSGPAFQMQLELQWFKEVKKIVPSSFWRRLNLEKKAPYVVFTEEHEKLKVDGEK  529

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WMKDT++SCTI A+LI T+ FAAAITVPGGN   +G P FS   AF +F+ISNAASLFT+
Sbjct  530   WMKDTSSSCTIGASLIATIAFAAAITVPGGNDQNSGFPTFSGSIAFIIFSISNAASLFTS  589

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
             +TSLLVFLSVLTSRYAE+DFL+ LP  LI+GL+TLF SI   + +FS+T+YL+FGQ K+W
Sbjct  590   STSLLVFLSVLTSRYAEEDFLHTLPRSLIMGLLTLFLSITSTIISFSATVYLMFGQKKAW  649

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             + I V  +A LPITSFVLLQFPLLVAL+SSTYG G F
Sbjct  650   VLIPVATMACLPITSFVLLQFPLLVALISSTYGAGTF  686



>ref|XP_009783944.1| PREDICTED: uncharacterized protein LOC104232428 isoform X4 [Nicotiana 
sylvestris]
Length=724

 Score =   303 bits (775),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 211/448 (47%), Positives = 284/448 (63%), Gaps = 36/448 (8%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHH---------AALNMGVPPLDAIVKYDCPIINTANFSFWKR  157
             S  YD A ELV +H D+  +           L M      +  + +C   + ++ + W+R
Sbjct  273   SDMYDFATELVTKHPDLAKNDTDERSSALKELAMKEFAFRSGSRLNCWQRSGSHLNCWQR  332

Query  158   SIYYC---------ISKNSASTQNFVSQLLLWKS-----IPKKILM-----------HQQ  262
               + C         I  +  S  N   Q+L  KS     I ++I             H  
Sbjct  333   LFFSCQLQEVTHERIPDDIESVTN-ERQMLKPKSCWLSPICERIYFITAPPLKHNKKHYN  391

Query  263   ATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDL  442
             A  L +CLC+++++L+ +++V S+ S  LL A      E+V  IV  +P++ + +D +  
Sbjct  392   ALKLAECLCEKIESLS-HDEVVSIVSRPLLEAARYGSYELVEIIVRKFPSLVHFTDRSGK  450

Query  443   NILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAAL  622
             NI HIAIE+RCEN+FNL+   S   H L  +I+ + N +++LA KLAPQ+KLNLVSG AL
Sbjct  451   NIFHIAIEHRCENVFNLVYQMSQHRHQLMISIDSSHNTMLHLAGKLAPQNKLNLVSGPAL  510

Query  623   QMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
              MQRELQWFK V+K+  P +    +   K P   FT+ H  LKI GE+WMK TA SCTIA
Sbjct  511   HMQRELQWFKAVKKLVPPSYWEFGNNEDKIPAEVFTKEHAELKINGEEWMKATANSCTIA  570

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
             AAL+ T+ FAAAITVPGGN + +GLPIFS ++AF++FAISNAASLF ++TS+LVFLSVLT
Sbjct  571   AALVATIAFAAAITVPGGNDNESGLPIFSRNSAFSMFAISNAASLFASSTSMLVFLSVLT  630

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLP  1162
             SRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+YLV GQ KS++ + V  LA LP
Sbjct  631   SRYAEEDFLYALPRSLILGLFTLFLSITLMTLSFSATVYLVSGQRKSYVLVPVAILACLP  690

Query  1163  ITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             I SFVL+QFPLL AL+SSTYG GIF ++
Sbjct  691   IISFVLMQFPLLAALISSTYGRGIFGKK  718



>ref|XP_009619908.1| PREDICTED: uncharacterized protein LOC104111831 isoform X4 [Nicotiana 
tomentosiformis]
Length=737

 Score =   302 bits (774),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 244/331 (74%), Gaps = 1/331 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  A  L +CLC+++++L+ + +V S+ S  LL A      E+V  IV  +P++ + +D 
Sbjct  402   HYNALKLAECLCEKIESLS-HEEVVSIVSRPLLEAARYGSYELVEIIVRKFPSLVHFTDR  460

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +  NI HIAIE+RCEN+FNL+   S   H L  +I+ + N +++LA KLAPQ+KLNLVSG
Sbjct  461   SGKNIFHIAIEHRCENVFNLVYQMSQHRHQLMISIDSSRNTMLHLAGKLAPQNKLNLVSG  520

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
              AL MQRELQWFK V+K+  P +    +   K P   FT+ H  LKI GE+WMK TA SC
Sbjct  521   PALHMQRELQWFKAVKKLVPPSYWEFGNNEDKIPAEVFTKEHAELKINGEEWMKATANSC  580

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             TIAAAL+ T+ FAAAITVPGGN++ +GLPIFS ++AF++FAISNAASLF ++TS+LVFLS
Sbjct  581   TIAAALVATIAFAAAITVPGGNNNESGLPIFSRNSAFSIFAISNAASLFASSTSMLVFLS  640

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             VLTSRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+YLV GQ KS++ + V  LA
Sbjct  641   VLTSRYAEEDFLYALPRSLILGLFTLFLSITLMTLSFSATVYLVSGQRKSYVLVPVATLA  700

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              LPI SFVL+QFPLL AL+SSTYG GIF ++
Sbjct  701   CLPIISFVLMQFPLLAALISSTYGRGIFGKK  731



>ref|XP_009619909.1| PREDICTED: uncharacterized protein LOC104111831 isoform X5 [Nicotiana 
tomentosiformis]
Length=728

 Score =   302 bits (773),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 244/331 (74%), Gaps = 1/331 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  A  L +CLC+++++L+ + +V S+ S  LL A      E+V  IV  +P++ + +D 
Sbjct  393   HYNALKLAECLCEKIESLS-HEEVVSIVSRPLLEAARYGSYELVEIIVRKFPSLVHFTDR  451

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +  NI HIAIE+RCEN+FNL+   S   H L  +I+ + N +++LA KLAPQ+KLNLVSG
Sbjct  452   SGKNIFHIAIEHRCENVFNLVYQMSQHRHQLMISIDSSRNTMLHLAGKLAPQNKLNLVSG  511

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
              AL MQRELQWFK V+K+  P +    +   K P   FT+ H  LKI GE+WMK TA SC
Sbjct  512   PALHMQRELQWFKAVKKLVPPSYWEFGNNEDKIPAEVFTKEHAELKINGEEWMKATANSC  571

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             TIAAAL+ T+ FAAAITVPGGN++ +GLPIFS ++AF++FAISNAASLF ++TS+LVFLS
Sbjct  572   TIAAALVATIAFAAAITVPGGNNNESGLPIFSRNSAFSIFAISNAASLFASSTSMLVFLS  631

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             VLTSRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+YLV GQ KS++ + V  LA
Sbjct  632   VLTSRYAEEDFLYALPRSLILGLFTLFLSITLMTLSFSATVYLVSGQRKSYVLVPVATLA  691

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              LPI SFVL+QFPLL AL+SSTYG GIF ++
Sbjct  692   CLPIISFVLMQFPLLAALISSTYGRGIFGKK  722



>ref|XP_009619907.1| PREDICTED: uncharacterized protein LOC104111831 isoform X3 [Nicotiana 
tomentosiformis]
Length=744

 Score =   302 bits (773),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 244/331 (74%), Gaps = 1/331 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  A  L +CLC+++++L+ + +V S+ S  LL A      E+V  IV  +P++ + +D 
Sbjct  409   HYNALKLAECLCEKIESLS-HEEVVSIVSRPLLEAARYGSYELVEIIVRKFPSLVHFTDR  467

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +  NI HIAIE+RCEN+FNL+   S   H L  +I+ + N +++LA KLAPQ+KLNLVSG
Sbjct  468   SGKNIFHIAIEHRCENVFNLVYQMSQHRHQLMISIDSSRNTMLHLAGKLAPQNKLNLVSG  527

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
              AL MQRELQWFK V+K+  P +    +   K P   FT+ H  LKI GE+WMK TA SC
Sbjct  528   PALHMQRELQWFKAVKKLVPPSYWEFGNNEDKIPAEVFTKEHAELKINGEEWMKATANSC  587

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             TIAAAL+ T+ FAAAITVPGGN++ +GLPIFS ++AF++FAISNAASLF ++TS+LVFLS
Sbjct  588   TIAAALVATIAFAAAITVPGGNNNESGLPIFSRNSAFSIFAISNAASLFASSTSMLVFLS  647

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             VLTSRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+YLV GQ KS++ + V  LA
Sbjct  648   VLTSRYAEEDFLYALPRSLILGLFTLFLSITLMTLSFSATVYLVSGQRKSYVLVPVATLA  707

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              LPI SFVL+QFPLL AL+SSTYG GIF ++
Sbjct  708   CLPIISFVLMQFPLLAALISSTYGRGIFGKK  738



>ref|XP_009619906.1| PREDICTED: uncharacterized protein LOC104111831 isoform X2 [Nicotiana 
tomentosiformis]
Length=751

 Score =   302 bits (773),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 244/331 (74%), Gaps = 1/331 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  A  L +CLC+++++L+ + +V S+ S  LL A      E+V  IV  +P++ + +D 
Sbjct  416   HYNALKLAECLCEKIESLS-HEEVVSIVSRPLLEAARYGSYELVEIIVRKFPSLVHFTDR  474

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +  NI HIAIE+RCEN+FNL+   S   H L  +I+ + N +++LA KLAPQ+KLNLVSG
Sbjct  475   SGKNIFHIAIEHRCENVFNLVYQMSQHRHQLMISIDSSRNTMLHLAGKLAPQNKLNLVSG  534

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
              AL MQRELQWFK V+K+  P +    +   K P   FT+ H  LKI GE+WMK TA SC
Sbjct  535   PALHMQRELQWFKAVKKLVPPSYWEFGNNEDKIPAEVFTKEHAELKINGEEWMKATANSC  594

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             TIAAAL+ T+ FAAAITVPGGN++ +GLPIFS ++AF++FAISNAASLF ++TS+LVFLS
Sbjct  595   TIAAALVATIAFAAAITVPGGNNNESGLPIFSRNSAFSIFAISNAASLFASSTSMLVFLS  654

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             VLTSRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+YLV GQ KS++ + V  LA
Sbjct  655   VLTSRYAEEDFLYALPRSLILGLFTLFLSITLMTLSFSATVYLVSGQRKSYVLVPVATLA  714

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              LPI SFVL+QFPLL AL+SSTYG GIF ++
Sbjct  715   CLPIISFVLMQFPLLAALISSTYGRGIFGKK  745



>ref|XP_009619904.1| PREDICTED: uncharacterized protein LOC104111831 isoform X1 [Nicotiana 
tomentosiformis]
Length=755

 Score =   302 bits (774),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 244/331 (74%), Gaps = 1/331 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  A  L +CLC+++++L+ + +V S+ S  LL A      E+V  IV  +P++ + +D 
Sbjct  420   HYNALKLAECLCEKIESLS-HEEVVSIVSRPLLEAARYGSYELVEIIVRKFPSLVHFTDR  478

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +  NI HIAIE+RCEN+FNL+   S   H L  +I+ + N +++LA KLAPQ+KLNLVSG
Sbjct  479   SGKNIFHIAIEHRCENVFNLVYQMSQHRHQLMISIDSSRNTMLHLAGKLAPQNKLNLVSG  538

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
              AL MQRELQWFK V+K+  P +    +   K P   FT+ H  LKI GE+WMK TA SC
Sbjct  539   PALHMQRELQWFKAVKKLVPPSYWEFGNNEDKIPAEVFTKEHAELKINGEEWMKATANSC  598

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             TIAAAL+ T+ FAAAITVPGGN++ +GLPIFS ++AF++FAISNAASLF ++TS+LVFLS
Sbjct  599   TIAAALVATIAFAAAITVPGGNNNESGLPIFSRNSAFSIFAISNAASLFASSTSMLVFLS  658

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             VLTSRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+YLV GQ KS++ + V  LA
Sbjct  659   VLTSRYAEEDFLYALPRSLILGLFTLFLSITLMTLSFSATVYLVSGQRKSYVLVPVATLA  718

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              LPI SFVL+QFPLL AL+SSTYG GIF ++
Sbjct  719   CLPIISFVLMQFPLLAALISSTYGRGIFGKK  749



>ref|XP_009783943.1| PREDICTED: uncharacterized protein LOC104232428 isoform X3 [Nicotiana 
sylvestris]
Length=733

 Score =   301 bits (771),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 244/331 (74%), Gaps = 1/331 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  A  L +CLC+++++L+ +++V S+ S  LL A      E+V  IV  +P++ + +D 
Sbjct  398   HYNALKLAECLCEKIESLS-HDEVVSIVSRPLLEAARYGSYELVEIIVRKFPSLVHFTDR  456

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +  NI HIAIE+RCEN+FNL+   S   H L  +I+ + N +++LA KLAPQ+KLNLVSG
Sbjct  457   SGKNIFHIAIEHRCENVFNLVYQMSQHRHQLMISIDSSHNTMLHLAGKLAPQNKLNLVSG  516

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
              AL MQRELQWFK V+K+  P +    +   K P   FT+ H  LKI GE+WMK TA SC
Sbjct  517   PALHMQRELQWFKAVKKLVPPSYWEFGNNEDKIPAEVFTKEHAELKINGEEWMKATANSC  576

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             TIAAAL+ T+ FAAAITVPGGN + +GLPIFS ++AF++FAISNAASLF ++TS+LVFLS
Sbjct  577   TIAAALVATIAFAAAITVPGGNDNESGLPIFSRNSAFSMFAISNAASLFASSTSMLVFLS  636

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             VLTSRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+YLV GQ KS++ + V  LA
Sbjct  637   VLTSRYAEEDFLYALPRSLILGLFTLFLSITLMTLSFSATVYLVSGQRKSYVLVPVAILA  696

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              LPI SFVL+QFPLL AL+SSTYG GIF ++
Sbjct  697   CLPIISFVLMQFPLLAALISSTYGRGIFGKK  727



>ref|XP_009783942.1| PREDICTED: uncharacterized protein LOC104232428 isoform X2 [Nicotiana 
sylvestris]
Length=740

 Score =   301 bits (770),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 244/331 (74%), Gaps = 1/331 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  A  L +CLC+++++L+ +++V S+ S  LL A      E+V  IV  +P++ + +D 
Sbjct  405   HYNALKLAECLCEKIESLS-HDEVVSIVSRPLLEAARYGSYELVEIIVRKFPSLVHFTDR  463

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +  NI HIAIE+RCEN+FNL+   S   H L  +I+ + N +++LA KLAPQ+KLNLVSG
Sbjct  464   SGKNIFHIAIEHRCENVFNLVYQMSQHRHQLMISIDSSHNTMLHLAGKLAPQNKLNLVSG  523

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
              AL MQRELQWFK V+K+  P +    +   K P   FT+ H  LKI GE+WMK TA SC
Sbjct  524   PALHMQRELQWFKAVKKLVPPSYWEFGNNEDKIPAEVFTKEHAELKINGEEWMKATANSC  583

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             TIAAAL+ T+ FAAAITVPGGN + +GLPIFS ++AF++FAISNAASLF ++TS+LVFLS
Sbjct  584   TIAAALVATIAFAAAITVPGGNDNESGLPIFSRNSAFSMFAISNAASLFASSTSMLVFLS  643

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             VLTSRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+YLV GQ KS++ + V  LA
Sbjct  644   VLTSRYAEEDFLYALPRSLILGLFTLFLSITLMTLSFSATVYLVSGQRKSYVLVPVAILA  703

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              LPI SFVL+QFPLL AL+SSTYG GIF ++
Sbjct  704   CLPIISFVLMQFPLLAALISSTYGRGIFGKK  734



>ref|XP_009783941.1| PREDICTED: uncharacterized protein LOC104232428 isoform X1 [Nicotiana 
sylvestris]
Length=751

 Score =   301 bits (771),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 187/331 (56%), Positives = 244/331 (74%), Gaps = 1/331 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  A  L +CLC+++++L+ +++V S+ S  LL A      E+V  IV  +P++ + +D 
Sbjct  416   HYNALKLAECLCEKIESLS-HDEVVSIVSRPLLEAARYGSYELVEIIVRKFPSLVHFTDR  474

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +  NI HIAIE+RCEN+FNL+   S   H L  +I+ + N +++LA KLAPQ+KLNLVSG
Sbjct  475   SGKNIFHIAIEHRCENVFNLVYQMSQHRHQLMISIDSSHNTMLHLAGKLAPQNKLNLVSG  534

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
              AL MQRELQWFK V+K+  P +    +   K P   FT+ H  LKI GE+WMK TA SC
Sbjct  535   PALHMQRELQWFKAVKKLVPPSYWEFGNNEDKIPAEVFTKEHAELKINGEEWMKATANSC  594

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             TIAAAL+ T+ FAAAITVPGGN + +GLPIFS ++AF++FAISNAASLF ++TS+LVFLS
Sbjct  595   TIAAALVATIAFAAAITVPGGNDNESGLPIFSRNSAFSMFAISNAASLFASSTSMLVFLS  654

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             VLTSRYAE+DFLYALP  LI+GL TLF SI LM  +FS+T+YLV GQ KS++ + V  LA
Sbjct  655   VLTSRYAEEDFLYALPRSLILGLFTLFLSITLMTLSFSATVYLVSGQRKSYVLVPVAILA  714

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              LPI SFVL+QFPLL AL+SSTYG GIF ++
Sbjct  715   CLPIISFVLMQFPLLAALISSTYGRGIFGKK  745



>ref|XP_011093854.1| PREDICTED: alpha-latrocrustotoxin-Lt1a-like isoform X2 [Sesamum 
indicum]
Length=648

 Score =   297 bits (761),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 206/439 (47%), Positives = 270/439 (62%), Gaps = 37/439 (8%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVP-PLDAIVKYDCPIINTANFSFWKRSIYYCISK  181
             ++FYD+AL LV  + ++    +   G+P     I   D  +      S    S  YC   
Sbjct  218   AEFYDLALYLVQLYPNLATLRS-PAGLPAKFGNIYSQDESVKGNPAVSTLTASKRYCAP-  275

Query  182   NSASTQNFVSQL----------LLWKSI----PK------KILMHQQATDLLKCLCDELK  301
                    F+ QL          +LWK I    P+      K +MH Q   L+KCLC E+ 
Sbjct  276   -------FLQQLSFPGCQKLHWVLWKVIEHIAPQARFIRDKRMMHCQTLQLIKCLCKEIT  328

Query  302   TLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCEN  481
              L DY+   S+    +L A  L   E+V  IVE++P   +  +    NI  +A+ NR EN
Sbjct  329   GL-DYSTAASMFETPILFAASLGNHEIVEEIVESFPPAIWSRNRMGQNIFLLAVANRREN  387

Query  482   IFNLIRGTS---VLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFK  652
             +FNL+   S    L   L+D     GN+I++LA KLAP  +LNLVS AALQMQRELQW+K
Sbjct  388   VFNLLYQMSEHKRLATQLRDV---EGNNILHLAGKLAPPAQLNLVSSAALQMQRELQWYK  444

Query  653   EVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfa  832
             EV+   LP F    +   +TP + F+  H+ L  EGEKWMKDTA SCT+AAALI T+ FA
Sbjct  445   EVETFVLPDFKDSKNSKRRTPAVEFSVEHKDLIKEGEKWMKDTANSCTVAAALIATIAFA  504

Query  833   aaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLY  1012
             A+ITVPGGN+  +G PIFS++ AF +FA+ +A SLF++  S+L+FLS+LT+RYAE DFLY
Sbjct  505   ASITVPGGNNGDSGFPIFSNNPAFNIFALFDALSLFSSTASMLMFLSILTARYAEGDFLY  564

Query  1013  ALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFP  1192
             +LP RLIIGL+TLF SI  MM AFS+T+YLVFGQ K+W  I V ALA LP+T FV LQFP
Sbjct  565   SLPKRLIIGLVTLFLSITSMMIAFSATLYLVFGQKKAWTLIPVAALACLPVTLFVTLQFP  624

Query  1193  LLVALVSSTYGPGIFSQRG  1249
             LLV +V STY PG+F +RG
Sbjct  625   LLVGIVRSTYFPGMFGKRG  643



>ref|XP_011093853.1| PREDICTED: alpha-latrocrustotoxin-Lt1a-like isoform X1 [Sesamum 
indicum]
Length=678

 Score =   298 bits (762),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 210/467 (45%), Positives = 281/467 (60%), Gaps = 63/467 (13%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVT------HHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIY  166
             ++FYD+AL LV  + ++        ++ALNM       I       +  ++ SF +R I 
Sbjct  218   AEFYDLALYLVQLYPNLATLRSPAGNSALNM-------IAGKSSAFLRRSSLSFLQRFID  270

Query  167   YCI--------SKNSASTQN---------------FVSQL----------LLWKSI----  235
              C+        S++ +   N               F+ QL          +LWK I    
Sbjct  271   SCLPAKFGNIYSQDESVKGNPAVSTLTASKRYCAPFLQQLSFPGCQKLHWVLWKVIEHIA  330

Query  236   PK------KILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIV  397
             P+      K +MH Q   L+KCLC E+  L DY+   S+    +L A  L   E+V  IV
Sbjct  331   PQARFIRDKRMMHCQTLQLIKCLCKEITGL-DYSTAASMFETPILFAASLGNHEIVEEIV  389

Query  398   EAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS---VLVHNLQDTINGNGNDIMNL  568
             E++P   +  +    NI  +A+ NR EN+FNL+   S    L   L+D     GN+I++L
Sbjct  390   ESFPPAIWSRNRMGQNIFLLAVANRRENVFNLLYQMSEHKRLATQLRDV---EGNNILHL  446

Query  569   AAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLL  748
             A KLAP  +LNLVS AALQMQRELQW+KEV+   LP F    +   +TP + F+  H+ L
Sbjct  447   AGKLAPPAQLNLVSSAALQMQRELQWYKEVETFVLPDFKDSKNSKRRTPAVEFSVEHKDL  506

Query  749   KIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNa  928
               EGEKWMKDTA SCT+AAALI T+ FAA+ITVPGGN+  +G PIFS++ AF +FA+ +A
Sbjct  507   IKEGEKWMKDTANSCTVAAALIATIAFAASITVPGGNNGDSGFPIFSNNPAFNIFALFDA  566

Query  929   aslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVF  1108
              SLF++  S+L+FLS+LT+RYAE DFLY+LP RLIIGL+TLF SI  MM AFS+T+YLVF
Sbjct  567   LSLFSSTASMLMFLSILTARYAEGDFLYSLPKRLIIGLVTLFLSITSMMIAFSATLYLVF  626

Query  1109  GQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             GQ K+W  I V ALA LP+T FV LQFPLLV +V STY PG+F +RG
Sbjct  627   GQKKAWTLIPVAALACLPVTLFVTLQFPLLVGIVRSTYFPGMFGKRG  673



>ref|XP_010694915.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=597

 Score =   294 bits (752),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 265/420 (63%), Gaps = 22/420 (5%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             ++FYD+AL+LV  + D+       +G  PL  + +      +  ++ FW + +       
Sbjct  190   AEFYDIALKLVNLYPDLATMELNGLG-SPLSVLAEKPNAFPSGCHWKFWPQVL-------  241

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVH  364
                  N  S L   K +    LMH QA  L+KCLC E+  L+D  + FS+  + L  A  
Sbjct  242   -----NPFSYL---KYVRDTKLMHHQAILLVKCLCLEIMELDD-AKAFSMLQEPLHLAAK  292

Query  365   LDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTING  544
             L I E +  IV A+P   +  +  + N+  +A+  R EN+FNLI   S   H +   I+ 
Sbjct  293   LGIDEFIEEIVGAFPPAIWSVNEENHNVFQLAVTYRRENVFNLIYQMSEYRHLVTRYIDP  352

Query  545   NGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMH  724
             +GN+I++LA +L P  +LNLVSGAALQMQRELQWFKEV+K   P + +  +  GKTP   
Sbjct  353   HGNNILHLAGRLPPPDRLNLVSGAALQMQRELQWFKEVEKFVQPAYKAWKNAKGKTPSFV  412

Query  725   FTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIF-----S  889
             F+E H+ L  EGEKWMKDTATSCT+AAALI TVVFAAAITVPGGN   +G P++      
Sbjct  413   FSEAHQNLVKEGEKWMKDTATSCTVAAALIATVVFAAAITVPGGNDQNSGTPLYVMPEQH  472

Query  890   SHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIIL  1069
                AF VF + +A SLF++ TS+L+FLS+LTSRYAE DFLYALP RLIIGL  L  SI  
Sbjct  473   QQRAFAVFGVFDAISLFSSVTSILMFLSILTSRYAEADFLYALPKRLIIGLSMLLISITS  532

Query  1070  MMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             +M AFSS +YLV GQNK W  ++V ALASLP+T F+ LQFPLL+ ++ +TYG GIF ++G
Sbjct  533   LMVAFSSALYLVLGQNKPWRLLLVGALASLPVTLFIFLQFPLLLEIMLATYGRGIFQKKG  592



>ref|XP_010694908.1| PREDICTED: uncharacterized protein LOC104907637 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=610

 Score =   287 bits (735),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 196/416 (47%), Positives = 261/416 (63%), Gaps = 22/416 (5%)
 Frame = +2

Query  17    DMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKNSAST  196
             D+AL+LV  + D+       +G P L  + +      +  ++ FW + +           
Sbjct  207   DIALKLVNLYPDLATMELNGLGSP-LSVLAEKPNAFPSGCHWKFWPQVL-----------  254

Query  197   QNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIA  376
              N  S L   K +    LMH QA  L+KCLC E+  L+D  + FS+  + L  A  L I 
Sbjct  255   -NPFSYL---KYVRDTKLMHHQAILLVKCLCLEIMELDD-AKAFSMLQEPLHLAAKLGID  309

Query  377   EVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGND  556
             E +  IV A+P   +  +  + N+  +A+  R EN+FNLI   S   H +   I+ +GN+
Sbjct  310   EFIEEIVGAFPPAIWSVNEENHNVFQLAVTYRRENVFNLIYQMSEYRHLVTRYIDPHGNN  369

Query  557   IMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTEN  736
             I++LA +L P  +LNLVSGAALQMQRELQWFKEV+K   P + +  +  GKTP   F+E 
Sbjct  370   ILHLAGRLPPPDRLNLVSGAALQMQRELQWFKEVEKFVQPAYKAWKNAKGKTPSFVFSEA  429

Query  737   HRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIF-----SSHNA  901
             H+ L  EGEKWMKDTATSCT+AAALI TVVFAAAITVPGGN   +G P++         A
Sbjct  430   HQNLVKEGEKWMKDTATSCTVAAALIATVVFAAAITVPGGNDQNSGTPLYVMPEQHQQRA  489

Query  902   FTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTA  1081
             F VF + +A SLF++ TS+L+FLS+LTSRYAE DFLYALP RLIIGL  L  SI  +M A
Sbjct  490   FAVFGVFDAISLFSSVTSILMFLSILTSRYAEADFLYALPKRLIIGLSMLLISITSLMVA  549

Query  1082  FSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             FSS +YLV GQNK W  ++V ALASLP+T F+ LQFPLL+ ++ +TYG GIF ++G
Sbjct  550   FSSALYLVLGQNKPWRLLLVGALASLPVTLFIFLQFPLLLEIMLATYGRGIFQKKG  605



>ref|XP_010694923.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=586

 Score =   286 bits (731),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 233/339 (69%), Gaps = 6/339 (2%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             LMH QA  L+KCLC E+  L+D  + FS+  + L  A  L I E +  IV A+P   +  
Sbjct  244   LMHHQAILLVKCLCLEIMELDD-AKAFSMLQEPLHLAAKLGIDEFIEEIVGAFPPAIWSV  302

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             +  + N+  +A+  R EN+FNLI   S   H +   I+ +GN+I++LA +L P  +LNLV
Sbjct  303   NEENHNVFQLAVTYRRENVFNLIYQMSEYRHLVTRYIDPHGNNILHLAGRLPPPDRLNLV  362

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGAALQMQRELQWFKEV+K   P + +  +  GKTP   F+E H+ L  EGEKWMKDTAT
Sbjct  363   SGAALQMQRELQWFKEVEKFVQPAYKAWKNAKGKTPSFVFSEAHQNLVKEGEKWMKDTAT  422

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIF-----SSHNAFTVFAISNaaslftaat  952
             SCT+AAALI TVVFAAAITVPGGN   +G P++         AF VF + +A SLF++ T
Sbjct  423   SCTVAAALIATVVFAAAITVPGGNDQNSGTPLYVMPEQHQQRAFAVFGVFDAISLFSSVT  482

Query  953   sllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIR  1132
             S+L+FLS+LTSRYAE DFLYALP RLIIGL  L  SI  +M AFSS +YLV GQNK W  
Sbjct  483   SILMFLSILTSRYAEADFLYALPKRLIIGLSMLLISITSLMVAFSSALYLVLGQNKPWRL  542

Query  1133  IIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             ++V ALASLP+T F+ LQFPLL+ ++ +TYG GIF ++G
Sbjct  543   LLVGALASLPVTLFIFLQFPLLLEIMLATYGRGIFQKKG  581



>ref|XP_010694898.1| PREDICTED: uncharacterized protein LOC104907637 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010694904.1| PREDICTED: uncharacterized protein LOC104907637 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=639

 Score =   287 bits (735),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 196/416 (47%), Positives = 261/416 (63%), Gaps = 22/416 (5%)
 Frame = +2

Query  17    DMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKNSAST  196
             D+AL+LV  + D+       +G P L  + +      +  ++ FW + +           
Sbjct  236   DIALKLVNLYPDLATMELNGLGSP-LSVLAEKPNAFPSGCHWKFWPQVL-----------  283

Query  197   QNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIA  376
              N  S L   K +    LMH QA  L+KCLC E+  L+D  + FS+  + L  A  L I 
Sbjct  284   -NPFSYL---KYVRDTKLMHHQAILLVKCLCLEIMELDD-AKAFSMLQEPLHLAAKLGID  338

Query  377   EVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGND  556
             E +  IV A+P   +  +  + N+  +A+  R EN+FNLI   S   H +   I+ +GN+
Sbjct  339   EFIEEIVGAFPPAIWSVNEENHNVFQLAVTYRRENVFNLIYQMSEYRHLVTRYIDPHGNN  398

Query  557   IMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTEN  736
             I++LA +L P  +LNLVSGAALQMQRELQWFKEV+K   P + +  +  GKTP   F+E 
Sbjct  399   ILHLAGRLPPPDRLNLVSGAALQMQRELQWFKEVEKFVQPAYKAWKNAKGKTPSFVFSEA  458

Query  737   HRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIF-----SSHNA  901
             H+ L  EGEKWMKDTATSCT+AAALI TVVFAAAITVPGGN   +G P++         A
Sbjct  459   HQNLVKEGEKWMKDTATSCTVAAALIATVVFAAAITVPGGNDQNSGTPLYVMPEQHQQRA  518

Query  902   FTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTA  1081
             F VF + +A SLF++ TS+L+FLS+LTSRYAE DFLYALP RLIIGL  L  SI  +M A
Sbjct  519   FAVFGVFDAISLFSSVTSILMFLSILTSRYAEADFLYALPKRLIIGLSMLLISITSLMVA  578

Query  1082  FSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             FSS +YLV GQNK W  ++V ALASLP+T F+ LQFPLL+ ++ +TYG GIF ++G
Sbjct  579   FSSALYLVLGQNKPWRLLLVGALASLPVTLFIFLQFPLLLEIMLATYGRGIFQKKG  634



>gb|EYU28334.1| hypothetical protein MIMGU_mgv1a023484mg [Erythranthe guttata]
Length=312

 Score =   271 bits (693),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 221/306 (72%), Gaps = 1/306 (0%)
 Frame = +2

Query  332   LASDALLRAVHLDIAEVVLSIVEAYPTMAYCS-DHNDLNILHIAIENRCENIFNLIRGTS  508
             +A+ ++  A +    EVV  IVEA+P + Y     +   I H+A+ +R E++FNLI+  S
Sbjct  1     MATSSIFAATNSGNYEVVEMIVEAFPNVIYAVVPLSRQPIFHVAVLSRSESVFNLIQQMS  60

Query  509   VLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSS  688
                +   D  + +GN++++ A KLAP HKLN +SGAALQMQRE+QW+K+V+K   P    
Sbjct  61    DHKYVHLDIEDDDGNNLLHAAGKLAPSHKLNEISGAALQMQREMQWYKQVEKTMNPSSRK  120

Query  689   CMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDA  868
               ++ GK+P M FTE H+ LK EGEKW+KDT+ SCTIAAALIVT++FAAAITVPGGN   
Sbjct  121   RENKQGKSPNMVFTEEHKKLKEEGEKWIKDTSESCTIAAALIVTIMFAAAITVPGGNESD  180

Query  869   NGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLIT  1048
              G P+F+    F VFAIS+A SLF + TSLL+FLS+LTSRYAE+DFL  LP RLIIGL T
Sbjct  181   TGFPVFAREKVFLVFAISDAISLFASTTSLLMFLSILTSRYAEEDFLSNLPKRLIIGLGT  240

Query  1049  LFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGP  1228
             LF SI  MM AFS+T+YLVFG+  +W+ I V ALA LP+TSFV LQFPLL  L+SST+GP
Sbjct  241   LFLSITFMMVAFSATLYLVFGRKNAWVLIPVAALACLPVTSFVFLQFPLLADLISSTFGP  300

Query  1229  GIFSQR  1246
             GIF ++
Sbjct  301   GIFRKQ  306



>emb|CDP03067.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   268 bits (686),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 219/332 (66%), Gaps = 1/332 (0%)
 Frame = +2

Query  251   MHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSD  430
             MH QA  L++CLC E+  L DY    S     ++         +V  I+ ++P   +  +
Sbjct  1     MHLQALQLVRCLCTEVSKL-DYATAASFFQQPIIVGASFGNNVIVEEILHSFPPAIWSRN  59

Query  431   HNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVS  610
             H   NI   A+ NR E IFNL+   S         ++   N+I++LA KLAP  +LNLVS
Sbjct  60    HEGHNIFMTAVANRREGIFNLLYQMSGHKRLALRLVDNKMNNILHLAGKLAPTAQLNLVS  119

Query  611   GAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATS  790
             GAALQMQRELQW+KEV+K  LP   +  +  G+TP + F+  H+ L  EGEKWMKD A S
Sbjct  120   GAALQMQRELQWYKEVEKHVLPESKAHKNSSGRTPAVEFSVEHKDLVKEGEKWMKDAANS  179

Query  791   CtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfl  970
             CT++A LI T+ FAA+ITVPGGN+   G PIFS+  AF +FA ++A SLF++  SLL+FL
Sbjct  180   CTVSATLIATIAFAASITVPGGNNGDTGSPIFSNDLAFNIFAAADALSLFSSTASLLMFL  239

Query  971   svltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPAL  1150
             S+LT+RYAE DFLY+LP RLIIGL+TLF SI  MM AFS+TIYLVFG  ++W  + + A+
Sbjct  240   SILTARYAEVDFLYSLPRRLIIGLVTLFISITTMMIAFSATIYLVFGDKRAWTIVPIAAI  299

Query  1151  ASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             A LP+T F  LQFPLL+ ++ STY PG F +R
Sbjct  300   ACLPVTLFATLQFPLLMDMIRSTYCPGCFGKR  331



>ref|XP_010655716.1| PREDICTED: ankyrin-2-like isoform X4 [Vitis vinifera]
 ref|XP_010655717.1| PREDICTED: ankyrin-2-like isoform X4 [Vitis vinifera]
 ref|XP_010655718.1| PREDICTED: ankyrin-2-like isoform X4 [Vitis vinifera]
Length=678

 Score =   275 bits (704),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 170/413 (41%), Positives = 249/413 (60%), Gaps = 3/413 (1%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             S  +D+AL++V +H  +      N G   L  + +      + +   F +R IY C+   
Sbjct  258   SDLFDVALKIVQKHPKIATARGRN-GETALHILARKPSAYQSGSQLGFLQRCIYACLHVE  316

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
              +   + + ++   K +  + LMH QA +L+KCL  E+  +N+    ++    S  L  A
Sbjct  317   LSGNSSVIHKVPFIKVVYDQKLMHIQALELVKCLWSEVLLMNELQVGELIRTPSRLLFTA  376

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
               L I E ++ ++ AYP + +  D    +I HIA+ +R E +FNLI     L   +    
Sbjct  377   AELGIVEFLIELIHAYPDLIWKVDTQSRSIFHIAVVHRQEKVFNLIHEIGALKDLIASYR  436

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N N++++LA KLAP  +L   SGAALQ++REL WFKEV+KI  P +    +  GKTP+
Sbjct  437   DENNNNMLHLAGKLAPSDRLKTDSGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQ  496

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
               F E H++L  EGEKWMKDTA SC + A LI TV+FAA  TVPGG++   G+PIF    
Sbjct  497   TLFMEEHKVLVREGEKWMKDTAASCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRR  556

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +FTVFA+S+A S  ++A S+L+FLS+LTSRYAE+DFL++LPNRL IGL TLF S+  MM 
Sbjct  557   SFTVFAVSDALSFVSSAASILMFLSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMI  616

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             AF +T++LV G      +I +  +A +P++ F LLQFPL   +VS TYG  +F
Sbjct  617   AFCATLFLVLGHGLHQAKIPIALVACIPVSLFALLQFPLFADMVSCTYGSRMF  669



>ref|XP_010655715.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Vitis vinifera]
Length=734

 Score =   275 bits (704),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 170/413 (41%), Positives = 249/413 (60%), Gaps = 3/413 (1%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             S  +D+AL++V +H  +      N G   L  + +      + +   F +R IY C+   
Sbjct  314   SDLFDVALKIVQKHPKIATARGRN-GETALHILARKPSAYQSGSQLGFLQRCIYACLHVE  372

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
              +   + + ++   K +  + LMH QA +L+KCL  E+  +N+    ++    S  L  A
Sbjct  373   LSGNSSVIHKVPFIKVVYDQKLMHIQALELVKCLWSEVLLMNELQVGELIRTPSRLLFTA  432

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
               L I E ++ ++ AYP + +  D    +I HIA+ +R E +FNLI     L   +    
Sbjct  433   AELGIVEFLIELIHAYPDLIWKVDTQSRSIFHIAVVHRQEKVFNLIHEIGALKDLIASYR  492

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N N++++LA KLAP  +L   SGAALQ++REL WFKEV+KI  P +    +  GKTP+
Sbjct  493   DENNNNMLHLAGKLAPSDRLKTDSGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQ  552

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
               F E H++L  EGEKWMKDTA SC + A LI TV+FAA  TVPGG++   G+PIF    
Sbjct  553   TLFMEEHKVLVREGEKWMKDTAASCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRR  612

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +FTVFA+S+A S  ++A S+L+FLS+LTSRYAE+DFL++LPNRL IGL TLF S+  MM 
Sbjct  613   SFTVFAVSDALSFVSSAASILMFLSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMI  672

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             AF +T++LV G      +I +  +A +P++ F LLQFPL   +VS TYG  +F
Sbjct  673   AFCATLFLVLGHGLHQAKIPIALVACIPVSLFALLQFPLFADMVSCTYGSRMF  725



>ref|XP_011093852.1| PREDICTED: uncharacterized protein LOC105173694 isoform X2 [Sesamum 
indicum]
Length=630

 Score =   273 bits (697),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 169/341 (50%), Positives = 229/341 (67%), Gaps = 3/341 (1%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLN-DYNQVFSLASDALLRAVHLDIAEVVLSIVEA  403
             K I    LMH QA +L+KCLC  L+++N D  +  S+   A++ +    + EV+  I+ +
Sbjct  279   KHIHDMKLMHCQAMELVKCLC--LESVNVDTVKSASIFKPAVISSATCGLYEVIEEILSS  336

Query  404   YPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLA  583
             +P+  +C D    ++  IA+ NR E IFNL+       H +    + + N+I++LA KLA
Sbjct  337   FPSAIWCLDPEHHDLFQIAVMNRRETIFNLLYDLEEHAHLVTQNTDSHNNNILHLAGKLA  396

Query  584   PQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGE  763
             P H+L++VSGAALQMQRELQW+KEV+    P +    +  GKTP M F E H+ L +E E
Sbjct  397   PPHRLSIVSGAALQMQRELQWYKEVENFVTPSYKGKENTDGKTPAMVFAEEHKDLIVEAE  456

Query  764   KWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslft  943
             +W+KDTA SCT AA LI TVVFAAAITVPGG+S  +GLPIF     F VFA+SNA SLF+
Sbjct  457   EWLKDTAKSCTFAATLIATVVFAAAITVPGGSSTESGLPIFQKQRPFVVFAVSNAVSLFS  516

Query  944   aatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKS  1123
             + TS+L+FL +LTSR AE DFLY LPN LIIGL+ LF S+  MM AFSS +Y VFG N++
Sbjct  517   SVTSVLMFLFILTSRCAEADFLYMLPNTLIIGLVNLFLSLASMMLAFSSAMYAVFGHNRT  576

Query  1124  WIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             W    +  +A LP+T F+ LQ+PLL  ++ STYGPGIF ++
Sbjct  577   WFLAPLTLVACLPVTLFLFLQYPLLKDMIRSTYGPGIFGKK  617



>ref|XP_011093848.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
 ref|XP_011093849.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
 ref|XP_011093850.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
 ref|XP_011093851.1| PREDICTED: uncharacterized protein LOC105173694 isoform X1 [Sesamum 
indicum]
Length=649

 Score =   273 bits (697),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 167/334 (50%), Positives = 227/334 (68%), Gaps = 3/334 (1%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLN-DYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYC  424
             LMH QA +L+KCLC  L+++N D  +  S+   A++ +    + EV+  I+ ++P+  +C
Sbjct  305   LMHCQAMELVKCLC--LESVNVDTVKSASIFKPAVISSATCGLYEVIEEILSSFPSAIWC  362

Query  425   SDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNL  604
              D    ++  IA+ NR E IFNL+       H +    + + N+I++LA KLAP H+L++
Sbjct  363   LDPEHHDLFQIAVMNRRETIFNLLYDLEEHAHLVTQNTDSHNNNILHLAGKLAPPHRLSI  422

Query  605   VSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTA  784
             VSGAALQMQRELQW+KEV+    P +    +  GKTP M F E H+ L +E E+W+KDTA
Sbjct  423   VSGAALQMQRELQWYKEVENFVTPSYKGKENTDGKTPAMVFAEEHKDLIVEAEEWLKDTA  482

Query  785   TSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllv  964
              SCT AA LI TVVFAAAITVPGG+S  +GLPIF     F VFA+SNA SLF++ TS+L+
Sbjct  483   KSCTFAATLIATVVFAAAITVPGGSSTESGLPIFQKQRPFVVFAVSNAVSLFSSVTSVLM  542

Query  965   flsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVP  1144
             FL +LTSR AE DFLY LPN LIIGL+ LF S+  MM AFSS +Y VFG N++W    + 
Sbjct  543   FLFILTSRCAEADFLYMLPNTLIIGLVNLFLSLASMMLAFSSAMYAVFGHNRTWFLAPLT  602

Query  1145  ALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              +A LP+T F+ LQ+PLL  ++ STYGPGIF ++
Sbjct  603   LVACLPVTLFLFLQYPLLKDMIRSTYGPGIFGKK  636



>ref|XP_010644720.1| PREDICTED: uncharacterized protein LOC100248044 [Vitis vinifera]
Length=581

 Score =   271 bits (692),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 191/469 (41%), Positives = 262/469 (56%), Gaps = 70/469 (15%)
 Frame = +2

Query  11    FYDMALELVGQHHDVTHHAALNMG--------------VPPLDAIVKYDCPIINTANFSF  148
             F+D+AL LV ++ D+   A  N G                PL  + K      + ++F+ 
Sbjct  118   FHDVALYLVKRYPDL---ATCNFGDAKDSDDDIYSDDDKAPLTVLAKRPWAFRSGSHFNL  174

Query  149   WKRSIYYCI---------------SKNSASTQNFVSQLLLW-------------------  226
             W+  IY+C+                KN   +    +Q+  W                   
Sbjct  175   WQLIIYHCVLVKLNHFLSQPNRGGMKNQVGSYELSTQMCCWTQLFKACQKANAIFWELVG  234

Query  227   ------KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVL  388
                   K I +   MH     LL  LC E+  ++   ++F     + +      I E++ 
Sbjct  235   WLVPPIKHIQETKTMHTLTLQLLNHLCTEVLEVSRAKKIFR---QSFINGAKYGIPEILE  291

Query  389   SIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS----VLVHNLQDTINGNGND  556
              I+++YP   Y  ++ D ++  +A+ NR E IFNLI  T     +++    D+ NGN   
Sbjct  292   EIIKSYP---YALEYLDEDVFKLAVLNRYEKIFNLICETGMHRQLIIRTEDDSNNGN---  345

Query  557   IMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTEN  736
             I++LA KLAP H+L+LVSGAALQMQREL WFKE++K A   FS   +E    P+M F + 
Sbjct  346   ILHLAGKLAPPHRLSLVSGAALQMQRELHWFKEIEKYAPRAFSESENENKDKPKMVFIKE  405

Query  737   HRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFA  916
             H  L  EGEKWMK TA    +AAALI TVVFAAAIT+PGGN D  G+P FS   AF VFA
Sbjct  406   HEKLIKEGEKWMKGTAKCYALAAALIATVVFAAAITIPGGNHDDTGIPNFSKEKAFKVFA  465

Query  917   ISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTI  1096
              S++ SLF +  S+L+ LS+LT+RYAE DFL+ALP RLI GL+TLF S+  MM A+SS I
Sbjct  466   ASDSLSLFLSIASVLICLSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSSAI  525

Query  1097  YLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             YL+FG+ K+WI I + ALA LP+T + +LQFPLLV L+ STYGPGIF +
Sbjct  526   YLLFGEKKAWILITLAALACLPVTLYGILQFPLLVELIYSTYGPGIFGK  574



>ref|XP_010655713.1| PREDICTED: uncharacterized protein LOC100256559 isoform X1 [Vitis 
vinifera]
Length=775

 Score =   275 bits (703),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 170/413 (41%), Positives = 249/413 (60%), Gaps = 3/413 (1%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             S  +D+AL++V +H  +      N G   L  + +      + +   F +R IY C+   
Sbjct  355   SDLFDVALKIVQKHPKIATARGRN-GETALHILARKPSAYQSGSQLGFLQRCIYACLHVE  413

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
              +   + + ++   K +  + LMH QA +L+KCL  E+  +N+    ++    S  L  A
Sbjct  414   LSGNSSVIHKVPFIKVVYDQKLMHIQALELVKCLWSEVLLMNELQVGELIRTPSRLLFTA  473

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
               L I E ++ ++ AYP + +  D    +I HIA+ +R E +FNLI     L   +    
Sbjct  474   AELGIVEFLIELIHAYPDLIWKVDTQSRSIFHIAVVHRQEKVFNLIHEIGALKDLIASYR  533

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N N++++LA KLAP  +L   SGAALQ++REL WFKEV+KI  P +    +  GKTP+
Sbjct  534   DENNNNMLHLAGKLAPSDRLKTDSGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQ  593

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
               F E H++L  EGEKWMKDTA SC + A LI TV+FAA  TVPGG++   G+PIF    
Sbjct  594   TLFMEEHKVLVREGEKWMKDTAASCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRR  653

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +FTVFA+S+A S  ++A S+L+FLS+LTSRYAE+DFL++LPNRL IGL TLF S+  MM 
Sbjct  654   SFTVFAVSDALSFVSSAASILMFLSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMI  713

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             AF +T++LV G      +I +  +A +P++ F LLQFPL   +VS TYG  +F
Sbjct  714   AFCATLFLVLGHGLHQAKIPIALVACIPVSLFALLQFPLFADMVSCTYGSRMF  766



>gb|EYU28337.1| hypothetical protein MIMGU_mgv11b016979mg, partial [Erythranthe 
guttata]
Length=328

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 169/300 (56%), Positives = 216/300 (72%), Gaps = 5/300 (2%)
 Frame = +2

Query  353   RAV-HLDIAEVVLSIVEAYPT-MAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNL  526
             RA+  L I +VV  IVEA+P+ + Y S      I   A+ NR E++FNL        +  
Sbjct  26    RAIARLGIHQVVEMIVEAFPSGVVYISRQP---IFLAAVLNRSESVFNLTHQMGDHKYIY  82

Query  527   QDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYG  706
              D  + +GN++++ A KLAP HKLN +SGAALQMQRE+QW+K+V+K   P     M+   
Sbjct  83    LDIEDKDGNNLLHAAGKLAPSHKLNEISGAALQMQREMQWYKQVEKTISPSSRERMNNER  142

Query  707   KTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIF  886
             K+P M FTE H+ LK EGEKWMKDT+ SCTIAAALIVT++FAAAITVPGG+    G P+F
Sbjct  143   KSPNMIFTEEHKNLKQEGEKWMKDTSGSCTIAAALIVTIMFAAAITVPGGSKSETGFPVF  202

Query  887   SSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSII  1066
             ++   F VFAIS+A SLF + TSLL+FLS+LTSRYAE+DFL+ LP RLI GL TLF SI 
Sbjct  203   ATDKMFLVFAISDAISLFASTTSLLMFLSILTSRYAEEDFLHVLPKRLIFGLGTLFLSIT  262

Query  1067  LMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              MM AFS+T+YLVFG+  +W+ I V ALA LP+TSFVLLQ+PLL  L+SST+GPGIF ++
Sbjct  263   FMMVAFSATLYLVFGRKNAWVLIPVAALACLPVTSFVLLQYPLLADLISSTFGPGIFVKQ  322



>emb|CBI30987.3| unnamed protein product [Vitis vinifera]
Length=702

 Score =   271 bits (692),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 168/409 (41%), Positives = 247/409 (60%), Gaps = 3/409 (1%)
 Frame = +2

Query  17    DMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKNSAST  196
             ++AL++V +H  +      N G   L  + +      + +   F +R IY C+    +  
Sbjct  263   NVALKIVQKHPKIATARGRN-GETALHILARKPSAYQSGSQLGFLQRCIYACLHVELSGN  321

Query  197   QNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRAVHLD  370
              + + ++   K +  + LMH QA +L+KCL  E+  +N+    ++    S  L  A  L 
Sbjct  322   SSVIHKVPFIKVVYDQKLMHIQALELVKCLWSEVLLMNELQVGELIRTPSRLLFTAAELG  381

Query  371   IAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNG  550
             I E ++ ++ AYP + +  D    +I HIA+ +R E +FNLI     L   +    + N 
Sbjct  382   IVEFLIELIHAYPDLIWKVDTQSRSIFHIAVVHRQEKVFNLIHEIGALKDLIASYRDENN  441

Query  551   NDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFT  730
             N++++LA KLAP  +L   SGAALQ++REL WFKEV+KI  P +    +  GKTP+  F 
Sbjct  442   NNMLHLAGKLAPSDRLKTDSGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQTLFM  501

Query  731   ENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTV  910
             E H++L  EGEKWMKDTA SC + A LI TV+FAA  TVPGG++   G+PIF    +FTV
Sbjct  502   EEHKVLVREGEKWMKDTAASCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRRSFTV  561

Query  911   FAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSS  1090
             FA+S+A S  ++A S+L+FLS+LTSRYAE+DFL++LPNRL IGL TLF S+  MM AF +
Sbjct  562   FAVSDALSFVSSAASILMFLSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMIAFCA  621

Query  1091  TIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             T++LV G      +I +  +A +P++ F LLQFPL   +VS TYG  +F
Sbjct  622   TLFLVLGHGLHQAKIPIALVACIPVSLFALLQFPLFADMVSCTYGSRMF  670



>ref|XP_009783297.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Nicotiana sylvestris]
Length=610

 Score =   268 bits (685),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 190/429 (44%), Positives = 258/429 (60%), Gaps = 22/429 (5%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTH---HAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI  175
             + FYD+ L L+ +H  +     +   N  +  L A +           F  W++ +Y  I
Sbjct  183   AGFYDVLLALLRRHPGLARTEFYGDNNESLLSLLAEIPSAFRSGTRLRFWHWQQLLYSGI  242

Query  176   SKNSASTQNFVSQLLLWKSIPKKI-------LMHQQATDLLKCLCDEL-----KTLNDYN  319
                S       +   +WK+  + I       LMH++  D++K LC+EL      T  D  
Sbjct  243   MMKSM----IRATREIWKTTTRAIRHIKDTKLMHEETLDIVKRLCEELTKHYSSTGEDIE  298

Query  320   QVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIR  499
              V      ALL A    I+E++  I+E YP   +  D  + N+ H+A+ NR E +F+LI 
Sbjct  299   PVLR---KALLSAAGSGISEIIEEIIERYPDAIWFVDSENHNLFHLAVINRYEKVFSLIY  355

Query  500   GTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPY  679
               SV  H +    + +GN+I+++A KLAP  +LNL+SGAALQMQRELQWF+EV+K   P 
Sbjct  356   QLSVYKHLVTAGEDTSGNNILHMAGKLAPLSRLNLISGAALQMQRELQWFQEVEKFVQPT  415

Query  680   FSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGN  859
               +  +  GKTP+M FTE H+ L  EGEKWMK+TA SC   A+L  TVVFAAAITVPGGN
Sbjct  416   LRTKRNSNGKTPKMVFTEEHKELVKEGEKWMKETANSCIFVASLTTTVVFAAAITVPGGN  475

Query  860   SDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIG  1039
             +  +G P+FS+  AFT FA+S A  LF++  S+L+FLS+LTSRYAE DFL  LP RLI+G
Sbjct  476   NQNSGFPLFSNETAFTTFAVSAAFCLFSSVASVLMFLSILTSRYAEGDFLRRLPKRLILG  535

Query  1040  LITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSST  1219
             L TLF S+  +M AFS+TIYLVFGQ K WI I V   A +P+  F  LQFPLL+ +  ST
Sbjct  536   LGTLFISMTSLMIAFSATIYLVFGQKKGWILIPVGIAALIPVILFESLQFPLLLDMFMST  595

Query  1220  YGPGIFSQR  1246
             YGP IF ++
Sbjct  596   YGPSIFRKQ  604



>ref|XP_009628820.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Nicotiana tomentosiformis]
Length=610

 Score =   267 bits (683),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 232/354 (66%), Gaps = 15/354 (4%)
 Frame = +2

Query  221   LWKSIPKKI-------LMHQQATDLLKCLCDEL-----KTLNDYNQVFSLASDALLRAVH  364
             +WK+  + I       LMH++  D++K LC+EL      T  D   V      ALL A  
Sbjct  254   IWKTTTRTIRHIKDTKLMHEETLDIVKRLCEELTKHYSSTGEDIEPVLR---KALLSAAG  310

Query  365   LDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTING  544
               I+E++  I+E YP   +  D  + N+ H+A+ NR E +F+LI   SV  H +    + 
Sbjct  311   SGISEIIEEIIERYPDAIWFVDSENHNLFHLAVINRYEKVFSLIYQLSVYKHLVTAGEDT  370

Query  545   NGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMH  724
             +GN+I+++A KLAP  +LNL+SGAALQMQRELQWF+EV+K   P   +  +  GKTP+M 
Sbjct  371   SGNNILHMAGKLAPLSRLNLISGAALQMQRELQWFQEVEKFVQPTLRTKRNSDGKTPKMV  430

Query  725   FTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAF  904
             FTE H+ L  EGEKWMK+TA SC   AAL  TVVFAAAITVPGGN+  +G P+FS+  AF
Sbjct  431   FTEEHKELVKEGEKWMKETANSCIFVAALTTTVVFAAAITVPGGNNQNSGFPLFSNETAF  490

Query  905   TVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAF  1084
             T FA+S A  LF++  S+L+FLS+LTSRYAE DFL  LP RLI+GL TLF S+  +M AF
Sbjct  491   TAFAVSAAFCLFSSVASVLMFLSILTSRYAEGDFLRRLPKRLILGLGTLFISMTSLMIAF  550

Query  1085  SSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             S+TIYLVFGQ K WI I V   A +P+  F  LQFPLL+ +  STYGP IF ++
Sbjct  551   SATIYLVFGQRKGWILIPVGIAALIPVILFESLQFPLLLDMFMSTYGPSIFRKQ  604



>ref|XP_010644722.1| PREDICTED: uncharacterized protein LOC100258383 isoform X2 [Vitis 
vinifera]
Length=388

 Score =   260 bits (665),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 225/343 (66%), Gaps = 13/343 (4%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I +   MH     LL  LC E+  ++   ++F     + +      I E++  I+++Y
Sbjct  48    KHIQETKTMHTLTLQLLNHLCTEVLKVSRAKEIFR---QSFINGAKYGIPEILEEIIKSY  104

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS----VLVHNLQDTINGNGNDIMNLAA  574
             P   +  ++ D ++  + + NR E IFNLI  T     +++    DT   N ++I++LA 
Sbjct  105   P---FALEYLDEDVFKLVVLNRYEKIFNLICETGMHRQLIIRTRDDT---NNDNILHLAG  158

Query  575   KLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKI  754
             KLAP H+L+LVSGAALQMQREL WFKE++K A   FS   +  G  P+M F + H+ L  
Sbjct  159   KLAPPHRLSLVSGAALQMQRELHWFKEIEKYAPRAFSESENRDGDKPKMAFIKEHKKLIK  218

Query  755   EGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaas  934
             EGEKWMK TA   T+AAALI TVVFAAAIT+PGGN D  G+P FS   AF VFA ++A S
Sbjct  219   EGEKWMKGTAKFYTLAAALIATVVFAAAITIPGGNHDDTGIPNFSKEKAFKVFAAADALS  278

Query  935   lftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQ  1114
             LF +  S+L+ LS+LT+RYAE DF++ALP RLI GL+TLF S+  MM A+SS IYL+FG+
Sbjct  279   LFLSIASVLICLSILTARYAEDDFIFALPRRLIFGLVTLFLSVTFMMIAYSSAIYLLFGE  338

Query  1115  NKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             NK+WI I + ALA  P+T + +LQFPLLV L+ STYGPGIF +
Sbjct  339   NKAWILITLAALACFPVTLYGILQFPLLVELIYSTYGPGIFGK  381



>ref|XP_009783296.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nicotiana sylvestris]
Length=663

 Score =   268 bits (685),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 179/375 (48%), Positives = 241/375 (64%), Gaps = 16/375 (4%)
 Frame = +2

Query  161   IYYCISKNSASTQNFV-SQLLLWKSIPKKI-------LMHQQATDLLKCLCDEL-----K  301
             IY C++      ++ + +   +WK+  + I       LMH++  D++K LC+EL      
Sbjct  286   IYSCMNHVGIMMKSMIRATREIWKTTTRAIRHIKDTKLMHEETLDIVKRLCEELTKHYSS  345

Query  302   TLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCEN  481
             T  D   V      ALL A    I+E++  I+E YP   +  D  + N+ H+A+ NR E 
Sbjct  346   TGEDIEPVLR---KALLSAAGSGISEIIEEIIERYPDAIWFVDSENHNLFHLAVINRYEK  402

Query  482   IFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQ  661
             +F+LI   SV  H +    + +GN+I+++A KLAP  +LNL+SGAALQMQRELQWF+EV+
Sbjct  403   VFSLIYQLSVYKHLVTAGEDTSGNNILHMAGKLAPLSRLNLISGAALQMQRELQWFQEVE  462

Query  662   KIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaai  841
             K   P   +  +  GKTP+M FTE H+ L  EGEKWMK+TA SC   A+L  TVVFAAAI
Sbjct  463   KFVQPTLRTKRNSNGKTPKMVFTEEHKELVKEGEKWMKETANSCIFVASLTTTVVFAAAI  522

Query  842   tvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALP  1021
             TVPGGN+  +G P+FS+  AFT FA+S A  LF++  S+L+FLS+LTSRYAE DFL  LP
Sbjct  523   TVPGGNNQNSGFPLFSNETAFTTFAVSAAFCLFSSVASVLMFLSILTSRYAEGDFLRRLP  582

Query  1022  NRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLV  1201
              RLI+GL TLF S+  +M AFS+TIYLVFGQ K WI I V   A +P+  F  LQFPLL+
Sbjct  583   KRLILGLGTLFISMTSLMIAFSATIYLVFGQKKGWILIPVGIAALIPVILFESLQFPLLL  642

Query  1202  ALVSSTYGPGIFSQR  1246
              +  STYGP IF ++
Sbjct  643   DMFMSTYGPSIFRKQ  657



>ref|XP_009628819.1| PREDICTED: uncharacterized protein LOC104119107 isoform X2 [Nicotiana 
tomentosiformis]
Length=663

 Score =   268 bits (685),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 241/375 (64%), Gaps = 16/375 (4%)
 Frame = +2

Query  161   IYYCISKNSASTQNFV-SQLLLWKSIPKKI-------LMHQQATDLLKCLCDEL-----K  301
             IY C++      ++ + +   +WK+  + I       LMH++  D++K LC+EL      
Sbjct  286   IYSCMNHVGIMIKSMIHAAREIWKTTTRTIRHIKDTKLMHEETLDIVKRLCEELTKHYSS  345

Query  302   TLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCEN  481
             T  D   V      ALL A    I+E++  I+E YP   +  D  + N+ H+A+ NR E 
Sbjct  346   TGEDIEPVLR---KALLSAAGSGISEIIEEIIERYPDAIWFVDSENHNLFHLAVINRYEK  402

Query  482   IFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQ  661
             +F+LI   SV  H +    + +GN+I+++A KLAP  +LNL+SGAALQMQRELQWF+EV+
Sbjct  403   VFSLIYQLSVYKHLVTAGEDTSGNNILHMAGKLAPLSRLNLISGAALQMQRELQWFQEVE  462

Query  662   KIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaai  841
             K   P   +  +  GKTP+M FTE H+ L  EGEKWMK+TA SC   AAL  TVVFAAAI
Sbjct  463   KFVQPTLRTKRNSDGKTPKMVFTEEHKELVKEGEKWMKETANSCIFVAALTTTVVFAAAI  522

Query  842   tvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALP  1021
             TVPGGN+  +G P+FS+  AFT FA+S A  LF++  S+L+FLS+LTSRYAE DFL  LP
Sbjct  523   TVPGGNNQNSGFPLFSNETAFTAFAVSAAFCLFSSVASVLMFLSILTSRYAEGDFLRRLP  582

Query  1022  NRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLV  1201
              RLI+GL TLF S+  +M AFS+TIYLVFGQ K WI I V   A +P+  F  LQFPLL+
Sbjct  583   KRLILGLGTLFISMTSLMIAFSATIYLVFGQRKGWILIPVGIAALIPVILFESLQFPLLL  642

Query  1202  ALVSSTYGPGIFSQR  1246
              +  STYGP IF ++
Sbjct  643   DMFMSTYGPSIFRKQ  657



>ref|XP_010644721.1| PREDICTED: uncharacterized protein LOC100258383 isoform X1 [Vitis 
vinifera]
Length=404

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 225/343 (66%), Gaps = 13/343 (4%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I +   MH     LL  LC E+  ++   ++F     + +      I E++  I+++Y
Sbjct  64    KHIQETKTMHTLTLQLLNHLCTEVLKVSRAKEIFR---QSFINGAKYGIPEILEEIIKSY  120

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS----VLVHNLQDTINGNGNDIMNLAA  574
             P   +  ++ D ++  + + NR E IFNLI  T     +++    DT   N ++I++LA 
Sbjct  121   P---FALEYLDEDVFKLVVLNRYEKIFNLICETGMHRQLIIRTRDDT---NNDNILHLAG  174

Query  575   KLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKI  754
             KLAP H+L+LVSGAALQMQREL WFKE++K A   FS   +  G  P+M F + H+ L  
Sbjct  175   KLAPPHRLSLVSGAALQMQRELHWFKEIEKYAPRAFSESENRDGDKPKMAFIKEHKKLIK  234

Query  755   EGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaas  934
             EGEKWMK TA   T+AAALI TVVFAAAIT+PGGN D  G+P FS   AF VFA ++A S
Sbjct  235   EGEKWMKGTAKFYTLAAALIATVVFAAAITIPGGNHDDTGIPNFSKEKAFKVFAAADALS  294

Query  935   lftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQ  1114
             LF +  S+L+ LS+LT+RYAE DF++ALP RLI GL+TLF S+  MM A+SS IYL+FG+
Sbjct  295   LFLSIASVLICLSILTARYAEDDFIFALPRRLIFGLVTLFLSVTFMMIAYSSAIYLLFGE  354

Query  1115  NKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             NK+WI I + ALA  P+T + +LQFPLLV L+ STYGPGIF +
Sbjct  355   NKAWILITLAALACFPVTLYGILQFPLLVELIYSTYGPGIFGK  397



>ref|XP_009783291.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009783293.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009783294.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009783295.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Nicotiana sylvestris]
Length=679

 Score =   268 bits (684),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 179/375 (48%), Positives = 241/375 (64%), Gaps = 16/375 (4%)
 Frame = +2

Query  161   IYYCISKNSASTQNFV-SQLLLWKSIPKKI-------LMHQQATDLLKCLCDEL-----K  301
             IY C++      ++ + +   +WK+  + I       LMH++  D++K LC+EL      
Sbjct  302   IYSCMNHVGIMMKSMIRATREIWKTTTRAIRHIKDTKLMHEETLDIVKRLCEELTKHYSS  361

Query  302   TLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCEN  481
             T  D   V      ALL A    I+E++  I+E YP   +  D  + N+ H+A+ NR E 
Sbjct  362   TGEDIEPVLR---KALLSAAGSGISEIIEEIIERYPDAIWFVDSENHNLFHLAVINRYEK  418

Query  482   IFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQ  661
             +F+LI   SV  H +    + +GN+I+++A KLAP  +LNL+SGAALQMQRELQWF+EV+
Sbjct  419   VFSLIYQLSVYKHLVTAGEDTSGNNILHMAGKLAPLSRLNLISGAALQMQRELQWFQEVE  478

Query  662   KIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaai  841
             K   P   +  +  GKTP+M FTE H+ L  EGEKWMK+TA SC   A+L  TVVFAAAI
Sbjct  479   KFVQPTLRTKRNSNGKTPKMVFTEEHKELVKEGEKWMKETANSCIFVASLTTTVVFAAAI  538

Query  842   tvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALP  1021
             TVPGGN+  +G P+FS+  AFT FA+S A  LF++  S+L+FLS+LTSRYAE DFL  LP
Sbjct  539   TVPGGNNQNSGFPLFSNETAFTTFAVSAAFCLFSSVASVLMFLSILTSRYAEGDFLRRLP  598

Query  1022  NRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLV  1201
              RLI+GL TLF S+  +M AFS+TIYLVFGQ K WI I V   A +P+  F  LQFPLL+
Sbjct  599   KRLILGLGTLFISMTSLMIAFSATIYLVFGQKKGWILIPVGIAALIPVILFESLQFPLLL  658

Query  1202  ALVSSTYGPGIFSQR  1246
              +  STYGP IF ++
Sbjct  659   DMFMSTYGPSIFRKQ  673



>ref|XP_009628816.1| PREDICTED: uncharacterized protein LOC104119107 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628818.1| PREDICTED: uncharacterized protein LOC104119107 isoform X1 [Nicotiana 
tomentosiformis]
Length=679

 Score =   267 bits (683),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 241/375 (64%), Gaps = 16/375 (4%)
 Frame = +2

Query  161   IYYCISKNSASTQNFV-SQLLLWKSIPKKI-------LMHQQATDLLKCLCDEL-----K  301
             IY C++      ++ + +   +WK+  + I       LMH++  D++K LC+EL      
Sbjct  302   IYSCMNHVGIMIKSMIHAAREIWKTTTRTIRHIKDTKLMHEETLDIVKRLCEELTKHYSS  361

Query  302   TLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCEN  481
             T  D   V      ALL A    I+E++  I+E YP   +  D  + N+ H+A+ NR E 
Sbjct  362   TGEDIEPVLR---KALLSAAGSGISEIIEEIIERYPDAIWFVDSENHNLFHLAVINRYEK  418

Query  482   IFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQ  661
             +F+LI   SV  H +    + +GN+I+++A KLAP  +LNL+SGAALQMQRELQWF+EV+
Sbjct  419   VFSLIYQLSVYKHLVTAGEDTSGNNILHMAGKLAPLSRLNLISGAALQMQRELQWFQEVE  478

Query  662   KIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaai  841
             K   P   +  +  GKTP+M FTE H+ L  EGEKWMK+TA SC   AAL  TVVFAAAI
Sbjct  479   KFVQPTLRTKRNSDGKTPKMVFTEEHKELVKEGEKWMKETANSCIFVAALTTTVVFAAAI  538

Query  842   tvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALP  1021
             TVPGGN+  +G P+FS+  AFT FA+S A  LF++  S+L+FLS+LTSRYAE DFL  LP
Sbjct  539   TVPGGNNQNSGFPLFSNETAFTAFAVSAAFCLFSSVASVLMFLSILTSRYAEGDFLRRLP  598

Query  1022  NRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLV  1201
              RLI+GL TLF S+  +M AFS+TIYLVFGQ K WI I V   A +P+  F  LQFPLL+
Sbjct  599   KRLILGLGTLFISMTSLMIAFSATIYLVFGQRKGWILIPVGIAALIPVILFESLQFPLLL  658

Query  1202  ALVSSTYGPGIFSQR  1246
              +  STYGP IF ++
Sbjct  659   DMFMSTYGPSIFRKQ  673



>ref|XP_010644712.1| PREDICTED: uncharacterized protein LOC100265216 [Vitis vinifera]
Length=659

 Score =   265 bits (676),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 188/462 (41%), Positives = 258/462 (56%), Gaps = 64/462 (14%)
 Frame = +2

Query  11    FYDMALELVGQHHDVTHHAALNMGVP--------PLDAIVKYDCPIINTANFSFWKRSIY  166
             F+D+AL LV ++ D+   A  N G          PL  + K      + + F+ W+  IY
Sbjct  204   FHDVALHLVERYPDL---ATCNFGDAKDSDDDKAPLTVLAKRPWAFRSGSRFNLWQLIIY  260

Query  167   YCIS---------------KNSASTQNFVSQLLLW-------------------------  226
             +C+                KN   +    +Q+  W                         
Sbjct  261   HCVPMKLNHFLSQPNRGGMKNQVGSYELSTQMCCWTRLFKACQKANAIFWELIGWLVPPI  320

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I +   MH     LL  LC E+  ++   ++F     + +      I E++  I+++Y
Sbjct  321   KHIQETKTMHTLTLQLLNHLCTEVLKVSRAKKIFR---QSFINGAKYGIPEILEEIIKSY  377

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAAK  577
             P   Y  ++ D ++  +A+ NR E IFNLI  T +   L+   +D    + N+I++LA K
Sbjct  378   P---YALEYLDEDVFKLAVLNRYEKIFNLICETGMHRQLIIRTED----DSNNILHLAGK  430

Query  578   LAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIE  757
             LAP H+L+LVSGAALQMQREL WFKE++K A   FS   +     P+  F + H  L  E
Sbjct  431   LAPPHRLSLVSGAALQMQRELHWFKEIEKYAPRAFSESENNNEDKPKTVFIKEHEKLIKE  490

Query  758   GEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaasl  937
             GEKWMK TA    +AAALI TVVFAAAIT+PGGN D  G+P FS   AF VFA S+A SL
Sbjct  491   GEKWMKGTAKCYALAAALIATVVFAAAITIPGGNHDDTGIPNFSKEKAFKVFAASDALSL  550

Query  938   ftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQN  1117
             F +  S+L+ LS+LT+RYAE DFL+ALP RLI GL+TLF S+  MM A+SS IYL+FG+ 
Sbjct  551   FLSIASVLICLSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSSAIYLLFGEK  610

Query  1118  KSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             K+WI   + ALA LP+T + +LQFPLLV L+ STYGPGIF +
Sbjct  611   KAWILTTLAALACLPVTLYGILQFPLLVELIYSTYGPGIFGK  652



>ref|XP_007012652.1| Ankyrin repeat-containing-like protein [Theobroma cacao]
 gb|EOY30271.1| Ankyrin repeat-containing-like protein [Theobroma cacao]
Length=558

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 170/341 (50%), Positives = 228/341 (67%), Gaps = 2/341 (1%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I +   MH +A  L+K LC E + L D  +  ++ +D L +AV   I E++ +I+ ++
Sbjct  213   KHIRQMKFMHGEALRLVKLLCTEAERL-DPQKAANIFADPLFQAVSHGIPEIIENILVSF  271

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLI-RGTSVLVHNLQDTINGNGNDIMNLAAKLA  583
             P      D++  NI+  A+  R  N+FNLI R      H L + ++    +I++LA  LA
Sbjct  272   PIAVQFRDNDGRNIIERAVLYRRHNVFNLIYRMNRQTKHALAEDLDRFQTNILHLAGILA  331

Query  584   PQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGE  763
             PQ +LNLVS AALQMQRELQWFKEV+K+    +    +  GKTP M FT+ H+ L  EGE
Sbjct  332   PQDQLNLVSSAALQMQRELQWFKEVEKLVPSIYRDARNYEGKTPRMVFTDKHKELVKEGE  391

Query  764   KWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslft  943
             KWMKDTA SC++ AALI TVVFAAAITVPGG +  +G P+FSS  AF +FA+S+A SLF+
Sbjct  392   KWMKDTANSCSVVAALIATVVFAAAITVPGGTNGDSGFPVFSSEKAFVIFAVSDALSLFS  451

Query  944   aatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKS  1123
             +  ++L+FLS+LT+RYA  +FL ALP RLI+GL+TL  SI  MM AFS+T+YLVFG +++
Sbjct  452   STAAILMFLSILTARYAGDNFLQALPKRLIMGLLTLLISITTMMIAFSATLYLVFGNDET  511

Query  1124  WIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             WI   V A A L +  FV LQF LLV + SS YG GIF QR
Sbjct  512   WILTSVAASACLLVILFVYLQFSLLVDMFSSIYGHGIFGQR  552



>ref|XP_010256492.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Nelumbo 
nucifera]
Length=312

 Score =   254 bits (649),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 151/301 (50%), Positives = 205/301 (68%), Gaps = 0/301 (0%)
 Frame = +2

Query  344   ALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHN  523
             A+ RA    I E ++ I+   P + + +D +D NI  +AI  R E IFNLI       + 
Sbjct  3     AIFRATQFGIVEFIIEIISICPHLIWSTDEHDRNIFEVAILYRQEKIFNLIYELGGQRNE  62

Query  524   LQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEY  703
             L   ++  GN ++++A  LAP H+LN VSG ALQMQRELQWFKEV+ I  P  +   +  
Sbjct  63    LASYVDEEGNSLLHVAGLLAPPHRLNEVSGPALQMQRELQWFKEVEAIVQPRCTELKNFQ  122

Query  704   GKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPI  883
             GKTP + F+E H+ L  EGEKWMKDTATSC + A LI TV+FAAA TVPGGN+   G+PI
Sbjct  123   GKTPRVLFSEQHKELVKEGEKWMKDTATSCMVVATLIATVMFAAAFTVPGGNNSNTGIPI  182

Query  884   FSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSI  1063
             F   N+F VF+IS+A +LF+++TS+L+FL++LTSRYAE DFL  LP +LIIGL  LF SI
Sbjct  183   FLETNSFMVFSISDALALFSSSTSVLMFLAILTSRYAEDDFLKFLPQKLIIGLFFLFVSI  242

Query  1064  ILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             + MM AF +TI+++      W+ I +  LAS+P+T F LLQFPL + ++ STYG GIF++
Sbjct  243   VAMMVAFGATIFIILCHRIVWLTIPITLLASVPVTLFALLQFPLFIDMIVSTYGSGIFNK  302

Query  1244  R  1246
             +
Sbjct  303   Q  303



>ref|XP_002513462.1| ankyrin repeat-containing protein, putative [Ricinus communis]
 gb|EEF48865.1| ankyrin repeat-containing protein, putative [Ricinus communis]
Length=590

 Score =   261 bits (668),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 176/430 (41%), Positives = 247/430 (57%), Gaps = 22/430 (5%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             + FY +AL L+ + +          G   LD + +      + +   F    +Y+  + N
Sbjct  159   ADFYGLALHLL-KRYPALARGTDQYGFTSLDMLARKPQAFPSGSRLGFRHSFLYHYCAAN  217

Query  185   SASTQNF-----------------VSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND  313
             S  T+ F                   +    + I K +LMH+QA +LL+ L  E    N+
Sbjct  218   SVDTETFHQGGDVENQVGGSEKYCQKRFSFLRDIDKTLLMHKQAVELLRNLISEALKANE  277

Query  314   YNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNL  493
              +Q+ SL   +   A    I E V   +++YP   +  D +   I H+AI++R E IFNL
Sbjct  278   -SQLHSLLGSSTQTATKFGIQEFVAEAIKSYPYSVWFRDGDGCTIFHLAIKHRQEKIFNL  336

Query  494   IRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIAL  673
             +       H +    +  GN +++LA  L P  K   +SGAALQMQRELQWFKEV+K+  
Sbjct  337   LYQIGNHKHIITSLADSLGNTMLHLAGTLQPSSK---ISGAALQMQRELQWFKEVEKVIQ  393

Query  674   PYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPG  853
             P +    D+ G+TP   FTE H+ L  +GEKWMKDTATSC   AAL++TVVFAAA TVPG
Sbjct  394   PSYKELKDKNGRTPRQVFTEGHKSLVEQGEKWMKDTATSCATVAALVITVVFAAAFTVPG  453

Query  854   GNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLI  1033
             GN+   G+PI+ +  AF +FAIS+A  LF+++TSLL+FL +LTSRY+E DFL ALP RL 
Sbjct  454   GNNSDQGIPIYLNETAFVIFAISDALGLFSSSTSLLMFLGILTSRYSEGDFLKALPMRLS  513

Query  1034  IGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVS  1213
             IGLITLFFSI  M+ AFS+  +LV      WI + +  +A  P+T F LLQFPLL  ++S
Sbjct  514   IGLITLFFSIASMLAAFSAAFHLVLFHRVKWIAVPIGLVACAPVTLFALLQFPLLSEMIS  573

Query  1214  STYGPGIFSQ  1243
             ST+G  +F +
Sbjct  574   STFGRSVFRK  583



>emb|CDP03066.1| unnamed protein product [Coffea canephora]
Length=626

 Score =   262 bits (670),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 182/454 (40%), Positives = 262/454 (58%), Gaps = 38/454 (8%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI---  175
             S FYD+AL+L+  +  +    +   G  PL  I        +  + SF+++ IY+C    
Sbjct  176   SGFYDVALDLLRSYPKLATTISPG-GNTPLSIIAGKPSAFPSGTSLSFFQQVIYFCAPEK  234

Query  176   ----------------SKNSAS-----TQNFVSQLLLWKSIPKKI----------LMHQQ  262
                             SK S++      Q F S+   W+ I + +          LMH Q
Sbjct  235   LEKPFDQNERQDIENQSKKSSNLLLYGCQKFHSKF--WEVIRRIVPYVKHIQNIKLMHHQ  292

Query  263   ATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDL  442
             A +L+KCLC E     D +    +   A++    L + EVV   ++++P+  +  D +  
Sbjct  293   AVELVKCLCME-DVQVDNSISARIFKPAIILGARLGVYEVVAETLKSFPSAIWSLDQDGH  351

Query  443   NILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAAL  622
             ++  +A+ NR E+IFN++       H +   I+   N+I++LA KLAP  +LNLVSGAAL
Sbjct  352   DLFQLAVMNRHESIFNILYEKDEHSHLVTQNIDKYKNNILHLAGKLAPPDQLNLVSGAAL  411

Query  623   QMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
             QMQRELQW+KEV+K   P +    +  GKTP M FTE H+ L  EG+ W+KDTA SCT  
Sbjct  412   QMQRELQWYKEVEKFVQPSYKVKENVDGKTPGMVFTEEHKDLISEGQNWLKDTAKSCTFV  471

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
             A LI TVV  +AITVPGG+   NG PIF+ + AF  FAISNA SLF+++TS+++FL +L 
Sbjct  472   AVLIATVVCTSAITVPGGSIPDNGHPIFAKNGAFICFAISNALSLFSSSTSVIMFLFILN  531

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLP  1162
             SR AE DFLY LPN+LIIGL+TLF S+  +M AF + IY+VF + KS   I +  L   P
Sbjct  532   SRCAEADFLYFLPNKLIIGLVTLFLSLATLMIAFGAAIYIVFARQKSLTIIPLSVLVCFP  591

Query  1163  ITSFVLLQFPLLVALVSSTYGPGIFSQRGIPQML  1264
             +T F+ LQ+P++  ++ STYGP IF ++   Q L
Sbjct  592   LTLFMSLQYPVMKDMIKSTYGPSIFGKKSRAQFL  625



>ref|XP_010260577.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nelumbo nucifera]
Length=412

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 171/394 (43%), Positives = 238/394 (60%), Gaps = 18/394 (5%)
 Frame = +2

Query  107   KYDCPIINTANFSFWKRSIYYCISKN-SASTQNFVSQLLLWKSIPKKI----------LM  253
             +Y C I      +F K     C++   +A+   F    LLW S+   +          +M
Sbjct  19    RYSCGI---TYLTFSKEDKEVCMAHMITAAVHEF--NALLWNSLKAIVPYIKQVYDTKVM  73

Query  254   HQQATDLLKCLCDELKTLNDYNQ--VFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             H QA +++K L  E+  L+D N   +    S  L  A  L IAE +  ++  YP + +  
Sbjct  74    HFQAIEVVKVLWHEVLKLDDKNMSALLREPSRPLFVAAELGIAEFIAVLLRDYPDLLWKV  133

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             + ++ +I H A+ +  E IF LI     L   +   ++GN N++++LA  LAP  +LN +
Sbjct  134   NSDNQSIFHTAVAHHQEKIFILIHDIGALKDLITSYVDGNNNNMLHLAGNLAPSSRLNTI  193

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGAALQMQRE QWFKEV+K+  P +    +  GKTP   FTE H  L  EGEKWMKDTA+
Sbjct  194   SGAALQMQREHQWFKEVEKVMQPLYMEMKNSEGKTPRTLFTEKHANLVKEGEKWMKDTAS  253

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             SC I A LI TVVFAAA TVPGGN D  G+P+F    +F VFAIS+A +LF++ TS+L+F
Sbjct  254   SCMIVATLIATVVFAAAFTVPGGNYDDKGIPVFLEVRSFIVFAISDALALFSSITSVLMF  313

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
             LS+LTSRYA +DFL  LP R+++GL TLF SI  M+ AFS+T+++V      WI I +  
Sbjct  314   LSILTSRYAAEDFLETLPRRMVLGLTTLFVSIATMVIAFSATLFIVLRSRLDWIAIPIAI  373

Query  1148  LASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             LA +P+T F LLQFPL + ++ ST+G GIF + G
Sbjct  374   LACVPVTMFALLQFPLFMDIIHSTHGFGIFYRPG  407



>ref|XP_010244047.1| PREDICTED: uncharacterized protein LOC104587959 [Nelumbo nucifera]
Length=588

 Score =   259 bits (663),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 172/415 (41%), Positives = 248/415 (60%), Gaps = 9/415 (2%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKR---SIYYCI  175
             ++ YD+AL L+ Q            G   L  + +      + +  S W +   SI++ +
Sbjct  177   AEIYDVALNLL-QRFPRLAITKDKFGETALSTLARRPSAFPSGSQHSIWAQWIYSIFWLL  235

Query  176   SKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLR  355
              + + S      + L  + + +K L+  Q  ++LK +C E++ L++ +   +    A+ R
Sbjct  236   RRIAWSAL----KPLGIQQVYQKKLVRIQVIEILKVICSEIEKLDEAHLQEAGVYFAMHR  291

Query  356   AVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDT  535
             A    I E+V  I+++ P   Y  D N  +I+ +AI +R   +FNLI G       +   
Sbjct  292   AAKFGIVEIVDGIIDSIPNTLYALDENGQSIITVAIVHRQHKVFNLIYGMGTKESYIMP-  350

Query  536   INGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTP  715
              +   N +++LAA L+P  +L+ VSGAALQMQRELQWFKEV+K   P +    +  G+TP
Sbjct  351   FDKQQNTMLHLAAMLSPYSQLSRVSGAALQMQRELQWFKEVEKFVPPKYKEFQNSNGQTP  410

Query  716   EMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSH  895
             +  FTE HR L  +GEKWMKDTATSC + A LI T++F AA T+PGGN+   G+PIF   
Sbjct  411   QTLFTEAHRNLVKDGEKWMKDTATSCMVVATLIATIMFTAAFTMPGGNNSDTGIPIFLHT  470

Query  896   NAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMM  1075
              AF +F IS+A SLF++ TS+L+FL +LTSRYAE+DFL +LP RLIIGL TLFFS+  MM
Sbjct  471   KAFMIFIISDAFSLFSSTTSVLMFLGILTSRYAEEDFLVSLPKRLIIGLATLFFSVATMM  530

Query  1076  TAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
              AF +T+++V      W  I V  L S+P+  FVLLQFPLLV ++ STYG GIF 
Sbjct  531   IAFGATLFIVLHHRAKWTAIPVTLLGSVPVALFVLLQFPLLVDMIVSTYGSGIFG  585



>ref|XP_009783300.1| PREDICTED: uncharacterized protein LOC104231927 isoform X1 [Nicotiana 
sylvestris]
Length=860

 Score =   265 bits (677),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 232/369 (63%), Gaps = 4/369 (1%)
 Frame = +2

Query  149   WKRSIYY---CISKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYN  319
             W+  + Y   C+    A     +++  ++K I    LMH++  D++K LC EL       
Sbjct  487   WECFVKYPRNCVITIQAWLARMINRAAIFKRIKDIKLMHKETLDIVKRLCKELMKEYKPK  546

Query  320   QVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIR  499
              +  +   A+L A    I E++  IV+ YP   +  +  + N+ H+A+ NR E +FN I 
Sbjct  547   DIEPVLRKAVLLAASSGIPEIIEEIVDCYPDAIWFVNSENHNLFHLAVINRHEKVFNFIY  606

Query  500   GTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPY  679
               S+  H +    + +GN+I+++A KLAP  +LNL+SGAALQMQRELQWF+EV+K   P 
Sbjct  607   QLSLYKHLVTTDEDTSGNNILHMAGKLAPLGRLNLISGAALQMQRELQWFQEVEKFVHPT  666

Query  680   FSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGN  859
               +  + YGKTP+M FTE H+ L  EGEKWMK+TA SCT  AAL  TV FAAAITVPGGN
Sbjct  667   LRTNRNSYGKTPKMVFTEEHKELVKEGEKWMKETANSCTFVAALTATVGFAAAITVPGGN  726

Query  860   SDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIG  1039
               + G PIFS   AFT+FA+S A  LF++  S+L+FLS+LT+RYAE DFL +LP RLIIG
Sbjct  727   -QSKGFPIFSKEPAFTIFAVSVAFCLFSSVASVLMFLSILTARYAETDFLRSLPKRLIIG  785

Query  1040  LITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSST  1219
             L TLF S+  +M AF +TIYLVFGQ    I I V     +P+  F  LQF LL+ +  ST
Sbjct  786   LGTLFISMTSLMIAFGATIYLVFGQKNGLILIPVGIAGLIPVILFESLQFRLLLDMCMST  845

Query  1220  YGPGIFSQR  1246
             YGP IF ++
Sbjct  846   YGPSIFHKQ  854



>ref|XP_009783301.1| PREDICTED: uncharacterized protein LOC104231927 isoform X2 [Nicotiana 
sylvestris]
Length=859

 Score =   264 bits (674),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 167/342 (49%), Positives = 222/342 (65%), Gaps = 1/342 (0%)
 Frame = +2

Query  221   LWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVE  400
             ++K I    LMH++  D++K LC EL        +  +   A+L A    I E++  IV+
Sbjct  513   IFKRIKDIKLMHKETLDIVKRLCKELMKEYKPKDIEPVLRKAVLLAASSGIPEIIEEIVD  572

Query  401   AYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKL  580
              YP   +  +  + N+ H+A+ NR E +FN I   S+  H +    + +GN+I+++A KL
Sbjct  573   CYPDAIWFVNSENHNLFHLAVINRHEKVFNFIYQLSLYKHLVTTDEDTSGNNILHMAGKL  632

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
             AP  +LNL+SGAALQMQRELQWF+EV+K   P   +  + YGKTP+M FTE H+ L  EG
Sbjct  633   APLGRLNLISGAALQMQRELQWFQEVEKFVHPTLRTNRNSYGKTPKMVFTEEHKELVKEG  692

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK+TA SCT  AAL  TV FAAAITVPGGN  + G PIFS   AFT+FA+S A  LF
Sbjct  693   EKWMKETANSCTFVAALTATVGFAAAITVPGGN-QSKGFPIFSKEPAFTIFAVSVAFCLF  751

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++  S+L+FLS+LT+RYAE DFL +LP RLIIGL TLF S+  +M AF +TIYLVFGQ  
Sbjct  752   SSVASVLMFLSILTARYAETDFLRSLPKRLIIGLGTLFISMTSLMIAFGATIYLVFGQKN  811

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
               I I V     +P+  F  LQF LL+ +  STYGP IF ++
Sbjct  812   GLILIPVGIAGLIPVILFESLQFRLLLDMCMSTYGPSIFHKQ  853



>ref|XP_009790151.1| PREDICTED: uncharacterized protein LOC104237664 isoform X2 [Nicotiana 
sylvestris]
Length=695

 Score =   259 bits (663),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 180/441 (41%), Positives = 258/441 (59%), Gaps = 34/441 (8%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCIS--  178
             S  +D+AL ++    ++      N G   L  + +      +      W+R +Y  +S  
Sbjct  252   SNLFDVALHILQHMPELGIERDQN-GDTILHVLARKPLAFSDKIGLGIWQRFLYAYVSVH  310

Query  179   --------------KNSASTQNFVSQL-------LLWKSIPKKILMHQQATDLLKCLCDE  295
                           KN+     F++++       L  K + +  LMH QA +L+KC   E
Sbjct  311   LQNRSSNMSSGSRIKNNTKASAFITRVVQHLLKTLGIKEVLETKLMHLQALELVKCSWKE  370

Query  296   LKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIE  466
             +  LND +Q+ +L    S  L  A  L   + ++ ++++YP + +  D    +I HIA+ 
Sbjct  371   VLLLND-SQIGNLLRSPSRPLFVAAELGNFKFIVELIQSYPDLIWKVDEESRSIFHIAVI  429

Query  467   NRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRE  637
             +R E I+ LI        ++ + +  IN N   I++LAAKLAP ++L +VSGAALQMQRE
Sbjct  430   HRQEKIYKLIYNIGAHKDIITSYKSRINEN---ILHLAAKLAPTNRLGIVSGAALQMQRE  486

Query  638   LQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaaliv  817
             L WFKEV+ I    +    D  G+TP M F E H+ L  EGEKWMK+TA+SC + AALI 
Sbjct  487   LLWFKEVKTIVQASYKEMRDSKGRTPGMLFAEEHKELVKEGEKWMKETASSCMLVAALIT  546

Query  818   tvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAE  997
             TV+FAA  TVPGGN+D  G PIF     F +F+I++A +LF++ TS+L+FLS+LTSRYAE
Sbjct  547   TVMFAAIFTVPGGNNDDTGTPIFLKEKTFILFSITDALALFSSVTSILMFLSILTSRYAE  606

Query  998   QDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFV  1177
             +DFL  LP RLI+G ITLF +I  M+ AFSS+ ++V G   +WI I V  LAS+PIT F 
Sbjct  607   EDFLSTLPKRLILGFITLFVAIAAMLVAFSSSFFIVLGHQMAWIIIPVAVLASIPITLFA  666

Query  1178  LLQFPLLVALVSSTYGPGIFS  1240
              LQFPLL  ++ STYG GIF+
Sbjct  667   FLQFPLLADMIRSTYGSGIFT  687



>ref|XP_010644786.1| PREDICTED: uncharacterized protein LOC100250505 isoform X2 [Vitis 
vinifera]
Length=333

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 219/335 (65%), Gaps = 13/335 (4%)
 Frame = +2

Query  251   MHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSD  430
             MH    +LL  +C E+  ++   ++F     + +      I E++  I+++YP   +  +
Sbjct  1     MHTLTLELLNHVCTEVLKVSRAKEIFR---QSFINGAKYGIPEILEEIIKSYP---FALE  54

Query  431   HNDLNILHIAIENRCENIFNLIRGTS----VLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
             + D ++  + + NR E IFNLI  T     +++    DT   N ++I++LA KLAP H+L
Sbjct  55    YLDEDLFKLVVLNRYEKIFNLICETGMHRQLIIRTRDDT---NNDNILHLAGKLAPPHRL  111

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
             +LVSGAALQMQREL WFKE++K A   FS   +E    P+M F + H  L  EGEKWMK 
Sbjct  112   SLVSGAALQMQRELHWFKEIEKYAPRAFSESENENKDKPKMAFIKEHENLIKEGEKWMKG  171

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             TA   T+AAALI TVVFAAAIT+PGGN D  G+  FS   AF VFA+S+A SLF +  S+
Sbjct  172   TAKFYTLAAALIATVVFAAAITIPGGNHDDTGIRNFSKEIAFKVFAVSDALSLFLSIASV  231

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             L+ LS+LT+RYAE DFL+ALP RLI GL+TLF S+  MM A+S  IYL+FG+ K+WI I 
Sbjct  232   LICLSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSGAIYLLFGEKKAWILIA  291

Query  1139  VPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             + ALA  P+T +  LQFPLLV L+ STYGPGIF +
Sbjct  292   LAALACFPVTLYGNLQFPLLVELIYSTYGPGIFGK  326



>ref|XP_010644785.1| PREDICTED: uncharacterized protein LOC100250505 isoform X1 [Vitis 
vinifera]
Length=358

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 164/343 (48%), Positives = 222/343 (65%), Gaps = 13/343 (4%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I +   MH    +LL  +C E+  ++   ++F     + +      I E++  I+++Y
Sbjct  18    KHIQETKTMHTLTLELLNHVCTEVLKVSRAKEIFR---QSFINGAKYGIPEILEEIIKSY  74

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS----VLVHNLQDTINGNGNDIMNLAA  574
             P   +  ++ D ++  + + NR E IFNLI  T     +++    DT   N ++I++LA 
Sbjct  75    P---FALEYLDEDLFKLVVLNRYEKIFNLICETGMHRQLIIRTRDDT---NNDNILHLAG  128

Query  575   KLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKI  754
             KLAP H+L+LVSGAALQMQREL WFKE++K A   FS   +E    P+M F + H  L  
Sbjct  129   KLAPPHRLSLVSGAALQMQRELHWFKEIEKYAPRAFSESENENKDKPKMAFIKEHENLIK  188

Query  755   EGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaas  934
             EGEKWMK TA   T+AAALI TVVFAAAIT+PGGN D  G+  FS   AF VFA+S+A S
Sbjct  189   EGEKWMKGTAKFYTLAAALIATVVFAAAITIPGGNHDDTGIRNFSKEIAFKVFAVSDALS  248

Query  935   lftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQ  1114
             LF +  S+L+ LS+LT+RYAE DFL+ALP RLI GL+TLF S+  MM A+S  IYL+FG+
Sbjct  249   LFLSIASVLICLSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSGAIYLLFGE  308

Query  1115  NKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              K+WI I + ALA  P+T +  LQFPLLV L+ STYGPGIF +
Sbjct  309   KKAWILIALAALACFPVTLYGNLQFPLLVELIYSTYGPGIFGK  351



>ref|XP_009610229.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Nicotiana tomentosiformis]
Length=690

 Score =   259 bits (662),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 178/434 (41%), Positives = 252/434 (58%), Gaps = 24/434 (6%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCIS--  178
             S  +D+AL ++    ++      N G   L  + +      +      W+R +Y  +S  
Sbjct  251   SNLFDVALHILQHMPELGIERDQN-GDTILHVLARKPLAFSDKIELGIWQRFLYAYVSVH  309

Query  179   --------------KNSASTQNFVSQLLLW---KSIPKKILMHQQATDLLKCLCDELKTL  307
                           KN+     F+  LL     K + +  LMH QA +L+KC   E+  L
Sbjct  310   LQNRSSNMSSGSRIKNNTKAYAFIQHLLKTLGVKEVLETKLMHLQALELVKCSWKEVLLL  369

Query  308   NDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCE  478
             ND +Q+ +L    S  L  A  L   + ++ ++++YP + +  D    +I HIA+ +R E
Sbjct  370   ND-SQIGNLLRSPSRPLFVAAELGNFKFIVELIQSYPDLIWKVDEESRSIFHIAVIHRQE  428

Query  479   NIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEV  658
              I+ LI         +    + N  +I++LAAKLAP ++L +VSGAALQMQREL WFKEV
Sbjct  429   KIYKLIYNIGAHKDIITSYKSRNNENILHLAAKLAPTNRLGIVSGAALQMQRELLWFKEV  488

Query  659   QKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaa  838
             + I    +    D  G+TP M F E H+ L  EGEKWMK+TA+SC + AALI TV+FAA 
Sbjct  489   KTIVQASYKEMRDLKGRTPGMLFAEEHKELVKEGEKWMKETASSCMLVAALITTVMFAAI  548

Query  839   itvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYAL  1018
              TVPGGN+D  G PIF     F +F+I++A +LF++ TS+L+FLS+LTSRYAE+DFL  L
Sbjct  549   FTVPGGNNDDTGTPIFLKEKTFILFSITDALALFSSVTSILMFLSILTSRYAEEDFLSTL  608

Query  1019  PNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLL  1198
             P RLI+G ITLF +I  M+ AFSS+ ++V G   +WI   V  LAS+PIT F  LQFPLL
Sbjct  609   PKRLILGFITLFVAIAAMLVAFSSSFFIVLGHQMAWIITPVAVLASIPITLFAFLQFPLL  668

Query  1199  VALVSSTYGPGIFS  1240
               ++ STYG GIF+
Sbjct  669   ADMIRSTYGSGIFT  682



>ref|XP_010276714.1| PREDICTED: uncharacterized protein LOC104611391 isoform X2 [Nelumbo 
nucifera]
Length=595

 Score =   257 bits (656),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 224/338 (66%), Gaps = 8/338 (2%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             LMH Q   L+  +C ++  LND  ++  L  + L+ A    I E++   V+AYP + +  
Sbjct  243   LMHMQVQKLINRICAQVLLLNDKEEIKKLFMEVLVSA-KFGIIELIQICVQAYPEVLW-Y  300

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             + +  NILH+AIE R E +FN++RG+    + L +    N N I++LAAKLAP  KLN V
Sbjct  301   ETDGRNILHLAIEYRQEEVFNILRGSGAFFNILANPRLRNLNSIIHLAAKLAPPSKLNSV  360

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGAALQMQRELQWFKEV+KI  P +++  +   K  +  FTE H+ L  + EKWMKDTA 
Sbjct  361   SGAALQMQRELQWFKEVEKIPTPGYNTRPNNSSKIAKDMFTEEHKDLLEKAEKWMKDTAA  420

Query  788   SCtiaaalivtvvfaaaitvPGG-NSDAN-----GLPIFSSHNAFTVFAISNaaslftaa  949
             SC + A LI TVVF AA TVPGG NSD+      G PIF    +F VFAIS+A +LF + 
Sbjct  421   SCMVVATLIATVVFTAAFTVPGGNNSDSGNNYDKGSPIFLEEKSFMVFAISDAIALFFST  480

Query  950   tsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWI  1129
             +S+L+FLS+LTSRYAE+DFL +LP +LIIGL+TLFFSI  MM AFS+T +++F    SW+
Sbjct  481   SSVLMFLSILTSRYAEEDFLKSLPTKLIIGLVTLFFSIAAMMIAFSATFFIIFSHRFSWL  540

Query  1130  RIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              I++ ALA+ P+T F L    LL  +V STYG GIF Q
Sbjct  541   SILIAALATFPVTLFALSHARLLAEIVISTYGSGIFQQ  578



>ref|XP_010276715.1| PREDICTED: uncharacterized protein LOC104611391 isoform X3 [Nelumbo 
nucifera]
Length=592

 Score =   256 bits (655),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 224/338 (66%), Gaps = 8/338 (2%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             LMH Q   L+  +C ++  LND  ++  L  + L+ A    I E++   V+AYP + +  
Sbjct  240   LMHMQVQKLINRICAQVLLLNDKEEIKKLFMEVLVSA-KFGIIELIQICVQAYPEVLW-Y  297

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             + +  NILH+AIE R E +FN++RG+    + L +    N N I++LAAKLAP  KLN V
Sbjct  298   ETDGRNILHLAIEYRQEEVFNILRGSGAFFNILANPRLRNLNSIIHLAAKLAPPSKLNSV  357

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGAALQMQRELQWFKEV+KI  P +++  +   K  +  FTE H+ L  + EKWMKDTA 
Sbjct  358   SGAALQMQRELQWFKEVEKIPTPGYNTRPNNSSKIAKDMFTEEHKDLLEKAEKWMKDTAA  417

Query  788   SCtiaaalivtvvfaaaitvPGG-NSDAN-----GLPIFSSHNAFTVFAISNaaslftaa  949
             SC + A LI TVVF AA TVPGG NSD+      G PIF    +F VFAIS+A +LF + 
Sbjct  418   SCMVVATLIATVVFTAAFTVPGGNNSDSGNNYDKGSPIFLEEKSFMVFAISDAIALFFST  477

Query  950   tsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWI  1129
             +S+L+FLS+LTSRYAE+DFL +LP +LIIGL+TLFFSI  MM AFS+T +++F    SW+
Sbjct  478   SSVLMFLSILTSRYAEEDFLKSLPTKLIIGLVTLFFSIAAMMIAFSATFFIIFSHRFSWL  537

Query  1130  RIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              I++ ALA+ P+T F L    LL  +V STYG GIF Q
Sbjct  538   SILIAALATFPVTLFALSHARLLAEIVISTYGSGIFQQ  575



>gb|KDO77352.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
Length=570

 Score =   256 bits (653),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 253/416 (61%), Gaps = 18/416 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD+AL+L+ QHH     A    G   L  + +      + +   FW+R IY      
Sbjct  165   AGLYDVALDLI-QHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGM-  222

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
                           ++I    LMH QA +L+K L +++  L+D    ++    S  L  A
Sbjct  223   --------------RAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTA  268

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
             V L   E ++ +++ YP + +  D +  ++ HIA+ +R E IFNLI         +    
Sbjct  269   VELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYK  328

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N N++++LA KLAP  +L + SGAALQ++REL WFKE++K+  P +    +  G+TP 
Sbjct  329   DENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPH  388

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
             + F+E HR L  EGEKWMKDTA+SC + A LI TV+FAAA TVPGGN D+ G PIF  + 
Sbjct  389   ILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYK  448

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +F VFA+S+A +LF +ATS+L+FLS++TSRYAE+DF+++LPNRLIIGL TLF SI  MM 
Sbjct  449   SFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMA  508

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             AF++T+++V G +  WI I +   A +P++ F LLQFPLL  ++S  Y   IF++R
Sbjct  509   AFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRR  564



>ref|XP_010260576.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Nelumbo nucifera]
Length=460

 Score =   252 bits (644),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 163/356 (46%), Positives = 224/356 (63%), Gaps = 12/356 (3%)
 Frame = +2

Query  218   LLWKSIPKKI----------LMHQQATDLLKCLCDELKTLNDYNQ--VFSLASDALLRAV  361
             LLW S+   +          +MH QA +++K L  E+  L+D N   +    S  L  A 
Sbjct  100   LLWNSLKAIVPYIKQVYDTKVMHFQAIEVVKVLWHEVLKLDDKNMSALLREPSRPLFVAA  159

Query  362   HLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTIN  541
              L IAE +  ++  YP + +  + ++ +I H A+ +  E IF LI     L   +   ++
Sbjct  160   ELGIAEFIAVLLRDYPDLLWKVNSDNQSIFHTAVAHHQEKIFILIHDIGALKDLITSYVD  219

Query  542   GNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEM  721
             GN N++++LA  LAP  +LN +SGAALQMQRE QWFKEV+K+  P +    +  GKTP  
Sbjct  220   GNNNNMLHLAGNLAPSSRLNTISGAALQMQREHQWFKEVEKVMQPLYMEMKNSEGKTPRT  279

Query  722   HFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNA  901
              FTE H  L  EGEKWMKDTA+SC I A LI TVVFAAA TVPGGN D  G+P+F    +
Sbjct  280   LFTEKHANLVKEGEKWMKDTASSCMIVATLIATVVFAAAFTVPGGNYDDKGIPVFLEVRS  339

Query  902   FTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTA  1081
             F VFAIS+A +LF++ TS+L+FLS+LTSRYA +DFL  LP R+++GL TLF SI  M+ A
Sbjct  340   FIVFAISDALALFSSITSVLMFLSILTSRYAAEDFLETLPRRMVLGLTTLFVSIATMVIA  399

Query  1082  FSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             FS+T+++V      WI I +  LA +P+T F LLQFPL + ++ ST+G GIF + G
Sbjct  400   FSATLFIVLRSRLDWIAIPIAILACVPVTMFALLQFPLFMDIIHSTHGFGIFYRPG  455



>ref|XP_007138825.1| hypothetical protein PHAVU_009G240400g [Phaseolus vulgaris]
 gb|ESW10819.1| hypothetical protein PHAVU_009G240400g [Phaseolus vulgaris]
Length=720

 Score =   258 bits (659),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 174/441 (39%), Positives = 255/441 (58%), Gaps = 29/441 (7%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIY------  166
             +  YD AL ++     +  +  LN G   L  + K      +      W+R IY      
Sbjct  281   TDLYDFALHVLECRPQLATYHGLN-GETALHVLAKKTSSFRSGTQLGIWERCIYPWIQVK  339

Query  167   -----YCISKNSASTQNFVSQLLL--------------WKSIPKKILMHQQATDLLKCLC  289
                   C S NS S      Q LL              ++++ KK +++ QA  L++ L 
Sbjct  340   LATEYKCQSNNSLSQAPSTFQDLLVNGLCRAVKYLVPGFETVQKKKILNSQALKLVQHLW  399

Query  290   DELKTLNDY---NQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIA  460
             + +++ ++    + + S  S  L  A    I E+V  ++ +YP + +  D  + ++ HIA
Sbjct  400   ELVESSDEMHYGDLIKSPLSRPLFIAAEFGIPEIVTELLYSYPDLLWKVDSQNRSLFHIA  459

Query  461   IENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQREL  640
             I  R E IFNLI         +    + N ++I++LA KLAP  +L++VSGAALQMQREL
Sbjct  460   IMYRQEKIFNLIYNIGAHKDLITSYRDNNNHNILHLAGKLAPSDQLHVVSGAALQMQREL  519

Query  641   QWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivt  820
              WFKEV+KI  P      D  G+TP+M FTE H+ L  EGEKW+K+TA+SC + + LI T
Sbjct  520   LWFKEVEKIIQPLLKEIKDSEGRTPQMLFTEEHKGLAKEGEKWLKNTASSCMLVSTLITT  579

Query  821   vvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQ  1000
             V+FAA  TVPGGN+++NG PIF    +F VFA+S+A  LF++  S+L+FLS+LTSRYA++
Sbjct  580   VMFAALFTVPGGNNNSNGYPIFMRTTSFKVFALSDALGLFSSVVSILMFLSILTSRYAQE  639

Query  1001  DFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVL  1180
             DFL +LP RL +G+ TLFFSII M+ AF +T ++V G   +WI I +  +A +P   F  
Sbjct  640   DFLVSLPKRLSVGIATLFFSIITMLIAFGATFFIVLGHQLAWIVIPITLVACIPAILFAF  699

Query  1181  LQFPLLVALVSSTYGPGIFSQ  1243
             LQFPLLV  +S TYG G+F++
Sbjct  700   LQFPLLVDTISCTYGAGVFAR  720



>ref|XP_010276713.1| PREDICTED: uncharacterized protein LOC104611391 isoform X1 [Nelumbo 
nucifera]
Length=642

 Score =   256 bits (654),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 168/338 (50%), Positives = 224/338 (66%), Gaps = 8/338 (2%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             LMH Q   L+  +C ++  LND  ++  L  + L+ A    I E++   V+AYP + +  
Sbjct  290   LMHMQVQKLINRICAQVLLLNDKEEIKKLFMEVLVSA-KFGIIELIQICVQAYPEVLW-Y  347

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             + +  NILH+AIE R E +FN++RG+    + L +    N N I++LAAKLAP  KLN V
Sbjct  348   ETDGRNILHLAIEYRQEEVFNILRGSGAFFNILANPRLRNLNSIIHLAAKLAPPSKLNSV  407

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGAALQMQRELQWFKEV+KI  P +++  +   K  +  FTE H+ L  + EKWMKDTA 
Sbjct  408   SGAALQMQRELQWFKEVEKIPTPGYNTRPNNSSKIAKDMFTEEHKDLLEKAEKWMKDTAA  467

Query  788   SCtiaaalivtvvfaaaitvPGG-NSDAN-----GLPIFSSHNAFTVFAISNaaslftaa  949
             SC + A LI TVVF AA TVPGG NSD+      G PIF    +F VFAIS+A +LF + 
Sbjct  468   SCMVVATLIATVVFTAAFTVPGGNNSDSGNNYDKGSPIFLEEKSFMVFAISDAIALFFST  527

Query  950   tsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWI  1129
             +S+L+FLS+LTSRYAE+DFL +LP +LIIGL+TLFFSI  MM AFS+T +++F    SW+
Sbjct  528   SSVLMFLSILTSRYAEEDFLKSLPTKLIIGLVTLFFSIAAMMIAFSATFFIIFSHRFSWL  587

Query  1130  RIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              I++ ALA+ P+T F L    LL  +V STYG GIF Q
Sbjct  588   SILIAALATFPVTLFALSHARLLAEIVISTYGSGIFQQ  625



>ref|XP_007024884.1| Ankyrin repeat-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY27506.1| Ankyrin repeat-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=709

 Score =   258 bits (658),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 172/425 (40%), Positives = 247/425 (58%), Gaps = 14/425 (3%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIY------  166
             +  +D+AL L+ QHH        + G   L  + +      + +    W++ IY      
Sbjct  286   TDLFDVALCLI-QHHPELATLRDSNGETALHVLARKPSAFASRSELGTWEKFIYPWIYVE  344

Query  167   -----YCISKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQV  325
                   C S  S    +  +Q+   K+I KK L+H QA  L++ L  ++ +L D     +
Sbjct  345   PLVKSSCPSGMSKCCCDHTNQVPGHKAIYKKKLLHMQAIVLVELLWGQILSLEDSQITDI  404

Query  326   FSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGT  505
                 S  L  A    + E++  ++++YP + +  D +  +I H+A+ +R E IF LI   
Sbjct  405   LRSPSQVLFIAAEFGVVELITELIQSYPDLIWRVDEHSRSIFHMAVIHRQEKIFRLIHDI  464

Query  506   SVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFS  685
               L   +    + N + I++LA K+AP ++LN+VSGAALQMQREL WFKEV+K   P + 
Sbjct  465   GALKDMIAAYKDKNNHCILHLAGKIAPPNRLNIVSGAALQMQRELLWFKEVEKNVQPLYK  524

Query  686   SCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSD  865
                D  G+TP M FTE H  L  EGEKWMK TA+SC + A LI TV+FAA  TVPGGN +
Sbjct  525   EMRDINGRTPRMLFTEEHAKLVKEGEKWMKSTASSCMLVATLITTVMFAAIFTVPGGNDN  584

Query  866   ANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLI  1045
               G P+F    +F +FAIS+A +LF++ TS+L+FLS+LTSRYAE+DFL  LP RLI+GL 
Sbjct  585   EKGTPLFLEAKSFIIFAISDALALFSSVTSILMFLSILTSRYAEEDFLRLLPQRLIVGLA  644

Query  1046  TLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYG  1225
             TLF SI  M+ AF +T  +V  Q  +WI +    +A +P+T F  LQFPLLV ++ S+ G
Sbjct  645   TLFLSIAAMLVAFGATFCIVLSQRLAWIAVPAALIACIPVTLFAFLQFPLLVDMIQSSNG  704

Query  1226  PGIFS  1240
              GIFS
Sbjct  705   AGIFS  709



>ref|XP_009610228.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Nicotiana tomentosiformis]
Length=692

 Score =   256 bits (655),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 162/341 (48%), Positives = 222/341 (65%), Gaps = 4/341 (1%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIV  397
             K + +  LMH QA +L+KC   E+  LND +Q+ +L    S  L  A  L   + ++ ++
Sbjct  345   KEVLETKLMHLQALELVKCSWKEVLLLND-SQIGNLLRSPSRPLFVAAELGNFKFIVELI  403

Query  398   EAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAK  577
             ++YP + +  D    +I HIA+ +R E I+ LI         +    + N  +I++LAAK
Sbjct  404   QSYPDLIWKVDEESRSIFHIAVIHRQEKIYKLIYNIGAHKDIITSYKSRNNENILHLAAK  463

Query  578   LAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIE  757
             LAP ++L +VSGAALQMQREL WFKEV+ I    +    D  G+TP M F E H+ L  E
Sbjct  464   LAPTNRLGIVSGAALQMQRELLWFKEVKTIVQASYKEMRDLKGRTPGMLFAEEHKELVKE  523

Query  758   GEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaasl  937
             GEKWMK+TA+SC + AALI TV+FAA  TVPGGN+D  G PIF     F +F+I++A +L
Sbjct  524   GEKWMKETASSCMLVAALITTVMFAAIFTVPGGNNDDTGTPIFLKEKTFILFSITDALAL  583

Query  938   ftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQN  1117
             F++ TS+L+FLS+LTSRYAE+DFL  LP RLI+G ITLF +I  M+ AFSS+ ++V G  
Sbjct  584   FSSVTSILMFLSILTSRYAEEDFLSTLPKRLILGFITLFVAIAAMLVAFSSSFFIVLGHQ  643

Query  1118  KSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
              +WI   V  LAS+PIT F  LQFPLL  ++ STYG GIF+
Sbjct  644   MAWIITPVAVLASIPITLFAFLQFPLLADMIRSTYGSGIFT  684



>emb|CAN68331.1| hypothetical protein VITISV_030161 [Vitis vinifera]
Length=476

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 166/353 (47%), Positives = 225/353 (64%), Gaps = 18/353 (5%)
 Frame = +2

Query  212   QLLLW-----KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIA  376
             +L++W     K I +   MH     LL  LC E+  ++   ++F     + +      I 
Sbjct  126   ELVVWLVPPIKHIQETKTMHTLTLQLLNHLCTEVLKVSRAKEIFR---QSFINGAKYGIP  182

Query  377   EVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS----VLVHNLQDTING  544
             E++  I+++YP   +  ++ D ++  + + NR E IFNLI  T     +++    DT   
Sbjct  183   EILEEIIKSYP---FALEYLDEDLFKLVVLNRYEKIFNLICETGMHRQLIIRTRDDT---  236

Query  545   NGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMH  724
             N ++I++LA KLAP H+L+L SGAALQMQREL WFKE++K A   FS   +E    P+M 
Sbjct  237   NNDNILHLAGKLAPPHRLSLXSGAALQMQRELHWFKEIEKYAPRAFSESENENKDKPKMA  296

Query  725   FTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAF  904
             F + H  L  EGEKWMK TA   T+AAALI TVVFAAAIT+PGGN D  G+  FS   AF
Sbjct  297   FIKEHENLIKEGEKWMKGTAKFYTLAAALIATVVFAAAITIPGGNHDDTGIXNFSKEIAF  356

Query  905   TVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAF  1084
              VFA+S+A SLF +  S+L+ LS+LT+RYAE DFL+ALP RLI GL+TLF S+  MM A+
Sbjct  357   KVFAVSDALSLFLSIASVLICLSILTARYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAY  416

Query  1085  SSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             S  IYL+FG+ K+WI I + ALA  P+T +  LQFPLLV L+ STYGPGIF +
Sbjct  417   SGAIYLLFGEKKAWILIALAALACFPVTLYGXLQFPLLVELIYSTYGPGIFGK  469



>ref|XP_010260578.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Nelumbo nucifera]
Length=636

 Score =   254 bits (650),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 231/373 (62%), Gaps = 17/373 (5%)
 Frame = +2

Query  137   NFSFWKRSIYYCISKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDY  316
             NF  WKR +Y         +  ++ Q+   K      +MH QA +++K L  E+  L+D 
Sbjct  274   NFGIWKRFLY---------SFPYIKQVYDTK------VMHFQAIEVVKVLWHEVLKLDDK  318

Query  317   NQ--VFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFN  490
             N   +    S  L  A  L IAE +  ++  YP + +  + ++ +I H A+ +  E IF 
Sbjct  319   NMSALLREPSRPLFVAAELGIAEFIAVLLRDYPDLLWKVNSDNQSIFHTAVAHHQEKIFI  378

Query  491   LIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIA  670
             LI     L   +   ++GN N++++LA  LAP  +LN +SGAALQMQRE QWFKEV+K+ 
Sbjct  379   LIHDIGALKDLITSYVDGNNNNMLHLAGNLAPSSRLNTISGAALQMQREHQWFKEVEKVM  438

Query  671   LPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvP  850
              P +    +  GKTP   FTE H  L  EGEKWMKDTA+SC I A LI TVVFAAA TVP
Sbjct  439   QPLYMEMKNSEGKTPRTLFTEKHANLVKEGEKWMKDTASSCMIVATLIATVVFAAAFTVP  498

Query  851   GGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRL  1030
             GGN D  G+P+F    +F VFAIS+A +LF++ TS+L+FLS+LTSRYA +DFL  LP R+
Sbjct  499   GGNYDDKGIPVFLEVRSFIVFAISDALALFSSITSVLMFLSILTSRYAAEDFLETLPRRM  558

Query  1031  IIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALV  1210
             ++GL TLF SI  M+ AFS+T+++V      WI I +  LA +P+T F LLQFPL + ++
Sbjct  559   VLGLTTLFVSIATMVIAFSATLFIVLRSRLDWIAIPIAILACVPVTMFALLQFPLFMDII  618

Query  1211  SSTYGPGIFSQRG  1249
              ST+G GIF + G
Sbjct  619   HSTHGFGIFYRPG  631



>ref|XP_006448683.1| hypothetical protein CICLE_v10014428mg [Citrus clementina]
 gb|ESR61923.1| hypothetical protein CICLE_v10014428mg [Citrus clementina]
Length=715

 Score =   255 bits (652),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 253/416 (61%), Gaps = 18/416 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD+AL+L+ QHH     A    G   L  + +      + +   FW+R IY      
Sbjct  310   AGLYDVALDLI-QHHPQLAMARDGNGETALHVLARKPSAFASGSQLRFWRRCIYSVPG--  366

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
                           ++I    LMH QA +L+K L +++  L+D    ++    S  L  A
Sbjct  367   -------------MRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTA  413

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
             V L   E ++ +++ YP + +  D +  ++ HIA+ +R E IFNLI         +    
Sbjct  414   VELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYK  473

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N N++++LA KLAP  +L + SGAALQ++REL WFKE++K+  P +    +  G+TP 
Sbjct  474   DENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPH  533

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
             + F+E HR L  EGEKWMKDTA+SC + A LI TV+FAAA TVPGGN D+ G PIF  + 
Sbjct  534   ILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFRHYK  593

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +F VFA+S+A +LF +ATS+L+FLS++TSRYAE+DF+++LPNRLIIGL TLF SI  MM 
Sbjct  594   SFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMA  653

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             AF++T+++V G +  WI I +   A +P++ F LLQFPLL  ++S  Y   IF++R
Sbjct  654   AFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRR  709



>gb|KDO77348.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
 gb|KDO77349.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
 gb|KDO77350.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
 gb|KDO77351.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
Length=715

 Score =   254 bits (650),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 253/416 (61%), Gaps = 18/416 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD+AL+L+ QHH     A    G   L  + +      + +   FW+R IY      
Sbjct  310   AGLYDVALDLI-QHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPG--  366

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
                           ++I    LMH QA +L+K L +++  L+D    ++    S  L  A
Sbjct  367   -------------MRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTA  413

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
             V L   E ++ +++ YP + +  D +  ++ HIA+ +R E IFNLI         +    
Sbjct  414   VELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYK  473

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N N++++LA KLAP  +L + SGAALQ++REL WFKE++K+  P +    +  G+TP 
Sbjct  474   DENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPH  533

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
             + F+E HR L  EGEKWMKDTA+SC + A LI TV+FAAA TVPGGN D+ G PIF  + 
Sbjct  534   ILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYK  593

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +F VFA+S+A +LF +ATS+L+FLS++TSRYAE+DF+++LPNRLIIGL TLF SI  MM 
Sbjct  594   SFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMA  653

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             AF++T+++V G +  WI I +   A +P++ F LLQFPLL  ++S  Y   IF++R
Sbjct  654   AFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRR  709



>ref|XP_006468495.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Citrus sinensis]
 ref|XP_006468496.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Citrus sinensis]
 ref|XP_006468497.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X4 [Citrus sinensis]
Length=715

 Score =   254 bits (650),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 253/416 (61%), Gaps = 18/416 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD+AL+L+ QHH     A    G   L  + +      + +   FW+R IY      
Sbjct  310   AGLYDVALDLI-QHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPG--  366

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
                           ++I    LMH QA +L+K L +++  L+D    ++    S  L  A
Sbjct  367   -------------MRAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTA  413

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
             V L   E ++ +++ YP + +  D +  ++ HIA+ +R E IFNLI         +    
Sbjct  414   VELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYK  473

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N N++++LA KLAP  +L + SGAALQ++REL WFKE++K+  P +    +  G+TP 
Sbjct  474   DENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPH  533

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
             + F+E HR L  EGEKWMKDTA+SC + A LI TV+FAAA TVPGGN D+ G PIF  + 
Sbjct  534   ILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYK  593

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +F VFA+S+A +LF +ATS+L+FLS++TSRYAE+DF+++LPNRLIIGL TLF SI  MM 
Sbjct  594   SFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMA  653

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             AF++T+++V G +  WI I +   A +P++ F LLQFPLL  ++S  Y   IF++R
Sbjct  654   AFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRR  709



>ref|XP_010244048.1| PREDICTED: uncharacterized protein LOC104587960 [Nelumbo nucifera]
Length=884

 Score =   257 bits (656),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 174/418 (42%), Positives = 258/418 (62%), Gaps = 13/418 (3%)
 Frame = +2

Query  2     RSKFYDMALELVGQHHD--VTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIY---  166
             R++ YD+AL L+ ++    +T +   N+G   L A+ +      + +    W++ +Y   
Sbjct  325   RAEIYDVALNLLRRYPRLAITQN---NLGDTVLTALSRRPSAFPSGSRHGIWRQWVYSFF  381

Query  167   YCISKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDA  346
             + + + + S     S+ L    + +K  +H Q  ++LK +C E++ L++ + + +    A
Sbjct  382   WLLHRIAWSA----SKPLGIHHMHQKEPVHIQVIEILKVICSEIEKLDEAHLLEAKVYFA  437

Query  347   LLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNL  526
             ++ A    I E+V  I+ + P   Y +D N  NI+ IAI +R   +FNLI G      ++
Sbjct  438   VVNAAKFGIVEIVDEIIRSIPNAIYTADENGRNIVAIAIVHRQHKVFNLIYGMGPKQSHI  497

Query  527   QDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYG  706
                 N + N +++LAA L+P  +L+ VSGAALQMQRELQW+KEV K   P F+  +++ G
Sbjct  498   TPFDNQD-NSLLHLAAMLSPYSQLSRVSGAALQMQRELQWYKEVGKFVPPVFAERINKNG  556

Query  707   KTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIF  886
             + P   FTE H+ L  EGE WMK TA+SCT+ AALI T++F AA TVPGGN+   G+PIF
Sbjct  557   QIPPTLFTEQHKDLVKEGETWMKGTASSCTVVAALIATIMFTAAFTVPGGNNSDTGIPIF  616

Query  887   SSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSII  1066
                 AF +F IS+A SLF+++ S+L+FL +LTSRYAE+DFL +LP RLIIGL TLFFS+ 
Sbjct  617   LHRKAFMIFIISDAFSLFSSSASMLMFLGILTSRYAEEDFLVSLPKRLIIGLATLFFSVA  676

Query  1067  LMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
              MM AF +T+++V      W  I +  L S+P+  FVLLQFPLLV +V STYG GIF 
Sbjct  677   TMMIAFGATLFIVLHHRAQWTAIPITLLGSVPVALFVLLQFPLLVDMVVSTYGSGIFG  734



>emb|CDP11284.1| unnamed protein product [Coffea canephora]
Length=352

 Score =   244 bits (623),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 154/342 (45%), Positives = 216/342 (63%), Gaps = 2/342 (1%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRAVHLDIAEVVLSIVE  400
             + + ++ L H QA +LLKC+  ++  L+D    ++    S  L  A      E ++ ++ 
Sbjct  5     QEVFERKLKHFQALELLKCIWKQVMLLDDSQIGKLLRGPSRPLFVAAECGNFEFIVELLR  64

Query  401   AYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKL  580
             +YP + +  D    +  HIA+ +R E IF LI     L   +    + N ++I++LAAKL
Sbjct  65    SYPDLIWKVDEQSQSFFHIAVIHRQERIFKLIYQIGALKDLITSYKSTNNSNILHLAAKL  124

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
             A  ++LN+VSGAALQMQREL WFKEV+K   P +    D  G+ P M FT+ H+ L   G
Sbjct  125   AAPNRLNIVSGAALQMQRELLWFKEVEKNVQPLYKEMRDSEGRMPHMLFTQEHKALLKSG  184

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             E+WMKDTA+SC + A LI TV+FAA  TVPGGN++  G PIF    AF +F+IS+A +LF
Sbjct  185   ERWMKDTASSCMLVATLITTVMFAAIFTVPGGNNNETGTPIFLKDKAFIIFSISDALALF  244

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++ TS+L+FLS+LTSRYAE DF+  LP RLIIGL+TLFFSI  M+ AFS++  +V G   
Sbjct  245   SSVTSILMFLSILTSRYAEVDFMETLPKRLIIGLMTLFFSIASMLIAFSASFSIVHGHKI  304

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +WI I V   A +P+  F   QFPL+  +  STYG GIF+Q 
Sbjct  305   AWIIIPVALAACIPVLLFAFSQFPLVADMFHSTYGSGIFAQE  346



>ref|XP_006365060.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Solanum 
tuberosum]
Length=695

 Score =   253 bits (646),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 220/334 (66%), Gaps = 4/334 (1%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYPTMA  418
             LMH QA +L+KC   E+  LND +Q+ +L    S  L  A  L   E ++ ++++YP + 
Sbjct  355   LMHLQALELVKCSWKEVLLLND-SQIGNLLRSPSRPLFVAAELGNFEFIVELIQSYPDLI  413

Query  419   YCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
             +  D    +I HIA+ +R E I+ LI         +    + N  +I++LAAKLAP ++L
Sbjct  414   WKVDEESRSIFHIAVIHRQEKIYKLIYNIGSHKDIITSYKSTNNENILHLAAKLAPTNRL  473

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
              +VSGAALQMQREL WFKEV+ I    +    D  G+TP M FTE H+ L  EGEKWMK+
Sbjct  474   GIVSGAALQMQRELLWFKEVETIVQASYKEMRDSRGRTPGMLFTEEHKELVKEGEKWMKE  533

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             TA+SC + AALI TV+FAA  TVPGGN++  G   F    AF +F++ +A +LF++  S+
Sbjct  534   TASSCMLVAALITTVMFAAIFTVPGGNNNDTGTAFFLKEKAFIIFSMMDALALFSSVISI  593

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             L+FLS+LTSRYAE+DFL  LP RLIIG I+LF +I  M+ AF S+ ++V G+  +WI I 
Sbjct  594   LMFLSILTSRYAEEDFLCTLPKRLIIGFISLFVAIAAMLVAFCSSFFIVLGRQMAWIIIP  653

Query  1139  VPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
             V ALAS+P+T F  LQFPLL  +++S+YG GIF+
Sbjct  654   VAALASIPVTLFAFLQFPLLADMITSSYGSGIFT  687



>ref|XP_006468494.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Citrus sinensis]
Length=793

 Score =   254 bits (650),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 253/416 (61%), Gaps = 18/416 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD+AL+L+ QHH     A    G   L  + +      + +   FW+R IY      
Sbjct  388   AGLYDVALDLI-QHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGM-  445

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
                           ++I    LMH QA +L+K L +++  L+D    ++    S  L  A
Sbjct  446   --------------RAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTA  491

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
             V L   E ++ +++ YP + +  D +  ++ HIA+ +R E IFNLI         +    
Sbjct  492   VELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYK  551

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N N++++LA KLAP  +L + SGAALQ++REL WFKE++K+  P +    +  G+TP 
Sbjct  552   DENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPH  611

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
             + F+E HR L  EGEKWMKDTA+SC + A LI TV+FAAA TVPGGN D+ G PIF  + 
Sbjct  612   ILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYK  671

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +F VFA+S+A +LF +ATS+L+FLS++TSRYAE+DF+++LPNRLIIGL TLF SI  MM 
Sbjct  672   SFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMA  731

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             AF++T+++V G +  WI I +   A +P++ F LLQFPLL  ++S  Y   IF++R
Sbjct  732   AFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRR  787



>gb|KDO77347.1| hypothetical protein CISIN_1g003814mg [Citrus sinensis]
Length=793

 Score =   254 bits (650),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 253/416 (61%), Gaps = 18/416 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD+AL+L+ QHH     A    G   L  + +      + +   FW+R IY      
Sbjct  388   AGLYDVALDLI-QHHPQLAMARDGNGETALHVLARKPSAFASGSQLGFWRRCIYSVPGM-  445

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
                           ++I    LMH QA +L+K L +++  L+D    ++    S  L  A
Sbjct  446   --------------RAILDPKLMHLQALELVKRLWEQVLLLDDSKIGELLRKPSRLLFTA  491

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
             V L   E ++ +++ YP + +  D +  ++ HIA+ +R E IFNLI         +    
Sbjct  492   VELGNVEFLMVLIQMYPNLIWKVDDHSRSMFHIAVVHRQEKIFNLIYELGAHKDLIASYK  551

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N N++++LA KLAP  +L + SGAALQ++REL WFKE++K+  P +    +  G+TP 
Sbjct  552   DENNNNMLHLAGKLAPPDRLKIDSGAALQLRRELHWFKEIEKVVQPSYREAKNSEGRTPH  611

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
             + F+E HR L  EGEKWMKDTA+SC + A LI TV+FAAA TVPGGN D+ G PIF  + 
Sbjct  612   ILFSEEHRRLVREGEKWMKDTASSCMVVATLIATVMFAAAFTVPGGNDDSTGRPIFLHYK  671

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +F VFA+S+A +LF +ATS+L+FLS++TSRYAE+DF+++LPNRLIIGL TLF SI  MM 
Sbjct  672   SFMVFAVSDALALFCSATSILMFLSIITSRYAEEDFVHSLPNRLIIGLATLFISIATMMA  731

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             AF++T+++V G +  WI I +   A +P++ F LLQFPLL  ++S  Y   IF++R
Sbjct  732   AFAATLFIVLGDDFVWIAIPIATGACVPVSLFALLQFPLLSDMISHLYKYSIFTRR  787



>ref|XP_010317038.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Solanum 
lycopersicum]
Length=701

 Score =   253 bits (645),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 220/334 (66%), Gaps = 4/334 (1%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYPTMA  418
             LMH QA +L+KC   ++  LND +Q+ +L    S  L  A  L   E ++ ++++YP + 
Sbjct  361   LMHLQALELVKCSWRKVLLLND-SQIGNLLRSPSRPLFVAAELGNFEFIVELIQSYPDLI  419

Query  419   YCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
             +  D    +I HIA+ +R E ++ LI         +    + N  +I++LAAKLAP ++L
Sbjct  420   WKVDEESRSIFHIAVIHRQEKVYKLIYNIGSHKDIITSYKSTNNENILHLAAKLAPINRL  479

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
              +VSGAALQMQREL WFKEV+ I    +    D  G+TP M FTE H+ L  EGEKWMK+
Sbjct  480   GIVSGAALQMQRELLWFKEVETIVQASYKEMRDSKGRTPGMLFTEEHKELIKEGEKWMKE  539

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             TA+SC + AALI TV+FAA  TVPGGN++  G  IF    AF +F++ +A +LF++  S+
Sbjct  540   TASSCMLVAALITTVMFAAIFTVPGGNNNDTGTAIFLKEKAFIIFSMMDALALFSSVISI  599

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             L+FLS+LTSRYAE+DFL  LP RLIIG ITLF +I  M+ AF S+ ++V G   +WI I 
Sbjct  600   LMFLSILTSRYAEEDFLCTLPKRLIIGFITLFVAIAAMLVAFCSSFFIVLGHQMTWIVIP  659

Query  1139  VPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
             V ALAS+PIT F  LQFPLL  +++S+YG GIF+
Sbjct  660   VAALASIPITLFAFLQFPLLADMITSSYGSGIFT  693



>ref|XP_009628824.1| PREDICTED: uncharacterized protein LOC104119112 [Nicotiana tomentosiformis]
Length=528

 Score =   248 bits (632),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 221/342 (65%), Gaps = 9/342 (3%)
 Frame = +2

Query  221   LWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVE  400
             ++K I  K LMH++  D+++ LC EL    +   +  +   A+L A    I E++  I +
Sbjct  190   IFKHIKDKKLMHKETLDIVERLCKELMKEYNAKNIEPVLRKAVLLAASSGIPEIIEEIED  249

Query  401   AYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKL  580
              Y    +  +  + N+ H+A+ NR E +FNLI   S+  H +    + +GN+I+++A KL
Sbjct  250   CYSDAIWFVNSENHNLFHLAVINRYEKVFNLIYQLSLYNHLVITDEDTSGNNILHMAGKL  309

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
             AP  +LNL+SGAALQMQRELQWF+EV+K   P   +  + YGKTP+M FTE H+ L  EG
Sbjct  310   APLSRLNLISGAALQMQRELQWFQEVEKFVHPTLRTNRNSYGKTPKMVFTEEHKELVKEG  369

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK+TA SCT  AAL  TV FAAAITVPGGN  + G PIFS   AFTVFA+S A  LF
Sbjct  370   EKWMKETANSCTFVAALTATVGFAAAITVPGGN-QSKGFPIFSKEPAFTVFAVSVAFCLF  428

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++  S+L+FLS+LT+RYAE DFL +LP RLIIGL TLF S+  +M AF ++IYLVFGQ  
Sbjct  429   SSVASVLMFLSILTARYAEMDFLRSLPKRLIIGLGTLFISMTSLMIAFGASIYLVFGQKN  488

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
               I I        P+  F  LQF LL+ +  STYGP IF ++
Sbjct  489   GLILI--------PVILFESLQFRLLLDICMSTYGPSIFHKQ  522



>gb|KDP43902.1| hypothetical protein JCGZ_20912 [Jatropha curcas]
Length=562

 Score =   248 bits (632),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 163/348 (47%), Positives = 221/348 (64%), Gaps = 6/348 (2%)
 Frame = +2

Query  206   VSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVV  385
             + Q      I   +LM++QA +LLK L  E++      Q   +   A  RA      E V
Sbjct  214   LKQFQFLHRIQNTVLMNKQAKELLKLLISEVRKAG-VKQADKILGPASRRAARSGNQEFV  272

Query  386   LSIVEAYPTMAYCSDHND-LNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIM  562
             + +++AYP + + S+ ND L I H+A++ R E IFNL+       H L    + + N+++
Sbjct  273   IEVIKAYPQVLWLSNKNDGLTIFHLAVQYRQERIFNLLYQMGTHKHFLTQLHDKSDNNML  332

Query  563   NLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHR  742
             +LA  L P  K   +SGAA QMQRELQWFKEV+K+  P +    +   KTP   FTE H+
Sbjct  333   HLAGDLQPSTK---ISGAAFQMQRELQWFKEVEKVVQPSYKEEKNNDEKTPREVFTEKHK  389

Query  743   LLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAIS  922
              L  +GEKWMK TATSC   AAL++TVVFAAA TVPGGNS   G+P + +  +F +FAIS
Sbjct  390   DLVKKGEKWMKGTATSCATVAALVLTVVFAAAFTVPGGNS-GQGIPNYLNQTSFMIFAIS  448

Query  923   NaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYL  1102
             +  +LF+++TSLL+FL +LTSRYAE+DFL ALP RL IGLITLFFSI  M+ AFS   +L
Sbjct  449   DVLALFSSSTSLLMFLGMLTSRYAEEDFLKALPMRLSIGLITLFFSIASMLAAFSGAFHL  508

Query  1103  VFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             V      WI + + A+A +P+T F LLQFPLLV +V ST+GP IF ++
Sbjct  509   VLFHKVQWIAVPIGAVACVPVTLFALLQFPLLVEIVYSTFGPSIFGKQ  556



>ref|XP_007024885.1| Ankyrin repeat-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY27507.1| Ankyrin repeat-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=715

 Score =   251 bits (640),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 156/340 (46%), Positives = 217/340 (64%), Gaps = 2/340 (1%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRAVHLDIAEVVLSIVE  400
             K+I KK L+H QA  L++ L  ++ +L D     +    S  L  A    + E++  +++
Sbjct  376   KAIYKKKLLHMQAIVLVELLWGQILSLEDSQITDILRSPSQVLFIAAEFGVVELITELIQ  435

Query  401   AYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKL  580
             +YP + +  D +  +I H+A+ +R E IF LI     L   +    + N + I++LA K+
Sbjct  436   SYPDLIWRVDEHSRSIFHMAVIHRQEKIFRLIHDIGALKDMIAAYKDKNNHCILHLAGKI  495

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
             AP ++LN+VSGAALQMQREL WFKEV+K   P +    D  G+TP M FTE H  L  EG
Sbjct  496   APPNRLNIVSGAALQMQRELLWFKEVEKNVQPLYKEMRDINGRTPRMLFTEEHAKLVKEG  555

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK TA+SC + A LI TV+FAA  TVPGGN +  G P+F    +F +FAIS+A +LF
Sbjct  556   EKWMKSTASSCMLVATLITTVMFAAIFTVPGGNDNEKGTPLFLEAKSFIIFAISDALALF  615

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++ TS+L+FLS+LTSRYAE+DFL  LP RLI+GL TLF SI  M+ AF +T  +V  Q  
Sbjct  616   SSVTSILMFLSILTSRYAEEDFLRLLPQRLIVGLATLFLSIAAMLVAFGATFCIVLSQRL  675

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
             +WI +    +A +P+T F  LQFPLLV ++ S+ G GIFS
Sbjct  676   AWIAVPAALIACIPVTLFAFLQFPLLVDMIQSSNGAGIFS  715



>emb|CAN70302.1| hypothetical protein VITISV_032663 [Vitis vinifera]
Length=333

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 220/335 (66%), Gaps = 13/335 (4%)
 Frame = +2

Query  251   MHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSD  430
             MH     LL  LC E+  ++   ++F     + +      I E++  I+++YP   +  +
Sbjct  1     MHXLTLQLLNHLCTEVLKVSRAKEIFR---QSFINGAKYGIPEILEEIIKSYP---FALE  54

Query  431   HNDLNILHIAIENRCENIFNLIRGTS----VLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
             + D ++  + + NR E IFNLI  T     +++    DT   N ++I++LA KLAP H+L
Sbjct  55    YLDEDLFKLVVLNRYEKIFNLICETGMHRQLIIRTRDDT---NNDNILHLAGKLAPPHRL  111

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
             +LVSGAALQMQREL WFKE++K A   FS   +E    P+M F + H  L  EGEKWMK 
Sbjct  112   SLVSGAALQMQRELHWFKEIEKYAPRAFSESENENKDKPKMAFIKEHEKLIKEGEKWMKG  171

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             TA   T+AAAL+ TVVFAAAIT+PGGN D  G+P FS   AF VFA+S+A SLF +  S+
Sbjct  172   TAKFYTLAAALLATVVFAAAITIPGGNHDDTGIPNFSKEIAFKVFAVSDALSLFLSIASV  231

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             L+ LS+LT+RYAE DFL+ALP RLI GL+TLF S+  MM A+S  IYL+FG+ K+WI I 
Sbjct  232   LICLSILTTRYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSGAIYLLFGEKKAWILIX  291

Query  1139  VPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             + ALA LP+T +  LQFPLLV L+ STYGPGIF +
Sbjct  292   LAALACLPVTLYGXLQFPLLVELIYSTYGPGIFGK  326



>ref|XP_008356256.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=654

 Score =   248 bits (633),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 167/409 (41%), Positives = 245/409 (60%), Gaps = 18/409 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD+AL+++ +H D+              A  + D       +    K S YY  S+ 
Sbjct  248   ADLYDLALDIIQKHPDM--------------AFARDDENRETALHVMARKHSAYYNGSQ-  292

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLR  355
                 Q FV  +   K    K +MH QA +L+K L  ++ TL + +++  L    S  L  
Sbjct  293   PGVLQRFVFSVPRIKVCYNKKVMHTQAIELVKQLWKKVLTLENDSKISDLIRAPSRLLFS  352

Query  356   AVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDT  535
             A  L   + ++ ++  YP + +  D  + +I H A+ +R E +FNLI     L   +   
Sbjct  353   AAELGNIDFLIILMRTYPNLIWKVDEQNRSIFHTAVVHRQEKVFNLIYELGGLKDIIASY  412

Query  536   INGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTP  715
              + + N++++LAAKLAP  +LN+ +GAALQ +RELQWFKEV+KI  P +    +  GKTP
Sbjct  413   KDEDNNNMLHLAAKLAPDDRLNIDTGAALQFRRELQWFKEVKKIVQPLYKEMRNSDGKTP  472

Query  716   EMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSH  895
             ++ FTE H+ L  EGEKWMK TA+SC + A LI TV+FA   TVPGGN++  G+PIF + 
Sbjct  473   QVLFTEEHKDLLREGEKWMKGTASSCMLVATLIATVMFAVFSTVPGGNNNDTGIPIFLNS  532

Query  896   NAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMM  1075
              AF VFAIS+A SL ++ATS+L FLS+LTSRYAE+DFL++LPNRLI+GL TLF SI+ MM
Sbjct  533   RAFMVFAISDALSLVSSATSILSFLSILTSRYAEEDFLHSLPNRLIVGLATLFISIVTMM  592

Query  1076  TAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
               F +++Y+V G     I+  +   A +P++ + LLQFPLL  ++S  Y
Sbjct  593   ITFVASLYIVLGHGYQGIKFPITLAAGVPVSFYALLQFPLLGDMISHAY  641



>gb|KCW75498.1| hypothetical protein EUGRSUZ_E04257 [Eucalyptus grandis]
Length=379

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 165/377 (44%), Positives = 233/377 (62%), Gaps = 10/377 (3%)
 Frame = +2

Query  134   ANFSFWKRSIYYCISKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND  313
             ++ S  KR   Y + K  ++ +  V  +   + + +K  MH Q   L+K LC+++ +L D
Sbjct  2     SDISQTKRVSLYLLEKLWSAAKLIVPGI---RGVHEKKTMHLQVLQLVKLLCEQISSLED  58

Query  314   YN--QVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIF  487
                  + +  S  LL A    I E+V  +V + P + +  D    NI H+A+  R E IF
Sbjct  59    SKIADLLTHPSQPLLIAAGFGIVELVTELVRSNPDLIWTVDEQSHNIFHVAVMYRREKIF  118

Query  488   NLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEV  658
             +LI        ++   +D    N +++++LA KLAP  +LN VSGAALQMQREL WFKEV
Sbjct  119   DLIHDLGAHKDMITTYKDP--DNNHNLLHLAGKLAPLDQLNSVSGAALQMQRELLWFKEV  176

Query  659   QKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaa  838
             +K          D+ G+TP M FTE HR L  EGE WMK TA+SC + A LI TV+FAA 
Sbjct  177   EKTVHTLSKQMRDKSGRTPRMLFTEEHRALVKEGEDWMKSTASSCMLVATLITTVMFAAI  236

Query  839   itvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYAL  1018
              TVPGG ++ +G+PI     AF  FAI++A +LF++ TS+L+FLS+LTSRYAE+DFL +L
Sbjct  237   FTVPGGTNNNSGVPILLESTAFITFAIADAFALFSSVTSILMFLSILTSRYAEEDFLESL  296

Query  1019  PNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLL  1198
             P RLIIGL TLF SI  M+ AFS+TI++VFG + +WI + V   + +PIT F  L FPLL
Sbjct  297   PKRLIIGLTTLFLSIASMLIAFSATIFIVFGSHLAWILVPVALASCIPITLFAFLHFPLL  356

Query  1199  VALVSSTYGPGIFSQRG  1249
               ++ S+YG GIF++  
Sbjct  357   NDMLCSSYGNGIFTREA  373



>ref|XP_002322392.1| ankyrin repeat family protein [Populus trichocarpa]
 gb|EEF06519.1| ankyrin repeat family protein [Populus trichocarpa]
Length=743

 Score =   249 bits (636),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 160/416 (38%), Positives = 245/416 (59%), Gaps = 18/416 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  +D+AL ++    ++     LN G   L  + +      + +   FW R IY      
Sbjct  338   TDLFDVALSIIQHQPELAIQRDLN-GETALHVLARKSSAFASKSGLGFWHRFIY------  390

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYN--QVFSLASDALLRA  358
                           K++  K LMH Q  +L+K   +++  L+D    ++ +  S  L  A
Sbjct  391   ---------PFPGIKAVYDKKLMHTQVLELVKLSWEQVLLLDDCQIAELLASPSQPLFVA  441

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
                 I E + +++ +YP + +  +    +I HIA+ +R E IF+LI         +    
Sbjct  442   AEFGIVEFITALIRSYPDLIWKVNEQSRSIFHIAVAHRQEKIFSLINDIGAHKDMITAYK  501

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + N  +I++LA  +AP+ KLN++SGAALQMQREL WFKEV+K   P      D+ G+TP 
Sbjct  502   DINNANILHLAGMIAPRDKLNVISGAALQMQRELLWFKEVEKNVQPSLKEMRDKNGRTPR  561

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
             M FTE HR L  EGEKWMK+TA+SC + A LI TV+FAA  TVPGGN ++ G P+  +  
Sbjct  562   MLFTEEHRGLVKEGEKWMKNTASSCMLLATLITTVMFAAIFTVPGGNDNSKGTPLVLAST  621

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
             +F VFA+++A +LF++ TS+L+FLS+LTSRYAE+DF+ +LP RL++GL TLF SI  M+ 
Sbjct  622   SFIVFAVADAFALFSSVTSILMFLSILTSRYAEEDFVESLPKRLVVGLATLFCSIAAMLV  681

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             AF++T  +V     +WI + +   +S+P+T F  LQFPL V ++ S+YG GIF+++
Sbjct  682   AFAATFCIVLDHRLAWIVVPISLGSSVPVTLFAFLQFPLFVDMIHSSYGAGIFARK  737



>ref|XP_007048308.1| Ankyrin repeat family protein isoform 3 [Theobroma cacao]
 gb|EOX92465.1| Ankyrin repeat family protein isoform 3 [Theobroma cacao]
Length=643

 Score =   246 bits (628),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 178/451 (39%), Positives = 253/451 (56%), Gaps = 38/451 (8%)
 Frame = +2

Query  8     KFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCIS--K  181
             +FYD+AL+LV Q +     A    G   L  + +      +      W+  IY CI    
Sbjct  181   EFYDIALDLV-QGYPQLAIAEDTDGDTALRILAQKPSAFPSGTQLKTWQWWIYKCIQLHP  239

Query  182   NSASTQN-----------------------FVSQLLLWK----------SIPKKILMHQQ  262
             ++AS  N                        +SQ+  WK          SI +  L H Q
Sbjct  240   HNASLNNSGDIEKPPEGPTHPKNLTKRALHLLSQIF-WKCLKLTVPGVRSIYELKLTHVQ  298

Query  263   ATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDL  442
             A +LL C+C E  T+ D N++ SL   AL  AV   + E V  I++ YP + +  D  D 
Sbjct  299   AKELLTCVCREASTIEDENRLVSLVKKALFEAVKQGLVEFVTEIMKHYPEVIWFHDDKDR  358

Query  443   NILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAAL  622
             NI  +A   R E IF+LI       + +    + + N++++ AA LAP  +L+ VSGAAL
Sbjct  359   NIFFVATAERQEKIFSLIYKMGAKKNYVATHWDKDFNNMLHQAAFLAPSSQLDRVSGAAL  418

Query  623   QMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
             QMQRELQWFKEV+    P +   ++ + KTP   FT++HR L  +GE+W K TA SCT+ 
Sbjct  419   QMQRELQWFKEVESAVQPKYKEMINNHFKTPRALFTDHHRKLVEQGEQWTKKTAESCTVV  478

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
              ALIVT++F+   TVPGG  +A G+P++   ++F +  IS+A SLFT+ TSLL+FL +LT
Sbjct  479   TALIVTIMFSVVFTVPGGYDEA-GVPLYLHRSSFLILMISDALSLFTSTTSLLMFLGILT  537

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLP  1162
             SRY E+DFL ++P +L+IGL  LFFSI  MM AF   +++V  +  +W+   +  LASLP
Sbjct  538   SRYGEEDFLQSVPTKLMIGLSMLFFSIATMMIAFGVALFIVLHERIAWVSFPIILLASLP  597

Query  1163  ITSFVLLQFPLLVALVSSTYGPGIFSQRGIP  1255
             +T F LLQFPLLV +  +TYGPGIF +   P
Sbjct  598   VTLFALLQFPLLVEIFFATYGPGIFDKPKKP  628



>ref|XP_007048306.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 ref|XP_007048307.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 gb|EOX92463.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
 gb|EOX92464.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao]
Length=648

 Score =   246 bits (628),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 155/343 (45%), Positives = 219/343 (64%), Gaps = 1/343 (0%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             +SI +  L H QA +LL C+C E  T+ D N++ SL   AL  AV   + E V  I++ Y
Sbjct  292   RSIYELKLTHVQAKELLTCVCREASTIEDENRLVSLVKKALFEAVKQGLVEFVTEIMKHY  351

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
             P + +  D  D NI  +A   R E IF+LI       + +    + + N++++ AA LAP
Sbjct  352   PEVIWFHDDKDRNIFFVATAERQEKIFSLIYKMGAKKNYVATHWDKDFNNMLHQAAFLAP  411

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +L+ VSGAALQMQRELQWFKEV+    P +   ++ + KTP   FT++HR L  +GE+
Sbjct  412   SSQLDRVSGAALQMQRELQWFKEVESAVQPKYKEMINNHFKTPRALFTDHHRKLVEQGEQ  471

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             W K TA SCT+  ALIVT++F+   TVPGG  +A G+P++   ++F +  IS+A SLFT+
Sbjct  472   WTKKTAESCTVVTALIVTIMFSVVFTVPGGYDEA-GVPLYLHRSSFLILMISDALSLFTS  530

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
              TSLL+FL +LTSRY E+DFL ++P +L+IGL  LFFSI  MM AF   +++V  +  +W
Sbjct  531   TTSLLMFLGILTSRYGEEDFLQSVPTKLMIGLSMLFFSIATMMIAFGVALFIVLHERIAW  590

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRGIP  1255
             +   +  LASLP+T F LLQFPLLV +  +TYGPGIF +   P
Sbjct  591   VSFPIILLASLPVTLFALLQFPLLVEIFFATYGPGIFDKPKKP  633



>ref|XP_009349120.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Pyrus 
x bretschneideri]
Length=722

 Score =   247 bits (631),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 161/363 (44%), Positives = 228/363 (63%), Gaps = 14/363 (4%)
 Frame = +2

Query  152   KRSIYYCISKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFS  331
             K S YY     S     FV      K    KI+M  QAT+L+K L  ++ TL + +++  
Sbjct  355   KHSAYY-----SGRQPGFVQPFPRIKVCYNKIVMQTQATELVKHLWKKVLTLENDSKISD  409

Query  332   L---ASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIR-  499
             L    S  L  A  L   + ++ ++  YP + +  D  + +I H A+ +R E +FNLI  
Sbjct  410   LIRAPSRLLFSAAELGNVDFLVILIRTYPNLIWKVDEQNRSIFHTAVVHRQEKVFNLIHE  469

Query  500   --GTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIAL  673
               G   L+ + +D +N   N++++LAAKLAP  +LN  +GAALQ +RELQWFKEV+KI  
Sbjct  470   LGGLKDLIASYKDEVN---NNMLHLAAKLAPDDRLNTDTGAALQFRRELQWFKEVEKIVQ  526

Query  674   PYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPG  853
             P +    +  GKTP++ FTE H+ L  EGEKWMK TA+SC + A LI TV+FA   TVPG
Sbjct  527   PLYKEMRNSDGKTPQVLFTEEHKDLLREGEKWMKGTASSCMVVATLIATVMFAVFSTVPG  586

Query  854   GNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLI  1033
             GN++  G+PIF +  AF VF IS+A SL ++ATS+L FLS+LTSRYAE DFL++LPNRLI
Sbjct  587   GNNNDTGIPIFLNSRAFMVFTISDALSLVSSATSILSFLSILTSRYAEGDFLHSLPNRLI  646

Query  1034  IGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVS  1213
             +GL TLF SI+ MM  F +++Y+V G     I++ +   A +P++ + LLQFPLL  ++S
Sbjct  647   VGLATLFISIVTMMITFVASLYIVLGHGYQGIKVPIALAAGVPVSFYALLQFPLLGDMIS  706

Query  1214  STY  1222
               Y
Sbjct  707   HAY  709



>emb|CBI35215.3| unnamed protein product [Vitis vinifera]
Length=655

 Score =   246 bits (628),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 183/450 (41%), Positives = 268/450 (60%), Gaps = 40/450 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMG-VPPLDAIVKYDCPIINTANFSFWKRSIYYCI--  175
             S+  D+AL+++ +H  +    +L+M  + P+  + +      + +   FW+R IY CI  
Sbjct  205   SQILDVALDILKKHPRLA--ISLDMERIIPIFVLGQMPSLFKSGSQLWFWQRWIYSCIPV  262

Query  176   ----------------SKNSASTQN--------------FVSQLLLWKSIPKKILMHQQA  265
                             +++S   +N              ++ QLL  K+I  K L H QA
Sbjct  263   KVDHASDQIQVNVADDTQHSRDVKNNTAKVLRHLYGPVSYLLQLLGIKNIYAKKLRHAQA  322

Query  266   TDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLN  445
             T+LL+C+C+E++ +N    +       +++AV     +    +++  P +   +D ND N
Sbjct  323   TELLQCICNEIQKVNVEGTLGLRLHHTVIQAVKQGNVDFATEMIKYTPQLVQKTDINDRN  382

Query  446   ILHIAIENRCENIFNLIRG-TSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAAL  622
             I  IAI NR E IF+L+ G  +V    +   ++  GN++++LAA LAP ++L+ +SGAAL
Sbjct  383   IFFIAILNRQEKIFSLLHGLNNVKKMKMTSNVDRFGNNMLHLAAMLAPANQLDGISGAAL  442

Query  623   QMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
             QMQRELQWFKEV+ I  P     ++  GK P   FTE H  L  EGEKWMKD A S +  
Sbjct  443   QMQRELQWFKEVESIVPPICKDLVNADGKRPSELFTEQHANLVKEGEKWMKDIAASSSFV  502

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
             AALIVT++FAAA T+PGGN D  G PIF  ++ F VF IS++ SLF+A TS+L+FL +LT
Sbjct  503   AALIVTIMFAAAFTIPGGNDD-TGAPIFLGNDLFMVFIISDSISLFSATTSVLMFLGILT  561

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA--LAS  1156
             S+YAE  FL  LP +LIIGL TLFFSI  MM AF + + ++  + +S   +I+P   LA 
Sbjct  562   SQYAENKFLTRLPTKLIIGLSTLFFSIATMMIAFCAALAILL-KGRSTKVVIIPIILLAC  620

Query  1157  LPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +P+T FVLLQFPLLV +  STYGPGIF+++
Sbjct  621   VPVTLFVLLQFPLLVEIFISTYGPGIFNRK  650



>ref|XP_010244728.1| PREDICTED: uncharacterized protein LOC104588485 [Nelumbo nucifera]
Length=669

 Score =   246 bits (627),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 171/449 (38%), Positives = 252/449 (56%), Gaps = 31/449 (7%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCIS--  178
             S FYD AL+LV ++  +        G   L A+ +      + + + F +R IY  IS  
Sbjct  222   SGFYDTALDLVQRYPQLATARDDKSGYTALLALSQRPSAFPSKSRYGFLERLIYSLISVE  281

Query  179   -------------KNSASTQNF--------------VSQLLLWKSIPKKILMHQQATDLL  277
                          +N   + N               ++++ + K +    L   Q+  L+
Sbjct  282   KSGSPRPTINGDVENPPESGNLTQVPDRPCSLLNAQINKVPMVKQVRDMKLTQIQSVKLV  341

Query  278   KCLCDELKTLNDYNQVFSLASDALLR-AVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILH  454
               +C++L ++     +    + A+L  A      EVV+   E +P + + +     +I H
Sbjct  342   NRICEQLSSMETDEMLECFLNPAVLNIAAEHGNTEVVIQCCEYFPDLLWLT-MKGRSIFH  400

Query  455   IAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQR  634
             +A+E+R E IF+L+ G S     L      + N ++++ AKLAP  +LN+ SGAALQMQR
Sbjct  401   VAVEHRQEKIFSLVYGMSARRRLLTSLRVDDSNTMLHMVAKLAPSPQLNVASGAALQMQR  460

Query  635   ELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaali  814
             ELQWFK V+KI  P F +  +  GKTP   FTE+H+ L ++GEKWMK+TAT C I A +I
Sbjct  461   ELQWFKGVEKIVDPSFQNLKNSEGKTPRALFTEHHKELAVKGEKWMKETATPCMIVATII  520

Query  815   vtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYA  994
              +VVF AA TVPGG +  +G+PIF   N F  F +S+A +LF + TS+++FLS+LTS Y 
Sbjct  521   ASVVFGAAFTVPGGINGDSGIPIFLQSNYFMAFVVSDAMALFFSTTSIVMFLSILTSSYN  580

Query  995   EQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSF  1174
             E+DFL ALP  LIIGL  LF S+  M+TAFS+ +Y+V G    W+   +  LA LP++SF
Sbjct  581   EEDFLIALPRTLIIGLGALFISVAAMVTAFSAGLYIVLGHRVKWVIFPITLLACLPLSSF  640

Query  1175  VLLQFPLLVALVSSTYGPGIFSQRGIPQM  1261
              LLQFPL V ++ STYG  IF Q G P++
Sbjct  641   ALLQFPLFVKIIHSTYGSPIFEQNGEPKV  669



>gb|KDP43903.1| hypothetical protein JCGZ_20913 [Jatropha curcas]
Length=587

 Score =   244 bits (622),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 160/348 (46%), Positives = 223/348 (64%), Gaps = 6/348 (2%)
 Frame = +2

Query  206   VSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVV  385
             + Q      I   +LM++QA +LLK L  E++     +Q  ++   A  RA      E V
Sbjct  239   LKQFQFLPRIQNTVLMNKQAKELLKLLISEVRKAG-VDQADNVLGPASWRAARSGNQEFV  297

Query  386   LSIVEAYPTMAYCSDHND-LNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIM  562
             + +++AYP + +  + ND L I H+A++ R E IFNL+       H L    + +GN+++
Sbjct  298   IEVIKAYPQVLWLFNKNDGLTIFHLAVQYRQERIFNLLYQMGTHKHFLTAMQDKSGNNML  357

Query  563   NLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHR  742
             +LA +L P  +   +SGAA QMQRELQWFKEV+ +  P +    ++  KTP   FTE H+
Sbjct  358   HLAGELQPSTR---ISGAAFQMQRELQWFKEVENVVQPSYKEEKNKEDKTPREVFTEKHK  414

Query  743   LLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAIS  922
              L  +GEKWMK TATSC   AAL++TVVFAAA TVPGGNS   G+P + +  +F +FAIS
Sbjct  415   DLVKKGEKWMKGTATSCATVAALVLTVVFAAAFTVPGGNS-GQGIPNYLNQTSFMIFAIS  473

Query  923   NaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYL  1102
             +  +LF+++TSLL+FL +LTSRYAE+DFL ALP R  IGLITLFFSI  M+ AFS   +L
Sbjct  474   DVLALFSSSTSLLMFLGMLTSRYAEEDFLKALPMRFSIGLITLFFSIASMLAAFSGAFHL  533

Query  1103  VFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             V      WI + V A+A +P++ F LLQFPLLV +V ST+GP IF ++
Sbjct  534   VLFYKIQWIAVPVGAVACVPVSLFALLQFPLLVEIVYSTFGPSIFGKQ  581



>ref|XP_007048311.1| Ankyrin repeat family protein [Theobroma cacao]
 gb|EOX92468.1| Ankyrin repeat family protein [Theobroma cacao]
Length=639

 Score =   244 bits (624),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 176/451 (39%), Positives = 254/451 (56%), Gaps = 38/451 (8%)
 Frame = +2

Query  8     KFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCIS--K  181
             +FYD+AL+LV Q +     A    G   L  + +      +      W+  IY CI    
Sbjct  181   EFYDIALDLV-QRYSQLAIAEDTDGDTALRILAQKPSAFSSGTQLETWQWWIYKCIHIHP  239

Query  182   NSASTQN-----------------------FVSQLLLWK----------SIPKKILMHQQ  262
             ++AS  N                        +SQ+  WK          SI +  L H Q
Sbjct  240   HNASLNNSGDIEKPREGPTHPKNLTKRALHLLSQIF-WKCLTLSVPGVTSIYELKLKHVQ  298

Query  263   ATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDL  442
             A +LL C+C E+ T+ D N+V SL    L  AV   + E V  +++ YP + +  D  + 
Sbjct  299   AKELLTCVCREVSTIEDENRVQSLVKKPLFDAVKNGLVEFVTDLMKHYPEVLWFYDDKER  358

Query  443   NILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAAL  622
             NI  +A   R E IF+LI       + +    + + N++++ AA LAP  +L+ VSGAAL
Sbjct  359   NIFFVAAAERQEKIFSLIYKMGAKKNYMATHWDKDSNNMLHQAAFLAPSSQLDRVSGAAL  418

Query  623   QMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
             QMQRELQWFKEV+ +  P +   ++ + KTP   FT+ H+ L  +GE+W K+TA SCT+ 
Sbjct  419   QMQRELQWFKEVESVVQPKYREMVNNHFKTPRALFTDQHKKLVEQGEQWTKETAESCTVV  478

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
              ALIVT++F+A  T PGG  +A G+P++   ++F +F IS+A SLFT+ TSLL+FL +LT
Sbjct  479   TALIVTIMFSAVFTAPGGYDEA-GVPLYLHRSSFLIFIISDALSLFTSTTSLLMFLGILT  537

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLP  1162
             SRY E+DFL  +P +L+IGL  LFFS+  MM AF   +++V  +  +W+   +  LASLP
Sbjct  538   SRYREEDFLKDVPTKLMIGLSMLFFSLATMMIAFGVALFIVLHERIAWVSFPIILLASLP  597

Query  1163  ITSFVLLQFPLLVALVSSTYGPGIFSQRGIP  1255
             +T F LLQFPLLV +  STYGPGIF +   P
Sbjct  598   VTLFALLQFPLLVEIFFSTYGPGIFDKPKKP  628



>ref|XP_006464617.1| PREDICTED: uncharacterized protein LOC102609031 [Citrus sinensis]
Length=653

 Score =   244 bits (624),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 170/445 (38%), Positives = 251/445 (56%), Gaps = 36/445 (8%)
 Frame = +2

Query  14    YDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKNSAS  193
             +D+ L+L+ ++  + + A  N G   +D + +      +    +FWK+ IY  I  +SA 
Sbjct  200   FDIPLDLLQRYRKLAY-AQDNDGDTAIDMLAQKPSAFPSGTQLAFWKKWIYSSIYIHSAY  258

Query  194   TQNFVSQ-------------------------LLLWKS----------IPKKILMHQQAT  268
               N +S                           ++WKS          I +  L H Q  
Sbjct  259   ASNNISHGDIERPHLGPAEHKNFFTPAMTKLLHMVWKSLNLFVPAIKHIYEVKLAHVQTQ  318

Query  269   DLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNI  448
             +LL C+C E+ T  +           +  AV   I E +  I++ YP + +C D  + +I
Sbjct  319   ELLSCVCREISTQGESQFEKVGIKKVVFIAVKHGIVEFITEIMKHYPDIIWCYDDYNRHI  378

Query  449   LHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQM  628
                A   R E IFNLI       +++    +   N+I++ AA LAP  +L+ VSGAALQM
Sbjct  379   FSYATLQRQEKIFNLIYTMGAKKNSVATNWDKAHNNILHQAAFLAPSSQLDRVSGAALQM  438

Query  629   QRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaa  808
             QRELQWFKEV+ I  P +   ++ + KTP   F++ H+ L  +GEKWMK+TA SCT+ AA
Sbjct  439   QRELQWFKEVESIVQPKYKEMVNLHYKTPRALFSDQHKKLVEQGEKWMKETAESCTVVAA  498

Query  809   livtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsR  988
             LI T++F+AA TVPGG  +  G+P++   N+F VF +++A SLF++ TS+L+FL +LTSR
Sbjct  499   LIATIMFSAAFTVPGGYDEYTGIPLYLHRNSFMVFIVADAMSLFSSCTSVLMFLGILTSR  558

Query  989   YAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPIT  1168
             Y E+DFL +LP +LIIGL +LFFSI  MM  F  T+ ++     +W+   +  LASLP+T
Sbjct  559   YGEEDFLKSLPRKLIIGLSSLFFSIATMMVTFGVTLVIILKARIAWVSFPIILLASLPVT  618

Query  1169  SFVLLQFPLLVALVSSTYGPGIFSQ  1243
              F LLQFPLLV +  STYGPGIF++
Sbjct  619   LFALLQFPLLVEIFYSTYGPGIFNK  643



>ref|XP_011032352.1| PREDICTED: uncharacterized protein LOC105131196 isoform X2 [Populus 
euphratica]
Length=640

 Score =   244 bits (622),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 179/448 (40%), Positives = 255/448 (57%), Gaps = 39/448 (9%)
 Frame = +2

Query  8     KFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI----  175
             + YD+AL+L+ Q   +      +     LD + +      +    ++W++ IY  I    
Sbjct  186   ELYDIALDLLQQFPQLAFDQDSDKDTA-LDMLAQKPSAFPSGTQLAWWQQWIYNGIRVPH  244

Query  176   --------------SKNSASTQNFVS----QLLL--WKSIP------KKI----LMHQQA  265
                           +K     +N V     QLL+  WK +       KK+    L+H QA
Sbjct  245   SLASSHSHGDIERPNKGPTDRRNIVKRASDQLLVMAWKGLKIFVPAIKKMYNLKLIHGQA  304

Query  266   TDLLKCLCDELKTL--NDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHND  439
               +L CLC+++ TL  +D+ ++      A+  AV   I E ++ IV  YP M +C D  +
Sbjct  305   LAVLCCLCEQISTLHRSDFKEIG--VHKAVFNAVKHGIVEFIVEIVRHYPDMIWCEDDLN  362

Query  440   LNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAA  619
               I   A   R E IF+LI       +++  + +   N+I++ AA LAP  +L+ VSGAA
Sbjct  363   RGIFLYATLQRQEKIFSLIYKMGAKKNSMATSWDKYHNNILHQAAFLAPSSQLDRVSGAA  422

Query  620   LQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCti  799
             LQMQRELQW+KEV+ I  P +   ++   KTP+  FTE HR L  EGEKWMKDT+ SCT+
Sbjct  423   LQMQRELQWYKEVESIVQPKYREMINSNRKTPQALFTEQHRKLMEEGEKWMKDTSESCTV  482

Query  800   aaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvl  979
              AALI T++FAA  TVPGG    +G+PI+   N+F VF +S+A SLF +A+SLL+FL +L
Sbjct  483   VAALISTIMFAAIFTVPGGYDQYSGIPIYLHRNSFMVFMVSDAMSLFASASSLLMFLGIL  542

Query  980   tsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASL  1159
             TSRY E+DFL +LP ++I+GL  LFFSI  MM  F  T++++      WI   +  LASL
Sbjct  543   TSRYREEDFLNSLPTKMIVGLSCLFFSIATMMITFGITLFVMLRDRFPWISFPIILLASL  602

Query  1160  PITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             P+T F LLQFPLLV +  STYG GIF +
Sbjct  603   PVTLFALLQFPLLVEIFFSTYGLGIFDK  630



>ref|XP_010648914.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648918.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648922.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648925.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
 ref|XP_010648930.1| PREDICTED: uncharacterized protein LOC100260982 [Vitis vinifera]
Length=768

 Score =   246 bits (629),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 154/340 (45%), Positives = 222/340 (65%), Gaps = 3/340 (1%)
 Frame = +2

Query  224   WKSIPKKILMHQQATDLLKCLCDELKTLN---DYNQVFSLASDALLRAVHLDIAEVVLSI  394
             +KS+  K LMH QA +L++ L D++ +L+      ++    S  L  A  L I E +  +
Sbjct  420   FKSVYDKKLMHIQALELVQQLWDKILSLDHDPKIGELIRTPSRLLFTAAELGIVEFITVL  479

Query  395   VEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAA  574
             + +YP + +  +     I H+A+ +R E IFNLI         +    +   N++++LA 
Sbjct  480   IRSYPDLIWKVNDQSQTIFHVAVAHRQEKIFNLIYEIGAHKDYIAAYKDEKNNNMLHLAG  539

Query  575   KLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKI  754
             KLAP ++L + SGAA Q+QREL WFKEV+KI  P ++   +E G+TP++ FTE H+ L  
Sbjct  540   KLAPSNRLKIDSGAAFQLQRELHWFKEVEKIIQPSYTEMKNEQGRTPQILFTEEHKDLVR  599

Query  755   EGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaas  934
             EGEKWMKDTA+SC + A LI TV+FAAA +VPGGN D  G PIF +  +F VFAIS+A +
Sbjct  600   EGEKWMKDTASSCMVVATLIATVMFAAAFSVPGGNDDDTGRPIFLTKKSFLVFAISDALA  659

Query  935   lftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQ  1114
             LF++ATS+L+FLS+LTSRYAE+DFL +LPNRLIIGL TLF S+  MM AF +T+++V G 
Sbjct  660   LFSSATSILIFLSILTSRYAEEDFLESLPNRLIIGLATLFISVATMMIAFCATLFIVLGP  719

Query  1115  NKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGI  1234
                W+   +  +A +P+T F LL+FPL + ++S  Y   I
Sbjct  720   ELVWVANPMALVACVPVTLFPLLKFPLFIDMISHRYRSSI  759



>ref|XP_006427804.1| hypothetical protein CICLE_v10025204mg [Citrus clementina]
 gb|ESR41044.1| hypothetical protein CICLE_v10025204mg [Citrus clementina]
Length=603

 Score =   243 bits (620),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 163/410 (40%), Positives = 240/410 (59%), Gaps = 16/410 (4%)
 Frame = +2

Query  14    YDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKNSAS  193
             +D+ L+L+ ++  + + A  N G   +D + +      +    +FWK+ IY         
Sbjct  200   FDIPLDLLQRYRKLAY-AQDNDGDTAIDMLAQKPSAFPSGTQLAFWKKWIY---------  249

Query  194   TQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDI  373
                        K I +  L H Q  +LL C+C E+ T  +           +  AV   I
Sbjct  250   ------SFPAIKHIYEVKLAHVQTQELLSCVCREISTQGESQFEKVGIKKVVFIAVKHGI  303

Query  374   AEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGN  553
              E +  I++ YP + +C D  + +I   A   R E IFNLI       +++    +   N
Sbjct  304   VEFITEIMKHYPDIIWCYDDYNRHIFSYATLQRQEKIFNLIYTMGAKKNSVATNWDKAHN  363

Query  554   DIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTE  733
             +I++ AA LAP  +L+ VSGAALQMQRELQWFKEV+ I  P +   ++ + KTP   F++
Sbjct  364   NILHQAAFLAPSSQLDRVSGAALQMQRELQWFKEVESIVQPKYKEMVNLHYKTPRALFSD  423

Query  734   NHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVF  913
              H+ L  +GEKWMK+TA SCT+ AALI T++F+AA TVPGG  +  G+P++   N+F VF
Sbjct  424   QHKKLVEQGEKWMKETAESCTVVAALIATIMFSAAFTVPGGYDEYTGIPLYLHRNSFMVF  483

Query  914   AISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSST  1093
              +++A SLF++ TS+L+FL +LTSRY E+DFL +LP +LIIGL +LFFSI  MM  F  T
Sbjct  484   IVADAMSLFSSCTSVLMFLGILTSRYGEEDFLKSLPRKLIIGLSSLFFSIATMMVTFGVT  543

Query  1094  IYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             + ++     +W+   +  LASLP+T F LLQFPLLV +  STYGPGIF++
Sbjct  544   LVIILKARIAWVSFPIILLASLPVTLFALLQFPLLVEIFYSTYGPGIFNK  593



>ref|XP_008219093.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
 ref|XP_008219094.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=635

 Score =   243 bits (621),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 163/409 (40%), Positives = 240/409 (59%), Gaps = 18/409 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD+AL+++ ++  +      N G  PL  + +      + +   FW+R     +   
Sbjct  228   ADLYDVALDIIQKNPQIAFARDEN-GETPLHVMARKPSACYSGSQLGFWQRCKGSLLPHT  286

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLR  355
              A                 K LMH QAT L+K L +++ TLN  + +  L    S  L  
Sbjct  287   KAPY--------------GKKLMHMQATQLVKQLWEKILTLNSDSAISDLIRTPSSLLFT  332

Query  356   AVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDT  535
             A  L   + ++ ++ +YP + +  D  + +I H A+ +R E +FNLI     L   +   
Sbjct  333   AAELGNIDFLIILLRSYPGLIWHVDEQNRSIFHTAVIHRQEKVFNLIYELGGLKELIASD  392

Query  536   INGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTP  715
              + + N++++LAAKLAP  +LN  +GAAL+++REL WFKEV+KI  P +    +  GKTP
Sbjct  393   KDNDNNNMLHLAAKLAPAIRLNDDTGAALKLRRELLWFKEVEKIVQPLYKEMRNSIGKTP  452

Query  716   EMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSH  895
             ++ FTE H+ L  EGE WMK TA+SC + A LI TV+FAA  TVPGGN++  G+PIF   
Sbjct  453   QILFTEEHKELLREGEVWMKGTASSCMVVATLIATVMFAAFSTVPGGNNNDTGIPIFLQS  512

Query  896   NAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMM  1075
              AF VFAIS+A SL ++A S+L FLS+LTSRYAE DFL++LPNRLI+GL TLF SI  MM
Sbjct  513   RAFIVFAISDAVSLISSAASILSFLSILTSRYAEGDFLHSLPNRLIVGLATLFISITAMM  572

Query  1076  TAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
               F +T+++V G     I++ +  +A +P+  + LLQFPLL  +VS  Y
Sbjct  573   ITFVATVFIVLGSEFHGIKVPIALVAGVPVGFYALLQFPLLADMVSHAY  621



>ref|XP_011000169.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Populus 
euphratica]
Length=785

 Score =   246 bits (627),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 164/443 (37%), Positives = 254/443 (57%), Gaps = 30/443 (7%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIY------  166
             +  +D+AL ++    ++      N G   L  + +      + +   FW R IY      
Sbjct  338   TDLFDVALSIIQHQPELAIQRDQN-GETALHVLARKSSAFASKSGLGFWHRFIYPWIFVE  396

Query  167   -----YCIS--------KNSASTQNFVSQLLLW--------KSIPKKILMHQQATDLLKC  283
                   C S        +++  + + V QL           K++  K LMH Q  +L+K 
Sbjct  397   VPTKCSCPSSIFQIHRHRSNQESLSLVGQLFRAIQMNVPGIKAVYDKKLMHTQVLELVKL  456

Query  284   LCDELKTLNDYN--QVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHI  457
               +++  L+D    ++ +  S  L  A    I E + +++ +YP + +  +    +I HI
Sbjct  457   SWEQVLLLDDCQIAELLASPSQPLFVAAEFGIVEFITALIRSYPDLIWKVNEQSRSIFHI  516

Query  458   AIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRE  637
             A+ +R E IF+LI         +    + N  +I++LA  +AP+ KLN++SGAALQMQRE
Sbjct  517   AVAHRQEKIFSLINDIGAHKDMITAYKDINNANILHLAGMIAPRDKLNVISGAALQMQRE  576

Query  638   LQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaaliv  817
             L WFKEV+K   P      D+ G+TP M FTE HR L  EGEKWMK+TA+SC + A LI 
Sbjct  577   LLWFKEVEKNVQPSLKEMRDKNGRTPRMLFTEEHRGLVKEGEKWMKNTASSCMLLATLIT  636

Query  818   tvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAE  997
             TV+FAA  TVPGGN ++ G P+  +  +F VFA+++A +LF++ TS+L+FLS+LTSRYAE
Sbjct  637   TVMFAAIFTVPGGNDNSKGTPLVLASTSFIVFAVADAFALFSSVTSILMFLSILTSRYAE  696

Query  998   QDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFV  1177
             +DF+ +LP RL++GL TLF SI  M+ AF++T  +V     +WI + +   +S+P+T F 
Sbjct  697   EDFVESLPKRLVVGLATLFCSIAAMLVAFAATFCIVLDHRLAWIGVPISLGSSVPVTLFA  756

Query  1178  LLQFPLLVALVSSTYGPGIFSQR  1246
              LQFPL V ++ S+YG GIF+++
Sbjct  757   FLQFPLFVDMIHSSYGAGIFARK  779



>ref|XP_011032351.1| PREDICTED: uncharacterized protein LOC105131196 isoform X1 [Populus 
euphratica]
Length=683

 Score =   244 bits (622),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 179/448 (40%), Positives = 255/448 (57%), Gaps = 39/448 (9%)
 Frame = +2

Query  8     KFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI----  175
             + YD+AL+L+ Q   +      +     LD + +      +    ++W++ IY  I    
Sbjct  186   ELYDIALDLLQQFPQLAFDQDSDKDTA-LDMLAQKPSAFPSGTQLAWWQQWIYNGIRVPH  244

Query  176   --------------SKNSASTQNFVS----QLLL--WKSIP------KKI----LMHQQA  265
                           +K     +N V     QLL+  WK +       KK+    L+H QA
Sbjct  245   SLASSHSHGDIERPNKGPTDRRNIVKRASDQLLVMAWKGLKIFVPAIKKMYNLKLIHGQA  304

Query  266   TDLLKCLCDELKTL--NDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHND  439
               +L CLC+++ TL  +D+ ++      A+  AV   I E ++ IV  YP M +C D  +
Sbjct  305   LAVLCCLCEQISTLHRSDFKEIG--VHKAVFNAVKHGIVEFIVEIVRHYPDMIWCEDDLN  362

Query  440   LNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAA  619
               I   A   R E IF+LI       +++  + +   N+I++ AA LAP  +L+ VSGAA
Sbjct  363   RGIFLYATLQRQEKIFSLIYKMGAKKNSMATSWDKYHNNILHQAAFLAPSSQLDRVSGAA  422

Query  620   LQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCti  799
             LQMQRELQW+KEV+ I  P +   ++   KTP+  FTE HR L  EGEKWMKDT+ SCT+
Sbjct  423   LQMQRELQWYKEVESIVQPKYREMINSNRKTPQALFTEQHRKLMEEGEKWMKDTSESCTV  482

Query  800   aaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvl  979
              AALI T++FAA  TVPGG    +G+PI+   N+F VF +S+A SLF +A+SLL+FL +L
Sbjct  483   VAALISTIMFAAIFTVPGGYDQYSGIPIYLHRNSFMVFMVSDAMSLFASASSLLMFLGIL  542

Query  980   tsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASL  1159
             TSRY E+DFL +LP ++I+GL  LFFSI  MM  F  T++++      WI   +  LASL
Sbjct  543   TSRYREEDFLNSLPTKMIVGLSCLFFSIATMMITFGITLFVMLRDRFPWISFPIILLASL  602

Query  1160  PITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             P+T F LLQFPLLV +  STYG GIF +
Sbjct  603   PVTLFALLQFPLLVEIFFSTYGLGIFDK  630



>ref|XP_009790150.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Nicotiana sylvestris]
Length=725

 Score =   244 bits (623),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 180/471 (38%), Positives = 258/471 (55%), Gaps = 64/471 (14%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCIS--  178
             S  +D+AL ++    ++      N G   L  + +      +      W+R +Y  +S  
Sbjct  252   SNLFDVALHILQHMPELGIERDQN-GDTILHVLARKPLAFSDKIGLGIWQRFLYAYVSVH  310

Query  179   --------------KNSASTQNFVSQL-------LLWKSIPKKILMHQQATDLLKCLCDE  295
                           KN+     F++++       L  K + +  LMH QA +L+KC   E
Sbjct  311   LQNRSSNMSSGSRIKNNTKASAFITRVVQHLLKTLGIKEVLETKLMHLQALELVKCSWKE  370

Query  296   LKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIE  466
             +  LND +Q+ +L    S  L  A  L   + ++ ++++YP + +  D    +I HIA+ 
Sbjct  371   VLLLND-SQIGNLLRSPSRPLFVAAELGNFKFIVELIQSYPDLIWKVDEESRSIFHIAVI  429

Query  467   NRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRE  637
             +R E I+ LI        ++ + +  IN N   I++LAAKLAP ++L +VSGAALQMQRE
Sbjct  430   HRQEKIYKLIYNIGAHKDIITSYKSRINEN---ILHLAAKLAPTNRLGIVSGAALQMQRE  486

Query  638   LQWF------------------------------KEVQKIALPYFSSCMDEYGKTPEMHF  727
             L WF                              KEV+ I    +    D  G+TP M F
Sbjct  487   LLWFKVISTSGEMLLPYYVYSLSIFHKILLLIIPKEVKTIVQASYKEMRDSKGRTPGMLF  546

Query  728   TENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFT  907
              E H+ L  EGEKWMK+TA+SC + AALI TV+FAA  TVPGGN+D  G PIF     F 
Sbjct  547   AEEHKELVKEGEKWMKETASSCMLVAALITTVMFAAIFTVPGGNNDDTGTPIFLKEKTFI  606

Query  908   VFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFS  1087
             +F+I++A +LF++ TS+L+FLS+LTSRYAE+DFL  LP RLI+G ITLF +I  M+ AFS
Sbjct  607   LFSITDALALFSSVTSILMFLSILTSRYAEEDFLSTLPKRLILGFITLFVAIAAMLVAFS  666

Query  1088  STIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
             S+ ++V G   +WI I V  LAS+PIT F  LQFPLL  ++ STYG GIF+
Sbjct  667   SSFFIVLGHQMAWIIIPVAVLASIPITLFAFLQFPLLADMIRSTYGSGIFT  717



>ref|XP_010655714.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Vitis vinifera]
Length=745

 Score =   244 bits (623),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 159/411 (39%), Positives = 231/411 (56%), Gaps = 29/411 (7%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             S  +D+AL++V +H  +      N G   L  + +      + +   F +R IY C+   
Sbjct  355   SDLFDVALKIVQKHPKIATARGRN-GETALHILARKPSAYQSGSQLGFLQRCIYACLHVE  413

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVH  364
              +   + + ++   K                              ++    S  L  A  
Sbjct  414   LSGNSSVIHKVPFIK----------------------------VGELIRTPSRLLFTAAE  445

Query  365   LDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTING  544
             L I E ++ ++ AYP + +  D    +I HIA+ +R E +FNLI     L   +    + 
Sbjct  446   LGIVEFLIELIHAYPDLIWKVDTQSRSIFHIAVVHRQEKVFNLIHEIGALKDLIASYRDE  505

Query  545   NGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMH  724
             N N++++LA KLAP  +L   SGAALQ++REL WFKEV+KI  P +    +  GKTP+  
Sbjct  506   NNNNMLHLAGKLAPSDRLKTDSGAALQLRRELHWFKEVEKIVQPLYREIRNSEGKTPQTL  565

Query  725   FTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAF  904
             F E H++L  EGEKWMKDTA SC + A LI TV+FAA  TVPGG++   G+PIF    +F
Sbjct  566   FMEEHKVLVREGEKWMKDTAASCMLVATLIATVMFAAFFTVPGGDNGNTGIPIFLKRRSF  625

Query  905   TVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAF  1084
             TVFA+S+A S  ++A S+L+FLS+LTSRYAE+DFL++LPNRL IGL TLF S+  MM AF
Sbjct  626   TVFAVSDALSFVSSAASILMFLSILTSRYAEEDFLHSLPNRLTIGLGTLFISVATMMIAF  685

Query  1085  SSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
              +T++LV G      +I +  +A +P++ F LLQFPL   +VS TYG  +F
Sbjct  686   CATLFLVLGHGLHQAKIPIALVACIPVSLFALLQFPLFADMVSCTYGSRMF  736



>emb|CDP11257.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   243 bits (620),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 163/381 (43%), Positives = 230/381 (60%), Gaps = 14/381 (4%)
 Frame = +2

Query  146   FWKRSIYY---CISKNSASTQ-NFVSQLLLWKSIPK--------KILMHQQATDLLKCLC  289
              WK+S Y     + +N   T+ + +   LL ++  K        + L H QA +LLKC+ 
Sbjct  305   LWKKSSYKFSKTVDQNDKCTRAHLLFDRLLHRATEKIGIQEVFERKLKHFQALELLKCIW  364

Query  290   DELKTLND--YNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAI  463
              ++  L+D    ++    S  L  A      E ++ ++ +YP + +  D    +  HIA+
Sbjct  365   KQVMLLDDSQIGKLLRGPSRPLFVAAECGNFEFIVELLRSYPDLIWKVDEQSQSFFHIAV  424

Query  464   ENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQ  643
              +R E IF LI     L   +    + N ++I++LAAKLA  ++LN+VSGAALQMQREL 
Sbjct  425   IHRQERIFKLIYQIGALKDLITSYKSTNNSNILHLAAKLAAPNRLNIVSGAALQMQRELL  484

Query  644   WFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtv  823
             WFKEV+K   P +    D  G+ P M FT+ H+ L   GE+WMKDTA+SC + A LI TV
Sbjct  485   WFKEVEKNVQPLYKEMRDSEGRMPHMLFTQEHKALLKSGERWMKDTASSCMLVATLITTV  544

Query  824   vfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQD  1003
             +FAA  TVPGGN++  G PIF    AF +F+IS+A +LF++ TS+L+FLS+LTSRYAE D
Sbjct  545   MFAAIFTVPGGNNNDTGTPIFLKDKAFIIFSISDALALFSSVTSILMFLSILTSRYAEVD  604

Query  1004  FLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLL  1183
             F+  LP RLIIGL+TLFFSI  M+ AFS++  +V G   +WI I V   A +P+  F   
Sbjct  605   FMETLPKRLIIGLMTLFFSIASMLIAFSASFSIVHGHKIAWIIIPVALAACIPVLLFAFS  664

Query  1184  QFPLLVALVSSTYGPGIFSQR  1246
             QFPL+  +  STYG GIF+Q 
Sbjct  665   QFPLVADMFHSTYGSGIFAQE  685



>ref|XP_010658755.1| PREDICTED: uncharacterized protein LOC100245348 isoform X2 [Vitis 
vinifera]
Length=810

 Score =   244 bits (624),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 183/450 (41%), Positives = 268/450 (60%), Gaps = 40/450 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMG-VPPLDAIVKYDCPIINTANFSFWKRSIYYCI--  175
             S+  D+AL+++ +H  +    +L+M  + P+  + +      + +   FW+R IY CI  
Sbjct  360   SQILDVALDILKKHPRLA--ISLDMERIIPIFVLGQMPSLFKSGSQLWFWQRWIYSCIPV  417

Query  176   ----------------SKNSASTQN--------------FVSQLLLWKSIPKKILMHQQA  265
                             +++S   +N              ++ QLL  K+I  K L H QA
Sbjct  418   KVDHASDQIQVNVADDTQHSRDVKNNTAKVLRHLYGPVSYLLQLLGIKNIYAKKLRHAQA  477

Query  266   TDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLN  445
             T+LL+C+C+E++ +N    +       +++AV     +    +++  P +   +D ND N
Sbjct  478   TELLQCICNEIQKVNVEGTLGLRLHHTVIQAVKQGNVDFATEMIKYTPQLVQKTDINDRN  537

Query  446   ILHIAIENRCENIFNLIRG-TSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAAL  622
             I  IAI NR E IF+L+ G  +V    +   ++  GN++++LAA LAP ++L+ +SGAAL
Sbjct  538   IFFIAILNRQEKIFSLLHGLNNVKKMKMTSNVDRFGNNMLHLAAMLAPANQLDGISGAAL  597

Query  623   QMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
             QMQRELQWFKEV+ I  P     ++  GK P   FTE H  L  EGEKWMKD A S +  
Sbjct  598   QMQRELQWFKEVESIVPPICKDLVNADGKRPSELFTEQHANLVKEGEKWMKDIAASSSFV  657

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
             AALIVT++FAAA T+PGGN D  G PIF  ++ F VF IS++ SLF+A TS+L+FL +LT
Sbjct  658   AALIVTIMFAAAFTIPGGNDD-TGAPIFLGNDLFMVFIISDSISLFSATTSVLMFLGILT  716

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA--LAS  1156
             S+YAE  FL  LP +LIIGL TLFFSI  MM AF + + ++  + +S   +I+P   LA 
Sbjct  717   SQYAENKFLTRLPTKLIIGLSTLFFSIATMMIAFCAALAILL-KGRSTKVVIIPIILLAC  775

Query  1157  LPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +P+T FVLLQFPLLV +  STYGPGIF+++
Sbjct  776   VPVTLFVLLQFPLLVEIFISTYGPGIFNRK  805



>ref|XP_002311025.2| hypothetical protein POPTR_0008s02380g [Populus trichocarpa]
 gb|EEE88392.2| hypothetical protein POPTR_0008s02380g [Populus trichocarpa]
Length=376

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 150/339 (44%), Positives = 218/339 (64%), Gaps = 9/339 (3%)
 Frame = +2

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSLASD-ALLRAVHLDIAEVVLSIVEAYPTM  415
             KKI  H  +  +L+C+C+ + TL DY +      D A   AV   + E ++ +V+A P  
Sbjct  21    KKI--HIYSDKILRCMCEHISTL-DYEEYLKADVDGAFHSAVENGMVEFIIEVVKACPHA  77

Query  416   AYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHK  595
                 D N  N+   +I NR E +F+L  G           + G+GN +++LAAKL+P  +
Sbjct  78    MISVDGNGRNLFMSSIANRQEKVFSLFYGLEAGGAEFVSIVYGSGNTMLHLAAKLSPPSQ  137

Query  596   LNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMK  775
             L  +SGAALQMQRELQW+KEV+ I  P  +   ++  +TP   FT +H+ L ++GEKWMK
Sbjct  138   LARISGAALQMQRELQWYKEVESIVDPTDNDYYNKDNQTPRELFTSDHKDLVVKGEKWMK  197

Query  776   DTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaats  955
               ATSCT+  ALI+T++F  A TVPGGN    G P+F    +FTVF +++A SLF+++TS
Sbjct  198   QAATSCTVVGALIITIMFTVAFTVPGGNVQETGYPVFKDEKSFTVFIVADAISLFSSSTS  257

Query  956   llvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRI  1135
             +L+FL +LTSRYAE+DFL +LP +LIIGL  LFFSI  MM  F + + ++       +++
Sbjct  258   VLMFLGILTSRYAEEDFLKSLPTKLIIGLSMLFFSIAAMMVTFCAALIIMLDGR---LQV  314

Query  1136  IVPA--LASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             I+P   LA++P+T F+LLQFPLLV +  STYGPGIF+++
Sbjct  315   IIPIVLLATIPVTLFMLLQFPLLVEIGVSTYGPGIFNRK  353



>ref|XP_010658754.1| PREDICTED: uncharacterized protein LOC100245348 isoform X1 [Vitis 
vinifera]
Length=826

 Score =   244 bits (624),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 183/450 (41%), Positives = 268/450 (60%), Gaps = 40/450 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMG-VPPLDAIVKYDCPIINTANFSFWKRSIYYCI--  175
             S+  D+AL+++ +H  +    +L+M  + P+  + +      + +   FW+R IY CI  
Sbjct  376   SQILDVALDILKKHPRLA--ISLDMERIIPIFVLGQMPSLFKSGSQLWFWQRWIYSCIPV  433

Query  176   ----------------SKNSASTQN--------------FVSQLLLWKSIPKKILMHQQA  265
                             +++S   +N              ++ QLL  K+I  K L H QA
Sbjct  434   KVDHASDQIQVNVADDTQHSRDVKNNTAKVLRHLYGPVSYLLQLLGIKNIYAKKLRHAQA  493

Query  266   TDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLN  445
             T+LL+C+C+E++ +N    +       +++AV     +    +++  P +   +D ND N
Sbjct  494   TELLQCICNEIQKVNVEGTLGLRLHHTVIQAVKQGNVDFATEMIKYTPQLVQKTDINDRN  553

Query  446   ILHIAIENRCENIFNLIRG-TSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAAL  622
             I  IAI NR E IF+L+ G  +V    +   ++  GN++++LAA LAP ++L+ +SGAAL
Sbjct  554   IFFIAILNRQEKIFSLLHGLNNVKKMKMTSNVDRFGNNMLHLAAMLAPANQLDGISGAAL  613

Query  623   QMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
             QMQRELQWFKEV+ I  P     ++  GK P   FTE H  L  EGEKWMKD A S +  
Sbjct  614   QMQRELQWFKEVESIVPPICKDLVNADGKRPSELFTEQHANLVKEGEKWMKDIAASSSFV  673

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
             AALIVT++FAAA T+PGGN D  G PIF  ++ F VF IS++ SLF+A TS+L+FL +LT
Sbjct  674   AALIVTIMFAAAFTIPGGNDD-TGAPIFLGNDLFMVFIISDSISLFSATTSVLMFLGILT  732

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA--LAS  1156
             S+YAE  FL  LP +LIIGL TLFFSI  MM AF + + ++  + +S   +I+P   LA 
Sbjct  733   SQYAENKFLTRLPTKLIIGLSTLFFSIATMMIAFCAALAILL-KGRSTKVVIIPIILLAC  791

Query  1157  LPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +P+T FVLLQFPLLV +  STYGPGIF+++
Sbjct  792   VPVTLFVLLQFPLLVEIFISTYGPGIFNRK  821



>emb|CDP04746.1| unnamed protein product [Coffea canephora]
Length=700

 Score =   241 bits (616),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 163/385 (42%), Positives = 231/385 (60%), Gaps = 22/385 (6%)
 Frame = +2

Query  146   FWKRSIYYCI--------------SKNSASTQNFVSQLLLW---KSIPKKILMHQQATDL  274
              WK+ IY C+              S    S  N +  L+ W   K I  + L+H +A  L
Sbjct  307   LWKKWIYSCVMVHSPWESPRGSQTSHEDDSIGNALVGLIYWCYIKHIHDRKLVHDEAVKL  366

Query  275   LKCLCDELKTLNDYNQVFSLASDALL-RAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNIL  451
             L C+  E++ ++  +Q+  +  D +L  A+   I E V+ I++  P + +  D     I 
Sbjct  367   LSCIFKEIRHMSK-SQLEKMEIDKVLYEAIKHGIVEFVVEILKFTPEIIWRKDKKGRTIF  425

Query  452   HIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQ  631
               AI  R E IF+LI G       +    +  GN+ ++LAAKL+PQ +L+ VSGAALQMQ
Sbjct  426   AHAIVLRQEKIFSLIYGLGTQRCIMARRHDVFGNNYLHLAAKLSPQSQLDRVSGAALQMQ  485

Query  632   RELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaal  811
             RELQWFKEV+ I  P     M++  KTP   FT+ H++L  EGE+WMK+TA S  I   L
Sbjct  486   RELQWFKEVESIVQPKLKEDMNDNKKTPSTLFTDEHKVLAREGERWMKNTAGSSMIVGTL  545

Query  812   ivtvvfaaaitvPGGNSDANGLPIF--SSHNAFTVFAISNaaslftaatsllvflsvlts  985
             I  V+F  A T+PGGNS + GLPI   +   AF +F ISNA S+FT++TS+L+FL +LT+
Sbjct  546   ISAVMFTTAFTIPGGNSQS-GLPILLETQTKAFLIFMISNALSMFTSSTSILMFLGILTA  604

Query  986   RYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPI  1165
             RYAE DFL +LP +L+IGL  LFFSI+ MM +F + IYL+  +  +W+   + ALA++P+
Sbjct  605   RYAEADFLNSLPTKLVIGLACLFFSIVTMMVSFGAAIYLMLNKQLTWVFYPIVALATVPV  664

Query  1166  TSFVLLQFPLLVALVSSTYGPGIFS  1240
               F LLQFPLLV +++ TYG GIF 
Sbjct  665   AFFSLLQFPLLVEMINRTYGSGIFG  689



>ref|XP_006342272.1| PREDICTED: uncharacterized protein LOC102590607 [Solanum tuberosum]
Length=247

 Score =   229 bits (584),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 157/244 (64%), Positives = 197/244 (81%), Gaps = 0/244 (0%)
 Frame = +2

Query  506   SVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFS  685
             S L+HNL    + +GN I++LA KLAPQ+KLNLVSG A QMQ+ELQWFKEV++I    F 
Sbjct  2     SPLLHNLVICFDSSGNTILDLAGKLAPQNKLNLVSGPAFQMQQELQWFKEVKQIVPSTFW  61

Query  686   SCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSD  865
               ++   K P + FTE H  LK++GEKWMKDT++SCTIAAALI T+ FAAAITVPGGN+ 
Sbjct  62    KRLNLEMKDPYVVFTEEHEKLKVDGEKWMKDTSSSCTIAAALIATIAFAAAITVPGGNNQ  121

Query  866   ANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLI  1045
              +GLPIFS++  F +FAISNAASLFT++TSLLVFLSVLTSRYAE+DFL+ LP  LI+GL+
Sbjct  122   QSGLPIFSANIGFIIFAISNAASLFTSSTSLLVFLSVLTSRYAEEDFLHTLPRSLILGLL  181

Query  1046  TLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYG  1225
             TLF SI  M+ +FS+T+Y+++GQ K+W+ + V  +A LPITSFVLLQFPLLVAL+SSTYG
Sbjct  182   TLFLSITSMIISFSATVYIMYGQKKAWVLLPVATMACLPITSFVLLQFPLLVALISSTYG  241

Query  1226  PGIF  1237
              GIF
Sbjct  242   AGIF  245



>ref|XP_006586979.1| PREDICTED: receptor-interacting serine/threonine-protein kinase 
4-like [Glycine max]
Length=722

 Score =   240 bits (613),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 176/442 (40%), Positives = 255/442 (58%), Gaps = 30/442 (7%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIY------  166
             +  YD AL ++     +  +  LN G   L  + K      +      W+R IY      
Sbjct  282   TDLYDFALHVLECQPQLATYHGLN-GETALHVLAKKPSSFTSGIQLGIWERCIYPWIQVK  340

Query  167   -----YCISK--NSASTQNFVSQLLL-------------WKSIPKKILMHQQATDLLKCL  286
                   C S    S +   F   LL+             ++++ KK  ++ QA  L++ L
Sbjct  341   LANDYRCQSSIFQSQAPLTFQDNLLVTGLCQAVKYIVPGFEAVQKKKTLNAQALKLVQRL  400

Query  287   CDELKTLNDYNQ---VFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHI  457
              + + + ++      + S  S  L  A    I E+V+ ++ +YP + +  D  + ++ HI
Sbjct  401   WELIVSSDEIQHGDLIKSPLSRPLFIAAESGIPEIVIELLYSYPDLLWKVDGQNRSLFHI  460

Query  458   AIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRE  637
             AI +R E IFNLI         +    + N ++I++LA KLAP  +L++VSGAALQMQRE
Sbjct  461   AIMHRQEKIFNLIYDIGAHKDLITSYRDNNNHNILHLAGKLAPSEQLHVVSGAALQMQRE  520

Query  638   LQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaaliv  817
             L WFKEV+KI  P F    D  G+TP+M FTE H+ L  EGEKW+K+TA+SC + A LI 
Sbjct  521   LLWFKEVEKIIQPLFKEIKDSQGRTPQMLFTEEHKELAKEGEKWLKNTASSCMLVATLIT  580

Query  818   tvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAE  997
             TV+FAA  TVPGGN++ NG PIF    +F VFA+S+A +LF++  S+L+FLS+LTSRYA+
Sbjct  581   TVMFAAIFTVPGGNNNNNGYPIFMHTTSFKVFALSDALALFSSVISVLMFLSILTSRYAQ  640

Query  998   QDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFV  1177
             +DFL +LP RL +G+ TLFFSII M+ AF +T ++V G   +WI I    +A +P   F 
Sbjct  641   EDFLVSLPRRLSVGIATLFFSIITMLIAFGATFFIVLGHQLAWIVIPTTLVACIPAILFA  700

Query  1178  LLQFPLLVALVSSTYGPGIFSQ  1243
             LLQFPLLV  +S TYG G+FS+
Sbjct  701   LLQFPLLVDTISCTYGAGVFSR  722



>ref|XP_010058027.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Eucalyptus 
grandis]
Length=745

 Score =   239 bits (611),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 165/377 (44%), Positives = 233/377 (62%), Gaps = 10/377 (3%)
 Frame = +2

Query  134   ANFSFWKRSIYYCISKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND  313
             ++ S  KR   Y + K  ++ +  V  +   + + +K  MH Q   L+K LC+++ +L D
Sbjct  368   SDISQTKRVSLYLLEKLWSAAKLIVPGI---RGVHEKKTMHLQVLQLVKLLCEQISSLED  424

Query  314   YN--QVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIF  487
                  + +  S  LL A    I E+V  +V + P + +  D    NI H+A+  R E IF
Sbjct  425   SKIADLLTHPSQPLLIAAGFGIVELVTELVRSNPDLIWTVDEQSHNIFHVAVMYRREKIF  484

Query  488   NLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEV  658
             +LI        ++   +D    N +++++LA KLAP  +LN VSGAALQMQREL WFKEV
Sbjct  485   DLIHDLGAHKDMITTYKDP--DNNHNLLHLAGKLAPLDQLNSVSGAALQMQRELLWFKEV  542

Query  659   QKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaa  838
             +K          D+ G+TP M FTE HR L  EGE WMK TA+SC + A LI TV+FAA 
Sbjct  543   EKTVHTLSKQMRDKSGRTPRMLFTEEHRALVKEGEDWMKSTASSCMLVATLITTVMFAAI  602

Query  839   itvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYAL  1018
              TVPGG ++ +G+PI     AF  FAI++A +LF++ TS+L+FLS+LTSRYAE+DFL +L
Sbjct  603   FTVPGGTNNNSGVPILLESTAFITFAIADAFALFSSVTSILMFLSILTSRYAEEDFLESL  662

Query  1019  PNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLL  1198
             P RLIIGL TLF SI  M+ AFS+TI++VFG + +WI + V   + +PIT F  L FPLL
Sbjct  663   PKRLIIGLTTLFLSIASMLIAFSATIFIVFGSHLAWILVPVALASCIPITLFAFLHFPLL  722

Query  1199  VALVSSTYGPGIFSQRG  1249
               ++ S+YG GIF++  
Sbjct  723   NDMLCSSYGNGIFTREA  739



>ref|XP_007221248.1| hypothetical protein PRUPE_ppa026067mg [Prunus persica]
 gb|EMJ22447.1| hypothetical protein PRUPE_ppa026067mg [Prunus persica]
Length=328

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 147/335 (44%), Positives = 202/335 (60%), Gaps = 16/335 (5%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             L+H ++ D+L  + + LK L        L   A+ RAV   I E ++ + +  P + +  
Sbjct  3     LIHARSQDILDYMGEVLKHLGTQEMEECLVYAAIFRAVRSGIIEFIIRLCKVDPDILWRR  62

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI-NGNGNDIMNLAAKLAPQHKLNL  604
             +    NI   +IE R E +++LI G  V   NL  T  + +GND+++LA  L+P  KL+ 
Sbjct  63    NSMGRNIFQYSIECRQEKVYSLIYG--VGQRNLIATFADASGNDMLHLAGMLSPTEKLDR  120

Query  605   VSGAALQMQRELQWFKEVQK-IALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDT  781
             +SGAALQMQRE QWFKEV+  + LP      +  G  P   FT+NH  LK EGEKWMKDT
Sbjct  121   ISGAALQMQRERQWFKEVKSLVVLPSGVGAFNNQGMRPHELFTQNHNKLKEEGEKWMKDT  180

Query  782   ATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsll  961
             ATSC              A TVPGGN+   G P+F   N F VF +S+A SLF++ TS+L
Sbjct  181   ATSC-----------TVVAFTVPGGNNGGTGFPLFLDENMFMVFIVSDAISLFSSTTSVL  229

Query  962   vflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIV  1141
             +FL +LTSRYAE DFL +LP ++IIGL +L  SI  MM AF S ++L+    + WI I +
Sbjct  230   MFLGILTSRYAEDDFLKSLPTKMIIGLSSLLISIAFMMVAFCSALFLML-HERLWIVIPI  288

Query  1142  PALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
               LAS+P+T F+ +QFPLLV +  STYG GIF ++
Sbjct  289   IFLASIPVTLFIWMQFPLLVEIFISTYGGGIFDKK  323



>gb|KHN44023.1| Ankyrin repeat-containing protein [Glycine soja]
Length=724

 Score =   239 bits (609),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 176/444 (40%), Positives = 255/444 (57%), Gaps = 32/444 (7%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD AL ++     +  +  LN G   L  + K      +      W+R IY  I   
Sbjct  282   TDLYDFALHVLECQPQLATYHGLN-GETALHVLAKKPSSFTSGIQLGIWERCIYPWIQVK  340

Query  185   SAS-----TQNFVSQLLL-----------------------WKSIPKKILMHQQATDLLK  280
              A+     +  F SQ  L                       ++++ KK  ++ QA  L++
Sbjct  341   LANDYRCQSSIFQSQAPLTFQVADNLLVTGLCQAVKYIVPGFEAVQKKKTLNAQALKLVQ  400

Query  281   CLCDELKTLNDYNQ---VFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNIL  451
              L + + + ++      + S  S  L  A    I E+V+ ++ +YP + +  D  + ++ 
Sbjct  401   RLWELIVSSDEIQHGDLIKSPLSRPLFIAAESGIPEIVIELLYSYPDLLWKVDGQNRSLF  460

Query  452   HIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQ  631
             HIAI +R E IFNLI         +    + N ++I++LA KLAP  +L++VSGAALQMQ
Sbjct  461   HIAIMHRQEKIFNLIYDIGAHKDLITSYRDNNNHNILHLAGKLAPSEQLHVVSGAALQMQ  520

Query  632   RELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaal  811
             REL WFKEV+KI  P F    D  G+TP+M FTE H+ L  EGEKW+K+TA+SC + A L
Sbjct  521   RELLWFKEVEKIIQPLFKEIKDSQGRTPQMLFTEEHKELAKEGEKWLKNTASSCMLVATL  580

Query  812   ivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRY  991
             I TV+FAA  TVPGGN++ NG PIF    +F VFA+S+A +LF++  S+L+FLS+LTSRY
Sbjct  581   ITTVMFAAIFTVPGGNNNNNGYPIFMHTTSFKVFALSDALALFSSVISVLMFLSILTSRY  640

Query  992   AEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITS  1171
             A++DFL +LP RL +G+ TLFFSII M+ AF +T ++V G   +WI I    +A +P   
Sbjct  641   AQEDFLVSLPRRLSVGIATLFFSIITMLIAFGATFFIVLGHQLAWIVIPTTLVACIPAIL  700

Query  1172  FVLLQFPLLVALVSSTYGPGIFSQ  1243
             F LLQFPLLV  +S TYG G+FS+
Sbjct  701   FALLQFPLLVDTISCTYGAGVFSR  724



>ref|XP_002311029.2| hypothetical protein POPTR_0008s02410g [Populus trichocarpa]
 gb|EEE88396.2| hypothetical protein POPTR_0008s02410g [Populus trichocarpa]
Length=358

 Score =   229 bits (585),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 144/337 (43%), Positives = 215/337 (64%), Gaps = 7/337 (2%)
 Frame = +2

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMA  418
             KKI  H  +  +L+C+C+ + TL+      +    A   AV   + E +  +++A P + 
Sbjct  21    KKI--HMYSEKILRCMCEYISTLDYEGHRQADVHGAFHNAVKNGMVEFITEVIKACPHLM  78

Query  419   YCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
                D N  N+   +I NR E +F+L  G       +   ++ +GN +++LAAKL+P  +L
Sbjct  79    ISGDDNSRNLFMSSIANRQEKVFSLFYGLEAERAGIVSLVDRSGNTLLHLAAKLSPPSQL  138

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
               +SGAALQMQRELQW+KEV+ I  P     ++   +T    FT +H+ L ++GE+WMK+
Sbjct  139   ARISGAALQMQRELQWYKEVESIMNPVLKENLNANTQTARELFTSDHKDLVVKGEQWMKE  198

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
              ATSCT+  ALI+T++F  A TVPGGN    G P+     +FTVF +++A SLF+++TS+
Sbjct  199   AATSCTVVGALIITIMFTVAFTVPGGNVQETGYPVLKDEKSFTVFIVADALSLFSSSTSV  258

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             L+FL +LTSRYAE+DFL +LP +LIIGL TLFFSI  MM  F + + ++       ++II
Sbjct  259   LMFLGILTSRYAEKDFLKSLPKKLIIGLSTLFFSIATMMVTFCAALIIMLDGR---LKII  315

Query  1139  VPA--LASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             +P   LA++P+T F+LLQFPLLV +  STYGPGIF++
Sbjct  316   IPIVLLATIPVTFFMLLQFPLLVEIFVSTYGPGIFNR  352



>ref|XP_007224368.1| hypothetical protein PRUPE_ppa020961mg [Prunus persica]
 gb|EMJ25567.1| hypothetical protein PRUPE_ppa020961mg [Prunus persica]
Length=705

 Score =   238 bits (608),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 161/409 (39%), Positives = 239/409 (58%), Gaps = 18/409 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             +  YD+AL+++ ++  +      N G  PL  + +      + +   FW+R     +   
Sbjct  240   ADLYDVALDIIQKNPQIAFARDEN-GETPLHVMARKPLACYSGSQLGFWQRCKGSLLPHT  298

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLR  355
              A                 K LM+ QAT L+K L +++ TLN  + +  L    S  L  
Sbjct  299   KAPY--------------GKKLMYMQATQLVKQLWEKILTLNSDSAISDLIRTPSSLLFT  344

Query  356   AVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDT  535
             A  L   + ++ ++ +YP + +  D  + +I H A+ +R E +FNLI     L   +   
Sbjct  345   AAELGNIDFLIILLRSYPGLIWHVDEQNRSIFHTAVIHRQEKVFNLIYELGGLKELIVSY  404

Query  536   INGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTP  715
              + N N++++LAAKLAP  +LN  +GAAL+++REL WFKEV+KI  P +    +  GKTP
Sbjct  405   KDNNNNNMLHLAAKLAPVIRLNDDTGAALKLRRELLWFKEVEKIVQPLYKEMRNSIGKTP  464

Query  716   EMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSH  895
             ++ FTE H+ L  EGE WMK TA+SC + A LI TV+FAA  TVPGGN++  G+PIF   
Sbjct  465   QILFTEEHKELLREGEVWMKGTASSCMVVATLIATVMFAAFSTVPGGNNNDTGIPIFLQS  524

Query  896   NAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMM  1075
              AF VFAIS+A SL ++A S+L FLSVL SRYAE DFL++LPNRLI+GL TLF SI  MM
Sbjct  525   RAFIVFAISDAVSLISSAASILSFLSVLMSRYAEGDFLHSLPNRLIVGLATLFISITAMM  584

Query  1076  TAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
               F +T+++V G     I++ +  +A +P+  + LLQFPLL  +++  Y
Sbjct  585   ITFVATVFIVLGSEFHGIKVPIALVAGVPVGFYALLQFPLLADMINHAY  633



>ref|XP_011022999.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Populus euphratica]
Length=628

 Score =   237 bits (604),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 164/446 (37%), Positives = 245/446 (55%), Gaps = 35/446 (8%)
 Frame = +2

Query  8     KFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI----  175
             + YD+AL+L+  +  +  +   +     LD + +      +    + WK+ IY CI    
Sbjct  177   ELYDIALDLLQHYPQLAFYQDSDKDTA-LDMLAQKPSAFPSGTQLALWKKWIYKCIRVPQ  235

Query  176   --------------SKNSASTQNFVSQ------LLLWKSIPKKI----------LMHQQA  265
                           ++     +N V +      +++WK +   +          L H QA
Sbjct  236   PLASSNNHGDIERPNRGPTDRRNIVKRASDKLLVMVWKGLRFFVPAIKHMYNLKLTHGQA  295

Query  266   TDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLN  445
               +L CLC+++ TL+           A+  AV   I E ++ ++  YP + +  D  +  
Sbjct  296   HAVLCCLCEQISTLHKSEFKEIGVYRAVFSAVKHGIVEFIIEMIRHYPDIIWSEDELNRG  355

Query  446   ILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQ  625
             I   A   R E IF+LI       +++    +   N++++ AA +AP  +L+ VSGA LQ
Sbjct  356   IFLYATLQRQEKIFSLIYKMGAKKNSVSTYWDKYQNNMLHQAAFIAPSSQLDRVSGAPLQ  415

Query  626   MQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaa  805
             MQRELQW+KEV+ I  P +    +   KTP+  FTE H+ L  EGEKWMK TA SCT+ A
Sbjct  416   MQRELQWYKEVESIVQPKYREMSNSSHKTPQTLFTEQHKKLVEEGEKWMKATAESCTVVA  475

Query  806   alivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlts  985
             ALI T++F+A  TVPGG    +G+PI+ + N+F VF +S+A SLF ++ SLL+F  +LTS
Sbjct  476   ALIATIMFSAIFTVPGGYDQYSGIPIYLNRNSFMVFIVSDAMSLFASSASLLMFFGILTS  535

Query  986   RYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPI  1165
             RY E+DFL +LP +LI+GL  LFFSI  MM AF  T+ ++  +   W+   +  LASLP+
Sbjct  536   RYREEDFLKSLPTKLIVGLSCLFFSIATMMIAFGITLVMMLRERFHWVSFPITLLASLPV  595

Query  1166  TSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             T F LLQFPLLV +  STYGPGIF +
Sbjct  596   TLFALLQFPLLVEIFVSTYGPGIFDK  621



>ref|XP_011022998.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Populus euphratica]
Length=643

 Score =   236 bits (603),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 164/446 (37%), Positives = 245/446 (55%), Gaps = 35/446 (8%)
 Frame = +2

Query  8     KFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI----  175
             + YD+AL+L+  +  +  +   +     LD + +      +    + WK+ IY CI    
Sbjct  192   ELYDIALDLLQHYPQLAFYQDSDKDTA-LDMLAQKPSAFPSGTQLALWKKWIYKCIRVPQ  250

Query  176   --------------SKNSASTQNFVSQ------LLLWKSIPKKI----------LMHQQA  265
                           ++     +N V +      +++WK +   +          L H QA
Sbjct  251   PLASSNNHGDIERPNRGPTDRRNIVKRASDKLLVMVWKGLRFFVPAIKHMYNLKLTHGQA  310

Query  266   TDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLN  445
               +L CLC+++ TL+           A+  AV   I E ++ ++  YP + +  D  +  
Sbjct  311   HAVLCCLCEQISTLHKSEFKEIGVYRAVFSAVKHGIVEFIIEMIRHYPDIIWSEDELNRG  370

Query  446   ILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQ  625
             I   A   R E IF+LI       +++    +   N++++ AA +AP  +L+ VSGA LQ
Sbjct  371   IFLYATLQRQEKIFSLIYKMGAKKNSVSTYWDKYQNNMLHQAAFIAPSSQLDRVSGAPLQ  430

Query  626   MQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaa  805
             MQRELQW+KEV+ I  P +    +   KTP+  FTE H+ L  EGEKWMK TA SCT+ A
Sbjct  431   MQRELQWYKEVESIVQPKYREMSNSSHKTPQTLFTEQHKKLVEEGEKWMKATAESCTVVA  490

Query  806   alivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlts  985
             ALI T++F+A  TVPGG    +G+PI+ + N+F VF +S+A SLF ++ SLL+F  +LTS
Sbjct  491   ALIATIMFSAIFTVPGGYDQYSGIPIYLNRNSFMVFIVSDAMSLFASSASLLMFFGILTS  550

Query  986   RYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPI  1165
             RY E+DFL +LP +LI+GL  LFFSI  MM AF  T+ ++  +   W+   +  LASLP+
Sbjct  551   RYREEDFLKSLPTKLIVGLSCLFFSIATMMIAFGITLVMMLRERFHWVSFPITLLASLPV  610

Query  1166  TSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             T F LLQFPLLV +  STYGPGIF +
Sbjct  611   TLFALLQFPLLVEIFVSTYGPGIFDK  636



>emb|CBI27188.3| unnamed protein product [Vitis vinifera]
Length=1855

 Score =   244 bits (622),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 155/340 (46%), Positives = 223/340 (66%), Gaps = 3/340 (1%)
 Frame = +2

Query  224   WKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSI  394
             +KS+  K LMH QA +L++ L D++ +L+   ++  L    S  L  A  L I E +  +
Sbjct  352   FKSVYDKKLMHIQALELVQQLWDKILSLDHDPKIGELIRTPSRLLFTAAELGIVEFITVL  411

Query  395   VEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAA  574
             + +YP + +  +     I H+A+ +R E IFNLI         +    +   N++++LA 
Sbjct  412   IRSYPDLIWKVNDQSQTIFHVAVAHRQEKIFNLIYEIGAHKDYIAAYKDEKNNNMLHLAG  471

Query  575   KLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKI  754
             KLAP ++L + SGAA Q+QREL WFKEV+KI  P ++   +E G+TP++ FTE H+ L  
Sbjct  472   KLAPSNRLKIDSGAAFQLQRELHWFKEVEKIIQPSYTEMKNEQGRTPQILFTEEHKDLVR  531

Query  755   EGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaas  934
             EGEKWMKDTA+SC + A LI TV+FAAA +VPGGN D  G PIF +  +F VFAIS+A +
Sbjct  532   EGEKWMKDTASSCMVVATLIATVMFAAAFSVPGGNDDDTGRPIFLTKKSFLVFAISDALA  591

Query  935   lftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQ  1114
             LF++ATS+L+FLS+LTSRYAE+DFL +LPNRLIIGL TLF S+  MM AF +T+++V G 
Sbjct  592   LFSSATSILIFLSILTSRYAEEDFLESLPNRLIIGLATLFISVATMMIAFCATLFIVLGP  651

Query  1115  NKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGI  1234
                W+   +  +A +P+T F LL+FPL + ++S  Y   I
Sbjct  652   ELVWVANPMALVACVPVTLFPLLKFPLFIDMISHRYRSSI  691



>ref|XP_006382837.1| hypothetical protein POPTR_0005s05920g [Populus trichocarpa]
 gb|ERP60634.1| hypothetical protein POPTR_0005s05920g [Populus trichocarpa]
Length=581

 Score =   234 bits (596),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 209/332 (63%), Gaps = 0/332 (0%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             L+H QA  +L CLC+++ TL+           A+  AV   I E ++ IV  YP + +  
Sbjct  240   LIHGQALAVLCCLCEQISTLHRSEFKEIGVYKAVFNAVKHGIVEFIVEIVRHYPDVIWFE  299

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             D  +  I   A   R E IF+L+       +++    +   N+I++ AA LAP  +L+ V
Sbjct  300   DDLNRGIFLYATLQRQEKIFSLLYKMGAKKNSMATPWDKYHNNILHQAAFLAPSSQLDRV  359

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGAALQMQRELQW+KEV+ I  P +   ++   +TP+  FTE HR L  EGEKWMKDT+ 
Sbjct  360   SGAALQMQRELQWYKEVESIVQPKYREMVNFNHRTPQALFTEQHRKLVEEGEKWMKDTSE  419

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             SCT+ AALI T++F+A  TVPGG    +G+PI+   N+F VF +S+A SLF + +SLL+F
Sbjct  420   SCTVVAALISTIMFSAIFTVPGGYDQFSGIPIYLHGNSFMVFMVSDAMSLFASTSSLLMF  479

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
             L +LTSRY E+DFL +LP ++I+GL  LFFSI  MM  F  T++++      WI   +  
Sbjct  480   LGILTSRYREEDFLKSLPTKMIVGLSCLFFSIATMMITFGITLFMMLRDRFPWISFPIIL  539

Query  1148  LASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             LASLP+T F LLQFPLLV +  STYGPGIF +
Sbjct  540   LASLPVTLFALLQFPLLVEIFFSTYGPGIFDR  571



>emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera]
Length=1697

 Score =   243 bits (619),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 154/336 (46%), Positives = 222/336 (66%), Gaps = 3/336 (1%)
 Frame = +2

Query  224   WKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSI  394
             +KS+  K LMH QA +L++ L D++ +L+   ++  L    S  L  A  L I E +  +
Sbjct  417   FKSVYDKKLMHIQALELVQQLWDKILSLDHDPKIGELIRTPSRLLFTAAELGIVEFITVL  476

Query  395   VEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAA  574
             + +YP + +  +     I H+A+ +R E IFNLI         +    +   N++++LA 
Sbjct  477   IRSYPDLIWKVNDQSQTIFHVAVAHRQEKIFNLIYEIGAHKDYIAAYKDEKNNNMLHLAG  536

Query  575   KLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKI  754
             KLAP ++L + SGAA Q+QREL WFKEV+KI  P ++   +E G+TP++ FTE H+ L  
Sbjct  537   KLAPSNRLKIDSGAAFQLQRELHWFKEVEKIIQPSYTEMKNEQGRTPQILFTEEHKDLVR  596

Query  755   EGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaas  934
             EGEKWMKDTA+SC + A LI TV+FAAA +VPGGN D  G PIF +  +F VFAIS+A +
Sbjct  597   EGEKWMKDTASSCMVVATLIATVMFAAAFSVPGGNDDDTGRPIFLTKKSFLVFAISDALA  656

Query  935   lftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQ  1114
             LF++ATS+L+FLS+LTSRYAE+DFL +LPNRLIIGL TLF S+  MM AF +T+++V G 
Sbjct  657   LFSSATSILIFLSILTSRYAEEDFLESLPNRLIIGLATLFISVATMMIAFCATLFIVLGP  716

Query  1115  NKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
                W+   +  +A +P+T F LL+FPL + ++S  Y
Sbjct  717   ELVWVANPMALVACVPVTLFPLLKFPLFIDMISHRY  752



>emb|CBI35217.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   230 bits (586),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 161/346 (47%), Positives = 221/346 (64%), Gaps = 3/346 (1%)
 Frame = +2

Query  212   QLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLS  391
             +LL  KSI  + L H QA  LL+ +C EL+ +     +      A+++AV     E V  
Sbjct  80    KLLGIKSIRAQKLRHAQAVKLLQGICTELRNIKPDRVLGYRVHQAVIQAVKKGNVEFVTR  139

Query  392   IVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRG-TSVLVHNLQDTINGNGNDIMNL  568
             ++++ P + +  D ND NI  IAI NR E IFNL+ G T+V    +    +  GN++++L
Sbjct  140   MIKSIPELVWNGDINDRNIFSIAILNRQEKIFNLLHGLTNVKKMKVTSADDRFGNNMLHL  199

Query  569   AAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLL  748
             AA LAP  +L+ +SGAALQMQRELQWFKEV+ I  P     ++  GK P   F++ H  L
Sbjct  200   AAMLAPSDQLDGISGAALQMQRELQWFKEVESIVPPICKDVLNSDGKKPSEVFSQQHANL  259

Query  749   KIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNa  928
               EGEKWMK+ ATS +  AALIVT++FAAA T+PGGN+D  G PIF     F VF IS++
Sbjct  260   VKEGEKWMKEIATSSSFVAALIVTIMFAAAFTIPGGNND-KGAPIFLDDPLFMVFIISDS  318

Query  929   aslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVF  1108
              SLF+A TS+L+FL +LTS+YAE  FL  LP +LIIGL TLF  I  MM AF + + ++ 
Sbjct  319   ISLFSATTSVLMFLGILTSQYAENKFLTRLPTKLIIGLSTLFICIAAMMIAFCAALAILL  378

Query  1109  GQNKSWIRII-VPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              ++ + + +I +  LA +P+T F LLQFPLLV +  STYGPGIF +
Sbjct  379   KKSSTKVVMIPIILLACVPVTLFALLQFPLLVNIFISTYGPGIFDR  424



>ref|XP_002309894.2| hypothetical protein POPTR_0007s03780g [Populus trichocarpa]
 gb|EEE90344.2| hypothetical protein POPTR_0007s03780g [Populus trichocarpa]
Length=565

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 148/332 (45%), Positives = 208/332 (63%), Gaps = 0/332 (0%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             LMH QA  +L CLC+++ TL+           A+  AV   I E ++ ++  YP + +  
Sbjct  227   LMHGQAHAVLCCLCEQISTLHKSEFKVIGVYRAVFSAVKHGIVEFIIEMIRHYPDIIWSE  286

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             D  +  I   A   R E IF+LI       +++  + +   N+I++ AA +AP  +L+ V
Sbjct  287   DELNRGIFLYATLQRQEKIFSLIYKMGAKKNSMATSWDKYQNNILHQAAFIAPSSQLDRV  346

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGA LQMQRELQW+KEV+ I  P +   ++   KT +  FTE HR L  EGEKWMK TA 
Sbjct  347   SGAPLQMQRELQWYKEVESIVQPKYREMLNSSHKTAQTLFTEQHRKLVEEGEKWMKATAE  406

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             SCT+ AALI T++F+A  TVPGG    +G+PI+ + N+F VF +S+A SLF +++SLL+F
Sbjct  407   SCTVVAALIATIMFSAIFTVPGGYDQYSGIPIYLNRNSFMVFIVSDAMSLFASSSSLLMF  466

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
               +LTSRY E+DFL +LP +LI+GL  LFFSI  MM  F  T+ ++  +   W+   +  
Sbjct  467   FGILTSRYREEDFLKSLPTKLIVGLSCLFFSIATMMITFGITLVMMLRERFHWVSFPIIL  526

Query  1148  LASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             LASLP+T F LLQFPLLV +  STYGPGIF +
Sbjct  527   LASLPVTLFALLQFPLLVEIFFSTYGPGIFDK  558



>ref|XP_007221373.1| hypothetical protein PRUPE_ppa017363mg, partial [Prunus persica]
 gb|EMJ22572.1| hypothetical protein PRUPE_ppa017363mg, partial [Prunus persica]
Length=342

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 210/332 (63%), Gaps = 6/332 (2%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H Q+ +LL  +C+ +K     + V      A+ RA+   + E   S+++A P + +  + 
Sbjct  11    HIQSLELLHHMCELIKHSRSKDYV----RKAIFRAIEKGMFEFTDSVLQARPDLVWIQNQ  66

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGN-GNDIMNLAAKLAPQHKLNLVS  610
                +    AIE R E I++LI   +     L  T   N GN  +++   L+P  KL+ +S
Sbjct  67    MGRDPFQFAIECRQEKIYSLIYRLNKRKRTLIGTFGDNYGNCSLHMTGMLSPLAKLDNIS  126

Query  611   GAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATS  790
             GAALQMQRELQWFKEV+ I LP      +  G TP   FT+NH+ L  EGE+WMK TA+S
Sbjct  127   GAALQMQRELQWFKEVETIVLPRTKDSTNNDGMTPRKLFTKNHKELVKEGERWMKGTASS  186

Query  791   CtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfl  970
             CT+  ALI+T++FAAA T+PGGN+   G PIF     F  F +S+A SLF++ TS+L+FL
Sbjct  187   CTVVGALIITIMFAAAFTIPGGNNGETGFPIFLHKKLFMAFIVSDAISLFSSTTSVLMFL  246

Query  971   svltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPAL  1150
              +LTSRYAE DFL +LP ++IIGL TLFFSI  MM AFSS ++++    +SWI I +  L
Sbjct  247   GILTSRYAEDDFLKSLPTKMIIGLSTLFFSIAAMMVAFSSALFIMV-HEQSWIVIPMIFL  305

Query  1151  ASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             AS+PIT F+ +QFPLLV +  STYG GIF ++
Sbjct  306   ASIPITLFIWMQFPLLVEMYISTYGGGIFDRK  337



>ref|XP_009377222.1| PREDICTED: uncharacterized protein LOC103965855 [Pyrus x bretschneideri]
Length=606

 Score =   233 bits (593),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 174/446 (39%), Positives = 252/446 (57%), Gaps = 38/446 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI---  175
             +K +D+A EL+ ++   T        + P+ A         +  +  FW++ IY  I   
Sbjct  162   AKQFDIAWELLQRYPQFTCTQGT---ISPVIAFASLSSAFASVTSLKFWQKWIYNRIRIE  218

Query  176   --------------SKNSASTQNFVSQLLLWKSIPKKIL-------------MHQQATDL  274
                            +N    Q   + L L + +P ++L             +H ++  +
Sbjct  219   LGHSVNDFRINVQNQENEQGNQWNNTVLGLLQGLPSRLLEFLGIKCIRELKLIHVRSRQI  278

Query  275   LKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILH  454
             L C+CD +K L            A+  AV   I EVV S+ +A P +   ++ +  NI  
Sbjct  279   LDCMCDVIKHLTRKEMRDGGVYGAIFVAVENGIVEVVTSLCKARPELLIKTNRDKNNIFQ  338

Query  455   IAIENRCENIFNLIRGTSVLVHNLQDTINGN-GNDIMNLAAKLAPQHKLNLVSGAALQMQ  631
              A+E R E +++LI G  V   NL  T+  N GN +++ A  L+P  KL+ ++GAALQMQ
Sbjct  339   YAVECRQEKVYSLIYG--VRQRNLITTLPDNSGNVLLHGAGMLSPLAKLDRIAGAALQMQ  396

Query  632   RELQWFKEVQKIALPY-FSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaa  808
             RE QW+KEV+ I      SS  +E G TP   FT++H  L  EGEKWMK+T++SCT+ +A
Sbjct  397   RERQWYKEVESIHFQLSGSSTKNEAGLTPSKLFTKSHEKLHQEGEKWMKETSSSCTVVSA  456

Query  809   livtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsR  988
             LI+T++FAAA TVPGGN+   G PIF +   F VF +S+A SLF++ TS+L+FL +LTSR
Sbjct  457   LIITIMFAAAFTVPGGNNQETGFPIFLNQKLFMVFIVSDAISLFSSVTSVLMFLGILTSR  516

Query  989   YAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPIT  1168
             YAE DFL +LP ++IIGL TLF SI  MM AFSS ++++  Q+K WI   +  LA +PI 
Sbjct  517   YAEDDFLKSLPTKMIIGLSTLFISITTMMVAFSSALFIML-QDKPWITYPIVFLAGVPII  575

Query  1169  SFVLLQFPLLVALVSSTYGPGIFSQR  1246
              FV +QFPLLV    STYG GIF ++
Sbjct  576   LFVWMQFPLLVDFFVSTYGGGIFDRK  601



>gb|KDO48318.1| hypothetical protein CISIN_1g047454mg [Citrus sinensis]
Length=339

 Score =   225 bits (573),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 148/340 (44%), Positives = 216/340 (64%), Gaps = 8/340 (2%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I K+ + + QA ++++ +C  +   +  NQ   L   A  +A  L I++ V  I+ AY
Sbjct  8     KVIHKEKVRNMQAVEIVRIICKGVIWNDPQNQ--QLLKKAFFKAATLGISKFVQEIIAAY  65

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
                 Y  D N   I H+A+ +R   +FNLI  +S    N   + +   N+I++   KL P
Sbjct  66    KGSVYWEDENKHTIFHVAVLHRRAEVFNLIY-SSTFKSNWLGSNDNIRNNILHFGGKLVP  124

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +   V+GAALQMQR+L+WFK V+ +  P+    ++   +TP   FTE H+ L  EGEK
Sbjct  125   SSE---VAGAALQMQRKLEWFKAVENLVHPFLREAVNN-EQTPREVFTEEHKELVKEGEK  180

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WMK+TAT+C++ AA I+TV+FAAA TVPGGN D+ G+P F   ++F +FA+S+A SLF++
Sbjct  181   WMKETATACSVVAAFIITVMFAAAFTVPGGN-DSRGIPNFLHESSFIIFAVSDALSLFSS  239

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
               S+L+FL +LTSRY+E+DFL +LP +LII LIT+FFSI  MM +F +TIYLV      W
Sbjct  240   IISVLMFLGILTSRYSEEDFLLSLPRKLIIDLITMFFSIASMMVSFGATIYLVLFSTWKW  299

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             + I +  +  +P+T F LLQFPLL  + SSTYG GIF ++
Sbjct  300   VFIPITLVGCVPVTLFALLQFPLLFDMYSSTYGRGIFGRK  339



>ref|XP_010251695.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010251696.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Nelumbo nucifera]
Length=625

 Score =   233 bits (593),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 157/369 (43%), Positives = 224/369 (61%), Gaps = 28/369 (8%)
 Frame = +2

Query  206   VSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLN---------DYNQVFSLASDALLRA  358
             ++++ + K +  K LMH+Q+ +L+K +C++L+ ++         +    F     A+  A
Sbjct  255   INRVAIIKRVYNKKLMHKQSVELVKRICEQLEDISAQIEDGRIENMEAPFYQVRGAMHLA  314

Query  359   VHLDIAEVVLSIVEAYPTMAY-------CSDHNDLNI----LHIAIENRCENIFNLIRGT  505
                 I E+++  +  +P   +       C  H   +      H AI  R E IFNLI  T
Sbjct  315   AENGIEELIIECLNHFPGQVWYVLDDQHCRYHKRASYQGTPFHTAIVYRQEKIFNLIHRT  374

Query  506   SVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFS  685
                    +  ++  G+++++L AKLAP  ++N VSGAALQMQRELQWFKE++K   P+  
Sbjct  375   G----GFKKMLSFYGSNMLHLVAKLAPSSRINCVSGAALQMQRELQWFKEIEKFVSPHCK  430

Query  686   SCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSD  865
                +  GKTP   F E H  L  +GEKWMKDTATSC I A LI TVVFAAA TVPGGN D
Sbjct  431   EETNNEGKTPRAAFGEEHMDLVEKGEKWMKDTATSCMIVATLIATVVFAAAFTVPGGNID  490

Query  866   ANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLI  1045
               G PIF    +F +F IS+  +LF++ TS+L+FL++LT+RYA  DFL +LP +LIIGL 
Sbjct  491   GKGTPIFLEETSFMIFLISDTIALFSSITSVLMFLAILTARYAVDDFLESLPKKLIIGLA  550

Query  1046  TLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPAL--ASLPITSFVLLQFPLLVALVSST  1219
             TLF SI  M+ AFSS ++++ G  K   R+I P +  A LP+TSF LL+FPL + ++ ST
Sbjct  551   TLFISIAGMVIAFSSALFIILGDQKK--RLITPIILFACLPVTSFGLLEFPLFIEIIFST  608

Query  1220  YGPGIFSQR  1246
             YG GIF ++
Sbjct  609   YGQGIFHRK  617



>ref|XP_007221399.1| hypothetical protein PRUPE_ppa021053mg, partial [Prunus persica]
 gb|EMJ22598.1| hypothetical protein PRUPE_ppa021053mg, partial [Prunus persica]
Length=325

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 201/306 (66%), Gaps = 8/306 (3%)
 Frame = +2

Query  341   DALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLI----RGTS  508
             +A+ RAV   I E +  I +A P + +  +    N    AIE R E ++ LI    +   
Sbjct  19    EAIFRAVERGIFEFIDRIFQASPNLVWSYNRMRRNAFQFAIECRQEKVYTLIYKLDKRKR  78

Query  509   VLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSS  688
               + NL DT   + N ++++A  L+P  KL+ +SGAALQMQRELQWFKEV+ I  P    
Sbjct  79    SSIANLVDT---SKNGMLHVAGMLSPLAKLDNISGAALQMQRELQWFKEVETITFPRSKE  135

Query  689   CMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDA  868
              ++     P   FT+NH+ L  EGE+WMK+TATSCT   ALI T++FA+A TVPGGN++ 
Sbjct  136   ALNAEFLAPRDVFTKNHKELVKEGERWMKETATSCTFVGALIFTIMFASAFTVPGGNNER  195

Query  869   NGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLIT  1048
              G+PIF +   F VF +S+A SLF++ TS+L FL +LTSRYAE DFL +LP ++IIGL T
Sbjct  196   TGIPIFLNKKIFMVFIVSDAISLFSSTTSVLKFLGILTSRYAEDDFLKSLPTKMIIGLST  255

Query  1049  LFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGP  1228
             LFFSI  MM AFSS ++++  Q +SWI + +  LA++PIT F+ +QFPLLV +  STYG 
Sbjct  256   LFFSIAAMMVAFSSALFIMIHQ-QSWIVVPIIFLATVPITLFIWMQFPLLVEMFISTYGS  314

Query  1229  GIFSQR  1246
             GIF ++
Sbjct  315   GIFDRK  320



>ref|XP_011078080.1| PREDICTED: uncharacterized protein LOC105161922 isoform X2 [Sesamum 
indicum]
 ref|XP_011078081.1| PREDICTED: uncharacterized protein LOC105161922 isoform X2 [Sesamum 
indicum]
Length=626

 Score =   232 bits (591),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 173/457 (38%), Positives = 253/457 (55%), Gaps = 58/457 (13%)
 Frame = +2

Query  5     SKFYDMALELVG-------QHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSI  163
             S FYD+AL LV        QH D++          PL+ + +      +  +F+FW+  +
Sbjct  181   SGFYDLALYLVEHNPGLAWQHEDIS----------PLELLAQEPSAFPSGMDFNFWQFFM  230

Query  164   YYCISKN-------------SASTQNFVSQ---------------LLLWK----------  229
             Y C+ +              S    +F  Q               ++LWK          
Sbjct  231   YSCVPEKLVEIPESLVGLTRSPKISSFKPQRRCSNQFSRAYEELHVILWKVLETLAKPFK  290

Query  230   SIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYP  409
              I  +  MH QA  L+K +C E++ L D  +  S+ +   L      I E+V  I++++P
Sbjct  291   HIRHRKAMHHQALQLIKQVCAEIRRL-DNAKAASILTGPFLLGTQNGIHEIVKEILDSFP  349

Query  410   TMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVH-NLQDTINGNGNDIMNLAAKLAP  586
                   D  + ++ H+A+  R E +F ++   S   + +L   ++   N+I++LA     
Sbjct  350   QAITFVDEENHSVFHLAVMYRHEKVFKIVHEQSGHYNMSLSLLLDNERNNILHLAGYRPH  409

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +L+L SGA L+MQRELQWFKEV+K  LP      + YGKTP   F E HR +     +
Sbjct  410   LDRLDLSSGAVLRMQRELQWFKEVEKFVLPQERKSKNAYGKTPLAIFNEEHREVAAYETQ  469

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WM   ATSCT+AA+LI TV FAAAITVPGGN +++GLPIFSS  AF +FAI++A +L ++
Sbjct  470   WMIGMATSCTVAASLIATVAFAAAITVPGGN-NSSGLPIFSSEKAFLLFAIADALALLSS  528

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
              T++L FLS+ TSRY+  DFLYALPNRLIIGLI+LF S+  +M AF ST++LV  +  S 
Sbjct  529   ITTVLSFLSIFTSRYSVNDFLYALPNRLIIGLISLFLSVTSLMVAFGSTMFLVAAKRNSL  588

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             I + + ALA +P++ F  LQ P L+ ++ STYGP IF
Sbjct  589   ILVPIIALACVPVSLFAYLQLPPLLNMIKSTYGPSIF  625



>gb|KDP29847.1| hypothetical protein JCGZ_18422 [Jatropha curcas]
Length=584

 Score =   231 bits (589),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 168/429 (39%), Positives = 257/429 (60%), Gaps = 18/429 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             S+ +D++L+L+ +            G  PL  +   +    ++  + FWK+ IY CI   
Sbjct  160   SEMFDISLDLLQRCPSFATRRT-RYGSTPLVELACLNDLFPSSNRYVFWKQWIYSCIHVQ  218

Query  185   SASTQNFVSQLLL--------WKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLAS  340
               +    V   +L         K I  + L H  A  +L+ +   + +++D         
Sbjct  219   LPAFPGDVRIAILENDHVKQGLKQIYDRKLRHTYALKILELMAKHVSSIDDTKLKQKRIY  278

Query  341   DALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVH  520
             DA  +A+   + EVV+ +++A   +   ++ N  ++L  AI+ R E +F+LI G   L  
Sbjct  279   DAFFKAIKYGVVEVVIEMIKANSILLTVANKNSRDMLMNAIQYRQEKVFSLIYG---LGS  335

Query  521   NLQDTINGNG---NDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSC  691
               Q  I+G+    N I+++AAKLAP ++L  +SGAALQMQRELQW+KEV+ I++P     
Sbjct  336   RKQLLISGSDEFENTILHMAAKLAPPNRLADISGAALQMQRELQWYKEVESISIPSNKEY  395

Query  692   MDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDAN  871
             ++   +     F+++H+ L  +GE+WMK+TATSCT+  ALI+T++F AA TVPGGN    
Sbjct  396   INSDNEQASEIFSKSHKELIKDGEEWMKETATSCTVVGALIITIMFTAAFTVPGGNVQET  455

Query  872   GLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITL  1051
             G P+F+   +F +F IS+A SLF ++TS+L+FL VLTSRY+E DFL +LP +LIIGL TL
Sbjct  456   GFPMFAHEKSFMIFIISDAISLFASSTSVLMFLGVLTSRYSEDDFLKSLPTKLIIGLSTL  515

Query  1052  FFSIILMMTAFSSTIYLVF-GQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGP  1228
             F SI  MM AF +T+ ++  G+ K  + II+  LAS+P+T F+LLQFPLLV +  STYGP
Sbjct  516   FISIAAMMVAFCATLMIMLEGELKLVLPIIL--LASIPVTLFILLQFPLLVEIFVSTYGP  573

Query  1229  GIFSQRGIP  1255
             GIF ++  P
Sbjct  574   GIFDRKMKP  582



>ref|XP_011078079.1| PREDICTED: uncharacterized protein LOC105161922 isoform X1 [Sesamum 
indicum]
Length=667

 Score =   232 bits (592),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 173/457 (38%), Positives = 253/457 (55%), Gaps = 58/457 (13%)
 Frame = +2

Query  5     SKFYDMALELVG-------QHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSI  163
             S FYD+AL LV        QH D++          PL+ + +      +  +F+FW+  +
Sbjct  222   SGFYDLALYLVEHNPGLAWQHEDIS----------PLELLAQEPSAFPSGMDFNFWQFFM  271

Query  164   YYCISK-------------NSASTQNFVSQ---------------LLLWK----------  229
             Y C+ +              S    +F  Q               ++LWK          
Sbjct  272   YSCVPEKLVEIPESLVGLTRSPKISSFKPQRRCSNQFSRAYEELHVILWKVLETLAKPFK  331

Query  230   SIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYP  409
              I  +  MH QA  L+K +C E++ L D  +  S+ +   L      I E+V  I++++P
Sbjct  332   HIRHRKAMHHQALQLIKQVCAEIRRL-DNAKAASILTGPFLLGTQNGIHEIVKEILDSFP  390

Query  410   TMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVH-NLQDTINGNGNDIMNLAAKLAP  586
                   D  + ++ H+A+  R E +F ++   S   + +L   ++   N+I++LA     
Sbjct  391   QAITFVDEENHSVFHLAVMYRHEKVFKIVHEQSGHYNMSLSLLLDNERNNILHLAGYRPH  450

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +L+L SGA L+MQRELQWFKEV+K  LP      + YGKTP   F E HR +     +
Sbjct  451   LDRLDLSSGAVLRMQRELQWFKEVEKFVLPQERKSKNAYGKTPLAIFNEEHREVAAYETQ  510

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WM   ATSCT+AA+LI TV FAAAITVPGGN +++GLPIFSS  AF +FAI++A +L ++
Sbjct  511   WMIGMATSCTVAASLIATVAFAAAITVPGGN-NSSGLPIFSSEKAFLLFAIADALALLSS  569

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
              T++L FLS+ TSRY+  DFLYALPNRLIIGLI+LF S+  +M AF ST++LV  +  S 
Sbjct  570   ITTVLSFLSIFTSRYSVNDFLYALPNRLIIGLISLFLSVTSLMVAFGSTMFLVAAKRNSL  629

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             I + + ALA +P++ F  LQ P L+ ++ STYGP IF
Sbjct  630   ILVPIIALACVPVSLFAYLQLPPLLNMIKSTYGPSIF  666



>ref|XP_007221269.1| hypothetical protein PRUPE_ppa027206mg [Prunus persica]
 gb|EMJ22468.1| hypothetical protein PRUPE_ppa027206mg [Prunus persica]
Length=650

 Score =   231 bits (589),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 211/328 (64%), Gaps = 5/328 (2%)
 Frame = +2

Query  269   DLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNI  448
             D+L  +C+ +K L+       L   A+ RAV   I E V+ + +  P + + ++    NI
Sbjct  321   DILDYMCEVVKHLDTQEMEDGLVYAAIFRAVQRGIIEFVIRLCKVDPDILWKTNSMGRNI  380

Query  449   LHIAIENRCENIFNLIRGTSVLVHNLQDTI-NGNGNDIMNLAAKLAPQHKLNLVSGAALQ  625
                +IE R E +++LI G  V   NL  T  + +GND+++LA  L+P  KL+L+SGAALQ
Sbjct  381   FQYSIECRQEKVYSLIYG--VGQRNLIATFSDASGNDMLHLAGMLSPTEKLDLISGAALQ  438

Query  626   MQRELQWFKEVQK-IALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
             MQRE QWFKEV+  + LP      ++ G  P   FT+NH  LK EGEKWMKD ATSCT+ 
Sbjct  439   MQRERQWFKEVKSLVVLPSGVGAFNKQGMRPHELFTQNHNKLKEEGEKWMKDAATSCTVV  498

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
              AL +T++FAAA TVPGGN+   G P+F     F VF +S+A SLF++ TS+L+FL +LT
Sbjct  499   GALTITIMFAAAFTVPGGNNGGTGFPLFLDEKMFLVFIVSDAISLFSSTTSVLMFLGILT  558

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLP  1162
             SRYAE DFL +LP ++IIGL TL  SI  MM AF S ++L+    K WI I +  L+S+P
Sbjct  559   SRYAEDDFLKSLPTKMIIGLSTLLISIASMMVAFCSALFLML-HEKLWIVIPIIFLSSVP  617

Query  1163  ITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +T F+ +QFP+LV +  STYG GIF ++
Sbjct  618   VTLFIWMQFPVLVEIFISTYGGGIFDKK  645



>ref|XP_007221266.1| hypothetical protein PRUPE_ppa019896mg [Prunus persica]
 gb|EMJ22465.1| hypothetical protein PRUPE_ppa019896mg [Prunus persica]
Length=648

 Score =   231 bits (588),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 211/328 (64%), Gaps = 5/328 (2%)
 Frame = +2

Query  269   DLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNI  448
             D+L  +C+ +K L+       L   A+ RAV   I E V+ + +  P + + ++    NI
Sbjct  319   DILDYMCEVVKHLDTQEMEDGLVYAAIFRAVQRGIIEFVIRLCKVDPDILWKTNSMGRNI  378

Query  449   LHIAIENRCENIFNLIRGTSVLVHNLQDTI-NGNGNDIMNLAAKLAPQHKLNLVSGAALQ  625
                +IE R E +++LI G  V   NL  T  + +GND+++LA  L+P  KL+L+SGAALQ
Sbjct  379   FQYSIECRQEKVYSLIYG--VGQRNLIATFSDASGNDMLHLAGMLSPTEKLDLISGAALQ  436

Query  626   MQRELQWFKEVQK-IALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
             MQRE QWFKEV+  + LP      ++ G  P   FT+NH  LK EGEKWMKD ATSCT+ 
Sbjct  437   MQRERQWFKEVKSLVVLPSGVGAFNKQGMRPHELFTQNHNKLKEEGEKWMKDAATSCTVV  496

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
              AL +T++FAAA TVPGGN+   G P+F     F VF +S+A SLF++ TS+L+FL +LT
Sbjct  497   GALTITIMFAAAFTVPGGNNGGTGFPLFLDEKMFLVFIVSDAISLFSSTTSVLMFLGILT  556

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLP  1162
             SRYAE DFL +LP ++IIGL TL  SI  MM AF S ++L+    K WI I +  L+S+P
Sbjct  557   SRYAEDDFLKSLPTKMIIGLSTLLISIASMMVAFCSALFLML-HEKLWIVIPIIFLSSVP  615

Query  1163  ITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +T F+ +QFP+LV +  STYG GIF ++
Sbjct  616   VTLFIWMQFPVLVEIFISTYGGGIFDKK  643



>ref|XP_010658753.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis 
vinifera]
Length=781

 Score =   233 bits (594),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 178/449 (40%), Positives = 256/449 (57%), Gaps = 39/449 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNM-GVPPLDAIVKYDCPIINTANFSFWKRSIYYCISK  181
             SKF D+AL+++ ++  +     L+M  + PL  + +      + +   FW+  IY C++ 
Sbjct  330   SKFLDIALDILEKYPSLA--VTLDMDSLIPLYVLGQTPSLFKSGSQLWFWQHWIYLCVTI  387

Query  182   NSASTQNFVS---------------------------------QLLLWKSIPKKILMHQQ  262
             N     ++V                                  +LL  KSI  + L H Q
Sbjct  388   NIDRASDWVRVNVVDDNTHSRDVRNNTETVLHQLMHGLVSYPLKLLGIKSIRAQKLRHAQ  447

Query  263   ATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDL  442
             A  LL+ +C EL+ +     +      A+++AV     E V  ++++ P + +  D ND 
Sbjct  448   AVKLLQGICTELRNIKPDRVLGYRVHQAVIQAVKKGNVEFVTRMIKSIPELVWNGDINDR  507

Query  443   NILHIAIENRCENIFNLIRG-TSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAA  619
             NI  IAI NR E IFNL+ G T+V    +    +  GN++++LAA LAP  +L+ +SGAA
Sbjct  508   NIFSIAILNRQEKIFNLLHGLTNVKKMKVTSADDRFGNNMLHLAAMLAPSDQLDGISGAA  567

Query  620   LQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCti  799
             LQMQRELQWFKEV+ I  P     ++  GK P   F++ H  L  EGEKWMK+ ATS + 
Sbjct  568   LQMQRELQWFKEVESIVPPICKDVLNSDGKKPSEVFSQQHANLVKEGEKWMKEIATSSSF  627

Query  800   aaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvl  979
              AALIVT++FAAA T+PGGN+D  G PIF     F VF IS++ SLF+A TS+L+FL +L
Sbjct  628   VAALIVTIMFAAAFTIPGGNND-KGAPIFLDDPLFMVFIISDSISLFSATTSVLMFLGIL  686

Query  980   tsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII-VPALAS  1156
             TS+YAE  FL  LP +LIIGL TLF  I  MM AF + + ++  ++ + + +I +  LA 
Sbjct  687   TSQYAENKFLTRLPTKLIIGLSTLFICIAAMMIAFCAALAILLKKSSTKVVMIPIILLAC  746

Query  1157  LPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             +P+T F LLQFPLLV +  STYGPGIF +
Sbjct  747   VPVTLFALLQFPLLVNIFISTYGPGIFDR  775



>ref|XP_006487673.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Citrus 
sinensis]
Length=322

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 145/329 (44%), Positives = 210/329 (64%), Gaps = 8/329 (2%)
 Frame = +2

Query  260   QATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHND  439
             QA ++++ +C  +   +  NQ   L   A  +A  L I++ V  I+ AY    Y  D N 
Sbjct  2     QAVEIVRIICKGVIWNDPQNQ--QLLKKAFFKAATLGISKFVQEIIAAYKGSVYWEDENK  59

Query  440   LNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAA  619
               I H+A+ +R   +FNLI  +S    N   + +   N+I++   KL P  +   V+GAA
Sbjct  60    HTIFHVAVLHRRAEVFNLIY-SSTFKSNWLGSNDNIRNNILHFGGKLVPSSE---VAGAA  115

Query  620   LQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCti  799
             LQMQR+L+WFK V+ +  P+    ++   +TP   FTE H+ L  EGEKWMK+TAT+C++
Sbjct  116   LQMQRKLEWFKAVENLVHPFLREAVNN-EQTPREVFTEEHKELVKEGEKWMKETATACSV  174

Query  800   aaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvl  979
              AA I+TV+FAAA TVPGGN D+ G+P F   ++F +FA+S+A SLF++  S+L+FL +L
Sbjct  175   VAAFIITVMFAAAFTVPGGN-DSRGIPNFLHESSFIIFAVSDALSLFSSIISVLMFLGIL  233

Query  980   tsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASL  1159
             TSRY+E+DFL +LP +LII LIT+FFSI  MM +F +TIYLV      W+ I +  +  +
Sbjct  234   TSRYSEEDFLLSLPRKLIIDLITMFFSIASMMVSFGATIYLVLFSTWKWVFIPITLVGCV  293

Query  1160  PITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             P+T F LLQFPLL  + SSTYG GIF ++
Sbjct  294   PVTLFALLQFPLLFDMYSSTYGRGIFGRK  322



>ref|XP_008231968.1| PREDICTED: uncharacterized protein LOC103331138 [Prunus mume]
Length=331

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 210/332 (63%), Gaps = 10/332 (3%)
 Frame = +2

Query  260   QATDLLKCLCDELK--TLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             Q+ +LL  +C+ +K    NDY         A+ RA+   + E   S+++A P + +  + 
Sbjct  2     QSLELLHHMCEWIKHSRSNDY------VRKAIFRAIEKGMFEFTDSLLQARPDLMWIQNQ  55

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGN-GNDIMNLAAKLAPQHKLNLVS  610
                +    AIE R E I++LI   +     L  T   N GN  +++   L+P  KL+ +S
Sbjct  56    MGRDPFQFAIECRQEKIYSLIYRLNKRKRTLIGTFGDNYGNCSLHMTGMLSPLAKLDNIS  115

Query  611   GAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATS  790
             GAALQMQRELQWFKEV+ I LP      +  G TP   FT+NH+ L  EGE+WMK TA+S
Sbjct  116   GAALQMQRELQWFKEVETIVLPRTKDSTNNDGMTPCKLFTKNHKELVKEGERWMKGTASS  175

Query  791   CtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfl  970
             CT+  ALI+T++FAAA T+PGGN+   G PIF     F  F +S+A SLF++ TS+L+FL
Sbjct  176   CTVVGALIITIMFAAAFTIPGGNNGETGFPIFLHKKLFMAFIVSDAISLFSSTTSVLMFL  235

Query  971   svltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPAL  1150
              +LTSRYAE DFL +LP ++IIGL TLFFSI  MM AFSS ++++    +SWI I +  L
Sbjct  236   GILTSRYAEDDFLKSLPTKMIIGLSTLFFSIAAMMVAFSSALFIMV-HEQSWIVIPMIFL  294

Query  1151  ASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             AS+P+T F+ +QFPLLV +  STYG GIF ++
Sbjct  295   ASIPVTLFIWMQFPLLVEMYISTYGGGIFDRK  326



>ref|XP_002509751.1| protein binding protein, putative [Ricinus communis]
 gb|EEF51138.1| protein binding protein, putative [Ricinus communis]
Length=325

 Score =   222 bits (565),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 202/303 (67%), Gaps = 5/303 (2%)
 Frame = +2

Query  344   ALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHN  523
             A   A+   + EVV+ +++A  T+    D N   IL +A+ +R E +F+L+       + 
Sbjct  21    AFFTAIRRGVIEVVVEMIKANSTLLTVVDRNLRGILMLAVAHRQEKVFSLVYVLDTYKYM  80

Query  524   LQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEY  703
             L   I+ + N+++++AA LAP  +L+ +SGAALQMQRELQW+KEV+ I  P     ++ +
Sbjct  81    LISGIDKDKNNLLHIAANLAPSRRLDRISGAALQMQRELQWYKEVESIVSPLSKEHLNRF  140

Query  704   GKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPI  883
              + P   F+E+H  L  +GEKWMK+TATSC++  ALI+T++F AA TVPGGN   +G P+
Sbjct  141   DQRPGDIFSESHLKLVADGEKWMKETATSCSVVGALIITIMFTAAFTVPGGNDQESGFPL  200

Query  884   FSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSI  1063
             F     F +F IS+A SLF ++TS+L FL VLTSRYAE+DFL +LP +LII L TLF SI
Sbjct  201   FLHKKTFIIFIISDAISLFASSTSVLTFLGVLTSRYAEEDFLKSLPTKLIIALSTLFVSI  260

Query  1064  ILMMTAFSSTIYLVFGQNKSWIRIIVP--ALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
               MM AF ST+ ++    +  + +I+P   LAS+P+T FVL QFPLLV + +STYGPGIF
Sbjct  261   AAMMVAFCSTLIIML---RGQLNLIMPLVLLASIPVTLFVLQQFPLLVDIFASTYGPGIF  317

Query  1238  SQR  1246
              ++
Sbjct  318   DRK  320



>ref|XP_007216069.1| hypothetical protein PRUPE_ppa017939mg [Prunus persica]
 gb|EMJ17268.1| hypothetical protein PRUPE_ppa017939mg [Prunus persica]
Length=345

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 150/336 (45%), Positives = 211/336 (63%), Gaps = 4/336 (1%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H++ +++L  +C+ +K  +      S+   A   A+     E +  I  A P     +  
Sbjct  5     HERTSEILHSMCEVIKDKSSKQLQGSVVEAAFFEAIKQGHVEFIREIFRANPPAFGLTGE  64

Query  434   NDLNILHIAIENRCENI-FNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVS  610
             N  ++L  AIE R E + F L + T +  H L  T +   N +++ AA L+P  +LN + 
Sbjct  65    NGKSMLQFAIECRQEKVYFFLYKFTGIAPHLLTRT-DQFSNTLLHAAASLSPIAQLNQIQ  123

Query  611   GAALQMQRELQWFKEVQKIALPYFSSCMD-EYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             GAALQMQRELQWFKE++ I  P     ++   G T    FT+NH+ L  EGE+ MK+ AT
Sbjct  124   GAALQMQRELQWFKEIENIVPPKILEVVNITDGMTARDLFTKNHKELAKEGERSMKEIAT  183

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             SCT+  ALI+T++F AA TVPGGN+   G+P+F +   F VF +S+A SLF++ TS++ F
Sbjct  184   SCTVVGALIITIMFTAAFTVPGGNNGNTGMPLFLNEKLFKVFIVSDALSLFSSTTSVMTF  243

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
             L VLTSRYAE DFL +LP ++IIGL TLFFSI  MM AF ST++++ G+N SWI I V  
Sbjct  244   LGVLTSRYAEADFLKSLPTKMIIGLFTLFFSIATMMVAFVSTLFIMLGEN-SWIVIPVIL  302

Query  1148  LASLPITSFVLLQFPLLVALVSSTYGPGIFSQRGIP  1255
             LAS P+ SF  +QFPLLV +  STYG GIF+++G P
Sbjct  303   LASAPVVSFAWMQFPLLVEIFISTYGAGIFAKKGKP  338



>ref|XP_010465977.1| PREDICTED: uncharacterized protein LOC104746241 [Camelina sativa]
Length=658

 Score =   230 bits (586),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 158/409 (39%), Positives = 230/409 (56%), Gaps = 27/409 (7%)
 Frame = +2

Query  98    AIVKYDCPIINTANFSFWKRSIYYCISKNSASTQNFV----------------SQLLLWK  229
             A+ +  C   +    +FW+R IY+CI     +  + V                 Q  LWK
Sbjct  236   ALAQTPCAFPSGTRLAFWQRWIYHCIHIEKVNNPHEVLNHHDHQYRKAEDHSWIQDKLWK  295

Query  230   ----------SIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAE  379
                        + K  L H QA ++L+C+C E+   +   Q  S    AL +AV   I E
Sbjct  296   YLKVLFPHIRRVYKLKLGHAQAKEILECICQEIPNFDMTQQKNSGLHQALFKAVENGIVE  355

Query  380   VVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDI  559
              +  ++  YP + +  D   LN+   A+  R E IF+LI       + L    +   N++
Sbjct  356   YIEEVMRHYPDIVWLKDSYGLNLFFYAVSQRQEKIFSLIYNMGAKKNILATAWDKLHNNM  415

Query  560   MNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMD-EYGKTPEMHFTEN  736
             ++ AA  AP  +LNL+ GAALQMQRELQWFKEV+++  P     ++ +  KTP+  FT+ 
Sbjct  416   LHHAAYRAPASRLNLIPGAALQMQRELQWFKEVERLVQPKHRKMVNLKQKKTPKALFTDQ  475

Query  737   HRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFA  916
             H+ L   GEKWMKDTATSCT+ AALI T++F++A TVPGG    NGLP++   + F +F 
Sbjct  476   HKDLVELGEKWMKDTATSCTVVAALITTMMFSSAFTVPGGYRSDNGLPLYMRKHIFKIFI  535

Query  917   ISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTI  1096
             IS+A SLFT+  SLL+FL +L SRY E+DFL +LP +LI+GL++LF S+  MM  F  T+
Sbjct  536   ISDAISLFTSCMSLLMFLGILKSRYREEDFLRSLPTKLIVGLLSLFLSMATMMVTFVVTL  595

Query  1097  YLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
               + G   SW+      LA +P+  FV+LQFP+L+ +  STY P +F +
Sbjct  596   MTLVGNKFSWVSAQFMLLAVIPLGMFVVLQFPVLLEIFCSTYFPRVFEK  644



>ref|XP_011032835.1| PREDICTED: uncharacterized protein LOC105131525 isoform X2 [Populus 
euphratica]
Length=638

 Score =   229 bits (584),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 146/338 (43%), Positives = 218/338 (64%), Gaps = 7/338 (2%)
 Frame = +2

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMA  418
             KKI  H  +  +L+C+C+ + +L+   Q+ +    A   AV     E ++ +++A P + 
Sbjct  301   KKI--HIYSDKILRCMCEHISSLDYEEQLKAAVHPAFHSAVKNGTVEFIMEMIKACPHVM  358

Query  419   YCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
              C+D N   +   +I NR E + +L  G           I+ +GN +++LAAKL+P  +L
Sbjct  359   ICTDDNSRTLFMSSIANRQEKVVSLFYGLEASRSGFVSLIDSSGNTMLHLAAKLSPPSQL  418

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
             + +SGAALQMQRELQW+KEV+ I  P      +  G+     FT +H+ L ++GE+WMK 
Sbjct  419   SRISGAALQMQRELQWYKEVESIINPTDKDFANVKGQIARELFTSDHKDLLVKGEEWMKA  478

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             TATSCT+  ALI+T++F AA TVPGG    +G PIF    +FTVF +S+A SLF+++TS+
Sbjct  479   TATSCTVVGALIITIMFTAAFTVPGGYVQESGYPIFKDKESFTVFIVSDAISLFSSSTSV  538

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             L+FL +LTSRYAE+DFL +LP +LIIGL TLFFSI  MM  F + + ++       ++II
Sbjct  539   LMFLGILTSRYAEEDFLKSLPTKLIIGLSTLFFSIATMMVTFCAALMIIVDGK---LQII  595

Query  1139  VPA--LASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +P   +A +P+T F++LQFPLLV +  STYGPGIF+++
Sbjct  596   IPIVLVACIPVTFFMMLQFPLLVEIFVSTYGPGIFNKK  633



>ref|XP_010242785.1| PREDICTED: uncharacterized protein LOC104587044 [Nelumbo nucifera]
Length=733

 Score =   231 bits (589),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 222/340 (65%), Gaps = 5/340 (1%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDE-LKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEA  403
             KS+ K  LMH QA +L++ L    L  + + ++V  L    L+ A    I E +   ++ 
Sbjct  394   KSVRKSKLMHLQARELVEHLFKNVLMAVKNDHKVEKLLGPPLIAATEFGIVEFLEMTLKY  453

Query  404   YPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGN--GNDIMNLAAK  577
             YP +    D N   ILH+A+ NR E IFN ++ T    H    T + +   N+I++LAAK
Sbjct  454   YPRLIEYPDANLRCILHVAVLNRQEMIFNHLKKTGR--HLALRTFDRDIYLNNILHLAAK  511

Query  578   LAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIE  757
             LAP  +LN VSGAALQ+QRELQWFK V+K+A P +    + +G  P++ F+E H+ L   
Sbjct  512   LAPPQQLNCVSGAALQLQRELQWFKVVEKLAPPKYREWKNSHGLKPQLLFSEEHKDLVAN  571

Query  758   GEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaasl  937
             GE WMK+TATSCT+AAALI+T++FAAA TVPGG     G PIF +  +F VF IS+A +L
Sbjct  572   GEVWMKETATSCTVAAALIITIMFAAAFTVPGGIQSDTGNPIFVTSKSFMVFVISDAFAL  631

Query  938   ftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQN  1117
             F+++TS+L+FLS+LTSRYAE DFL +LP +LIIGL  LFFSI  MMT F STI+++    
Sbjct  632   FSSSTSMLMFLSILTSRYAEDDFLKSLPQKLIIGLAMLFFSIAAMMTTFCSTIFIMLCSR  691

Query  1118  KSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
                I I++ +LA +P+T F  LQFPL + +V  TYG GIF
Sbjct  692   LRLISIVLTSLAVVPVTLFAFLQFPLFIDMVFYTYGSGIF  731



>ref|XP_002311032.2| hypothetical protein POPTR_0008s02420g [Populus trichocarpa]
 gb|EEE88399.2| hypothetical protein POPTR_0008s02420g [Populus trichocarpa]
Length=555

 Score =   226 bits (577),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 146/338 (43%), Positives = 217/338 (64%), Gaps = 7/338 (2%)
 Frame = +2

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMA  418
             KKI  H  +  +L+C+C+ + +L+   Q+ +    A   AV     E ++ +++A P + 
Sbjct  218   KKI--HIYSDKILRCMCEHISSLDYEEQLKASVHPAFHSAVKNGTLEFIMEMIKACPHVM  275

Query  419   YCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
              C+D N   +   +I NR E + +L  G           I+ +GN +++LAAKL+P  +L
Sbjct  276   ICTDDNSRTLFMSSIANRQEKVVSLFYGLEATRSGFVSLIDSSGNTMLHLAAKLSPPSQL  335

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
             + +SGAALQMQRELQW+KEV+ I  P      +  G+     FT +H  L ++GE+WMK 
Sbjct  336   SRISGAALQMQRELQWYKEVESIINPTDKDFANVKGQIARELFTSDHADLLLKGEEWMKA  395

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             TATSCT+  ALI+T++F AA TVPGG    +G PIF    +FTVF +S+A SLF+++TS+
Sbjct  396   TATSCTVVGALIITIMFTAAFTVPGGYVQESGYPIFKDKESFTVFIVSDAISLFSSSTSV  455

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             L+FL +LTSRYAE+DFL +LP +LIIGL TLFFSI  MM  F + + ++       ++II
Sbjct  456   LMFLGILTSRYAEEDFLKSLPTKLIIGLSTLFFSIATMMVTFCAALMIIVDGK---LQII  512

Query  1139  VPA--LASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +P   +A +P+T F++LQFPLLV +  STYGPGIF+++
Sbjct  513   IPIVLVACIPVTFFMMLQFPLLVEIFVSTYGPGIFNKK  550



>ref|XP_002517233.1| ankyrin repeat-containing protein, putative [Ricinus communis]
 gb|EEF45133.1| ankyrin repeat-containing protein, putative [Ricinus communis]
Length=580

 Score =   227 bits (578),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 148/332 (45%), Positives = 204/332 (61%), Gaps = 1/332 (0%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             L H QA +LL CLC E+ TL+           A+ +AV     E V  + + YP + +C 
Sbjct  243   LTHVQAHELLCCLCQEISTLHKSEFENIGVYRAIFKAVKHGTVEFVEEMTKHYPDIIWCE  302

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             D  +  I   A+  R E +FNLI       +++  + +   N+I++ AA   P  +L+ V
Sbjct  303   DECNRGIFMYAVLQRQEKVFNLIYKMGAKKNSIATSWDKYFNNILHQAASPPPSSQLDRV  362

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGAALQMQRELQW+KEV+ I  P +   ++   KTP   FTE+H+ L  EGEKWMKDTAT
Sbjct  363   SGAALQMQRELQWYKEVESIVQPKYKEMVNFQRKTPRALFTESHKKLVEEGEKWMKDTAT  422

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             S T+ AALI T++F+A  TVPGG  D  G P++     F VF +++A SLF + +S+L+F
Sbjct  423   SSTVVAALIATIMFSAIFTVPGG-YDQYGKPLYLYEGVFMVFMVADAMSLFASTSSILMF  481

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
             L +LT+RY E+DFL +LP +LI+GL TLFFSI  MM  F   ++    +  SW+   +  
Sbjct  482   LGILTARYREEDFLKSLPTKLIVGLSTLFFSIATMMITFGVALFTFLRERVSWVLFPIIL  541

Query  1148  LASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             LASLP+T F LLQFPLLV +  STYG GIF +
Sbjct  542   LASLPVTLFALLQFPLLVEIFFSTYGLGIFEK  573



>ref|XP_011032834.1| PREDICTED: uncharacterized protein LOC105131525 isoform X1 [Populus 
euphratica]
Length=711

 Score =   229 bits (584),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 146/338 (43%), Positives = 218/338 (64%), Gaps = 7/338 (2%)
 Frame = +2

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMA  418
             KKI  H  +  +L+C+C+ + +L+   Q+ +    A   AV     E ++ +++A P + 
Sbjct  374   KKI--HIYSDKILRCMCEHISSLDYEEQLKAAVHPAFHSAVKNGTVEFIMEMIKACPHVM  431

Query  419   YCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKL  598
              C+D N   +   +I NR E + +L  G           I+ +GN +++LAAKL+P  +L
Sbjct  432   ICTDDNSRTLFMSSIANRQEKVVSLFYGLEASRSGFVSLIDSSGNTMLHLAAKLSPPSQL  491

Query  599   NLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKD  778
             + +SGAALQMQRELQW+KEV+ I  P      +  G+     FT +H+ L ++GE+WMK 
Sbjct  492   SRISGAALQMQRELQWYKEVESIINPTDKDFANVKGQIARELFTSDHKDLLVKGEEWMKA  551

Query  779   TATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsl  958
             TATSCT+  ALI+T++F AA TVPGG    +G PIF    +FTVF +S+A SLF+++TS+
Sbjct  552   TATSCTVVGALIITIMFTAAFTVPGGYVQESGYPIFKDKESFTVFIVSDAISLFSSSTSV  611

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             L+FL +LTSRYAE+DFL +LP +LIIGL TLFFSI  MM  F + + ++       ++II
Sbjct  612   LMFLGILTSRYAEEDFLKSLPTKLIIGLSTLFFSIATMMVTFCAALMIIVDGK---LQII  668

Query  1139  VPA--LASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +P   +A +P+T F++LQFPLLV +  STYGPGIF+++
Sbjct  669   IPIVLVACIPVTFFMMLQFPLLVEIFVSTYGPGIFNKK  706



>ref|XP_009614681.1| PREDICTED: uncharacterized protein LOC104107554 isoform X1 [Nicotiana 
tomentosiformis]
Length=712

 Score =   229 bits (584),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 167/402 (42%), Positives = 232/402 (58%), Gaps = 18/402 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISK-  181
             S  YD A+ LV    D+  + +   G  PL  +       + T+  S  K   Y   S  
Sbjct  293   SDLYDFAMHLVKCFPDLAKYTS--NGSSPLALLATKTSAFVGTSRVSSQKPLSYIVTSAT  350

Query  182   --------NSASTQNFVSQLLLWKSIPKK---ILMHQQATDLLKCLCDELKTLNDYNQVF  328
                     N+++ +N V++ LL K  PK     L +Q A  L + LC++LK L++  ++ 
Sbjct  351   SWIFQERANASNIENAVNEALLDK--PKTNSPELEYQNAIKLAEFLCEKLKGLSE-KEII  407

Query  329   SLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS  508
             S+    LL+AVH D  ++V   V  +P + Y S+ N  NILHIA+ENRC N+FNL+   S
Sbjct  408   SIVGGPLLQAVHFDNYKLVEIFVGKFPLLVYHSNKNGKNILHIAVENRCTNVFNLVCQMS  467

Query  509   VLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSS  688
                HNL  +++   N +++LA KL P++K+N   GAAL+MQ EL+WF+ V+++  P +  
Sbjct  468   QHRHNLITSVDSFNNTMLHLAGKLPPKNKVNHTFGAALRMQEELRWFEVVKEMLPPPYFE  527

Query  689   CMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDA  868
              ++  GKT    FT  H  LKIEGEKWMK+TA+SC I A L V + F A ITVPGG +  
Sbjct  528   RLNNKGKTAHQVFTVQHANLKIEGEKWMKETASSCAIIAMLTVAIAFGATITVPGGRNCE  587

Query  869   NGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLIT  1048
             NGLPIFS +  F+ FA SN  SL TA  SL  F+S+LTS YAE+DFL  LP RL+ GL+T
Sbjct  588   NGLPIFSRNGFFSAFAFSNTVSLSTACISLFAFVSILTSSYAEEDFLRVLPKRLLWGLLT  647

Query  1049  LFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSF  1174
             L+ SI  MM +F   +Y VF  N   +  +   LA LPI  F
Sbjct  648   LYASIEAMMLSFGCALYFVFKDN-YMVFYVGFVLAVLPILPF  688



>ref|XP_009614682.1| PREDICTED: uncharacterized protein LOC104107554 isoform X2 [Nicotiana 
tomentosiformis]
Length=711

 Score =   229 bits (583),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 167/402 (42%), Positives = 232/402 (58%), Gaps = 18/402 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISK-  181
             S  YD A+ LV    D+  + +   G  PL  +       + T+  S  K   Y   S  
Sbjct  292   SDLYDFAMHLVKCFPDLAKYTS--NGSSPLALLATKTSAFVGTSRVSSQKPLSYIVTSAT  349

Query  182   --------NSASTQNFVSQLLLWKSIPKK---ILMHQQATDLLKCLCDELKTLNDYNQVF  328
                     N+++ +N V++ LL K  PK     L +Q A  L + LC++LK L++  ++ 
Sbjct  350   SWIFQERANASNIENAVNEALLDK--PKTNSPELEYQNAIKLAEFLCEKLKGLSE-KEII  406

Query  329   SLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS  508
             S+    LL+AVH D  ++V   V  +P + Y S+ N  NILHIA+ENRC N+FNL+   S
Sbjct  407   SIVGGPLLQAVHFDNYKLVEIFVGKFPLLVYHSNKNGKNILHIAVENRCTNVFNLVCQMS  466

Query  509   VLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSS  688
                HNL  +++   N +++LA KL P++K+N   GAAL+MQ EL+WF+ V+++  P +  
Sbjct  467   QHRHNLITSVDSFNNTMLHLAGKLPPKNKVNHTFGAALRMQEELRWFEVVKEMLPPPYFE  526

Query  689   CMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDA  868
              ++  GKT    FT  H  LKIEGEKWMK+TA+SC I A L V + F A ITVPGG +  
Sbjct  527   RLNNKGKTAHQVFTVQHANLKIEGEKWMKETASSCAIIAMLTVAIAFGATITVPGGRNCE  586

Query  869   NGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLIT  1048
             NGLPIFS +  F+ FA SN  SL TA  SL  F+S+LTS YAE+DFL  LP RL+ GL+T
Sbjct  587   NGLPIFSRNGFFSAFAFSNTVSLSTACISLFAFVSILTSSYAEEDFLRVLPKRLLWGLLT  646

Query  1049  LFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSF  1174
             L+ SI  MM +F   +Y VF  N   +  +   LA LPI  F
Sbjct  647   LYASIEAMMLSFGCALYFVFKDN-YMVFYVGFVLAVLPILPF  687



>ref|XP_010487790.1| PREDICTED: uncharacterized protein LOC104765727 [Camelina sativa]
Length=658

 Score =   228 bits (581),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 162/440 (37%), Positives = 245/440 (56%), Gaps = 32/440 (7%)
 Frame = +2

Query  11    FYDMALELVGQHHDV--THHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
              Y +AL+L+ ++  +  T  +  + G+    A+ +  C   +    +FW++ IY+CI   
Sbjct  208   LYGIALDLIQRYPKLAYTRDSDNDTGII---ALAQTPCAFPSGTRLAFWQKWIYHCIHIE  264

Query  185   SASTQNFV----------------SQLLLWKSIP----------KKILMHQQATDLLKCL  286
               +  + V                 Q  LWK +           K  L H QA ++L+C+
Sbjct  265   KVNNPHEVLNHHDHQYRKAEDHSWIQDKLWKHLKVLFPHIRRVYKLKLGHAQAKEILECI  324

Query  287   CDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIE  466
             C E+   +   Q  +    AL +AV   I E +  ++  YP + +  D   LN+   A+ 
Sbjct  325   CQEIPNFDVTQQKNTGLHQALFKAVENGIVEYIEEVMRHYPDIVWLKDSYGLNLFFYAVS  384

Query  467   NRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQW  646
              R E IF+LI       + L    +   N++++ AA  AP  +LNL+ GAALQMQRELQW
Sbjct  385   QRQEKIFSLIYNMGAKKNILATAWDKLHNNMLHHAAYRAPASRLNLIPGAALQMQRELQW  444

Query  647   FKEVQKIALPYFSSCMD-EYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtv  823
             FKEV+++  P     ++ +  KTP+  FT+ H+ L   GEKWMKDTATSCT+ AALI T+
Sbjct  445   FKEVERLVQPKHRKMVNLKQKKTPKALFTDQHKDLVELGEKWMKDTATSCTVVAALITTM  504

Query  824   vfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQD  1003
             +F++A TVPGG    NGLP++   + F +F IS+A SLFT+  SLL+FL +L SRY E+D
Sbjct  505   MFSSAFTVPGGYRSDNGLPLYMRKHIFKIFIISDAISLFTSCMSLLMFLGILKSRYREED  564

Query  1004  FLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLL  1183
             FL +LP +LI+GL++LF S+  MM  F  T+  + G   SW+      LA +P+  FV+L
Sbjct  565   FLRSLPTKLIVGLLSLFLSMATMMVTFVVTLMTLVGAKFSWVSAQFMLLAVIPLGMFVVL  624

Query  1184  QFPLLVALVSSTYGPGIFSQ  1243
             QFP+L+ +  STY P +F +
Sbjct  625   QFPVLLEIFCSTYFPRVFEK  644



>ref|XP_008231973.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=313

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 199/308 (65%), Gaps = 5/308 (2%)
 Frame = +2

Query  329   SLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS  508
              L  +A+ +AV     E V+ + +  P + + ++    NI   +IE R E +++LI G  
Sbjct  4     GLVYEAIFQAVRSGTIEFVIRLCKVDPDILWRTNSMRRNIFQYSIERRQEKVYSLIYG--  61

Query  509   VLVHNLQDTI-NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQK-IALPYF  682
             V   NL  T  + +GND+++L   L+P  KL+ + GAALQMQRE QWFKEV+  + LP  
Sbjct  62    VGQRNLIATFADASGNDMLHLTGMLSPTEKLDRILGAALQMQRERQWFKEVKSLVVLPSG  121

Query  683   SSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNS  862
                 ++ G  P   FT+NH  LK EGEKWMKDTATSCT+  AL +T++FAAA TVPGGN+
Sbjct  122   VGAYNKQGMRPHELFTQNHNKLKEEGEKWMKDTATSCTVVGALTITIMFAAAFTVPGGNN  181

Query  863   DANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGL  1042
                G P+F     FTVF +S+A SLF++ TS+L+FL +LTSRYAE DFL +LP ++IIGL
Sbjct  182   GGTGFPLFLDEKMFTVFIVSDAISLFSSTTSVLMFLGILTSRYAEDDFLKSLPTKMIIGL  241

Query  1043  ITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
              TL  SI  MM AF S ++L+    + WI I +  LA +P+T F+ +QFPLLV +  STY
Sbjct  242   STLLISIASMMVAFCSALFLML-HERLWIVIPIIFLARVPVTLFIWMQFPLLVEIFISTY  300

Query  1223  GPGIFSQR  1246
             G GIF ++
Sbjct  301   GGGIFDKK  308



>gb|KDO48313.1| hypothetical protein CISIN_1g0069422mg, partial [Citrus sinensis]
Length=355

 Score =   220 bits (560),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 215/338 (64%), Gaps = 11/338 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I  + L H +  ++++ +C+ +   N  N   +  S A+L A  L I EVV   + AY
Sbjct  8     KGIHDQKLTHMRTVEIVRIICEGVVWTNFQNS--AQLSVAMLAAAILGIPEVVNEFIMAY  65

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
              + +  S+ +   I   A+  R E +FNLI+G +     L  + +  GN+I++LA +L P
Sbjct  66    DSSSNWSNQDGHTIFDHAVLYRREKVFNLIQGVNFTTF-LFSSRDKAGNNILHLAGRLVP  124

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +   V+GAALQMQRELQWFK ++ +  P+F    ++  +TP   FTE H+ L  EGEK
Sbjct  125   SSE---VAGAALQMQRELQWFKAIENLVHPFFREATNDLKQTPREVFTEEHKELVKEGEK  181

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             W+K+TA+SC++ AALI+TVVFAA  T PGG SD  G+P F    +F +FAIS+  +LF++
Sbjct  182   WLKETASSCSVVAALIITVVFAAVFTAPGG-SDGRGMPNFLHDQSFMIFAISDMLALFSS  240

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
              TS+L+FL +LTSRYAE+DFL +LP +LIIGLITLFFSI  MM AF +T+++       W
Sbjct  241   ITSVLMFLGILTSRYAEEDFLVSLPKKLIIGLITLFFSIASMMVAFGATVHISLSHK--W  298

Query  1127  IRIIVPA--LASLPITSFVLLQFPLLVALVSSTYGPGI  1234
               +I+P   +  +PIT F LLQFPLL+ + SSTYG  I
Sbjct  299   NSVIIPIALVGCVPITLFALLQFPLLLDMYSSTYGRSI  336



>gb|KDP30536.1| hypothetical protein JCGZ_15245 [Jatropha curcas]
Length=722

 Score =   228 bits (582),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 160/408 (39%), Positives = 237/408 (58%), Gaps = 18/408 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             S  +D+ALEL+  H ++      N G   L  + +      + A    W+R +Y      
Sbjct  318   SNLFDVALELIKNHPELALARDGN-GETALHVLSRKPTAFYSGAQLGLWQRCLYSS----  372

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND--YNQVFSLASDALLRA  358
                      Q+ L  +I    L H QA +L++ L  ++  L+D    +     +  L  A
Sbjct  373   --------PQIDLIYNIK---LRHIQALELVRELWQQVMHLDDPSITEFIRTPTRLLFTA  421

Query  359   VHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI  538
                 I E +  ++ ++P + +  D +  +I H A+ +R EN+FNLI     L   +    
Sbjct  422   AEFGILEFITILIRSHPDLIWKVDEHSRSIFHTAVFHRQENVFNLIYELGALKDFIAVYK  481

Query  539   NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPE  718
             + + N++++LA KL    +LN  SGAALQ++REL WF+EV+KI  P +S   +  G+TP+
Sbjct  482   DESNNNMLHLAGKLPDPSRLNTDSGAALQLRRELLWFQEVEKIVQPLYSEMKNSEGQTPD  541

Query  719   MHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHN  898
               FT  H+ LK EGEKWMKDT++SC + A LI TV+FAA  TVPGGN +  G PIF    
Sbjct  542   CLFTMEHKTLKREGEKWMKDTSSSCMVVATLIATVMFAAVFTVPGGNDEKTGRPIFLQTR  601

Query  899   AFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMT  1078
              F VF IS+A +LF++A+S+L+FLS+LTSRYAE+DFL +LPN+LI+GL TLF SI  MM 
Sbjct  602   LFLVFVISDAVALFSSASSILIFLSILTSRYAEEDFLQSLPNKLIMGLATLFVSITSMMI  661

Query  1079  AFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
             AF++TI+++     +W  I V  +A +P+  FV LQFPL+  +V  TY
Sbjct  662   AFTATIFIILSHGLAWTTIPVVIVACIPVYLFVSLQFPLVADIVCHTY  709



>ref|XP_007221403.1| hypothetical protein PRUPE_ppa022028mg, partial [Prunus persica]
 gb|EMJ22602.1| hypothetical protein PRUPE_ppa022028mg, partial [Prunus persica]
Length=333

 Score =   219 bits (557),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 147/335 (44%), Positives = 218/335 (65%), Gaps = 12/335 (4%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H Q+ +LL  +C+ +K  +   Q +     A+ R+++  + E   S+++A P + + ++ 
Sbjct  2     HIQSLELLHHMCEVIK--HSPGQYY--IRRAIFRSINRGMFEFTDSVLQARPDIMWINNE  57

Query  434   NDLNILHIAIENRCENIFNLI----RGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLN  601
                 +   AIE R E I++LI    +    ++ N  D    + N  +++A  L+P  KL+
Sbjct  58    IGRTLFQFAIECRQEKIYSLIYKLDKRKRTVIGNFADR---SKNCALHVAGILSPLAKLD  114

Query  602   LVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDT  781
              +SGAALQMQRE+QWFKEV+ IALP     ++    TP   FT++H+ L  EGE+WMK++
Sbjct  115   NISGAALQMQREVQWFKEVETIALPRIKESINNDSMTPRELFTKSHKELVKEGERWMKES  174

Query  782   ATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsll  961
             ATSCT+  ALI+T++FAAA TVPGGN++  G PIF   N F  F +S+A SLF++ TS+L
Sbjct  175   ATSCTVVGALIITIMFAAAFTVPGGNNEETGFPIFLHKNLFMAFIVSDAVSLFSSTTSVL  234

Query  962   vflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIV  1141
             +FL +LTSRYAE DFL +LP ++IIGL TLF SI  MM AFSS ++++    +SWI I +
Sbjct  235   MFLGILTSRYAEDDFLKSLPTKMIIGLSTLFISIATMMVAFSSALFIMI-HEQSWIVIPM  293

Query  1142  PALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
               LAS+P+T F+ +QFPLLV +  STYG GIF ++
Sbjct  294   IFLASVPVTLFIWMQFPLLVEMYISTYGGGIFDKK  328



>ref|XP_009359765.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like, 
partial [Pyrus x bretschneideri]
Length=613

 Score =   226 bits (576),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 214/338 (63%), Gaps = 4/338 (1%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDEL-KTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYC  424
             L H  A +L+K +C +L +    +   + L SD +  A    I E++  +VE++P + + 
Sbjct  276   LRHHCAVELVKRICSQLSRRHTSWRSNYLLNSDIIYIATVNGIVEIISMLVESFPDLIWV  335

Query  425   SDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNL  604
                     L++AIE R E++   +   +     +   +  +G  I++LAAKLAP  +L+ 
Sbjct  336   RHRKQYWFLNLAIELRHEHLLRTVYDKTARCKLIAAKLLESGGSILHLAAKLAPLPQLSS  395

Query  605   VSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTA  784
             +SGAALQMQRELQWFKEV+K+  PY+    ++ G++    FT+ H+LL   GEKW+KDT+
Sbjct  396   ISGAALQMQRELQWFKEVEKLVHPYYKESPNDNGESARELFTKEHKLLAESGEKWLKDTS  455

Query  785   TSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNA--FTVFAISNaaslftaatsl  958
              SC + + L+ TVVFAAA TVPGGN D  G P+F    +  F VF +S+  +LF++ TSL
Sbjct  456   NSCMLVSTLVATVVFAAAFTVPGGN-DNEGAPMFLQKKSVIFLVFVVSDTLALFSSVTSL  514

Query  959   lvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII  1138
             L+FLS+LT RYAE+DFL +LP RLIIGL TLFF+I  MM AF +T+ +   +  +W+ + 
Sbjct  515   LMFLSILTERYAEKDFLESLPKRLIIGLATLFFAIAAMMVAFGATLSIALSKRFNWVSVP  574

Query  1139  VPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRGI  1252
             +  LAS+P T F LLQ PL++ +V ST+GP IF  + +
Sbjct  575   ITLLASIPATLFALLQLPLIIQMVRSTFGPSIFRPKKL  612



>ref|XP_008342267.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Malus 
domestica]
Length=369

 Score =   220 bits (560),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 157/364 (43%), Positives = 219/364 (60%), Gaps = 12/364 (3%)
 Frame = +2

Query  173   ISKNSASTQNFVS---QLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQV-FSLAS  340
             +S +    +  VS   ++L  K I +  ++H  +   LK +C+E+    D  Q+ +    
Sbjct  5     VSHSEKQKEGLVSKIVEILGIKRIYEMKIVHVGSLAFLKLICEEINKDFDMQQMSYPFVR  64

Query  341   DALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSV--L  514
              A+  AV     E V  + +A P +    D     + H+AIE R E I+NLI G S    
Sbjct  65    SAIFLAVRRGNVEFVTHMCKANPELLMFGDDRSRGLFHVAIECRQEKIYNLIYGISTKDT  124

Query  515   VHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCM  694
             + NL D  N   N+++++A  L+P  + N + GAALQMQRELQW+KEV+ I  P F  CM
Sbjct  125   ITNLADEHN---NNMLHIAGLLSPSAQRNHIPGAALQMQRELQWYKEVETIVPPKFLECM  181

Query  695   D-EYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDAN  871
             +      P   FT+NH  L  EGEKWMK+TATS T+  ALI+T++FAA IT+PGGN D  
Sbjct  182   NFNENLKPRELFTKNHSELLKEGEKWMKETATSYTVVGALIITIMFAAVITIPGGNGD-T  240

Query  872   GLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITL  1051
             G P F     F +F IS+A SLF++ T+ L FL +LTSR+AE DFL +LP ++IIGL TL
Sbjct  241   GFPTFIDEKLFMLFIISDAISLFSSTTATLTFLGILTSRFAEDDFLKSLPTKMIIGLATL  300

Query  1052  FFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPG  1231
             FF+I  MM AFS+ + L+  +  SWI I    L+S+P+T F  +QFPLLV +  STYG G
Sbjct  301   FFAIATMMVAFSAAL-LIIVRGHSWIVIPTILLSSVPVTLFAGMQFPLLVRITVSTYGKG  359

Query  1232  IFSQ  1243
             IF++
Sbjct  360   IFNR  363



>ref|XP_009614683.1| PREDICTED: uncharacterized protein LOC104107554 isoform X3 [Nicotiana 
tomentosiformis]
Length=710

 Score =   228 bits (580),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 166/400 (42%), Positives = 232/400 (58%), Gaps = 16/400 (4%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWK-------RSI  163
             S  YD A+ LV    D+  + +   G  PL  +       + T+  S  K        S 
Sbjct  293   SDLYDFAMHLVKCFPDLAKYTS--NGSSPLALLATKTSAFVGTSRVSSQKPLSLTSATSW  350

Query  164   YYCISKNSASTQNFVSQLLLWKSIPKK---ILMHQQATDLLKCLCDELKTLNDYNQVFSL  334
              +    N+++ +N V++ LL K  PK     L +Q A  L + LC++LK L++  ++ S+
Sbjct  351   IFQERANASNIENAVNEALLDK--PKTNSPELEYQNAIKLAEFLCEKLKGLSE-KEIISI  407

Query  335   ASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVL  514
                 LL+AVH D  ++V   V  +P + Y S+ N  NILHIA+ENRC N+FNL+   S  
Sbjct  408   VGGPLLQAVHFDNYKLVEIFVGKFPLLVYHSNKNGKNILHIAVENRCTNVFNLVCQMSQH  467

Query  515   VHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCM  694
              HNL  +++   N +++LA KL P++K+N   GAAL+MQ EL+WF+ V+++  P +   +
Sbjct  468   RHNLITSVDSFNNTMLHLAGKLPPKNKVNHTFGAALRMQEELRWFEVVKEMLPPPYFERL  527

Query  695   DEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANG  874
             +  GKT    FT  H  LKIEGEKWMK+TA+SC I A L V + F A ITVPGG +  NG
Sbjct  528   NNKGKTAHQVFTVQHANLKIEGEKWMKETASSCAIIAMLTVAIAFGATITVPGGRNCENG  587

Query  875   LPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLF  1054
             LPIFS +  F+ FA SN  SL TA  SL  F+S+LTS YAE+DFL  LP RL+ GL+TL+
Sbjct  588   LPIFSRNGFFSAFAFSNTVSLSTACISLFAFVSILTSSYAEEDFLRVLPKRLLWGLLTLY  647

Query  1055  FSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSF  1174
              SI  MM +F   +Y VF  N   +  +   LA LPI  F
Sbjct  648   ASIEAMMLSFGCALYFVFKDN-YMVFYVGFVLAVLPILPF  686



>ref|XP_006431547.1| hypothetical protein CICLE_v10003659mg, partial [Citrus clementina]
 gb|ESR44787.1| hypothetical protein CICLE_v10003659mg, partial [Citrus clementina]
Length=496

 Score =   222 bits (566),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 151/336 (45%), Positives = 218/336 (65%), Gaps = 7/336 (2%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I  + L H +  ++++ +C+ +   N   Q  +  S A+L A  L I EVV   + AY
Sbjct  151   KVIHDQKLTHMRTVEIVRIICEGVVWTN--FQKSAQLSGAMLSAAILGIPEVVNEFIMAY  208

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
              + +  S+ +   I   A+ +R E +FNLI+G +     L  + + +GN+I++LA +L P
Sbjct  209   DSCSNWSNQDGHTIFDHAVLHRREKVFNLIQGVNFTTF-LFSSRDKSGNNILHLAGRLVP  267

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +   V+GAALQMQRELQWFK V+ +  P+F    ++   TP   FT+ H+ L  EGEK
Sbjct  268   SSE---VAGAALQMQRELQWFKAVENLVHPFFREATNDLKNTPREVFTKEHKELVKEGEK  324

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WMK+TA+SC++ AALI+TVVFAAA TVPGG  D  G+P F    +F +FAIS+  +LF++
Sbjct  325   WMKETASSCSVVAALIITVVFAAAFTVPGG-IDGRGVPNFLYEQSFMIFAISDMLALFSS  383

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
              TS+L+FL +LTSRYAE+DFL +LP +LIIGLITLFFSI  MM AF +T+++      + 
Sbjct  384   ITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLITLFFSIASMMVAFGATVHISLSHKWNL  443

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGI  1234
             + I +  +  +P+T F LLQFPLL+ + SSTYGPGI
Sbjct  444   VIIPIALVGCVPVTLFALLQFPLLLDMYSSTYGPGI  479



>ref|XP_007221371.1| hypothetical protein PRUPE_ppa015563mg, partial [Prunus persica]
 gb|EMJ22570.1| hypothetical protein PRUPE_ppa015563mg, partial [Prunus persica]
Length=333

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 148/337 (44%), Positives = 215/337 (64%), Gaps = 16/337 (5%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H Q+ +LL  +C+ +K  +  + V      A+  A+   + E   S+++A P + + S+ 
Sbjct  2     HIQSLELLHRMCEMIKHSHSCDYVLG----AMFTAIERGMFEFADSVLQARPDIVWRSNK  57

Query  434   NDLNILHIAIENRCENIFNLI------RGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHK  595
                +    A+E R E I++LI      + TS+   NL D  N   N ++++A  L+P  K
Sbjct  58    MGRDPFMFAVECRQEKIYSLIYRFDNRKRTSI--GNLADMSN---NCVLHVAGMLSPLAK  112

Query  596   LNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMK  775
              + + GAALQMQRELQWFKEV+ I LP     M++   TP   FT++H+ L  EGE+WMK
Sbjct  113   FDNIPGAALQMQRELQWFKEVETIVLPRLKEHMNDNRMTPRQLFTKSHKQLVKEGERWMK  172

Query  776   DTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaats  955
             +TATSCT+   LI+T++FAAA TVPGGN+   G PIF   N F  F +S++ SLF++ TS
Sbjct  173   ETATSCTVVGTLIITIMFAAAFTVPGGNNGETGFPIFLHKNLFMAFIVSDSISLFSSTTS  232

Query  956   llvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRI  1135
             +L+FL +LTSRYAE DFL +LP ++IIGL TLF SI  +M AFSS ++++    +SWI I
Sbjct  233   VLMFLGILTSRYAEDDFLKSLPKKMIIGLSTLFISIATVMVAFSSALFIMI-HEQSWIVI  291

Query  1136  IVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              +  LAS+P+T F+ +QFPLLV +  STYG GIF ++
Sbjct  292   PMIFLASVPVTLFIGMQFPLLVEMYISTYGRGIFDRK  328



>ref|XP_010090147.1| Ankyrin repeat-containing protein [Morus notabilis]
 gb|EXB38944.1| Ankyrin repeat-containing protein [Morus notabilis]
Length=644

 Score =   225 bits (574),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 149/325 (46%), Positives = 206/325 (63%), Gaps = 2/325 (1%)
 Frame = +2

Query  254   HQQATDLLKCLCDEL-KTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSD  430
             H  A +L K  C ++ +T     + F        +A    IAE++  +    P + + S 
Sbjct  313   HHCAVELFKQACTKIHETHGSLTEYFRNRRLIQFQATTFGIAEILKIMFNLCPDLMWVSM  372

Query  431   HNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVS  610
              +    +H+AIE R ENIF+ +   ++ V    D  + +G  +M+LAAKLAP  +L+ VS
Sbjct  373   EDFKFPIHVAIEYRRENIFSFLCEKNMRVKVQADRSDRSGT-VMHLAAKLAPFDQLSSVS  431

Query  611   GAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATS  790
             GAA QMQRE++WFKEV+K+  PY  + ++E GKT +  FTE H+ L   GEKWMKDT+ S
Sbjct  432   GAAFQMQREMKWFKEVEKLVRPYSKTLLNERGKTAKELFTEEHKKLAEAGEKWMKDTSNS  491

Query  791   CtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfl  970
             C I A LI TVVF AA TVPGGN+   G+PIF   NAF VFAIS+A +LF++ TS+L+FL
Sbjct  492   CMIVATLIATVVFTAAFTVPGGNNSDTGVPIFLRTNAFLVFAISDALALFSSLTSVLMFL  551

Query  971   svltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPAL  1150
             S+LT+RYAE DFL +LP RLIIGL +LF +I  MM AF +T+ +V  +   WI +    L
Sbjct  552   SILTARYAEDDFLRSLPKRLIIGLASLFLAITTMMIAFGATLSIVLSKRLDWISVPTVLL  611

Query  1151  ASLPITSFVLLQFPLLVALVSSTYG  1225
             AS+P+  F LLQ PL + +  ST+G
Sbjct  612   ASVPVAIFTLLQLPLFIEMARSTFG  636



>ref|XP_008440794.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Cucumis melo]
Length=614

 Score =   224 bits (572),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 161/412 (39%), Positives = 244/412 (59%), Gaps = 20/412 (5%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             S +YD+AL+++ +  ++        G   L  + +    I ++    FWK+ I      N
Sbjct  203   SDYYDIALDILKKKPELAKERVEENGETALHLLARKPNAIGSSNKLCFWKKYI------N  256

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVH  364
             S   +       ++++   + L HQ    L   + + L T   +  + +  S+ LL A  
Sbjct  257   SRFNR-------IYRTAVMQTLAHQVVERLWNFVVENLSTFELHKLILT-PSNLLLDAAS  308

Query  365   LDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTIN-  541
             +   E ++ ++ +YP + + +  ++  I H+A+ENR  N+F+LI     + + L +  N 
Sbjct  309   VGNVEFLIILIRSYPDLLWMASKDNKTIFHVAVENRQGNVFSLIHEIGGVKNYLGNGYNE  368

Query  542   GNGNDIMNLAAKLAPQHKLN-LVSGAALQMQRELQWFKEVQKIALP--YFSSCMDEYGK-  709
              N  +I++LA KLA  + LN +VSG ALQMQ EL+WFKEV+KI +P  Y     +E+G  
Sbjct  369   KNDCNILHLAGKLASPYHLNKVVSGKALQMQYELRWFKEVEKIVIPSHYEMKMKNEHGDR  428

Query  710   -TPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIF  886
              TP   FT+ H+ L+ EGE+WMK+TA SC + AALI TVVFAAA TVPGGN D +G+PIF
Sbjct  429   LTPRELFTKEHKHLRREGEEWMKNTANSCMLVAALIATVVFAAAFTVPGGNEDKDGIPIF  488

Query  887   SSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSII  1066
               +  FTVF IS+ A+L  + TS+L FLS+LT+RYAE+DFL +LP++L+IGLITLF SI 
Sbjct  489   QKNQVFTVFVISDVAALVMSTTSILTFLSILTARYAEEDFLISLPSKLLIGLITLFVSIA  548

Query  1067  LMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
              MM AFS+T ++ + +    I +IV A+  LPI  F +  F L +  + STY
Sbjct  549   CMMVAFSATFFIAYHKTTVKIPLIVAAVLILPIVCFCMFHFKLFLDTMRSTY  600



>ref|XP_006466150.1| PREDICTED: uncharacterized protein LOC102617019 [Citrus sinensis]
Length=645

 Score =   224 bits (572),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 174/466 (37%), Positives = 258/466 (55%), Gaps = 60/466 (13%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI---  175
             S  +DMAL L+ +H ++   AAL+     L+++ K      + +   +WKR +Y  I   
Sbjct  179   SNLFDMALALLKKHPNIARTAALDDIRIILESLSKKPKAFASGSRLGYWKRLLYQWIPTQ  238

Query  176   ------------------SKNSASTQN-----------FVS-----QLLLW---------  226
                                K  + T N           F S     +++LW         
Sbjct  239   EEYNPHPHPHYENADGDVEKQLSVTSNIHLAPQKIATAFGSLRQKLKIVLWNNIMQLAPG  298

Query  227   -KSIPKKILMHQQATDLLKCLC-DELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVE  400
              KSI    L  +Q  ++L+ +C   +  L  + +   +    +  A    I E+V+ I+ 
Sbjct  299   IKSIRDTKLTQEQTLEILRIMCAGAVGNLTTHEEAEKILKTPMFTAARWGIYEIVIEIIL  358

Query  401   AY-PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI---NGNGNDIMNL  568
             +Y P   Y  + +  N+   A+E+R + +FN+I      +  L+ ++   +   N+ ++L
Sbjct  359   SYFPASLYFENKDQHNVFDAAVEHRQQKVFNIIFNMPKQLTILRVSVANFDAKLNNALHL  418

Query  569   AAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLL  748
             AA+  P  +   V GAALQMQRELQWFK V+ I  P     ++   KTP   FT+ H  L
Sbjct  419   AARSVPSSE---VPGAALQMQRELQWFKAVENIVHPTLQDQLNNEDKTPRELFTKAHEEL  475

Query  749   KIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNa  928
               EGEKWMKDTA SC++ AALI+T+ FAAAITVPGG SD+ G+P +    +FT+F ISNA
Sbjct  476   VKEGEKWMKDTAQSCSLVAALIITIAFAAAITVPGG-SDSRGMPNYLHEPSFTIFGISNA  534

Query  929   aslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVF  1108
              +LF++  S+L+FL +LTSR++E+DFL +LP +LIIGLITLFFSI  +M AF++T+Y+V 
Sbjct  535   LALFSSVISVLMFLGILTSRFSEEDFLVSLPKKLIIGLITLFFSIASLMVAFAATVYIV-  593

Query  1109  GQNKSWIRIIVPA--LASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
              Q  SW  +I+P   L  LP++ F  LQFPLL+ + SSTYGPGIF 
Sbjct  594   -QFHSWKWVIIPMGLLGFLPVSLFATLQFPLLIEVFSSTYGPGIFK  638



>ref|XP_008235975.1| PREDICTED: uncharacterized protein LOC103334783 [Prunus mume]
Length=732

 Score =   225 bits (574),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 171/454 (38%), Positives = 252/454 (56%), Gaps = 47/454 (10%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMG---VPPLDAIVKYDCPIINTANFSFWKRSIYYCI  175
             +K +D+A EL+           L  G   + P+  +        + A+  FW++ IY CI
Sbjct  277   AKKFDIAQELI----QFCPQLVLTKGPYWLSPIQTLACMSSAFPSGAHLKFWQQWIYNCI  332

Query  176   -----------------SKNSASTQNFVS-------------QLLLWKSIPKKILMHQQA  265
                                N  S    ++             +LL    I +  L+H QA
Sbjct  333   HIEPTRAIRDIRVRLQNEGNEGSNPTHITWSGFLKGLISNLLELLGINRIREMKLIHIQA  392

Query  266   TDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLN  445
              +LL  +C+ +K  ++ N+   +   A+ +A+   I E V  +++  P +    +     
Sbjct  393   LELLDRMCEVIKC-SEENEKRGI-DQAIFQAIERGIFEFVDRLLQTSPDLIGSFNQMKRT  450

Query  446   ILHIAIENRCENIFNLI----RGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +   AIE R E +++LI         ++ N+ D+   + N  +++A  L+P  KLN +SG
Sbjct  451   VFQFAIECRQEKVYSLIYRFDEKKRTVIGNVADS---SRNSTLHMAGMLSPLAKLNKISG  507

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
             AALQMQRELQWFKEV+ I  P      +E   TP   FT+NH  L  EGE+WMK+TATSC
Sbjct  508   AALQMQRELQWFKEVETIVFPRVQEIFNEENMTPHDLFTKNHEQLVKEGERWMKETATSC  567

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             T+  ALI+T++FA+A TVPGGN+   G+PIF     F  F +S+A SLF++ TS+L+FL 
Sbjct  568   TVVGALIITIMFASAFTVPGGNNGETGIPIFLKTKLFMAFIVSDAISLFSSTTSVLMFLG  627

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             +LTSRYAE+DFL +LP ++IIGL TLF SI  MM AFSS ++++    +SWI I +  LA
Sbjct  628   ILTSRYAEEDFLKSLPTKMIIGLSTLFVSIAAMMVAFSSGLFIMI-HEQSWIVIPMIFLA  686

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQRGIP  1255
             S+PIT F+ +QFPLLV +  STYG GIF ++  P
Sbjct  687   SVPITLFIWMQFPLLVEIFISTYGRGIFDRKLKP  720



>gb|KDO65032.1| hypothetical protein CISIN_1g0061731mg, partial [Citrus sinensis]
Length=409

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 147/341 (43%), Positives = 216/341 (63%), Gaps = 10/341 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLC-DELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEA  403
             KSI    ++H+Q  ++L+ +C   +  LN + +  ++    + +A  L I E+V+ I+ +
Sbjct  69    KSIRDAKIIHEQTLEILRIMCAGAVDILNTHEEAQNVFKKPMFKAARLGIYEIVMGIMNS  128

Query  404   Y-PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKL  580
             Y P      + +  +I  +A+E+R E +FN+I     +       I+    +I+++AA  
Sbjct  129   YFPWSLEFKNKDGYDIFKVAVEHRREKVFNIIFNFPNIYPFFMANIDEKRINILHIAAMS  188

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
              P  +   V GAALQMQRELQWFK V+    P     +++  KTP   FT+ H  L  EG
Sbjct  189   VPSTE---VPGAALQMQRELQWFKAVENCVHPTLQDQLNDKDKTPREVFTKEHEKLVEEG  245

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMKDTA SC++ A LI+T+VFAAAITVPGG SD+ G+P F    +FT+F ISNA +LF
Sbjct  246   EKWMKDTAGSCSVVATLIMTIVFAAAITVPGG-SDSRGMPNFLEEPSFTIFGISNALALF  304

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++  S+L+FL +LTSR++E+DFL +LP +LIIGLITLFFSI  +M AF++T+++   Q  
Sbjct  305   SSVISVLIFLGILTSRFSEEDFLVSLPRKLIIGLITLFFSIACLMVAFAATVHIT--QFH  362

Query  1121  SWIRIIVPA--LASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
              W  +I+P   L  LP+  F  LQFPLL+ + +STYGPGIF
Sbjct  363   PWKWVIIPTALLGFLPVFLFATLQFPLLIEVFASTYGPGIF  403



>ref|XP_008230430.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=564

 Score =   222 bits (565),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 208/334 (62%), Gaps = 3/334 (1%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMA-YCSD  430
             H++ +++L+ +C+ +K  +      S+   A+  A+     E V  I  + P +    + 
Sbjct  221   HERISEILRSMCEAIKGKSGKQLQGSVVQAAIFEAIKQGHVEFVHEIFRSNPAVGGLLTS  280

Query  431   HNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVS  610
              N   +L  AIE R E  +      + +  NL   I+   N +++ AA L+P  +LN + 
Sbjct  281   ENGKTMLQFAIECRQEKAYLFFYKFTGIAPNLLVRIDQFSNTLLHAAAGLSPIEQLNRIQ  340

Query  611   GAALQMQRELQWFKEVQKIALPYFSSCMD-EYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             GAALQMQRELQWFKE++KI  P     ++   G T    FT+NH+ L  EGE+ MK+TAT
Sbjct  341   GAALQMQRELQWFKEIEKIVPPKILEVVNVTDGMTARDLFTKNHKELAKEGERSMKETAT  400

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             SCT+  ALI+T++F AA TVPGGN+   G+P+F     F VF +S+A SLF + TS++ F
Sbjct  401   SCTVVGALIITIMFTAAFTVPGGNNGNTGMPMFLEKKLFKVFIVSDALSLFASTTSVMTF  460

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
             L VLTSRYAE DFL +LP ++IIGL TLFFSI  MM AF ST+ ++ G+ KSWI I +  
Sbjct  461   LGVLTSRYAEADFLESLPKKMIIGLFTLFFSIATMMIAFVSTLCIMLGE-KSWIVIPITL  519

Query  1148  LASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             L+S PI SF  +QFPLLV +  STYG GIFSQ+G
Sbjct  520   LSSAPIVSFAWMQFPLLVEIFISTYGAGIFSQKG  553



>ref|XP_008230427.1| PREDICTED: uncharacterized protein LOC103329708 [Prunus mume]
Length=744

 Score =   224 bits (572),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 170/453 (38%), Positives = 253/453 (56%), Gaps = 38/453 (8%)
 Frame = +2

Query  2     RSKFYDMALELVGQHHDVTHHAALNM-GVPPLDAIVKYDCPIINTANFSFWKRSIYYCI-  175
             R+K  D+AL+L+ +  ++    A N  G+ PL          +N  +  FW++ IY CI 
Sbjct  288   RAKKLDIALDLIRRCPNLA--VAKNYSGLTPLQMCASTRSGFLNGMHLKFWQQWIYDCIH  345

Query  176   ----------------------SKNSASTQNFVSQLLLWKSIPKKIL----------MHQ  259
                                   SK     ++ +  L      P+K+            H+
Sbjct  346   VRPHSAVYDICINVENVEDGPISKRDLIVRSGMGILRGLVPNPRKLFGINHIYKMKWTHE  405

Query  260   QATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHND  439
             + +++L  +C+ ++  +      S+   A+  A+     E V  +  A    +     N 
Sbjct  406   RTSEILHSMCEVIEGKSVKQLRGSVVEAAIFEAIKQGHVEFVREMFLANQAASGLIGENG  465

Query  440   LNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAA  619
              ++L  AIE R E ++  +   + +V N   +I+  GN +++ AA L+P  +LN + GAA
Sbjct  466   KSMLQFAIECRQEKVYFFLYKFTGVVPNWLTSIDHFGNTLLHAAASLSPIAQLNHIQGAA  525

Query  620   LQMQRELQWFKEVQKIALPYFSSCMD-EYGKTPEMHFTENHRLLKIEGEKWMKDTATSCt  796
             LQ+QRELQWFKE++KI  P     ++   G T    FT+NH+ L  EGE+ MK+TATSCT
Sbjct  526   LQLQRELQWFKEIEKIVPPKILEVVNVTDGMTARDLFTKNHKELAKEGERSMKETATSCT  585

Query  797   iaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsv  976
             +  ALI+T++F AA TVPGGN+   G+P+F     F VF +S+A SLF++ TS++ FL V
Sbjct  586   VVGALIITIMFTAAFTVPGGNNGNTGMPLFLDKRLFQVFIVSDALSLFSSTTSVMTFLGV  645

Query  977   ltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALAS  1156
             LTSRYAE DFL +LP ++IIGL TLFFSI  MM AF ST++++ G+N SWI I +  LAS
Sbjct  646   LTSRYAEADFLKSLPTKMIIGLFTLFFSIATMMIAFVSTLFIMLGEN-SWIVIPIILLAS  704

Query  1157  LPITSFVLLQFPLLVALVSSTYGPGIFSQRGIP  1255
              P+ SF  +QFPLLV +  STYG GIF++RG P
Sbjct  705   APVVSFAWMQFPLLVDIFISTYGVGIFAKRGKP  737



>ref|XP_011032833.1| PREDICTED: uncharacterized protein LOC105131524 [Populus euphratica]
Length=807

 Score =   225 bits (574),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 150/360 (42%), Positives = 224/360 (62%), Gaps = 10/360 (3%)
 Frame = +2

Query  185   SASTQNFVSQLLLWKSIPKKIL----MHQQATDLLKCLCDELKTLNDYNQVFSLASDALL  352
             S+  + F   LL +  I KKI     +H  +  +L+C+C+ + TL+    + +    A  
Sbjct  447   SSKLRGFAINLLAFLGI-KKIYELKKIHIYSDKILRCMCEYISTLDYEEYLKADVHGAFH  505

Query  353   RAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQD  532
              AV   + E +  +++A P +    D N  N+   +I NR E +F+L  G          
Sbjct  506   NAVRNGMVEFITEVIKACPHVMISGDGNSRNVFMSSIANRQEKVFSLFYGLEAEREGFVS  565

Query  533   TINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKT  712
              ++  GN +++LAAKL+P  +L  +SGAALQMQRELQW+KEV+ I  P      +E  +T
Sbjct  566   LVDSTGNTMLHLAAKLSPPSQLARISGAALQMQRELQWYKEVESIMNPILKDYPNENTQT  625

Query  713   PEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSS  892
                 FT +H+ L ++GE+WMK+ ATSCT+  ALI+T++F AA TVPGGN    G PIF  
Sbjct  626   ARELFTYDHKDLLVKGEQWMKEAATSCTVVGALIITMMFTAAFTVPGGNVQETGYPIFRD  685

Query  893   HNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILM  1072
               +FTVF +++A SLF+++TS+L+FL +LTSRY+E+DFL +LP +LIIGL  LFFSI  M
Sbjct  686   EKSFTVFIVADAISLFSSSTSVLMFLGILTSRYSEEDFLKSLPTKLIIGLSMLFFSIAAM  745

Query  1073  MTAFSSTIYLVFGQNKSWIRIIVPA--LASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             M  F + + ++       +++I+P   LAS+P+T F+ LQFPLLV +V STYG GIF+++
Sbjct  746   MVTFCAALIIMLDGR---LQVIIPIVLLASIPVTLFMWLQFPLLVEIVVSTYGKGIFNRK  802



>ref|XP_008362322.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Malus 
domestica]
Length=370

 Score =   216 bits (550),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 155/341 (45%), Positives = 214/341 (63%), Gaps = 18/341 (5%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQV-FSLASDALLRAVHLDIAEVVLSIVEAYPTMAYC  424
              +H  + + LK +C+E+K   D  QV +     A+ +AV     E +  I +A P + + 
Sbjct  33    FVHVHSLEFLKFMCEEIKKDLDMKQVSYGTLRSAIFQAVRKGNVEFITHICKANPVLLWS  92

Query  425   SDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTING---NGNDIMNLAAKLAP--Q  589
              D     I  +AI+ R E I+NLI G S      ++ I+G   N N+ +++A  L+P  Q
Sbjct  93    RDDESRGIFDVAIQCRQEKIYNLIYGISS-----KEVIHGGDKNNNNKLHMAGLLSPSAQ  147

Query  590   HKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGK--TPEMHFTENH-RLLKIEG  760
              +LN + GAALQMQRELQW+KEV+ I  P F    ++ GK  TP   FT+ H RLLK EG
Sbjct  148   AQLNRIPGAALQMQRELQWYKEVETIVPPNFREYRNK-GKHLTPRELFTKTHSRLLK-EG  205

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK+TATS  I  ALI T++FAA IT+PGGN D  G P F     F +F +S+A SLF
Sbjct  206   EKWMKETATSYIIVGALIFTIMFAAVITIPGGNGD-TGFPAFIDEKLFMLFIMSDAISLF  264

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++ T+ L FL +LTSR+AE DFL +LP ++IIGL TLF +I  MM AFS+  +L+  +  
Sbjct  265   SSTTATLTFLGILTSRFAEDDFLKSLPTKIIIGLATLFLAIATMMIAFSAA-FLIIVRGH  323

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             SWI I    L+S+P+T FV +QFPLLV + +STYG GIF++
Sbjct  324   SWIVIPTILLSSVPVTLFVWMQFPLLVRITASTYGRGIFNR  364



>gb|KDP35850.1| hypothetical protein JCGZ_10331 [Jatropha curcas]
Length=607

 Score =   222 bits (565),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 149/354 (42%), Positives = 225/354 (64%), Gaps = 11/354 (3%)
 Frame = +2

Query  209   SQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVL  388
             S++   K I  + L H  A  +L+ +   + +++D         +A  +A+   + EVV+
Sbjct  258   SEMFGLKQIYDRKLRHTYALKILELMAKHVSSIDDTKLNEKYIYNAFFKAIRHGVVEVVV  317

Query  389   SIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNG---NDI  559
              ++ A   +    + N  ++L  AI+ R E +F+LI    VL    Q  I+G+    N I
Sbjct  318   EMIRANYILLSVVNRNSRDMLMHAIKYRQEKVFSLIY---VLGSRKQLLISGSDDFENTI  374

Query  560   MNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENH  739
             +++AA+LAP  +L  +SGAALQMQRELQW+KEV+ I++P +    ++  +     F+++H
Sbjct  375   LHMAARLAPPDRLAGISGAALQMQRELQWYKEVESISIPSYKEYTNKNNEQASEIFSKSH  434

Query  740   RLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAI  919
             + L  +GEKWMK+TATSCT+  ALI+T++F  A TVPGGN    G P+F+   +F +F I
Sbjct  435   KELIKDGEKWMKETATSCTVVGALIITIMFTTAFTVPGGNVQETGFPMFAHEKSFMIFII  494

Query  920   SNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIY  1099
             S+A SLF ++TS+L+FL VLTSRY+E DFL +LP +LIIGL TLF SI  MM AF +T+ 
Sbjct  495   SDAVSLFASSTSVLMFLGVLTSRYSEDDFLKSLPTKLIIGLSTLFISIAAMMVAFCATLM  554

Query  1100  LVFGQNKSWIRIIVPA--LASLPITSFVLLQFPLLVALVSSTYGPGIFSQRGIP  1255
             ++    +  +R++ P   LAS+P+T F+LLQFPLLV +  STYGPGIF ++  P
Sbjct  555   IML---EGELRLVFPIIFLASIPVTLFILLQFPLLVEIFISTYGPGIFDRKMKP  605



>ref|XP_008231511.1| PREDICTED: uncharacterized protein LOC103330686 [Prunus mume]
Length=714

 Score =   223 bits (569),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 162/424 (38%), Positives = 240/424 (57%), Gaps = 41/424 (10%)
 Frame = +2

Query  80    GVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN-------SASTQNFVSQLL------  220
             G  P+  +       ++     FW+R IY CI          S + QN   +L       
Sbjct  292   GESPIFVLADIPSAFLSGTPLKFWQRWIYDCIHIQPPAIPDVSVNVQNPEIELGNQRNIS  351

Query  221   ---LWKSIPKKI--------------LMHQQATDLLKCLCDELKTLNDYNQVFSLASDAL  349
                L + +P  +              ++H ++  +L  +C+ +K ++   +   L  +A+
Sbjct  352   FSGLLQGLPSTLHNLLGINHYICEMKMIHDRSLKILDDMCEVVKHVDIREREDGLVYEAV  411

Query  350   LRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSV--LVHN  523
              +AV   I E V+ + +  P + +  +    NI H +IE R E +++LI G     L+  
Sbjct  412   FQAVRRGIIEFVIRLCKVEPDVLWHHNSMGRNIFHYSIECRQEKVYSLIYGVGQRNLIAT  471

Query  524   LQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQK-IALPYFSSCMDE  700
               D     GND+++LA  L+P  KL+ +SGAALQMQRE QWFKEV+  + LP      ++
Sbjct  472   FSDAF---GNDMLHLAGMLSPTEKLDGISGAALQMQRERQWFKEVKSTVVLPSGVRAFNK  528

Query  701   YGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLP  880
              GK P   FT+NH+ LK EGEKWMKD ATS T+  AL +T++FAAA TVPGGN+   G P
Sbjct  529   EGKRPHELFTQNHKNLKEEGEKWMKDVATSSTVVGALTITIMFAAAFTVPGGNNGETGFP  588

Query  881   IFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFS  1060
             IF     F +F +S+A SLF++ TS+L+FL +LTSRYAE DFL +LP ++IIGL TL  S
Sbjct  589   IFLHEKMFMIFIVSDAISLFSSITSVLIFLGILTSRYAEDDFLKSLPTKMIIGLSTLLIS  648

Query  1061  IILMMTAFSSTIYLVFGQNKSWIRIIVPA--LASLPITSFVLLQFPLLVALVSSTYGPGI  1234
             I  MM AF S ++L+  +    ++I++P   LAS+P+  F+ +QFPLLV +  STYG GI
Sbjct  649   IATMMVAFCSALFLMLHER---LQIVIPIIFLASIPVALFIGMQFPLLVEIFISTYGGGI  705

Query  1235  FSQR  1246
             F ++
Sbjct  706   FDKK  709



>ref|XP_008341407.1| PREDICTED: uncharacterized protein LOC103404290 isoform X2 [Malus 
domestica]
Length=617

 Score =   222 bits (565),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 169/441 (38%), Positives = 247/441 (56%), Gaps = 32/441 (7%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             ++ +D+  EL+ +   +T      M   P+ +   +     +  +  FW++ IY CI   
Sbjct  177   ARQFDITWELLQRCPRLTFTRGNQMS--PILSFAYFSSAFPSGTSLKFWQQWIYNCIHIE  234

Query  185   SASTQNFV---------SQLL-LWKSIPKKIL-------------MHQQATDLLKCLCDE  295
             S  + N            Q+L L + +P + L             +H ++  +L C+CD 
Sbjct  235   SGHSVNAFRINIQNQENEQVLGLLQGLPSRFLEFLGIKRIRELKLIHIRSRQILDCMCDV  294

Query  296   LKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRC  475
             +K LN          DA+  AV   I E+V S+ +A P +    D    NI H A+E R 
Sbjct  295   IKHLNREEMKDGYVYDAIFVAVENGIVELVTSLCKARPELLLRVDRKGKNIFHHAVECRQ  354

Query  476   ENIFNLIRGTSVLVHNL-QDTINGNGNDIMNLAAKLAP--QHKLNLVSGAALQMQRELQW  646
             E +++L+ G  V   NL  + I+ + N +++ A  L P    KL+ + GAALQMQRE QW
Sbjct  355   EKVYSLLYG--VRQRNLITNFIDDSDNHMLHCAGMLCPLATEKLDRIPGAALQMQRERQW  412

Query  647   FKEVQKIALPYFS-SCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtv  823
             +KEV+ I       S  +E G TP   FT+NH  L  +GEKWMK TA S T+ +ALI+T+
Sbjct  413   YKEVESIEFQLSGVSNKNEDGLTPSKLFTKNHEKLHKDGEKWMKGTAGSSTVVSALIITI  472

Query  824   vfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQD  1003
             +FAAA TVPGGN+   G PIF +   F VF +S+A SLF++ TS L+FL +LTSRYAE D
Sbjct  473   MFAAAFTVPGGNNQETGFPIFLNEKLFMVFIVSDAISLFSSTTSALMFLGILTSRYAEDD  532

Query  1004  FLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLL  1183
             FL +LP ++IIGL TLF SI  MM AFSS ++++  Q+K WI   +   A +P+  FV +
Sbjct  533   FLKSLPTKMIIGLSTLFISIATMMVAFSSALFIML-QDKPWITYPIIFFAGVPVILFVWM  591

Query  1184  QFPLLVALVSSTYGPGIFSQR  1246
             QFPLL+ +  ST+G GIF ++
Sbjct  592   QFPLLIDIFVSTFGRGIFDRK  612



>ref|XP_010242786.1| PREDICTED: uncharacterized protein LOC104587045 [Nelumbo nucifera]
Length=733

 Score =   223 bits (569),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 155/341 (45%), Positives = 221/341 (65%), Gaps = 7/341 (2%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTL--NDYNQVFSLASDALLRAVHLDIAEVVLSIVE  400
             K + ++ LMH Q+ +L+K L  ++  +  ND+ +V  L    L+ A    I E V   ++
Sbjct  395   KEVRRRKLMHLQSRELVKQLFKKVTMMIKNDH-KVEQLLGPPLIVAAEFGIVEFVEIALK  453

Query  401   AYPTMAYCSDHNDLNILHIAIENRCENIFNLI--RGTSVLVHNLQDTINGNGNDIMNLAA  574
              YP +    D N   I+ +A+ NR E +F ++  +G  + +      I  N  +I++LAA
Sbjct  454   YYPRLIEYPDANLRCIMQVAVLNRQEKVFKMLNKKGRQITLRTFDRDIYMN--NILHLAA  511

Query  575   KLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKI  754
             KLAP H+L+ VSGAALQ+QRELQWFK ++ +A P +    +  G TP++ F+E H+ L  
Sbjct  512   KLAPPHQLHSVSGAALQLQRELQWFKAIEMLAPPKYKERKNSQGLTPQLLFSEEHKDLIA  571

Query  755   EGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaas  934
             +GE WMK+TA SCT+AAALI+T++FAAA TVPGG     G PIF   ++F VF IS+A +
Sbjct  572   KGESWMKETAASCTVAAALIITMMFAAAFTVPGGIRSDTGTPIFEHSHSFLVFVISDAFA  631

Query  935   lftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQ  1114
             LF+A+TS+L+FLS+LTSRYAE DFL +LP +LIIGL  LF SI  MM  FSST++++   
Sbjct  632   LFSASTSMLMFLSILTSRYAEIDFLESLPRKLIIGLAMLFLSIASMMATFSSTMFIMLRN  691

Query  1115  NKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
              +  I II+ +L  +P T F  LQFPL V ++S TYG GIF
Sbjct  692   RQGPISIILASLGVVPATLFAFLQFPLFVDMMSYTYGSGIF  732



>gb|KDP25715.1| hypothetical protein JCGZ_23936 [Jatropha curcas]
Length=491

 Score =   218 bits (556),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 156/414 (38%), Positives = 235/414 (57%), Gaps = 19/414 (5%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             SK +D +L L+ +   +     ++    PL  +        ++   SFWKR IY  +   
Sbjct  92    SKMFDFSLALIQRCPRLAVTRTIH-KTTPLIELSSMSELFPSSNRLSFWKRRIYSGL---  147

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVH  364
                           K I    L H  A  +++C+ +      + + +     +AL  A  
Sbjct  148   --------------KQIYDMKLTHIYALQVIRCIFEGTSITKNQDIIKKGIDEALFTATE  193

Query  365   LDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTING  544
               I E+V+ I++A P++    +     I+  AIE R E +F++I         L ++ +G
Sbjct  194   SGIVEIVIEILKANPSIITTRNTLSRGIIEYAIEYRQEKVFSIIYAVGEWKGLLINSFDG  253

Query  545   NGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMH  724
             +GN+ +++A  LAP H+L  +S  ALQMQRELQW+KEV+ I  P     ++E   TP   
Sbjct  254   DGNNTLHMAGMLAPAHRLAHISSPALQMQRELQWYKEVESIVDPALKQYVNEEEYTPSQL  313

Query  725   FTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAF  904
             FT++H+ LK EGEKWMK  ATS T+  ALI+T++F  A TVPGGN    G PIF    AF
Sbjct  314   FTKSHKELKEEGEKWMKGIATSSTVVGALIITIMFTTAFTVPGGNFQDTGFPIFLHKKAF  373

Query  905   TVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAF  1084
              VF +++A SLF ++TS+L+FL VLTSRYAE+DFL +LP ++I+GL TLFFSI  MM +F
Sbjct  374   KVFIVADAISLFASSTSVLMFLGVLTSRYAEEDFLESLPRKMIMGLSTLFFSIAAMMISF  433

Query  1085  SSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              +T+ ++   +   + I +  LAS+P+T F+ LQFPLLV +  STY P +F ++
Sbjct  434   CATLIIMLDGDLK-LIIPIILLASIPVTVFIFLQFPLLVEIFVSTYRPRLFDRK  486



>ref|XP_010256489.1| PREDICTED: uncharacterized protein LOC104596860 [Nelumbo nucifera]
Length=782

 Score =   224 bits (570),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 151/351 (43%), Positives = 217/351 (62%), Gaps = 15/351 (4%)
 Frame = +2

Query  206   VSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVV  385
             + Q+L  K +    + H+QA  LLK L   +  LND+ ++      +L+ A    I E  
Sbjct  439   IPQVLDVKKLRDMKIKHKQAPRLLKELFSRVLELNDHFKIEESLGPSLVCAAENGIIEFF  498

Query  386   LSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNG-----  550
             +  + +YP +    D++  ++  IAI NR ENIF   +           T +G G     
Sbjct  499   IEALHSYPLLLRYRDNDLSSLQRIAITNRQENIFRFFKKLP--------TWDGEGLSLDA  550

Query  551   --NDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMH  724
               N +++L  +LAP ++LNL+ GAALQMQRELQWF EV+K+  PYF     + G T    
Sbjct  551   SMNTMLHLVGELAPSNRLNLIPGAALQMQRELQWFVEVEKMVPPYFREYKKKKGMTAYTL  610

Query  725   FTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAF  904
             F++ H+ L  EGEKWMK+TA SCTI A L++T++FAAA TVPGGN ++ G+P+      F
Sbjct  611   FSKEHKELVSEGEKWMKETAASCTIVATLVITIMFAAAFTVPGGNKESEGVPLLLRTKPF  670

Query  905   TVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAF  1084
              VF IS+A SLF++ TS+L+FLS+LTSRY E+ FL +LP +LI+GL+TLF S+  MM AF
Sbjct  671   MVFVISDALSLFSSTTSVLMFLSILTSRYTEEAFLESLPRKLILGLVTLFVSLAAMMAAF  730

Query  1085  SSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
              +TI+++   +  WI I++ + AS P+T F+LLQ PL V +V STY   IF
Sbjct  731   CATIFILLDGHLRWISIVLASFASFPVTMFLLLQLPLFVDMVRSTYFSNIF  781



>ref|XP_008341406.1| PREDICTED: uncharacterized protein LOC103404290 isoform X1 [Malus 
domestica]
Length=624

 Score =   221 bits (563),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 168/448 (38%), Positives = 246/448 (55%), Gaps = 39/448 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCI---  175
             ++ +D+  EL+ +   +T      M   P+ +   +     +  +  FW++ IY CI   
Sbjct  177   ARQFDITWELLQRCPRLTFTRGNQMS--PILSFAYFSSAFPSGTSLKFWQQWIYNCIHIE  234

Query  176   --------------SKNSASTQNFVSQLLLWKSIPKKIL-------------MHQQATDL  274
                            +N    Q   + L L + +P + L             +H ++  +
Sbjct  235   SGHSVNAFRINIQNQENEQGNQRSNTVLGLLQGLPSRFLEFLGIKRIRELKLIHIRSRQI  294

Query  275   LKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILH  454
             L C+CD +K LN          DA+  AV   I E+V S+ +A P +    D    NI H
Sbjct  295   LDCMCDVIKHLNREEMKDGYVYDAIFVAVENGIVELVTSLCKARPELLLRVDRKGKNIFH  354

Query  455   IAIENRCENIFNLIRGTSVLVHNL-QDTINGNGNDIMNLAAKLAP--QHKLNLVSGAALQ  625
              A+E R E +++L+ G  V   NL  + I+ + N +++ A  L P    KL+ + GAALQ
Sbjct  355   HAVECRQEKVYSLLYG--VRQRNLITNFIDDSDNHMLHCAGMLCPLATEKLDRIPGAALQ  412

Query  626   MQRELQWFKEVQKIALPYFS-SCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtia  802
             MQRE QW+KEV+ I       S  +E G TP   FT+NH  L  +GEKWMK TA S T+ 
Sbjct  413   MQRERQWYKEVESIEFQLSGVSNKNEDGLTPSKLFTKNHEKLHKDGEKWMKGTAGSSTVV  472

Query  803   aalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvlt  982
             +ALI+T++FAAA TVPGGN+   G PIF +   F VF +S+A SLF++ TS L+FL +LT
Sbjct  473   SALIITIMFAAAFTVPGGNNQETGFPIFLNEKLFMVFIVSDAISLFSSTTSALMFLGILT  532

Query  983   sRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLP  1162
             SRYAE DFL +LP ++IIGL TLF SI  MM AFSS ++++  Q+K WI   +   A +P
Sbjct  533   SRYAEDDFLKSLPTKMIIGLSTLFISIATMMVAFSSALFIML-QDKPWITYPIIFFAGVP  591

Query  1163  ITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +  FV +QFPLL+ +  ST+G GIF ++
Sbjct  592   VILFVWMQFPLLIDIFVSTFGRGIFDRK  619



>gb|KDP43897.1| hypothetical protein JCGZ_20907 [Jatropha curcas]
Length=333

 Score =   214 bits (544),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 150/334 (45%), Positives = 207/334 (62%), Gaps = 9/334 (3%)
 Frame = +2

Query  251   MHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSD  430
             M++QA +LLK L  E++      Q   +   A  RA      E V+ +++AYP + + SD
Sbjct  1     MNKQAKELLKLLISEVRKAG-VKQADKILGPASRRAAISGNQEFVIEVIKAYPHVLWLSD  59

Query  431   HND-LNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
              +D L I H+A++ R E IFNL+       H L    + + N++++LA +L P    N +
Sbjct  60    ESDGLTIFHLAVKYRQERIFNLLYQMGTHKHFLTAVHDKSDNNMLHLAGELRPS---NRI  116

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             S AA +MQRELQWFKEV+K+  P +    ++ GKTP   FTE H+ L   GEKWMK TA 
Sbjct  117   SYAAFEMQRELQWFKEVEKVVQPSYKEEKNKEGKTPREVFTEKHKDLFERGEKWMKKTAI  176

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             SC   AAL++TVVFAAA TVPGGNSD  G+PI+ S  +F  +AIS+  +LF + TSLL+F
Sbjct  177   SCATVAALVLTVVFAAAFTVPGGNSD-KGIPIYLSQKSFMSYAISDVLALFCSITSLLIF  235

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
             L ++TSRYAE+DF  ALP RLI GLITL FSI  M+  F     L       WI  ++ A
Sbjct  236   LGMITSRYAEEDFFKALPMRLIAGLITLCFSIGFMLGVFGDAFLLELSHKVQWIAALIAA  295

Query  1148  LASLPITS-FVLLQFPLLVALVSSTYGPGIFSQR  1246
             +  + IT+ FV ++FPLL  +V ST+GP IF ++
Sbjct  296   V--ICITNLFVPMRFPLLGEIVYSTFGPSIFGKQ  327



>ref|XP_006381090.1| hypothetical protein POPTR_0006s06170g [Populus trichocarpa]
 gb|ABK95894.1| unknown [Populus trichocarpa]
 gb|ERP58887.1| hypothetical protein POPTR_0006s06170g [Populus trichocarpa]
Length=354

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 152/334 (46%), Positives = 208/334 (62%), Gaps = 11/334 (3%)
 Frame = +2

Query  242   KILMHQQATDLLKCLCDELKTLND------YNQVFSLASDALLRAVHLDIAEVVLSIVEA  403
             K LMH++A D+++ L +++  L+D        +   L   A  R  +LD   V++ +   
Sbjct  2     KKLMHKEALDIIQYLWEQVVLLDDATISRQIGEPLPLIFTAAERG-NLDFLTVLIRL---  57

Query  404   YPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAK-L  580
             YP + +  +HN  +I HI+I NR E+IF +I     + + +    +  GN++++LAAK L
Sbjct  58    YPELIFKVEHNMYSIFHISILNRHEDIFKIIYQIGSIKNLITTYKDTEGNNMLHLAAKVL  117

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
                 +LN + GAALQ+QREL WF+EV+K+  P      + +GKTP   F E HR L  EG
Sbjct  118   ESPSRLNAIPGAALQLQRELLWFEEVKKVVQPRHIEEKNFHGKTPGALFIEQHRDLMKEG  177

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             E+WM+DTA SC + A LI TVVFAAA TVPGGN    G P+F    AF  FAIS+A SL 
Sbjct  178   EQWMRDTADSCMLVATLIATVVFAAAFTVPGGNFQDKGTPVFLKEIAFKFFAISDAISLV  237

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             T+A+SLL FLS+ TSRYAEQ+FL++LPNRLIIGL TLF SI  MM AF +T +LVFG   
Sbjct  238   TSASSLLTFLSIRTSRYAEQNFLWSLPNRLIIGLTTLFISIGAMMVAFMATFFLVFGNKL  297

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
                 I +  +ASLP+  F+   F L V ++ STY
Sbjct  298   LPYSIPIAVVASLPVIFFIWQHFRLFVDMIHSTY  331



>gb|EPS64453.1| hypothetical protein M569_10326, partial [Genlisea aurea]
Length=555

 Score =   218 bits (556),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 166/414 (40%), Positives = 229/414 (55%), Gaps = 24/414 (6%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
             + FYD+AL  V Q+  +      +   PPL+ +        + ANF+ WK  +Y      
Sbjct  163   AGFYDLALYAVEQNPKLAWET--DEVSPPLELLAMDSSAFRSGANFNLWKSLLY------  214

Query  185   SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVH  364
                       L   K I     MH QA +L+K +C+E K+L D  +  SL +   L    
Sbjct  215   ---------SLPPLKRIRVSKAMHCQAVELVKRVCEETKSL-DTAEASSLLTGPFLLGAR  264

Query  365   LDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIR---GTSVLVHNLQDT  535
               I E+V  I++++P      D  + ++ H+A+  R E IF L+    G   +  +L   
Sbjct  265   NGIHEMVKEILDSFPHAITFVDDENHSVFHLAVLYRHEKIFKLVHQQSGQYKMAMSL--L  322

Query  536   INGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTP  715
             ++   N+I++L      Q +L L  GA LQMQRELQW+KEV+K  +P      +  GK P
Sbjct  323   LDNKKNNILHLVGHRQYQDRLELAPGAVLQMQRELQWYKEVEKFVIPQERKSKNASGKMP  382

Query  716   EMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSH  895
                F E HR L     +WM   ATSC++AA+LI TV FAAAITVPGGN +  G PIFS  
Sbjct  383   LTVFHEEHRELISNETQWMIGMATSCSVAASLIATVAFAAAITVPGGN-NPEGFPIFSGE  441

Query  896   NAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMM  1075
               F VFA+S+A +L T+ T++L FLS+ TSRYA  DFL ALPNRLIIGLI+LFFS+  +M
Sbjct  442   ALFLVFAVSDAMALLTSVTTVLSFLSIFTSRYAVNDFLRALPNRLIIGLISLFFSVACLM  501

Query  1076  TAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
              AF ST++LV  Q K  + + V   +  PI  F   QFP L  +++STYGP IF
Sbjct  502   IAFGSTVFLVVAQQKRALLLPVILASCAPIILFASFQFPPLCNMIASTYGPSIF  555



>ref|XP_006487634.1| PREDICTED: uncharacterized protein LOC102628573 [Citrus sinensis]
Length=700

 Score =   221 bits (563),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 151/336 (45%), Positives = 218/336 (65%), Gaps = 7/336 (2%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I  + L H +  ++++ +C+ +   N   Q  +  S A+L A  L I EVV   + AY
Sbjct  345   KVIHDQKLTHMRTVEIVRIICEGVVWTN--FQKSAQLSGAMLSAAILGIPEVVNEFIMAY  402

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
              + +  S+ +   I   A+ +R E +FNLI+G +     L  + + +GN+I++LA +L P
Sbjct  403   DSCSNWSNQDGHTIFDHAVLHRREKVFNLIQGVNFTTF-LFSSRDKSGNNILHLAGRLVP  461

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +   V+GAALQMQRELQWFK V+ +  P+F    ++   TP   FT+ H+ L  EGEK
Sbjct  462   SSE---VAGAALQMQRELQWFKAVENLVHPFFREATNDLKNTPREVFTKEHKELVKEGEK  518

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WMK+TA+SC++ AALI+TVVFAAA TVPGG  D  G+P F    +F +FAIS+  +LF++
Sbjct  519   WMKETASSCSVVAALIITVVFAAAFTVPGG-IDGRGVPNFLYEQSFMIFAISDMLALFSS  577

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
              TS+L+FL +LTSRYAE+DFL +LP +LIIGLITLFFSI  MM AF +T+++      + 
Sbjct  578   ITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLITLFFSIASMMVAFGATVHISLSHKWNL  637

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGI  1234
             + I +  +  +P+T F LLQFPLL+ + SSTYGPGI
Sbjct  638   VIIPIALVGCVPVTLFALLQFPLLLDMYSSTYGPGI  673



>ref|XP_008231516.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=533

 Score =   218 bits (554),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 205/310 (66%), Gaps = 9/310 (3%)
 Frame = +2

Query  329   SLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTS  508
              L  +AL +AV   I E V+ + +  P + + ++    NI H +IE R E +++LI G  
Sbjct  224   GLVYEALFQAVRRGITEFVIHLCKVDPDVLWRNNSMGRNIFHYSIECRQEKVYSLIYG--  281

Query  509   VLVHNLQDTI-NGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKI-ALPYF  682
             V   NL  T  +  GND+++LA  L+P  KL+ +SGAALQMQRE QWFKEV++I  LP  
Sbjct  282   VRQRNLIATCSDAFGNDMLHLAGMLSPTEKLDRISGAALQMQRERQWFKEVKRIVVLPSG  341

Query  683   SSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNS  862
                 ++ GK P   FT+NH+ LK EGEKWMK+ ATS T+  AL +T++FAAA TVPGGN+
Sbjct  342   VIAFNKEGKRPHELFTQNHKKLKEEGEKWMKEAATSSTVVGALTITIMFAAAFTVPGGNN  401

Query  863   DANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGL  1042
                GLPIF   N F +F +S+A SLF++ TS+L+FL +LTSRYAE DFL +LP ++IIGL
Sbjct  402   GGTGLPIFLHENMFMIFVVSDAISLFSSITSVLMFLGILTSRYAEDDFLKSLPTKMIIGL  461

Query  1043  ITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA--LASLPITSFVLLQFPLLVALVSS  1216
              TL  SI  MM AF S ++L+  +    + +++P   LA++P+  F+ +QFPLLV +  S
Sbjct  462   STLLISIATMMDAFCSALFLMLHER---LHVVIPIIFLATIPVALFIGMQFPLLVEIFIS  518

Query  1217  TYGPGIFSQR  1246
             TYG GIF ++
Sbjct  519   TYGGGIFDKK  528



>ref|XP_006297262.1| hypothetical protein CARUB_v10013276mg [Capsella rubella]
 gb|EOA30160.1| hypothetical protein CARUB_v10013276mg [Capsella rubella]
Length=599

 Score =   219 bits (558),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 142/340 (42%), Positives = 207/340 (61%), Gaps = 1/340 (0%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             + + K  L H +A  +L C+C E+   +   Q  +    AL +AV   I E +  ++  Y
Sbjct  252   RRVYKLKLGHARAKKILDCICGEIPNFDAAQQKNTGLHQALFKAVENGIVEYIDEVMRHY  311

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
             P + +  D+  LN+   A+  R E IF+LI       + L    +   N++++ AA  AP
Sbjct  312   PDIVWLKDNYGLNLFFYAVSQRQEKIFSLIYNMGAKKNILATAWDKLHNNMLHHAAYRAP  371

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMD-EYGKTPEMHFTENHRLLKIEGE  763
               +LNL+ GAALQMQRELQWFKEV+ +  P     ++ +  KTP+  FT+ H+ L  +GE
Sbjct  372   ASRLNLIPGAALQMQRELQWFKEVESLVQPKHRKMVNLKQKKTPKALFTDQHKELVEQGE  431

Query  764   KWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslft  943
             KWMKDTA SCT+ AALI T++F++A TVPGG    NGLP++   N F +F IS+A SLFT
Sbjct  432   KWMKDTAASCTVVAALITTMMFSSAFTVPGGYRSDNGLPLYMHQNIFKIFIISDAISLFT  491

Query  944   aatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKS  1123
             +  SLL+FL +L SRY E+DFL +LP +LI+GL++LF S+  MM  F  T+  + G   S
Sbjct  492   SCMSLLMFLGILKSRYREEDFLRSLPTKLIVGLLSLFLSMATMMVTFVVTLMTLVGDKIS  551

Query  1124  WIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             W+      LA +P+  FV+LQFP+L+ +  STY P +F +
Sbjct  552   WVLAQFMLLAVIPLGMFVVLQFPVLLEIFCSTYFPKVFEK  591



>emb|CBI37570.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 148/343 (43%), Positives = 208/343 (61%), Gaps = 6/343 (2%)
 Frame = +2

Query  224   WKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEA  403
             +K I +   +H  ++ LL C+ +E+  L   +   +    AL  A+   I E V+ +++ 
Sbjct  30    FKHIYETKWVHVGSSQLLDCIFEEIPNLTMESLQMAGMDHALYDAIKHGIIEFVVKLMKQ  89

Query  404   YPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAA  574
                  +        +   AI  R E IF+LI G  +   +V    D  +   N+I++LA 
Sbjct  90    DHESIWRKGVKGRTMFSHAIVLRQEKIFSLIYGLGIKKNIVARRHDIFH---NNILHLAG  146

Query  575   KLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKI  754
             KL+P  +L+ VSGAALQMQRELQWFKEV+ +    +    +EY KTP   FTE H  L  
Sbjct  147   KLSPPSQLDRVSGAALQMQRELQWFKEVESMVQAKYKEEFNEYHKTPSTVFTEEHATLVK  206

Query  755   EGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaas  934
             EGE WMK TA SC + A LI  ++F  A T+PGG     G+P+F  H AF VF ++++ S
Sbjct  207   EGESWMKSTAASCMVVATLIAALMFTTAFTLPGGTKSDTGIPVFIGHGAFMVFIVADSLS  266

Query  935   lftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQ  1114
             LF+++TS+L+FL +LTSRYAE+DFL +LPN+LIIGL +LFFS++ MM AF S IY+V   
Sbjct  267   LFSSSTSVLMFLGILTSRYAEEDFLKSLPNKLIIGLSSLFFSLLSMMVAFGSAIYVVLSH  326

Query  1115  NKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
               +W+ I +  LA +PIT F LLQFPLLV +V  TYG  IF +
Sbjct  327   RIAWVSIPLIVLACIPITFFALLQFPLLVEIVMCTYGRSIFDK  369



>ref|XP_006465922.1| PREDICTED: uncharacterized protein LOC102626928 [Citrus sinensis]
Length=660

 Score =   220 bits (561),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 152/356 (43%), Positives = 221/356 (62%), Gaps = 20/356 (6%)
 Frame = +2

Query  212   QLLLW----------KSIPKKILMHQQATDLLKCLC-DELKTLNDYNQVFSLASDALLRA  358
             +L+LW          KSI    ++H+Q  ++L+ +C   +  LN + +  ++    + +A
Sbjct  303   KLVLWNNLMELAPSIKSIRDAKIIHEQTLEILRIMCAGAVDILNTHEEAQNVFKKPMFKA  362

Query  359   VHLDIAEVVLSIVEAY-PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDT  535
               L I E+V+ I+ +Y P      + +  +I  +A+E+R E +FN+I     +       
Sbjct  363   ARLGIYEIVMGIMNSYFPWSLEFKNKDGYDIFKVAVEHRREKVFNIIFNFPNIYPFFLAN  422

Query  536   INGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTP  715
             I+  G +I+++AA+  P  +   V GAALQMQRELQWFK V+    P     ++   KTP
Sbjct  423   IDEKGINILHIAARSVPSTE---VPGAALQMQRELQWFKAVENFVHPTLQDQLNGEDKTP  479

Query  716   EMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSH  895
                FTE H  L  EGEKWMKDTA SC++ A LI+T+VFAAAITVPGG SD+ G+P F   
Sbjct  480   REVFTEEHEKLVEEGEKWMKDTAGSCSVVATLIMTIVFAAAITVPGG-SDSRGMPNFLEE  538

Query  896   NAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMM  1075
              +FT+F ISNA +LF++  S+L+FL +LTSR++E+DFL +LP +LIIGLITLFFSI  +M
Sbjct  539   PSFTIFGISNALALFSSVISVLMFLGILTSRFSEEDFLVSLPRKLIIGLITLFFSIACLM  598

Query  1076  TAFSSTIYLVFGQNKSWIRIIVPA--LASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
              AF++T+++   Q   W  +I+P   L  LP+  F  LQFPLL+ +  STYGPGIF
Sbjct  599   VAFAATVHIT--QFHPWKWVIIPTALLGFLPVFLFATLQFPLLIEVFLSTYGPGIF  652



>ref|XP_008245179.1| PREDICTED: uncharacterized protein LOC103343293 [Prunus mume]
Length=705

 Score =   221 bits (562),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 221/350 (63%), Gaps = 13/350 (4%)
 Frame = +2

Query  212   QLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLS  391
             ++L  K + +  L H +A +LL  +C+  K  +  + +F     A+ RA  L + E +  
Sbjct  359   EILGIKRLREMKLAHIEALELLDNMCEVTKHSDSEDFLFP----AVFRATELGMFEFIDR  414

Query  392   IVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLI-----RGTSVLVHNLQDTINGNGND  556
             +++A P + +  +    N+   AIE R E ++NL      +     + N+ D  N   N 
Sbjct  415   VLQARPNIVWACNSKRRNLFQFAIECRQEKVYNLFYYKLSKRRRTAIGNIVDQDN---NC  471

Query  557   IMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTEN  736
              +++A  L+P  +L+ +SGAAL+MQRELQWFKEV+ I +P     +++  K P   FT+N
Sbjct  472   ALHVAGTLSPLARLDNISGAALKMQRELQWFKEVENIVVPLIKESLNKEHKMPREMFTKN  531

Query  737   HRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFA  916
             H  L  EGE+WMK+TA+SCT+  ALI+T++FAAA T+PGGN+   G PIF     F  F 
Sbjct  532   HNQLAKEGERWMKETASSCTVVGALIITIMFAAAFTIPGGNNGQTGFPIFLHKKLFMAFI  591

Query  917   ISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTI  1096
             +S+A SLF++ TS+L+FL +LTSRYAE DFL +LP ++IIGL TLF SI  MM AFSS +
Sbjct  592   VSDAVSLFSSTTSVLMFLGILTSRYAEDDFLKSLPTKMIIGLSTLFISIATMMVAFSSAL  651

Query  1097  YLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
             +++  + +SWI I +  +AS+P+T F+ +QFPLLV +  STYG GIF ++
Sbjct  652   FIMIHE-QSWIVIPMIFVASVPVTLFIWMQFPLLVEMYISTYGRGIFDRK  700



>ref|XP_009614684.1| PREDICTED: uncharacterized protein LOC104107554 isoform X4 [Nicotiana 
tomentosiformis]
Length=677

 Score =   220 bits (561),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 145/316 (46%), Positives = 198/316 (63%), Gaps = 2/316 (1%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K +    L +Q A  L + LC++LK L++  ++ S+    LL+AVH D  ++V   V  +
Sbjct  340   KPLSSPELEYQNAIKLAEFLCEKLKGLSE-KEIISIVGGPLLQAVHFDNYKLVEIFVGKF  398

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
             P + Y S+ N  NILHIA+ENRC N+FNL+   S   HNL  +++   N +++LA KL P
Sbjct  399   PLLVYHSNKNGKNILHIAVENRCTNVFNLVCQMSQHRHNLITSVDSFNNTMLHLAGKLPP  458

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
             ++K+N   GAAL+MQ EL+WF+ V+++  P +   ++  GKT    FT  H  LKIEGEK
Sbjct  459   KNKVNHTFGAALRMQEELRWFEVVKEMLPPPYFERLNNKGKTAHQVFTVQHANLKIEGEK  518

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WMK+TA+SC I A L V + F A ITVPGG +  NGLPIFS +  F+ FA SN  SL TA
Sbjct  519   WMKETASSCAIIAMLTVAIAFGATITVPGGRNCENGLPIFSRNGFFSAFAFSNTVSLSTA  578

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
               SL  F+S+LTS YAE+DFL  LP RL+ GL+TL+ SI  MM +F   +Y VF  N   
Sbjct  579   CISLFAFVSILTSSYAEEDFLRVLPKRLLWGLLTLYASIEAMMLSFGCALYFVFKDN-YM  637

Query  1127  IRIIVPALASLPITSF  1174
             +  +   LA LPI  F
Sbjct  638   VFYVGFVLAVLPILPF  653



>emb|CAN68156.1| hypothetical protein VITISV_036768 [Vitis vinifera]
Length=297

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 203/334 (61%), Gaps = 47/334 (14%)
 Frame = +2

Query  251   MHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSD  430
             MH     LL  LC E+  ++   ++F     + +      I E++  I+++YP   Y  +
Sbjct  1     MHTLTLQLLNHLCTEVLKVSRAKEIFR---QSFINGAKYGIPEILEEIIKSYP---YALE  54

Query  431   HNDLNILHIAIENRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLAPQHKLN  601
             + D ++  +A+ NR E IFNLI  T +   L+   +D  + N ++I++LA KLAP H+L+
Sbjct  55    YLDEDVFKLAVLNRYEKIFNLICETGMHRQLIIRTRD--DSNNDNILHLAGKLAPPHRLS  112

Query  602   LVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDT  781
             LVSGAALQMQREL WFK++            D Y                         T
Sbjct  113   LVSGAALQMQRELHWFKKL-----------FDFY-------------------------T  136

Query  782   ATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsll  961
             A   T+AAAL+ TVVFAAAIT+PGGN D  G P FS   AF VFA+S+A SLF +  S L
Sbjct  137   AKFYTLAAALLATVVFAAAITIPGGNHDDTGTPNFSKEIAFKVFAVSDALSLFLSIASAL  196

Query  962   vflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIV  1141
             + LS+LT+RYAE DFL+ALP RLI GL+TLF S+  MM A+SS IYL+FG+ K+WI I +
Sbjct  197   ICLSILTTRYAEDDFLFALPRRLIFGLVTLFLSVTFMMIAYSSAIYLLFGEKKAWILITL  256

Query  1142  PALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              ALA LP+T + +LQFPLLV L+ STYGPGIF +
Sbjct  257   AALACLPVTLYGILQFPLLVELIYSTYGPGIFGK  290



>ref|XP_010419743.1| PREDICTED: uncharacterized protein LOC104705430 [Camelina sativa]
Length=687

 Score =   220 bits (561),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 163/470 (35%), Positives = 250/470 (53%), Gaps = 63/470 (13%)
 Frame = +2

Query  11    FYDMALELVGQHHDV--THHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISKN  184
              Y +AL+L+ ++  +  T  +  + G+    A+ +  C   +    +FW++ IY+CI   
Sbjct  208   LYGIALDLIQRYPKLAYTRDSDNDTGII---ALAQTPCAFPSGTRLAFWQKWIYHCIHIE  264

Query  185   SASTQNFV----------------SQLLLWKSIP----------KKILMHQQATDLLKCL  286
               +  + V                 Q  LWK +           K  L H QA ++L+C+
Sbjct  265   KVNNPHEVLNHHDHQYRKAEDHSWIQDKLWKHLKVLFPHIRRVYKLKLGHAQAKEILECI  324

Query  287   CDEL------------------------------KTLNDYNQVFSLASDALLRAVHLDIA  376
             C E+                              + +  Y  +  L  D L +AV   I 
Sbjct  325   CQEIPNFDVTQQKNTGLHQALFKAVENGIVEYIEEVMRHYPDIVWL-KDTLFKAVENGIV  383

Query  377   EVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGND  556
             E +  ++  YP + +  D+  LN+   A+  R E IF+LI       + L    +   N+
Sbjct  384   EYIEEVMRHYPDIVWLKDNYGLNLFFYAVSQRQEKIFSLIYNMGAKKNILATAWDKLHNN  443

Query  557   IMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMD-EYGKTPEMHFTE  733
             +++ AA  AP  +LNL+ GAALQMQRELQWFKEV+++  P     ++ +  KTP+  FT+
Sbjct  444   MLHHAAYRAPASRLNLIPGAALQMQRELQWFKEVERLVQPKHRKMINLKQKKTPKALFTD  503

Query  734   NHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVF  913
              H+ L  +GEKWMKDTATSCT+ AALI T++F++A TVPGG    NGLP++   + F +F
Sbjct  504   QHKDLVDQGEKWMKDTATSCTVVAALITTMMFSSAFTVPGGYRSDNGLPLYMRKHIFKIF  563

Query  914   AISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSST  1093
               S+A SLFT+  SLL+FL +L SRY E+DFL +LP +LI+GL++LF S+  MM  F  T
Sbjct  564   ISSDAISLFTSCMSLLMFLGILKSRYREEDFLRSLPTKLIVGLLSLFLSMATMMVTFVVT  623

Query  1094  IYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             +  + G+ KSW+      LA +P+  FV+LQFP+L+ +  STY P +F +
Sbjct  624   LMTLVGEKKSWVSAQFMLLAVIPLGMFVVLQFPVLLEIFCSTYFPRVFEK  673



>ref|XP_002311023.2| hypothetical protein POPTR_0008s02350g [Populus trichocarpa]
 gb|EEE88390.2| hypothetical protein POPTR_0008s02350g [Populus trichocarpa]
Length=676

 Score =   219 bits (558),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 241/409 (59%), Gaps = 19/409 (5%)
 Frame = +2

Query  38    GQHHDVTHHAALNMGVPPLDAIVKY--DCPIINTANFSFWKRSIYYCISKNSASTQNF--  205
             G  H  ++     +G   LD ++ +   CP   T      + +    +SK     Q F  
Sbjct  276   GNGHHGSYFLQCALGAQMLDIVLDFLHRCPRFATTMNEVLRTNALIYLSK---MPQTFPS  332

Query  206   VSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVV  385
              S+L  W+   + I  ++    +L+C+C+ + TL+    + +    A  +A    + E +
Sbjct  333   ASRLAFWQ---RWIYSYK----ILRCMCEYISTLDYEEYIKADVHRAFHKAARNGMVEFI  385

Query  386   LSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMN  565
               +V+A P +   +D N  N+   +I NR E +F+L  G           ++ + N +++
Sbjct  386   TEVVKACPHVMTSADGNARNLFMSSIANRQEKVFSLFYGLESNRARFVCLMDISRNTMLH  445

Query  566   LAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRL  745
             LAAKL+P  +L  +SGAALQMQRELQW+KEV+ I  P     +++  +TP   FT +H+ 
Sbjct  446   LAAKLSPPSQLARISGAALQMQRELQWYKEVESIVNPTDKDFLNQNDQTPREIFTYDHKD  505

Query  746   LKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISN  925
             L ++GE+WMK+ ATSCT+  ALI+T++F  A TVPGGN    G P+F    +FTVF +++
Sbjct  506   LVVKGEQWMKEAATSCTVVGALIITIMFTVAFTVPGGNVQETGYPVFKDEKSFTVFIVAD  565

Query  926   aaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLV  1105
             A SLF+++TS+L+FL +L SRYAE+DFL +LP +LIIGL  LFFSI  MM  F + + ++
Sbjct  566   AISLFSSSTSVLMFLGILMSRYAEEDFLKSLPTKLIIGLSMLFFSIAAMMVTFCAALIIM  625

Query  1106  FGQNKSWIRIIVPA--LASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
                    +++I+P   LA++P+T F+ LQFPLLV +  STYGPGIF+++
Sbjct  626   LDGR---LQVIIPIVLLATIPVTFFMWLQFPLLVEIFVSTYGPGIFNRK  671



>gb|EYU45770.1| hypothetical protein MIMGU_mgv1a026656mg, partial [Erythranthe 
guttata]
Length=354

 Score =   212 bits (539),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 137/328 (42%), Positives = 213/328 (65%), Gaps = 4/328 (1%)
 Frame = +2

Query  260   QATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS--DH  433
             +A  L+  LC  ++++ ++N+   +A  A++ A  +   E+V  I+EA+P   Y S  + 
Sbjct  17    KARLLVALLCKNMESM-EFNEAIHIAHHAVICATKIGNHEIVEMIIEAFPNAIYSSYMES  75

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             +  +I H+A+ NRCE +F L+   +       D ++ +GN+++++AAKLAP HKLN +SG
Sbjct  76    SPGSIFHVAVLNRCEEVFKLLYHMNGHKFVYSDVVDNSGNNLLHMAAKLAPSHKLNQISG  135

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
             AALQMQRE+QW++ V+K+        ++  GKTP+M FTE H+ L+ EG KWMK+T+ +C
Sbjct  136   AALQMQREIQWYRLVEKLVARSSKIQINNEGKTPKMVFTEEHKNLEEEGAKWMKETSQNC  195

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
             T+ A+LI T +F+ A TVPGGN    GLPIF     F V+A+    SL  +  +L+ FLS
Sbjct  196   TVVASLIATFMFSCAFTVPGGNDGNTGLPIFYRQRMFFVYALFLFLSLLASTYALINFLS  255

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             +L SRY+E++FL+ LP RL+IGLI+LF SI+ MM   ++T+YLV  + K W+ I V    
Sbjct  256   ILISRYSEEEFLHTLPKRLLIGLISLFLSIMFMMVTCTATVYLVSDRMK-WVLITVGVCG  314

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             SL ++ F+ + F L++ L++ TYG  IF
Sbjct  315   SLLLSLFLRVLFRLIIDLINCTYGRQIF  342



>gb|EYU28332.1| hypothetical protein MIMGU_mgv1a003521mg [Erythranthe guttata]
Length=580

 Score =   217 bits (553),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 211/348 (61%), Gaps = 3/348 (1%)
 Frame = +2

Query  197   QNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIA  376
             Q  +  L+  K +  K  MH+ A  L+K LC E+K L D  +  S+ +   L      I 
Sbjct  234   QFLIYSLIPLKRVRHKKAMHRHAHQLVKRLCSEIKCL-DNAKASSILTGPFLIGAQNGIH  292

Query  377   EVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVH-NLQDTINGNGN  553
             E+V  I+E++P      D  + ++ H+A   R E IF ++   S     +L   ++  GN
Sbjct  293   EIVREILESFPHAITFLDEENHSVFHLAAMYRHEKIFKIVHQQSGQYKMSLSVLLDNRGN  352

Query  554   DIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTE  733
             +I++L A    Q +L+  S A L+MQRELQW+KE++   LP+     +  GKTP   F E
Sbjct  353   NILHLVACGPHQDRLDFSSRAVLRMQRELQWYKEIETFVLPHERKSKNADGKTPLTIFNE  412

Query  734   NHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVF  913
              HR L     +WM   +TSCT+AA+LI TV FAAAITVPGG + ++G P FS+ NAF  F
Sbjct  413   EHRELAAYETQWMIGMSTSCTVAASLIATVAFAAAITVPGGTT-SDGSPTFSTENAFVAF  471

Query  914   AISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSST  1093
             A+S+A +L ++ T++L FLS+ TSRY   DFLYALPNRLIIGLI+LF S+  +M AFSST
Sbjct  472   AVSDALALLSSLTTVLSFLSIFTSRYTVNDFLYALPNRLIIGLISLFMSVTSLMLAFSST  531

Query  1094  IYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             +YLV  Q    I I + ALA +P+T F  LQ P L+ ++ STYGP IF
Sbjct  532   MYLVAAQKNGLILIPIIALACVPVTLFACLQLPPLLNMIKSTYGPSIF  579



>ref|XP_002275383.2| PREDICTED: uncharacterized protein LOC100245499 isoform X4 [Vitis 
vinifera]
Length=718

 Score =   219 bits (559),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 165/444 (37%), Positives = 243/444 (55%), Gaps = 39/444 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVT----HHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYC  172
             +  YD+AL L+  H  +     ++  L M +     + +      + +   FW+R IY  
Sbjct  277   ANIYDIALHLLKHHRQLGFIKDYYGKLTMRI-----LAQKPSAFPSGSKLVFWERWIYSL  331

Query  173   I------------------------SKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLK  280
             I                         ++S   Q+ +S++  +K I +   +H  ++ LL 
Sbjct  332   IHIKPFDEQYQEHEQPHQAPADEDNPESSRQGQHLISRVPDFKHIYETKWVHVGSSQLLD  391

Query  281   CLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIA  460
             C+ +E+  L   +   +    AL  A+   I E V+ +++      +        +   A
Sbjct  392   CIFEEIPNLTMESLQMAGMDHALYDAIKHGIIEFVVKLMKQDHESIWRKGVKGRTMFSHA  451

Query  461   IENRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQ  631
             I  R E IF+LI G  +   +V    D  +   N+I++LA KL+P  +L+ VSGAALQMQ
Sbjct  452   IVLRQEKIFSLIYGLGIKKNIVARRHDIFH---NNILHLAGKLSPPSQLDRVSGAALQMQ  508

Query  632   RELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaal  811
             RELQWFKEV+ +    +    +EY KTP   FTE H  L  EGE WMK TA SC + A L
Sbjct  509   RELQWFKEVESMVQAKYKEEFNEYHKTPSTVFTEEHATLVKEGESWMKSTAASCMVVATL  568

Query  812   ivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRY  991
             I  ++F  A T+PGG     G+P+F  H AF VF ++++ SLF+++TS+L+FL +LTSRY
Sbjct  569   IAALMFTTAFTLPGGTKSDTGIPVFIGHGAFMVFIVADSLSLFSSSTSVLMFLGILTSRY  628

Query  992   AEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITS  1171
             AE+DFL +LPN+LIIGL +LFFS++ MM AF S IY+V     +W+ I +  LA +PIT 
Sbjct  629   AEEDFLKSLPNKLIIGLSSLFFSLLSMMVAFGSAIYVVLSHRIAWVSIPLIVLACIPITF  688

Query  1172  FVLLQFPLLVALVSSTYGPGIFSQ  1243
             F LLQFPLLV +V  TYG  IF +
Sbjct  689   FALLQFPLLVEIVMCTYGRSIFDK  712



>ref|XP_008380086.1| PREDICTED: uncharacterized protein LOC103443078 [Malus domestica]
Length=570

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 153/349 (44%), Positives = 221/349 (63%), Gaps = 4/349 (1%)
 Frame = +2

Query  200   NFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAE  379
             +++++ L    I K   +H ++  +L  +C E+K L+   Q+ S  + A+LRAV     E
Sbjct  219   SYIAEKLGINXIYKIKTVHVRSLAVLDVMCKEIKKLDMDQQLLSTVASAMLRAVDKGNVE  278

Query  380   VVLSIVEAYPTMAYCSDHNDLNIL-HIAIENRCENIFNLIRGTSVLVHNLQDTINGNGND  556
              +  I +A P + +  ++    IL H A++ R E I+NL+ G S     +  T N N N+
Sbjct  279   FITKICKANPELQFVWNNEKSKILFHYAVQCRQEKIYNLLHGISAKDWFIALTDNDN-NN  337

Query  557   IMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTEN  736
             ++++A  LAP  +LN + GAALQMQRELQW+KEV+ +  P F    ++   TP   FT++
Sbjct  338   MLHMAGLLAPFTQLNCIPGAALQMQRELQWYKEVEAVVPPKFLDSTNKDNLTPRDLFTKS  397

Query  737   HRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFA  916
             H  L  +GEKWMK+TATS T+  ALI+T++FAAAITVPGGN D  G P F +   F VF 
Sbjct  398   HSELLQKGEKWMKETATSYTVVGALIITMMFAAAITVPGGNKD-TGFPAFINEKLFMVFI  456

Query  917   ISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTI  1096
              S+A SLF++ T+ L FL +LTSRYAE DFL +LP ++IIGL +LFF+I  MM AFS+ +
Sbjct  457   ASDAISLFSSTTATLTFLGILTSRYAEDDFLKSLPTKMIIGLASLFFAIATMMIAFSTAL  516

Query  1097  YLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              L+     SWI I V  L+S+P+T F  ++FPLLV +  STYG G F++
Sbjct  517   -LIINCGHSWIVIPVILLSSVPVTLFAWMEFPLLVRITVSTYGKGKFNR  564



>ref|XP_004288982.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Fragaria 
vesca subsp. vesca]
Length=316

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 200/309 (65%), Gaps = 3/309 (1%)
 Frame = +2

Query  326   FSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS-DHNDLNILHIAIENRCENIFNLIRG  502
             + L S+ L  A    I+E++ ++++ +P + +    +N   +L  AIE R EN+F L+  
Sbjct  7     YVLNSNILYMATRNGISEIIGTLLDFFPDLIWARLSNNQFLLLPFAIELRHENVFRLVCD  66

Query  503   TSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYF  682
              +     +  T+  +G  I++LAAKLAP  +LN V GAALQMQRELQWFK V+ +  PY+
Sbjct  67    HTARSKLMASTLLDSGISILHLAAKLAPLAQLNSVCGAALQMQRELQWFKVVETLVHPYY  126

Query  683   SSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNS  862
                 +E  +T +  FT+ H  L  +GEKW+KDT+ SC + A LI TVV AAA TVPGGN 
Sbjct  127   KQSKNEANQTAKELFTKEHENLAEKGEKWLKDTSNSCMVVATLIATVVVAAAFTVPGGND  186

Query  863   DANGLPIFSSHNA--FTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLII  1036
             +A+G P F       F VF IS+A +LF++ TSLL+FLS+LT+R+AE+DF+ +LP RLII
Sbjct  187   EADGNPNFLMKKPFIFMVFLISDAVALFSSLTSLLMFLSILTARFAEEDFIDSLPKRLII  246

Query  1037  GLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSS  1216
             GL +LFF+I   + AF +TI +V  +  SW+ I +  LAS P+T F +LQ PL + +V S
Sbjct  247   GLASLFFAIAATIVAFGATISIVLSKRFSWVSIPITLLASFPVTLFAMLQLPLFIQMVRS  306

Query  1217  TYGPGIFSQ  1243
             T+G  IF Q
Sbjct  307   TFGNSIFRQ  315



>dbj|BAB01793.1| unnamed protein product [Arabidopsis thaliana]
Length=653

 Score =   218 bits (555),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 150/398 (38%), Positives = 231/398 (58%), Gaps = 30/398 (8%)
 Frame = +2

Query  137   NFSFWKRSIYYCIS-------------------KNSASTQNFVSQLL-----LWKSIPKK  244
               +FW+R IY CI                    +NS    +   +L+     L+  I ++
Sbjct  250   RLAFWQRWIYSCIHIEKINNPHEVNNHHHHHQYRNSQDHNSIQEKLMKHLKYLFPRIIRR  309

Query  245   I----LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPT  412
             +    L H QA ++L C+C E+   +   Q  +  + AL +AV   I E +  ++  YP 
Sbjct  310   VYKLKLGHAQAKEILDCICQEIPKFDAAQQKNAGLNQALFKAVENGIVEYIEEMMRHYPD  369

Query  413   MAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQH  592
             + +  + + LNI   A+  R E IF+LI       + L    +   N++++ AA  AP  
Sbjct  370   IVWSKNSSGLNIFFYAVSQRQEKIFSLIYNIGAKKNILATNWDIFHNNMLHHAAYRAPAS  429

Query  593   KLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMD-EYGKTPEMHFTENHRLLKIEGEKW  769
             +LNL+ GAALQMQRELQWFKEV+K+  P     ++ +  KTP+  FT+ H+ L  +GEKW
Sbjct  430   RLNLIPGAALQMQRELQWFKEVEKLVQPKHRKMVNLKQKKTPKALFTDQHKDLVEQGEKW  489

Query  770   MKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaa  949
             MK+TATSCT+ AALI T++F++A TVPGG   ++G+P++   + F +F IS+A SLFT+ 
Sbjct  490   MKETATSCTVVAALITTMMFSSAFTVPGGYR-SDGMPLYIHQHRFKIFLISDAISLFTSC  548

Query  950   tsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWI  1129
              SLL+FL +L SRY E+DFL +LP +LI+GL+ LF S+  M+  F  T+  + G+  SW+
Sbjct  549   MSLLMFLGILKSRYREEDFLRSLPTKLIVGLLALFLSMATMIVTFVVTLMTLVGEKISWV  608

Query  1130  RIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
                   LA +P+  FV+LQFP+L+ +  +TY P +F +
Sbjct  609   SAQFMFLAVIPLGMFVVLQFPVLLEIFRATYCPNVFDK  646



>ref|XP_006431545.1| hypothetical protein CICLE_v10003295mg, partial [Citrus clementina]
 gb|ESR44785.1| hypothetical protein CICLE_v10003295mg, partial [Citrus clementina]
Length=497

 Score =   214 bits (546),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 149/341 (44%), Positives = 217/341 (64%), Gaps = 11/341 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I  + L H +  ++++ +C  +   N  N+   L   A+  A  L I E V   + AY
Sbjct  156   KVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLG--AMFTATRLGIPEFVNEFIMAY  213

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGT--SVLVHNLQDTINGNGNDIMNLAAKL  580
                A+    ++  I  +A+ +R E +FNLI G   +  + + +D +   GN+I++LA +L
Sbjct  214   DNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFL---GNNILHLAGRL  270

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
              P  +   V+GAALQMQRELQWFK V+ +  P      ++  +TP   FT+ H+ L  EG
Sbjct  271   VPSSE---VAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEG  327

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK+TA+SC++ AALI+TVVFAAA TVPGGN D+ G+P +    +F VFAIS+  +LF
Sbjct  328   EKWMKETASSCSVVAALIITVVFAAAFTVPGGN-DSRGIPNYLHEPSFMVFAISDMLALF  386

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++ TS+L+FL +LTSRYAE+DFL +LP +LIIGL+TLFFSI  MM AF +T+++      
Sbjct  387   SSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLYHKW  446

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             + + I +  +  +P+T F LLQFPLL+ + SSTYG GIF Q
Sbjct  447   NLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQ  487



>ref|XP_008360874.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=553

 Score =   215 bits (547),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 204/338 (60%), Gaps = 4/338 (1%)
 Frame = +2

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYP  409
             K+ L   QA  L++CL  E+   +D ++V  L    S+ +  A  L   E +  ++++YP
Sbjct  211   KRNLKQTQALKLVECLWKEMLKHDD-DEVMHLIREPSELVFDAAKLGNYEFLSVLIDSYP  269

Query  410   TMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQ  589
              +    D N+  I HIA+ +R  +IFNL+  T  +   +    +   N+I++LAAKLAPQ
Sbjct  270   ELLLEYDDNNRTIFHIAVLHRHASIFNLVHETGSIKDIIATFTDDENNNILHLAAKLAPQ  329

Query  590   HKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKW  769
              +LNLVSGAALQMQREL WF+EV+KI  P F    +  GKTP   FT  H  L  +GE W
Sbjct  330   DQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNTQGKTPRELFTSEHEDLLRKGESW  389

Query  770   MKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaa  949
             MKDT  SC + + LI TVVF+AA ++PGG  D  G P F    AF +FAIS+  +LF+++
Sbjct  390   MKDTTNSCMLVSTLIATVVFSAAFSIPGGIDDNKGTPNFIKEEAFLIFAISDGVALFSSS  449

Query  950   tsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWI  1129
             T++L+FL +LTSRYAE DFL +LP +L++GL +LF SI  MM  FS+  YL       W+
Sbjct  450   TAILMFLYILTSRYAENDFLKSLPLKLMVGLTSLFVSITSMMVTFSTAFYLSCHYGLRWV  509

Query  1130  RIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
               ++   A +P+  F  LQ+PLL  +  STY   +  Q
Sbjct  510   PDLIFIFAFVPVALFAFLQYPLLFDMFFSTYCSSLLFQ  547



>ref|XP_007221398.1| hypothetical protein PRUPE_ppa020222mg [Prunus persica]
 gb|EMJ22597.1| hypothetical protein PRUPE_ppa020222mg [Prunus persica]
Length=631

 Score =   216 bits (551),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 224/372 (60%), Gaps = 24/372 (6%)
 Frame = +2

Query  161   IYYCISKNSAST---QNFVS--QLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQV  325
             +YYCI+K          F+S  +L  W+      L      +LL  +C+ +K  +D N  
Sbjct  269   LYYCIAKRKFEAFRPSTFLSGTRLKFWQQWIYDTL------ELLDNMCEVIKP-SDGNDF  321

Query  326   FSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLI---  496
                   A+ RA  L + E +  +++A P + +  +    N+   AIE R E ++NL    
Sbjct  322   LI---PAVFRATELGMFEFIDRVLQARPNLVWACNSMRRNLFQFAIECRQEKVYNLFYYK  378

Query  497   --RGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIA  670
               +   + + N+ D  N   N  +++A  L+P  +L+ +SGAAL+MQRELQWFKEV+ I 
Sbjct  379   LSKRQRIAIGNIADRDN---NCALHVAGTLSPLARLDNISGAALKMQRELQWFKEVENIV  435

Query  671   LPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvP  850
             LP     ++   K P   FT+NH  L  EGEKWMK+TA+SCT+  ALI+T++FAAA T+P
Sbjct  436   LPLVKESLNMEHKIPREMFTKNHNQLVKEGEKWMKETASSCTVVGALIITIMFAAAFTIP  495

Query  851   GGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRL  1030
             GGN+   G PIF     FT F +S+A SLF++ TS+L+FL +LTSRYAE DFL +LP ++
Sbjct  496   GGNNGQTGFPIFLHKKLFTAFIVSDAISLFSSTTSVLMFLGILTSRYAEDDFLTSLPTKM  555

Query  1031  IIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALV  1210
             IIGL TLF SI  MM AFSS ++++    + WI I +  +A +P+T F+ +QFPLLV + 
Sbjct  556   IIGLSTLFISIATMMVAFSSALFIMI-HEQLWIVIPMIVVAIIPVTLFIWMQFPLLVEMC  614

Query  1211  SSTYGPGIFSQR  1246
              STYG GIF ++
Sbjct  615   ISTYGRGIFDRK  626



>ref|XP_010658756.1| PREDICTED: uncharacterized protein LOC100254093 [Vitis vinifera]
 ref|XP_010658757.1| PREDICTED: uncharacterized protein LOC100254093 [Vitis vinifera]
Length=756

 Score =   218 bits (556),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 179/449 (40%), Positives = 250/449 (56%), Gaps = 40/449 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNM-GVPPLDAIVKYDCPIINTANFSFWKRSIYYCISK  181
             +KF D+AL ++ +H  +      N  GV PL  + +      + +   FW+R IY CIS 
Sbjct  306   TKFLDIALHILEKHPSLA--VTFNKDGVSPLYVLGQKPSLFKSGSQLWFWQRWIYSCISV  363

Query  182   N----------------------SASTQNFVSQLL-LWKSIPKKI----------LMHQQ  262
             N                        +T+  + QL+    S P+K+          L H Q
Sbjct  364   NVDCASDWIQINVVDDIAQGRDDRNNTKKGLGQLMHGLVSYPQKLPGIKNIHDQKLRHAQ  423

Query  263   ATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDL  442
             A  +L  +C EL+ +      F +   A+ +AV     E V  ++++ P +A+  D N  
Sbjct  424   AIKILGSICIELQNMKVDVLGFQV-HQAVFQAVKRGNVEFVTEMIKSIPELAWSHDINGR  482

Query  443   NILHIAIENRCENIFNLIRG-TSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAA  619
             NI  IAI NR E IFNL+ G T      +   ++   N++++L A LAP  +L+ +SGAA
Sbjct  483   NIFFIAILNRQEKIFNLLHGLTHAQKMKVISPLDRFRNNMLHLVAMLAPSEQLDGISGAA  542

Query  620   LQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCti  799
             LQMQRELQWFKEV+ I  P F    +  GK     F++ H  L  EGEKWMK+ ATS T 
Sbjct  543   LQMQRELQWFKEVESIVPPLFKDLTNSDGKKASEVFSQQHADLVKEGEKWMKEIATSSTF  602

Query  800   aaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvl  979
              AALIVT++FAAA T+P GN+D  G PIF     F VF IS++ SLF+A TS+L+FL +L
Sbjct  603   VAALIVTIMFAAAFTIPAGNND-KGAPIFLDDTFFIVFIISDSISLFSATTSVLMFLGIL  661

Query  980   tsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII-VPALAS  1156
             TS YAE  FL  LP +LIIGL  LF SI  MM AF + + ++  ++ + + +I +  LA 
Sbjct  662   TSVYAENKFLTRLPTKLIIGLSALFISIAAMMIAFCAALAVLLKESSTKVVMIPIILLAC  721

Query  1157  LPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             +P+T F LLQFPLLV +  STYGPGIF +
Sbjct  722   VPVTLFALLQFPLLVNIFISTYGPGIFDR  750



>gb|KDP43899.1| hypothetical protein JCGZ_20909 [Jatropha curcas]
Length=594

 Score =   216 bits (549),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 152/349 (44%), Positives = 212/349 (61%), Gaps = 9/349 (3%)
 Frame = +2

Query  206   VSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVV  385
             + Q      I   +LM++QA +LLK L  E++      Q   +   A  RA      E V
Sbjct  247   LKQFQFLHRIQNTVLMNKQAKELLKLLISEVRKAG-VKQADKILGPASRRAARSGNQEFV  305

Query  386   LSIVEAYPTMAYCSDHND-LNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIM  562
             + +++AYP + + S+ +D L I H+A++ R E IFNL+       H L    + + N+++
Sbjct  306   IEVIKAYPQVLWLSNKDDGLTIFHLAVQYRQERIFNLLYQMGTHKHFLTALHDKSDNNML  365

Query  563   NLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHR  742
             +LA +L P    N +S AA +MQRELQWFKEV+ +  P +    ++ GKTP   FTE H+
Sbjct  366   HLAGELRPS---NRISYAAFEMQRELQWFKEVENVVQPSYKEEKNKEGKTPREVFTEKHK  422

Query  743   LLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAIS  922
              L   GEKWMK TATSC   AAL++TVVFAAA TVPGGNSD  G+PI+ S  +F  +AIS
Sbjct  423   DLFERGEKWMKGTATSCATVAALVLTVVFAAAFTVPGGNSD-KGIPIYLSQKSFMSYAIS  481

Query  923   NaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYL  1102
             +  +LF + TSLL+FL ++TSRYAE+DF  ALP RLI GLITL FSI  M+  F     L
Sbjct  482   DVLALFCSITSLLIFLGMITSRYAEEDFFKALPMRLIAGLITLCFSIGFMLGVFGDAFLL  541

Query  1103  VFGQNKSWIRIIVPALASLPITS-FVLLQFPLLVALVSSTYGPGIFSQR  1246
                    WI  ++ A+  + IT+ FV ++FPLL  +V ST+GP IF ++
Sbjct  542   ELSHKVQWIAALIAAV--ICITNLFVPMRFPLLGEIVYSTFGPSIFGKQ  588



>ref|XP_007036277.1| Ankyrin repeat family protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY20778.1| Ankyrin repeat family protein, putative isoform 3 [Theobroma 
cacao]
Length=734

 Score =   218 bits (555),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 170/452 (38%), Positives = 247/452 (55%), Gaps = 42/452 (9%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCIS--  178
             +K++D+AL+L+ +H      A    GV    A+        +++ FSFW+R IY C+   
Sbjct  282   NKWFDVALDLL-RHRPQLAFAKERTGVNAALALSCQPSGFPSSSGFSFWQRWIYSCLKVK  340

Query  179   ------------------KNSASTQNFVSQL---LLW-----------KSIPKKILMHQQ  262
                               ++    +NF +Q+   LL            K I    L H  
Sbjct  341   QPKAWSREDDVHINTCELQDQKEMKNFTTQVAGQLLRLGSNLLKFFGIKQIYDLKLAHVY  400

Query  263   ATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDL  442
             A +LL  + + + T         L + A++ A    + E ++ I++    +   SD +D 
Sbjct  401   AHELLLLMAETIATFEIEQLYQGLVNHAIINAAQRGMMEFIVEIIKRNLDLLMMSDVDDR  460

Query  443   NILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNL--VSGA  616
             +I HIAI +R E +F+LI G   + +      + N N++++LA KL+PQ +L L  +SGA
Sbjct  461   SIFHIAIAHRQEKVFSLIYGLDTIKYIFVSFTDKNSNNMLHLAGKLSPQSQLKLQQISGA  520

Query  617   ALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCt  796
             ALQMQRELQWFKEV+ I  P +    ++ G+TP   F ++H  L  EGEKWMKD A S +
Sbjct  521   ALQMQRELQWFKEVESIIPPMYKEYRNKRGETPYEAFDQSHAKLVKEGEKWMKDRAQSSS  580

Query  797   iaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsv  976
             +   LI+T++FAA  TVPGG +   G+PI      F VF IS+A SL  + TS+L+F+ +
Sbjct  581   VVGTLIITIMFAALFTVPGGPNQETGVPILLRKKHFRVFVISDAISLSASTTSMLIFVGI  640

Query  977   ltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVP--AL  1150
             LTSRY   DFL +LPN+LII L  LF SI  MM AFSST++++    K  + II+P   L
Sbjct  641   LTSRYTAHDFLISLPNKLIIRLSFLFISIAAMMVAFSSTVFIML---KGQLEIIIPIVVL  697

Query  1151  ASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
                PI  FV LQFPLL  +  STYGPGIF ++
Sbjct  698   VGFPIGLFVWLQFPLLAKIFISTYGPGIFDKK  729



>emb|CAN62183.1| hypothetical protein VITISV_044401 [Vitis vinifera]
Length=667

 Score =   217 bits (553),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 141/330 (43%), Positives = 201/330 (61%), Gaps = 0/330 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  ++ LL C+ +E+  L          + A+  A+   I E ++++++  P   +    
Sbjct  332   HVGSSQLLDCIFEEIPYLTSSQLEMFGINQAIYDAIKHGIIEFIVALIKHDPESIWRKGV  391

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
                 +   A+  R E IF+L+ G  +  + +    +   N+I++LA KL+P  +L+ VSG
Sbjct  392   KGRTMFSHAVVLRQEKIFSLVYGLGIKKNVIARRHDIFHNNILHLAGKLSPTSQLDRVSG  451

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
             AALQMQRELQWFKEV+ +    +    +EY KTP   F E H  L  +GE WMK TA SC
Sbjct  452   AALQMQRELQWFKEVESMVQAKYKEEFNEYHKTPIHVFIEEHAELVKQGESWMKSTAASC  511

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
              + A LI  ++F  A T+PGG  +  G+P+F    AF VF  S+A SLF+++TS+L+FL 
Sbjct  512   MVVATLIAALMFTTAFTLPGGTKNDTGIPVFIKSKAFMVFIASDALSLFSSSTSVLMFLG  571

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             +LTSRYA +DFL +LP +LIIGL +LFFSI+ MM AF S I++V  Q  SWI   + ALA
Sbjct  572   ILTSRYAAEDFLKSLPIKLIIGLSSLFFSIVSMMVAFGSAIFVVLCQELSWISFPIIALA  631

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              +PIT F LLQFPLLV +V+ TYG  IF +
Sbjct  632   CIPITFFALLQFPLLVEIVTCTYGRSIFDK  661



>ref|XP_009350923.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Pyrus 
x bretschneideri]
Length=341

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 153/341 (45%), Positives = 207/341 (61%), Gaps = 17/341 (5%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFS-LASDALLRAVHLDIAEVVLSIVEAYPTMAYC  424
             ++H  +   LK +C+E+    D  Q+ S     A+  AV     E V  + +A P + + 
Sbjct  3     IVHVHSLAFLKLMCEEINKDWDMQQMSSPYVRSAIFLAVRRGNVEFVTHMCKANPELLWA  62

Query  425   SDHNDLNILHIAIENRCENIFNLIRGTSV--LVHNLQDTINGNGNDIMNLAAKLAP--QH  592
             ++     I H+AIE R E I+NLI G S    V NL D    + ++ +++A  L+P  Q 
Sbjct  63    TNEKVRGIFHVAIECRQEKIYNLIYGISAKDWVTNLADR---DFDNKLHMAGLLSPSAQG  119

Query  593   KLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGK----TPEMHFTENHRLLKIEG  760
             KLN + GAALQMQRELQW+KEV  I  P    C +   K    TP   FT+NH  L  EG
Sbjct  120   KLNRIPGAALQMQRELQWYKEVATILPP---KCREYRNKDKLLTPRELFTKNHSELLKEG  176

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK+TATS T+  ALI+T++FAA IT+PGGN D  G P F       +F IS+A S F
Sbjct  177   EKWMKETATSYTVVGALIITIMFAAVITIPGGNGD-TGFPTFIDEKLLMLFMISDAISPF  235

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++ T+ L FL +LTSRYAE DFL +LP  +IIGL TLFF+I  MM AFS+ + L+  + +
Sbjct  236   SSTTATLTFLGILTSRYAEDDFLKSLPTTMIIGLATLFFAIATMMIAFSAGL-LIIVRRE  294

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             SWI I    L+S+P+T F  +QFPLLV +  STYG GIF++
Sbjct  295   SWIVIPTILLSSVPVTLFAWMQFPLLVKITVSTYGKGIFNR  335



>ref|XP_010656436.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis 
vinifera]
Length=621

 Score =   216 bits (549),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 210/324 (65%), Gaps = 2/324 (1%)
 Frame = +2

Query  260   QATDLLKCLCDELKTL--NDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             QA  L+K L  +++    ++ + +    S  LL A  L     +  +V +YP + + +D+
Sbjct  285   QALRLVKHLWQQVRQRQPSEISDLIRRPSPLLLVAAELGNTVFLTELVGSYPDLIWEADN  344

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
             ++  I HIA+ +R E+IFNLI     +   +    + N N++++LA + AP  + N+VSG
Sbjct  345   DNRTIFHIAVLHRRESIFNLIYEIGSMKDLIVPYKDDNDNNMLHLAGRKAPLPQRNIVSG  404

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
             AALQMQREL WFKEV+KI LP +    ++ GKTP   FT+ H+ L  +GEKWM+ TA   
Sbjct  405   AALQMQRELLWFKEVEKIMLPTYRERKNKDGKTPRDLFTKEHKNLMKDGEKWMRGTAAQS  464

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
              + A LI TVVFAAA TVPGG++   G+PI     +F +FA+S+A +LF+++TS+LVFLS
Sbjct  465   MLVATLIATVVFAAAFTVPGGSNQDTGIPILLRKKSFMIFAVSDAIALFSSSTSILVFLS  524

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             +LTSRYAE DFL +LP+RL+ GLITLF SII MM  F+ T +LVFG   +W  +++   A
Sbjct  525   ILTSRYAEDDFLESLPSRLMFGLITLFVSIISMMVTFTITFFLVFGHGFAWAPMLIAVSA  584

Query  1154  SLPITSFVLLQFPLLVALVSSTYG  1225
              +P+T +  LQ+PLL  +  STYG
Sbjct  585   CVPVTLYFSLQYPLLADIFRSTYG  608



>emb|CBI35219.3| unnamed protein product [Vitis vinifera]
Length=750

 Score =   217 bits (553),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 176/443 (40%), Positives = 248/443 (56%), Gaps = 34/443 (8%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNM-GVPPLDAIVKYDCPIINTANFSFWKRSIYYCISK  181
             +KF D+AL ++ +H  +      N  GV PL  + +      + +   FW+R IY CIS 
Sbjct  306   TKFLDIALHILEKHPSLA--VTFNKDGVSPLYVLGQKPSLFKSGSQLWFWQRWIYSCISV  363

Query  182   NSASTQNFVS------------------------QLLLWK---SIPKKILMHQQATDLLK  280
             N     +++                         Q+  +K   +I  + L H QA  +L 
Sbjct  364   NVDCASDWIQINVVDDIAQGRDDRNNTKKGMSLLQIDNFKVVFNIHDQKLRHAQAIKILG  423

Query  281   CLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIA  460
              +C EL+ +      F +   A+ +AV     E V  ++++ P +A+  D N  NI  IA
Sbjct  424   SICIELQNMKVDVLGFQV-HQAVFQAVKRGNVEFVTEMIKSIPELAWSHDINGRNIFFIA  482

Query  461   IENRCENIFNLIRG-TSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRE  637
             I NR E IFNL+ G T      +   ++   N++++L A LAP  +L+ +SGAALQMQRE
Sbjct  483   ILNRQEKIFNLLHGLTHAQKMKVISPLDRFRNNMLHLVAMLAPSEQLDGISGAALQMQRE  542

Query  638   LQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaaliv  817
             LQWFKEV+ I  P F    +  GK     F++ H  L  EGEKWMK+ ATS T  AALIV
Sbjct  543   LQWFKEVESIVPPLFKDLTNSDGKKASEVFSQQHADLVKEGEKWMKEIATSSTFVAALIV  602

Query  818   tvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAE  997
             T++FAAA T+P GN+D  G PIF     F VF IS++ SLF+A TS+L+FL +LTS YAE
Sbjct  603   TIMFAAAFTIPAGNND-KGAPIFLDDTFFIVFIISDSISLFSATTSVLMFLGILTSVYAE  661

Query  998   QDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRII-VPALASLPITSF  1174
               FL  LP +LIIGL  LF SI  MM AF + + ++  ++ + + +I +  LA +P+T F
Sbjct  662   NKFLTRLPTKLIIGLSALFISIAAMMIAFCAALAVLLKESSTKVVMIPIILLACVPVTLF  721

Query  1175  VLLQFPLLVALVSSTYGPGIFSQ  1243
              LLQFPLLV +  STYGPGIF +
Sbjct  722   ALLQFPLLVNIFISTYGPGIFDR  744



>emb|CBI37569.3| unnamed protein product [Vitis vinifera]
Length=718

 Score =   217 bits (552),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 159/438 (36%), Positives = 239/438 (55%), Gaps = 29/438 (7%)
 Frame = +2

Query  14    YDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYC-------  172
             YD+AL L+ +H+          G   +  + +     ++ +   FW+R IY C       
Sbjct  276   YDIALHLL-KHYRHLSFTKDYYGNYTVRMLARKPSAFLSGSKLLFWERWIYSCKYFIVNH  334

Query  173   ----------ISKNSASTQNFV--------SQLLLW---KSIPKKILMHQQATDLLKCLC  289
                       ++ +     N++         Q+L++   K I +    H  ++ LL C+ 
Sbjct  335   HLLEKVYLHYLANHLTCPSNYMDTYGPPKSKQVLVFPDLKHIYEAKWTHVGSSQLLDCIF  394

Query  290   DELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIEN  469
             +E+  L          + A+  A+   I E ++++++  P   +        +   A+  
Sbjct  395   EEIPYLTSSQLEMFGINQAIYDAIKHGIIEFIVALIKHDPESIWRKGVKGRTMFSHAVVL  454

Query  470   RCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWF  649
             R E IF+L+ G  +  + +    +   N+I++LA KL+P  +L+ VSGAALQMQRELQWF
Sbjct  455   RQEKIFSLVYGLGIKKNVIARRHDIFHNNILHLAGKLSPPSQLDRVSGAALQMQRELQWF  514

Query  650   KEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvf  829
             KEV+ +    +    +EY KTP   F E H  L  +GE WMK TA SC + A LI  ++F
Sbjct  515   KEVESMVQAKYKEEFNEYHKTPIHVFIEEHAELVKQGESWMKSTAASCMVVATLIAALMF  574

Query  830   aaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFL  1009
               A T+PGG  +  G+P+F    AF VF  S+A SLF+++TS+L+FL +LTSRYA +DFL
Sbjct  575   TTAFTLPGGTKNDTGIPVFIKSKAFMVFIASDALSLFSSSTSVLMFLGILTSRYAAEDFL  634

Query  1010  YALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQF  1189
              +LP +LIIGL +LFFSI+ MM AF S I++V  Q  SWI   + ALA +PIT F LLQF
Sbjct  635   KSLPIKLIIGLSSLFFSIVSMMVAFGSAIFVVLCQELSWISFPIIALACIPITFFALLQF  694

Query  1190  PLLVALVSSTYGPGIFSQ  1243
             PLLV +V+ TYG  IF +
Sbjct  695   PLLVEIVTCTYGRSIFDK  712



>ref|XP_008244948.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Prunus 
mume]
Length=322

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 198/305 (65%), Gaps = 8/305 (3%)
 Frame = +2

Query  344   ALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLI----RGTSV  511
             A+  A+   + E   S+++A P + +  +    N    AIE R E I++LI    +    
Sbjct  17    AIFSAIERGMFEFTESVLQARPDLVWKYNQMGRNPFQFAIECRQEKIYSLIYRLDKRKRT  76

Query  512   LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSC  691
             L+ N+ D    + N  +++A  L+   KLN +SGAALQMQRE+QWFKEV+ I LP     
Sbjct  77    LIGNVADK---SDNCALHVAGMLSLLAKLNNISGAALQMQREVQWFKEVETIVLPRIKES  133

Query  692   MDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDAN  871
             ++  G TP   FT+NH+ L  EGE+WMK TA+SCT+  ALI+T++FAAA T+PGGN+   
Sbjct  134   INYDGMTPRELFTKNHKELVKEGERWMKGTASSCTVVGALIITIMFAAAFTIPGGNNGET  193

Query  872   GLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITL  1051
             G PIF     F  F +++A SLF++ TS+L+FL +LTSRYAE+DFL +LP ++IIGL TL
Sbjct  194   GFPIFLHKKLFMAFIVADAMSLFSSTTSVLMFLGILTSRYAEEDFLKSLPTKMIIGLSTL  253

Query  1052  FFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPG  1231
             F SI  MM AFSS ++++    +SWI I +  +AS+P+T F+ +QFPLLV +  ST G G
Sbjct  254   FISIATMMVAFSSALFIMI-HEQSWIVIPIIFVASVPVTLFIWMQFPLLVEMYISTCGRG  312

Query  1232  IFSQR  1246
             IF ++
Sbjct  313   IFDRK  317



>emb|CAN71662.1| hypothetical protein VITISV_001405 [Vitis vinifera]
Length=661

 Score =   215 bits (548),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 152/325 (47%), Positives = 211/325 (65%), Gaps = 5/325 (2%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K+I  K L H QAT+LL+C+C+E++ +N    +       +++AV     +    +++  
Sbjct  336   KNIYAKKLRHAQATELLQCICNEIQKVNVEGTLGLRLHHTVIQAVKQGNVDFATEMIKYT  395

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRG-TSVLVHNLQDTINGNGNDIMNLAAKLA  583
             P +   +D ND NI  IAI NR E IF+L+ G  +V    +   ++  GN++++LAA LA
Sbjct  396   PQLVQKTDINDRNIFFIAILNRQEKIFSLLHGLNNVKKMKMTSNVDRFGNNMLHLAAMLA  455

Query  584   PQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGE  763
             P ++L+ +SGAALQMQRELQWFKEV+ I  P     ++  GK P   FTE H  L  EGE
Sbjct  456   PANQLDGISGAALQMQRELQWFKEVESIVPPICKDLVNADGKRPSELFTEQHANLVKEGE  515

Query  764   KWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslft  943
             KWMKD A S +  AALIVT++FAAA T+PGGN D  G PIF  ++ F VF IS++ SLF+
Sbjct  516   KWMKDIAASSSFVAALIVTIMFAAAFTIPGGNDD-TGAPIFLGNDLFMVFIISDSISLFS  574

Query  944   aatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKS  1123
             A TS+L+FL +LTS+YAE  FL  LP +LIIGL TLFFSI  MM AF + + ++  + +S
Sbjct  575   ATTSVLMFLGILTSQYAENKFLTRLPTKLIIGLSTLFFSIATMMIAFCAALAILL-KGRS  633

Query  1124  WIRIIVPA--LASLPITSFVLLQFP  1192
                +I+P   LA +P+T FVLLQFP
Sbjct  634   TKVVIIPIILLACVPVTLFVLLQFP  658



>ref|XP_009344351.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Pyrus x bretschneideri]
Length=553

 Score =   213 bits (543),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 214/361 (59%), Gaps = 11/361 (3%)
 Frame = +2

Query  191   STQNFVSQLL-LWKSIP------KKILMHQQATDLLKCLCDELKTLNDYNQVFSL---AS  340
             ST    S+L+  +K +P      K+ +   QA  L++CL  E+   +D ++V  L    S
Sbjct  188   STPGMCSRLIKTFKVLPCMRVSYKRNVKQTQALKLVQCLWKEMLRHDD-DEVMHLIREPS  246

Query  341   DALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVH  520
             + +  A  L   E +  ++++YP +    D N+  I H A+ +R  NIFNL+  T  +  
Sbjct  247   ELVFDAAKLGNYEFLSVLIDSYPELLLEYDDNNRTIFHTAVLHRHANIFNLLHETGSIKD  306

Query  521   NLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDE  700
              +    +   N+I++LAAKLAPQ +LNLVSGAALQMQREL WF+EV+KI  P F    ++
Sbjct  307   IIATFTDDENNNILHLAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNK  366

Query  701   YGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLP  880
              GKTP   FT  H  L  +GE WMKDT  SC + + LI TVVF+AA ++PGG  D  G P
Sbjct  367   QGKTPRELFTSEHEDLLRKGESWMKDTTNSCMLVSTLIATVVFSAAFSIPGGIDDNKGTP  426

Query  881   IFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFS  1060
              F    AF +FAIS+  +LF+++T++L+FL +LTSRYAE DFL +LP +L++GL +LF S
Sbjct  427   NFIKEAAFLIFAISDGVALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMVGLTSLFVS  486

Query  1061  IILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
             I  MM  FS+  YL       W+  ++   A +P+  F  LQ+PLL  +  STY   +  
Sbjct  487   ITSMMVTFSTAFYLSCHYGLRWVPDLIFIFAFVPVALFAFLQYPLLFDMFFSTYCSSLLF  546

Query  1241  Q  1243
             Q
Sbjct  547   Q  547



>ref|XP_008348005.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Malus 
domestica]
Length=553

 Score =   213 bits (543),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 203/338 (60%), Gaps = 4/338 (1%)
 Frame = +2

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYP  409
             K+ L   QA  L++CL  E+   +D ++V  L    S+ +  A  L   E +  ++++YP
Sbjct  211   KRNLKQTQALKLVECLWKEMLKHDD-DEVMHLIREPSELVFDAAKLGNYEFLSVLIDSYP  269

Query  410   TMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQ  589
              +    D N+  I HIA+ +R  +IFNL+  T  +   +    +   N+I++LAAKLAPQ
Sbjct  270   ELLLEYDDNNRTIFHIAVLHRHASIFNLVHETGSIKDIIATFTDDENNNILHLAAKLAPQ  329

Query  590   HKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKW  769
              +LNLVSGAALQMQREL WF+EV+KI  P F    +  GKTP   FT  H  L  +GE W
Sbjct  330   DQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNTQGKTPRELFTSEHEDLLRKGESW  389

Query  770   MKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaa  949
             MKDT  SC + + LI TVVF+AA ++PGG  D  G P F    AF +FAIS+  +LF+++
Sbjct  390   MKDTTNSCMLVSTLIATVVFSAAFSIPGGIDDNKGTPNFIKEEAFLIFAISDGVALFSSS  449

Query  950   tsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWI  1129
             T++L+FL +LTSRYAE DFL +LP +L++GL +LF SI  MM  FS+  YL       W+
Sbjct  450   TAILMFLYILTSRYAENDFLKSLPLKLMVGLTSLFVSITSMMVTFSTAFYLSCHYGLRWV  509

Query  1130  RIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
               ++   A +P+  F  LQ PLL  +  STY   +  Q
Sbjct  510   PDLIFIFAFVPVALFAFLQXPLLFDMFFSTYCSSLLFQ  547



>ref|XP_004287295.1| PREDICTED: uncharacterized protein LOC101314594 [Fragaria vesca 
subsp. vesca]
Length=1120

 Score =   219 bits (558),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 159/423 (38%), Positives = 236/423 (56%), Gaps = 39/423 (9%)
 Frame = +2

Query  86    PPLDAIVKYDCPIINTANFSFWKRSIYYCISKNSAS-------------TQNFVSQLLLW  226
             PP+  + +     ++     FW+R IY  +    A+               N  +Q+ L 
Sbjct  691   PPIMELARMSSAFLSGTQLGFWQRLIYNWLRIEPANLSTLHTCINIPQQEDNRDNQIDLI  750

Query  227   KSIP---KKIL-----------------MHQQATDLLKCLCDELKTLNDYNQVFSLASDA  346
             +S+    KK++                 +H ++ D+L+C+ + LK     +   ++   +
Sbjct  751   RSVTTLYKKLVYRLFTLLGVIHLHEMKWIHTRSIDILRCISEMLKKEPPTSSQLNIVRKS  810

Query  347   LLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNL  526
             + +AV     E V  I EA+P++A   + +  NI   A+E R   IF+LI G S     L
Sbjct  811   MFKAVEHGNVEFVTHICEAHPSLANSREESK-NIFQFAVECRQHKIFSLIYGISEEDQRL  869

Query  527   QDTINGN-GNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEY  703
                   N   +I++LA KL+P  + N + GAALQMQREL WFK V+ I         +  
Sbjct  870   NGLRGVNYPENILHLAGKLSPLSRFNRIRGAALQMQRELHWFKAVEDIVPLQMREIPNSD  929

Query  704   GKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPI  883
             G TP   FT+NH  LK E E  MK TATSCT+  ALIVT++FAAA TVPGGN  + G+P+
Sbjct  930   GMTPHELFTKNHEALKKEAEDSMKGTATSCTVVGALIVTMMFAAAFTVPGGNDGSTGVPM  989

Query  884   FSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSI  1063
             F +   F VF IS+  SL ++ TS+++FL +LTSRYAE DFL  LP ++++GL TLF SI
Sbjct  990   FLAKKLFMVFIISDTLSLVSSTTSVILFLGILTSRYAEDDFLKHLPTKMMLGLSTLFISI  1049

Query  1064  ILMMTAFSSTIYLVFGQNKSWIRIIVPAL--ASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
               MM AFSS + ++  +  SW   ++P++  AS+P+ SF+ LQFPLL+ ++ STYGPGIF
Sbjct  1050  ATMMIAFSSALIIMLYKEYSWA--VIPSIFAASIPVASFIWLQFPLLIEIIWSTYGPGIF  1107

Query  1238  SQR  1246
              ++
Sbjct  1108  DKK  1110



>ref|XP_010649391.1| PREDICTED: uncharacterized protein LOC100250623 isoform X1 [Vitis 
vinifera]
 ref|XP_010649392.1| PREDICTED: uncharacterized protein LOC100250623 isoform X1 [Vitis 
vinifera]
 ref|XP_010649393.1| PREDICTED: uncharacterized protein LOC100250623 isoform X1 [Vitis 
vinifera]
Length=743

 Score =   216 bits (551),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 141/330 (43%), Positives = 201/330 (61%), Gaps = 0/330 (0%)
 Frame = +2

Query  254   HQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             H  ++ LL C+ +E+  L          + A+  A+   I E ++++++  P   +    
Sbjct  408   HVGSSQLLDCIFEEIPYLTSSQLEMFGINQAIYDAIKHGIIEFIVALIKHDPESIWRKGV  467

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
                 +   A+  R E IF+L+ G  +  + +    +   N+I++LA KL+P  +L+ VSG
Sbjct  468   KGRTMFSHAVVLRQEKIFSLVYGLGIKKNVIARRHDIFHNNILHLAGKLSPPSQLDRVSG  527

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
             AALQMQRELQWFKEV+ +    +    +EY KTP   F E H  L  +GE WMK TA SC
Sbjct  528   AALQMQRELQWFKEVESMVQAKYKEEFNEYHKTPIHVFIEEHAELVKQGESWMKSTAASC  587

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
              + A LI  ++F  A T+PGG  +  G+P+F    AF VF  S+A SLF+++TS+L+FL 
Sbjct  588   MVVATLIAALMFTTAFTLPGGTKNDTGIPVFIKSKAFMVFIASDALSLFSSSTSVLMFLG  647

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             +LTSRYA +DFL +LP +LIIGL +LFFSI+ MM AF S I++V  Q  SWI   + ALA
Sbjct  648   ILTSRYAAEDFLKSLPIKLIIGLSSLFFSIVSMMVAFGSAIFVVLCQELSWISFPIIALA  707

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              +PIT F LLQFPLLV +V+ TYG  IF +
Sbjct  708   CIPITFFALLQFPLLVEIVTCTYGRSIFDK  737



>ref|XP_010649394.1| PREDICTED: uncharacterized protein LOC100250623 isoform X2 [Vitis 
vinifera]
Length=741

 Score =   216 bits (550),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 143/339 (42%), Positives = 204/339 (60%), Gaps = 0/339 (0%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I +    H  ++ LL C+ +E+  L          + A+  A+   I E ++++++  
Sbjct  397   KHIYEAKWTHVGSSQLLDCIFEEIPYLTSSQLEMFGINQAIYDAIKHGIIEFIVALIKHD  456

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
             P   +        +   A+  R E IF+L+ G  +  + +    +   N+I++LA KL+P
Sbjct  457   PESIWRKGVKGRTMFSHAVVLRQEKIFSLVYGLGIKKNVIARRHDIFHNNILHLAGKLSP  516

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +L+ VSGAALQMQRELQWFKEV+ +    +    +EY KTP   F E H  L  +GE 
Sbjct  517   PSQLDRVSGAALQMQRELQWFKEVESMVQAKYKEEFNEYHKTPIHVFIEEHAELVKQGES  576

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WMK TA SC + A LI  ++F  A T+PGG  +  G+P+F    AF VF  S+A SLF++
Sbjct  577   WMKSTAASCMVVATLIAALMFTTAFTLPGGTKNDTGIPVFIKSKAFMVFIASDALSLFSS  636

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
             +TS+L+FL +LTSRYA +DFL +LP +LIIGL +LFFSI+ MM AF S I++V  Q  SW
Sbjct  637   STSVLMFLGILTSRYAAEDFLKSLPIKLIIGLSSLFFSIVSMMVAFGSAIFVVLCQELSW  696

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             I   + ALA +PIT F LLQFPLLV +V+ TYG  IF +
Sbjct  697   ISFPIIALACIPITFFALLQFPLLVEIVTCTYGRSIFDK  735



>ref|XP_007048310.1| Ankyrin repeat family protein, putative [Theobroma cacao]
 gb|EOX92467.1| Ankyrin repeat family protein, putative [Theobroma cacao]
Length=755

 Score =   216 bits (551),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 170/450 (38%), Positives = 245/450 (54%), Gaps = 48/450 (11%)
 Frame = +2

Query  14    YDMALELVGQHHD--VTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIY-YCISKN  184
             +D+AL L+ ++    VT     N  V  L          ++  +F FWKR IY  CI  +
Sbjct  269   FDLALSLLKRYPKLGVTEDINKNYAVKLL---AHKPSAFLSGKSFVFWKRWIYNSCIKIS  325

Query  185   SASTQN-------------------------------FVSQLLLW-----KSIPKKILMH  256
                 ++                               F  +LL W     K I    L H
Sbjct  326   EVELEDEGITYGESRGDEESIRRERSRPNNVRSSLIKFGWKLLKWFVPDMKQIHYAKLKH  385

Query  257   QQATDLLKCLCDELKTLNDYNQVFSLASD-ALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
              QA +LL+ +  E+  L++  Q+  +  D A+  A+   + E +  I++ +P + +  D 
Sbjct  386   DQAVELLRYIFKEIPRLSN-KQLDKIGLDKAIYDAIKHGMIEFIDEIIQLHPEVIWRKDK  444

Query  434   NDLNILHIAIENRCENIFNLIR--GTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
                 +   AI  R E IFN +   G+   +  L+  I  N  + ++LAAKL+P  +L+ +
Sbjct  445   KGRTLFANAIVLRREKIFNHVYHLGSKQRITLLRHDIFRN--NFLHLAAKLSPPSRLDHI  502

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGAALQMQRELQWF+E++KI  P F    +E  +TP   F+  H+ L  EGEKWMK+ A 
Sbjct  503   SGAALQMQRELQWFEELRKILPPKFEEEFNENNRTPASLFSAEHKELIKEGEKWMKNNAA  562

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvf  967
             SC + A LI  V+F +A TVPGGN +  G PIF   NAF VF I+N+ SLF ++TS+LVF
Sbjct  563   SCMVVATLIAAVMFTSAFTVPGGNDEKTGAPIFLKSNAFLVFVIANSLSLFASSTSVLVF  622

Query  968   lsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA  1147
             L VLTS YAE+DFL +LP + I+GL TLFFSI+ MM AF S I++   +  +WI + V  
Sbjct  623   LGVLTSHYAEKDFLQSLPAKSILGLFTLFFSIVTMMIAFGSAIFITLQKRLAWISVPVIV  682

Query  1148  LASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             L+++PI  F LLQFPLL+ ++ STY   +F
Sbjct  683   LSTVPIAFFTLLQFPLLIEMLISTYLIRVF  712



>ref|NP_188497.1| ankyrin repeat-containing protein [Arabidopsis thaliana]
 gb|AEE76130.1| ankyrin repeat-containing protein [Arabidopsis thaliana]
Length=598

 Score =   214 bits (544),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 141/348 (41%), Positives = 215/348 (62%), Gaps = 2/348 (1%)
 Frame = +2

Query  203   FVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEV  382
             F S   + + + K  L H QA ++L C+C E+   +   Q  +  + AL +AV   I E 
Sbjct  245   FPSVPRIIRRVYKLKLGHAQAKEILDCICQEIPKFDAAQQKNAGLNQALFKAVENGIVEY  304

Query  383   VLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIM  562
             +  ++  YP + +  + + LNI   A+  R E IF+LI       + L    +   N+++
Sbjct  305   IEEMMRHYPDIVWSKNSSGLNIFFYAVSQRQEKIFSLIYNIGAKKNILATNWDIFHNNML  364

Query  563   NLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMD-EYGKTPEMHFTENH  739
             + AA  AP  +LNL+ GAALQMQRELQWFKEV+K+  P     ++ +  KTP+  FT+ H
Sbjct  365   HHAAYRAPASRLNLIPGAALQMQRELQWFKEVEKLVQPKHRKMVNLKQKKTPKALFTDQH  424

Query  740   RLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAI  919
             + L  +GEKWMK+TATSCT+ AALI T++F++A TVPGG   ++G+P++   + F +F I
Sbjct  425   KDLVEQGEKWMKETATSCTVVAALITTMMFSSAFTVPGGYR-SDGMPLYIHQHRFKIFLI  483

Query  920   SNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIY  1099
             S+A SLFT+  SLL+FL +L SRY E+DFL +LP +LI+GL+ LF S+  M+  F  T+ 
Sbjct  484   SDAISLFTSCMSLLMFLGILKSRYREEDFLRSLPTKLIVGLLALFLSMATMIVTFVVTLM  543

Query  1100  LVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              + G+  SW+      LA +P+  FV+LQFP+L+ +  +TY P +F +
Sbjct  544   TLVGEKISWVSAQFMFLAVIPLGMFVVLQFPVLLEIFRATYCPNVFDK  591



>ref|XP_006431560.1| hypothetical protein CICLE_v10003198mg, partial [Citrus clementina]
 gb|ESR44800.1| hypothetical protein CICLE_v10003198mg, partial [Citrus clementina]
Length=670

 Score =   215 bits (547),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 149/336 (44%), Positives = 213/336 (63%), Gaps = 9/336 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K+I ++ L H Q  ++++ +C E+       ++      AL  A  L I E V   + A+
Sbjct  285   KAIHEQKLAHMQTVEIVRIICKEVIWTRHRREL----KGALFTAARLGIHEFVNEFIMAH  340

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
                A   + +  NI  +A+ +R E +FNLI   +  + NL  T   +GN+I++LAA+L P
Sbjct  341   NMTADVLNEDRRNIFDVAVLHRREKVFNLIHRVNFTI-NLFSTEGNSGNNILHLAAELVP  399

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +   V+GAALQMQRELQWFK V+K+  P+         KTP   FTE H+ L  +GEK
Sbjct  400   SSE---VAGAALQMQRELQWFKAVEKLIHPHRLGDEKSSNKTPREVFTEEHKELVKDGEK  456

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WMK+TA+SC++ AALI+TVVFAAA TVPGG SD+ G+P      +F +FAIS+  +LF++
Sbjct  457   WMKETASSCSVVAALIITVVFAAAFTVPGG-SDSRGIPNLLHEKSFMIFAISDMLALFSS  515

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
              TS+L+FL +LTSRYAE DFL +LP +LIIGL+ LFFSI  MM +F +T+++      + 
Sbjct  516   ITSVLMFLGILTSRYAEDDFLVSLPRKLIIGLVALFFSIASMMVSFGATVHISLSHKWNL  575

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGI  1234
             I I +  +  +P+T F LLQFPLL+ + SSTYG GI
Sbjct  576   IFIPIALVGCVPVTLFALLQFPLLLDIYSSTYGRGI  611



>ref|XP_006426655.1| hypothetical protein CICLE_v10025100mg [Citrus clementina]
 gb|ESR39895.1| hypothetical protein CICLE_v10025100mg [Citrus clementina]
Length=658

 Score =   214 bits (546),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 147/341 (43%), Positives = 215/341 (63%), Gaps = 10/341 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLC-DELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEA  403
             KSI    ++H+Q  ++L+ +C   +  LN + +  ++    +  A  L I E+V+ I+ +
Sbjct  318   KSIRDAKIIHEQTLEILRIVCAGAVDILNTHEEAQNVFKKPMFTAARLGIYEIVMEIMNS  377

Query  404   Y-PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKL  580
             Y P      + +  +I  +A+E+R E +FN+I     +       I+    +I+++AA  
Sbjct  378   YFPWSLEFKNKDGYDIFKVAVEHRREKVFNIIFNFPNIYPFFMANIDEKRINILHIAAMS  437

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
              P  +   V GAALQMQRELQWFK V+    P     +++  KTP   FT+ H  L  EG
Sbjct  438   VPSTE---VPGAALQMQRELQWFKAVENCVHPTLQDQLNDKDKTPREVFTKEHEKLVEEG  494

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMKDTA SC++ A LI+T+VFAAAITVPGG SD+ G+P F    +FT+F ISNA +LF
Sbjct  495   EKWMKDTAGSCSVVATLIMTIVFAAAITVPGG-SDSRGMPNFLEEPSFTIFGISNALALF  553

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++  S+L+FL +LTSR++E+DFL +LP +LIIGLITLFFSI  +M AF++T+++   Q  
Sbjct  554   SSVISVLIFLGILTSRFSEEDFLVSLPRKLIIGLITLFFSIACLMVAFAATVHIT--QFH  611

Query  1121  SWIRIIVPA--LASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
              W  +I+P   L  LP+  F  LQFPLL+ + +STYGPGIF
Sbjct  612   PWKWVIIPTALLGFLPVFLFATLQFPLLIEVFASTYGPGIF  652



>ref|XP_006431544.1| hypothetical protein CICLE_v10003264mg, partial [Citrus clementina]
 gb|ESR44784.1| hypothetical protein CICLE_v10003264mg, partial [Citrus clementina]
Length=364

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 147/369 (40%), Positives = 217/369 (59%), Gaps = 37/369 (10%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I K+ + + QA ++++ +C  +   +  NQ   L   A  +A  L I++ V  I+ AY
Sbjct  4     KVIHKEKVRNMQAVEIVRIICKGVIWNDPQNQ--QLLKKAFFKAATLGISKFVQEIIAAY  61

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
                 Y  D N   I H+A+ +R   +FNLI  +S    N   + +   N+I++   KL P
Sbjct  62    KGSVYWEDENKHTIFHVAVLHRRAEVFNLIY-SSTFKSNWLGSNDNIRNNILHFGGKLVP  120

Query  587   QHKLNLVSGAALQMQRELQWFKE-----------------------------VQKIALPY  679
               +   V+GAALQMQR+L+W ++                             V+ +  P+
Sbjct  121   SSE---VAGAALQMQRKLEWPRKLPPHIVKENLCNLQMYHYCSSKCLYYLLAVENLVHPF  177

Query  680   FSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGN  859
                 ++   +TP   FTE H+ L  EGEKWMK+TAT+C++ AA I+TV+FAAA TVPGGN
Sbjct  178   LREAVNN-EQTPREVFTEEHKELVKEGEKWMKETATACSVVAAFIITVMFAAAFTVPGGN  236

Query  860   SDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIG  1039
              D+ G+P F   ++F +FA+S+A SLF++  S+L+FL +LTSRY+E+DFL +LP +LIIG
Sbjct  237   -DSRGIPNFLHESSFIIFAVSDALSLFSSIISVLMFLGILTSRYSEEDFLLSLPRKLIIG  295

Query  1040  LITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSST  1219
             LIT+FFSI  MM +F +TIYLV      W+ I +  +  +P+T F LLQFPLL  + SST
Sbjct  296   LITMFFSIASMMVSFGATIYLVLFSTWKWVFIPITLVGCVPVTLFALLQFPLLFDMYSST  355

Query  1220  YGPGIFSQR  1246
             YG GIF ++
Sbjct  356   YGRGIFGRK  364



>ref|XP_009377835.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Pyrus 
x bretschneideri]
Length=614

 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 150/361 (42%), Positives = 214/361 (59%), Gaps = 11/361 (3%)
 Frame = +2

Query  191   STQNFVSQLL-LWKSIP------KKILMHQQATDLLKCLCDELKTLNDYNQVFSL---AS  340
             ST    S+L+  +K +P      K+ L   QA  L++CL  E+   +D ++V  L    S
Sbjct  249   STPGMCSRLIKTFKVLPCMRVSYKRNLKQTQALKLVQCLWKEMLRHDD-DEVMHLIREPS  307

Query  341   DALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVH  520
             + +  A  L   E +  ++++YP +    D N+  I H A+ +R  NIFNL+  T  +  
Sbjct  308   ELVFDAAKLGNYEFLSVLIDSYPELLLEYDDNNRTIFHTAVLHRHANIFNLLHETGSIKD  367

Query  521   NLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDE  700
              +    +   N+I++LAAKLAPQ +LNLVSGAALQMQREL WF+EV+KI  P F    ++
Sbjct  368   IIATFTDDENNNILHLAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNK  427

Query  701   YGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLP  880
              GKTP   FT  H  L  +GE WMKDT  SC + + LI TVVF+AA ++PGG  D  G P
Sbjct  428   QGKTPRELFTSEHEDLLRKGESWMKDTTNSCMLVSTLIATVVFSAAFSIPGGIDDNKGTP  487

Query  881   IFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFS  1060
              F    AF +FAIS+  +LF+++T++L+FL +LTSRYAE DFL +LP +L++GL +LF S
Sbjct  488   NFIKEAAFLIFAISDGVALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMVGLSSLFVS  547

Query  1061  IILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
             I  MM  FS+  YL       W+  ++   A +P+  F  LQ+PLL  +  STY   +  
Sbjct  548   ITSMMVTFSTAFYLSCHYGLRWVPDLIFIFAFVPVALFAFLQYPLLFDMFFSTYCSSLLF  607

Query  1241  Q  1243
             Q
Sbjct  608   Q  608



>ref|XP_002885271.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61530.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=605

 Score =   213 bits (543),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 140/340 (41%), Positives = 210/340 (62%), Gaps = 2/340 (1%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             + + K  L H QA ++L C+C E+   +   Q  +  + AL +AV   I E +  ++  Y
Sbjct  253   RRVYKLKLGHAQAKEILDCICQEIPKFDAAQQKNAGLNQALFKAVENGIVEYIEEMMRHY  312

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
             P + +  D   LNI   A+  R E IF+LI       + L    +   N++++ AA  AP
Sbjct  313   PDIVWFKDSCGLNIFFYAVSQRQEKIFSLIYNMGAKKNILATNWDKFHNNMLHHAAYRAP  372

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMD-EYGKTPEMHFTENHRLLKIEGE  763
               +LNL+ GAALQMQRELQWFKEV+++  P     ++ +  KTP+  FT+ H+ L  +GE
Sbjct  373   ASRLNLIPGAALQMQRELQWFKEVERLVQPKHRKMVNLKQKKTPKALFTDQHKDLVEQGE  432

Query  764   KWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslft  943
             KWMK+TA SCT+ AALI T++F++A TVPGG   ++G+P++   + F +F IS+A SLFT
Sbjct  433   KWMKETAASCTVVAALITTMMFSSAFTVPGGYR-SDGMPLYIHKHMFKIFLISDAISLFT  491

Query  944   aatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKS  1123
             +  SLL+FL +L SRY E+DFL +LP +LI+GL +LF S+  MM  F  T+  + G+  S
Sbjct  492   SCMSLLMFLGILKSRYREEDFLRSLPTKLIVGLFSLFLSMATMMVTFVVTLMTLVGEKIS  551

Query  1124  WIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             W+      LA +P+  FV+LQFP+L+ +  STY P +F +
Sbjct  552   WVSAQFMFLAVIPLGMFVVLQFPVLLEIFCSTYFPRVFDK  591



>ref|XP_010649401.1| PREDICTED: uncharacterized protein LOC100245499 isoform X6 [Vitis 
vinifera]
Length=574

 Score =   213 bits (541),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 153/371 (41%), Positives = 219/371 (59%), Gaps = 11/371 (3%)
 Frame = +2

Query  155   RSIYYCISKNSASTQNFVSQLLL-----WKSIPKKILMHQQATDLLKCLCDELKTLNDYN  319
             R   + IS+  +     + +LL+     +K I +   +H  ++ LL C+ +E+  L   +
Sbjct  201   RQGQHLISRVPSWWHGLILRLLINFVPDFKHIYETKWVHVGSSQLLDCIFEEIPNLTMES  260

Query  320   QVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIR  499
                +    AL  A+   I E V+ +++      +        +   AI  R E IF+LI 
Sbjct  261   LQMAGMDHALYDAIKHGIIEFVVKLMKQDHESIWRKGVKGRTMFSHAIVLRQEKIFSLIY  320

Query  500   GTSV---LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIA  670
             G  +   +V    D  +   N+I++LA KL+P  +L+ VSGAALQMQRELQWFKEV+ + 
Sbjct  321   GLGIKKNIVARRHDIFH---NNILHLAGKLSPPSQLDRVSGAALQMQRELQWFKEVESMV  377

Query  671   LPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvP  850
                +    +EY KTP   FTE H  L  EGE WMK TA SC + A LI  ++F  A T+P
Sbjct  378   QAKYKEEFNEYHKTPSTVFTEEHATLVKEGESWMKSTAASCMVVATLIAALMFTTAFTLP  437

Query  851   GGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRL  1030
             GG     G+P+F  H AF VF ++++ SLF+++TS+L+FL +LTSRYAE+DFL +LPN+L
Sbjct  438   GGTKSDTGIPVFIGHGAFMVFIVADSLSLFSSSTSVLMFLGILTSRYAEEDFLKSLPNKL  497

Query  1031  IIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALV  1210
             IIGL +LFFS++ MM AF S IY+V     +W+ I +  LA +PIT F LLQFPLLV +V
Sbjct  498   IIGLSSLFFSLLSMMVAFGSAIYVVLSHRIAWVSIPLIVLACIPITFFALLQFPLLVEIV  557

Query  1211  SSTYGPGIFSQ  1243
               TYG  IF +
Sbjct  558   MCTYGRSIFDK  568



>ref|XP_010649399.1| PREDICTED: uncharacterized protein LOC100245499 isoform X5 [Vitis 
vinifera]
 ref|XP_010649400.1| PREDICTED: uncharacterized protein LOC100245499 isoform X5 [Vitis 
vinifera]
Length=667

 Score =   214 bits (546),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 166/460 (36%), Positives = 243/460 (53%), Gaps = 55/460 (12%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDV----THHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYC  172
             +  YD+AL L+  H  +     ++  L M +     + +      + +   FW+R IY  
Sbjct  210   ANIYDIALHLLKHHRQLGFIKDYYGKLTMRI-----LAQKPSAFPSGSKLVFWERWIYSL  264

Query  173   I------------------------SKNSASTQNFVSQLLLW----------------KS  232
             I                         ++S   Q+ +S++  W                K 
Sbjct  265   IHIKPFDEQYQEHEQPHQAPADEDNPESSRQGQHLISRVPSWWHGLILRLLINFVPDFKH  324

Query  233   IPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPT  412
             I +   +H  ++ LL C+ +E+  L   +   +    AL  A+   I E V+ +++    
Sbjct  325   IYETKWVHVGSSQLLDCIFEEIPNLTMESLQMAGMDHALYDAIKHGIIEFVVKLMKQDHE  384

Query  413   MAYCSDHNDLNILHIAIENRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLA  583
               +        +   AI  R E IF+LI G  +   +V    D  +   N+I++LA KL+
Sbjct  385   SIWRKGVKGRTMFSHAIVLRQEKIFSLIYGLGIKKNIVARRHDIFH---NNILHLAGKLS  441

Query  584   PQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGE  763
             P  +L+ VSGAALQMQRELQWFKEV+ +    +    +EY KTP   FTE H  L  EGE
Sbjct  442   PPSQLDRVSGAALQMQRELQWFKEVESMVQAKYKEEFNEYHKTPSTVFTEEHATLVKEGE  501

Query  764   KWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslft  943
              WMK TA SC + A LI  ++F  A T+PGG     G+P+F  H AF VF ++++ SLF+
Sbjct  502   SWMKSTAASCMVVATLIAALMFTTAFTLPGGTKSDTGIPVFIGHGAFMVFIVADSLSLFS  561

Query  944   aatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKS  1123
             ++TS+L+FL +LTSRYAE+DFL +LPN+LIIGL +LFFS++ MM AF S IY+V     +
Sbjct  562   SSTSVLMFLGILTSRYAEEDFLKSLPNKLIIGLSSLFFSLLSMMVAFGSAIYVVLSHRIA  621

Query  1124  WIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             W+ I +  LA +PIT F LLQFPLLV +V  TYG  IF +
Sbjct  622   WVSIPLIVLACIPITFFALLQFPLLVEIVMCTYGRSIFDK  661



>ref|XP_008355241.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X2 [Malus domestica]
Length=606

 Score =   213 bits (542),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 146/331 (44%), Positives = 204/331 (62%), Gaps = 4/331 (1%)
 Frame = +2

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYP  409
             K+ L   QA +L++CL  E+   +D ++V  L    S+ +  A  L   E +  ++  YP
Sbjct  264   KRNLKQTQALNLVECLWKEMLKHDD-DEVMLLIREPSELVFDAAKLGNFEFLSVLIGFYP  322

Query  410   TMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQ  589
              +    D N+  I HIA+ +R  +IFNL+  T  +   +    +   N+I++LAAKLAPQ
Sbjct  323   ELLLEYDDNNRTIFHIAVLHRHASIFNLVHVTGSIKDIIATFTDDENNNILHLAAKLAPQ  382

Query  590   HKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKW  769
              +LNLVSGAALQMQREL WF+EV+KI  P F    ++ GKTP   FT  H  L  +GE W
Sbjct  383   DQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNKQGKTPRELFTSEHEDLLRKGESW  442

Query  770   MKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaa  949
             MKDTA SC + + LI TVVF+AA ++PGG +D  G P      AF +FAIS+  +LF+++
Sbjct  443   MKDTANSCMLVSTLIATVVFSAAFSIPGGINDHKGTPXSIKEPAFLIFAISDGVALFSSS  502

Query  950   tsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWI  1129
             T++L+FL +LTSRYAE DFL +LP +L+IGL +LF SI  MM  FS+T YL       W+
Sbjct  503   TAILMFLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSMMVTFSTTFYLSCHDGLIWV  562

Query  1130  RIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
               I+   A +P+  F  LQ+PLL  +  STY
Sbjct  563   PDIIFIFAFVPVALFAFLQYPLLFDMFFSTY  593



>ref|XP_008229278.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Prunus 
mume]
 ref|XP_008229285.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Prunus 
mume]
Length=437

 Score =   209 bits (532),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 208/339 (61%), Gaps = 5/339 (1%)
 Frame = +2

Query  242   KILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYPT  412
             K L   +A +L++CL +++   +D + V  L    S+ L  A  L   E +  ++ AYP 
Sbjct  95    KSLKQTEALELVECLWNQILKHDD-DDVMCLITEPSEVLFDATRLGNYEFLSVLINAYPD  153

Query  413   MAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQH  592
             + + +D  +  I H+A+  R  +IFNL+  T ++   +    +   N+I++LAAKLAPQ+
Sbjct  154   LLWETDDENRTIFHVAVLYRHASIFNLVHETGLIKDIIVTYTDDENNNILHLAAKLAPQN  213

Query  593   KLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWM  772
             +LNLVSGAALQMQREL WF+EV+KI  P      ++ GKTP   FT  H  L  +GE WM
Sbjct  214   QLNLVSGAALQMQRELVWFEEVKKIVQPLSIDMKNKDGKTPRELFTSEHEGLLCKGESWM  273

Query  773   KDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaat  952
             K+TA SC + A +I TVVF+AA T+PGG +D  G P F    AF +F IS+  +LF+++T
Sbjct  274   KNTANSCMLVATIITTVVFSAAFTIPGGIADNTGAPKFLKDTAFLIFVISDGVALFSSST  333

Query  953   sllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIR  1132
             S+L+FL +LTSRYAE DFL +LP +L++GL +LF S+  MM AFS+  YL       ++ 
Sbjct  334   SMLMFLYILTSRYAENDFLKSLPLKLMVGLASLFISLTSMMIAFSTAFYLSCHYGLGFVP  393

Query  1133  IIVPALASLPITSFVLLQFPLLVALVSST-YGPGIFSQR  1246
               +   A +P+  FV LQ+PLL  +  ST Y   IF  R
Sbjct  394   DFIFIFAFVPVVLFVFLQYPLLCDMFLSTYYSSSIFQPR  432



>ref|XP_008355240.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like isoform 
X1 [Malus domestica]
Length=611

 Score =   213 bits (542),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 146/331 (44%), Positives = 204/331 (62%), Gaps = 4/331 (1%)
 Frame = +2

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLDIAEVVLSIVEAYP  409
             K+ L   QA +L++CL  E+   +D ++V  L    S+ +  A  L   E +  ++  YP
Sbjct  269   KRNLKQTQALNLVECLWKEMLKHDD-DEVMLLIREPSELVFDAAKLGNFEFLSVLIGFYP  327

Query  410   TMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQ  589
              +    D N+  I HIA+ +R  +IFNL+  T  +   +    +   N+I++LAAKLAPQ
Sbjct  328   ELLLEYDDNNRTIFHIAVLHRHASIFNLVHVTGSIKDIIATFTDDENNNILHLAAKLAPQ  387

Query  590   HKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKW  769
              +LNLVSGAALQMQREL WF+EV+KI  P F    ++ GKTP   FT  H  L  +GE W
Sbjct  388   DQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNKQGKTPRELFTSEHEDLLRKGESW  447

Query  770   MKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaa  949
             MKDTA SC + + LI TVVF+AA ++PGG +D  G P      AF +FAIS+  +LF+++
Sbjct  448   MKDTANSCMLVSTLIATVVFSAAFSIPGGINDHKGTPXSIKEPAFLIFAISDGVALFSSS  507

Query  950   tsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWI  1129
             T++L+FL +LTSRYAE DFL +LP +L+IGL +LF SI  MM  FS+T YL       W+
Sbjct  508   TAILMFLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSMMVTFSTTFYLSCHDGLIWV  567

Query  1130  RIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
               I+   A +P+  F  LQ+PLL  +  STY
Sbjct  568   PDIIFIFAFVPVALFAFLQYPLLFDMFFSTY  598



>ref|XP_008391125.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Malus domestica]
Length=622

 Score =   213 bits (542),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 216/361 (60%), Gaps = 11/361 (3%)
 Frame = +2

Query  191   STQNFVSQLL-LWKSI------PKKILMHQQATDLLKCLCDELKTLNDYNQVFSL---AS  340
             ST    S+L+  WK +       K+ L   +A  L+K L +E+   +D ++V  L    S
Sbjct  251   STPGMCSRLMNAWKVLLDMKVSSKRNLKQTEALKLVKYLWEEMLKHDD-DEVMRLIRGPS  309

Query  341   DALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVH  520
               +  AV L   E +  ++++YP + +  D N+  I HIA+ +R  +IFNL+  T  +  
Sbjct  310   KLVFDAVKLGNYEFLSVLIDSYPELVWEYDDNNRTIFHIAVLHRHASIFNLVHETGSIKD  369

Query  521   NLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDE  700
              +   I+   N+I++ AAKLAPQ +LNLVSGAALQMQREL WF+EV+KI  P F    + 
Sbjct  370   IIATYIDNEKNNILHQAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNN  429

Query  701   YGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLP  880
               KTP   FT  H+ L  +GE WMK+TA SC + + +I TVVF+AA ++PGG SD  G P
Sbjct  430   QDKTPRELFTSEHKDLLRKGESWMKNTANSCMLVSTIIATVVFSAAFSIPGGISDNKGTP  489

Query  881   IFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFS  1060
              F    AF +F IS+  +LF+++T++L+FL +LTSRYAE DFL +LP +L+IGL +LF S
Sbjct  490   NFVKDTAFLIFTISDGVALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMIGLTSLFVS  549

Query  1061  IILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
             I  MM AFS+  YL       W+  ++   + +P+  F  LQ+PLL  +  STY   +  
Sbjct  550   ITSMMVAFSTAFYLSCHYELRWVPDLIFIFSFVPVALFAFLQYPLLSDMFFSTYRSSLLF  609

Query  1241  Q  1243
             Q
Sbjct  610   Q  610



>emb|CDP04741.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 199/334 (60%), Gaps = 2/334 (1%)
 Frame = +2

Query  248   LMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCS  427
             ++H+ A +LL  +  E++TL+  +         L  A+   I E V  I +    + Y  
Sbjct  31    VIHKDANELLTLIFKEIETLSMKDLEEMDIMKILYDAIEQGIIEFVDKIFKYRTGIIYKR  90

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLV  607
             D     I   AI  R + I++L+         L    +  GN++++LAAKL+P  +L+ +
Sbjct  91    DVKGRTIFSHAIVLRQDKIYSLLNALGTRKSILARRHDFFGNNLLHLAAKLSPLSRLDKI  150

Query  608   SGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTAT  787
             SGAALQMQRE++WFKEV+ I  P      + Y KTP   FTE H++L  EGE+WMK+TA 
Sbjct  151   SGAALQMQREIRWFKEVESIVQPRMKEERNAYNKTPSELFTEEHKVLAKEGERWMKNTAG  210

Query  788   SCtiaaalivtvvfaaaitvPGGNSDANGLPIF--SSHNAFTVFAISNaaslftaatsll  961
             S  I   LI  V+F  A TVPGGN +  GLP+   +   AF +F  SNA S+FT++TS+L
Sbjct  211   SSMIVGTLIAAVMFTTAFTVPGGNDNKTGLPVMLETQQKAFLIFMASNALSMFTSSTSIL  270

Query  962   vflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIV  1141
             +FL +LT+RYAE DFL +LP +LI G+  LF SI+ MM +F + +YL+  +  +WI   +
Sbjct  271   MFLGILTARYAEGDFLKSLPTKLIFGITCLFVSIVTMMASFGTALYLMLIKQVAWISYPI  330

Query  1142  PALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
                + +PI  + LLQFPLLV ++S TYG GIF +
Sbjct  331   IVFSVVPIALYSLLQFPLLVEMISRTYGHGIFEK  364



>ref|XP_009344349.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009344350.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Pyrus x bretschneideri]
Length=614

 Score =   213 bits (542),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 149/361 (41%), Positives = 214/361 (59%), Gaps = 11/361 (3%)
 Frame = +2

Query  191   STQNFVSQLL-LWKSIP------KKILMHQQATDLLKCLCDELKTLNDYNQVFSL---AS  340
             ST    S+L+  +K +P      K+ +   QA  L++CL  E+   +D ++V  L    S
Sbjct  249   STPGMCSRLIKTFKVLPCMRVSYKRNVKQTQALKLVQCLWKEMLRHDD-DEVMHLIREPS  307

Query  341   DALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVH  520
             + +  A  L   E +  ++++YP +    D N+  I H A+ +R  NIFNL+  T  +  
Sbjct  308   ELVFDAAKLGNYEFLSVLIDSYPELLLEYDDNNRTIFHTAVLHRHANIFNLLHETGSIKD  367

Query  521   NLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDE  700
              +    +   N+I++LAAKLAPQ +LNLVSGAALQMQREL WF+EV+KI  P F    ++
Sbjct  368   IIATFTDDENNNILHLAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPFIDMKNK  427

Query  701   YGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLP  880
              GKTP   FT  H  L  +GE WMKDT  SC + + LI TVVF+AA ++PGG  D  G P
Sbjct  428   QGKTPRELFTSEHEDLLRKGESWMKDTTNSCMLVSTLIATVVFSAAFSIPGGIDDNKGTP  487

Query  881   IFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFS  1060
              F    AF +FAIS+  +LF+++T++L+FL +LTSRYAE DFL +LP +L++GL +LF S
Sbjct  488   NFIKEAAFLIFAISDGVALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMVGLTSLFVS  547

Query  1061  IILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFS  1240
             I  MM  FS+  YL       W+  ++   A +P+  F  LQ+PLL  +  STY   +  
Sbjct  548   ITSMMVTFSTAFYLSCHYGLRWVPDLIFIFAFVPVALFAFLQYPLLFDMFFSTYCSSLLF  607

Query  1241  Q  1243
             Q
Sbjct  608   Q  608



>ref|XP_010649397.1| PREDICTED: uncharacterized protein LOC100245499 isoform X3 [Vitis 
vinifera]
Length=732

 Score =   214 bits (546),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 166/458 (36%), Positives = 243/458 (53%), Gaps = 53/458 (12%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVT----HHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYC  172
             +  YD+AL L+  H  +     ++  L M +     + +      + +   FW+R IY  
Sbjct  277   ANIYDIALHLLKHHRQLGFIKDYYGKLTMRI-----LAQKPSAFPSGSKLVFWERWIYSL  331

Query  173   I------------------------SKNSASTQNFVSQLLLW--------------KSIP  238
             I                         ++S   Q+ +S++  W              K I 
Sbjct  332   IHIKPFDEQYQEHEQPHQAPADEDNPESSRQGQHLISRVPSWWHGLILRLLINFDFKHIY  391

Query  239   KKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMA  418
             +   +H  ++ LL C+ +E+  L   +   +    AL  A+   I E V+ +++      
Sbjct  392   ETKWVHVGSSQLLDCIFEEIPNLTMESLQMAGMDHALYDAIKHGIIEFVVKLMKQDHESI  451

Query  419   YCSDHNDLNILHIAIENRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLAPQ  589
             +        +   AI  R E IF+LI G  +   +V    D  +   N+I++LA KL+P 
Sbjct  452   WRKGVKGRTMFSHAIVLRQEKIFSLIYGLGIKKNIVARRHDIFH---NNILHLAGKLSPP  508

Query  590   HKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKW  769
              +L+ VSGAALQMQRELQWFKEV+ +    +    +EY KTP   FTE H  L  EGE W
Sbjct  509   SQLDRVSGAALQMQRELQWFKEVESMVQAKYKEEFNEYHKTPSTVFTEEHATLVKEGESW  568

Query  770   MKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaa  949
             MK TA SC + A LI  ++F  A T+PGG     G+P+F  H AF VF ++++ SLF+++
Sbjct  569   MKSTAASCMVVATLIAALMFTTAFTLPGGTKSDTGIPVFIGHGAFMVFIVADSLSLFSSS  628

Query  950   tsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWI  1129
             TS+L+FL +LTSRYAE+DFL +LPN+LIIGL +LFFS++ MM AF S IY+V     +W+
Sbjct  629   TSVLMFLGILTSRYAEEDFLKSLPNKLIIGLSSLFFSLLSMMVAFGSAIYVVLSHRIAWV  688

Query  1130  RIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              I +  LA +PIT F LLQFPLLV +V  TYG  IF +
Sbjct  689   SIPLIVLACIPITFFALLQFPLLVEIVMCTYGRSIFDK  726



>emb|CAN72586.1| hypothetical protein VITISV_001920 [Vitis vinifera]
Length=317

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 190/303 (63%), Gaps = 6/303 (2%)
 Frame = +2

Query  344   ALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSV---L  514
             AL  A+   I E V+ +++      +        +   AI  R E IF+LI G  +   +
Sbjct  12    ALYDAIKHGIIEFVVKLMKQDHESIWRKGVKGRTMFSHAIVLRQEKIFSLIYGLGIKKNI  71

Query  515   VHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCM  694
             V    D  +   N+I++LA KL+P  +L+ VSGAALQMQRELQWFKEV+ +    +    
Sbjct  72    VARRHDIFH---NNILHLAGKLSPPSQLDRVSGAALQMQRELQWFKEVESMVQAKYKEEF  128

Query  695   DEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANG  874
             +EY KTP   FTE H  L  EGE WMK TA SC + A LI  ++F  A T+PGG     G
Sbjct  129   NEYHKTPSTVFTEEHATLVKEGESWMKSTAASCMVVATLIAALMFTTAFTLPGGTKSDTG  188

Query  875   LPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLF  1054
             +P+F  H AF VF ++++ SLF+++TS+L+FL +LTSRYAE+DFL +LPN+LIIGL +LF
Sbjct  189   IPVFIGHGAFMVFIVADSLSLFSSSTSVLMFLGILTSRYAEEDFLKSLPNKLIIGLSSLF  248

Query  1055  FSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGI  1234
             FS++ MM AF S IY+V     +W+ I +  LA +PIT F LLQFPLLV +V  TYG  I
Sbjct  249   FSLLSMMVAFGSAIYVVLSHRIAWVSIPLIVLACIPITFFALLQFPLLVEIVMCTYGRSI  308

Query  1235  FSQ  1243
             F +
Sbjct  309   FDK  311



>ref|XP_010694148.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Beta 
vulgaris subsp. vulgaris]
Length=632

 Score =   213 bits (542),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 158/418 (38%), Positives = 242/418 (58%), Gaps = 31/418 (7%)
 Frame = +2

Query  11    FYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANF-SFWKRSIYYCISKNS  187
              YD+AL  + +H  +     LN G   L  + +   P+ N A+  S W   +  C + N 
Sbjct  206   LYDVALHFIDEHPHLAVERNLN-GETVLHILARR--PLQNCASKQSIWGNFVNRCTNMNK  262

Query  188   ASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHL  367
               ++    QL L   + ++  +     +++K      K  N+ + +    S  L  A  +
Sbjct  263   DESKQ---QLELALQVTQRAWI-----EVIK------KDENEISDLIGYPSRILFVAAEM  308

Query  368   DIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGN  547
                + +++++ +YP + +  D  + +I HIAI+ R E IF LI     +   +    +  
Sbjct  309   GNVDFLITLILSYPDVIWKVDEKNRSIFHIAIKCRHEEIFKLIHEIGAIKDLIASYKDTE  368

Query  548   GNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMD----------  697
              N++++LAAK+AP  +LN VSGAALQMQREL WF+ V+ +  P++++  +          
Sbjct  369   RNNMLHLAAKIAPPDRLNCVSGAALQMQRELLWFEVVKNVVQPHYAAAKNKSKVTSQDVG  428

Query  698   ---EYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDA  868
                + GKTP+  FTE H+ L+I+GE WMK TA SCT+ A LI TVVF AA T+PGGN ++
Sbjct  429   NTSKSGKTPQALFTEEHKDLRIQGEAWMKKTAESCTLVATLITTVVFTAAFTLPGGNDES  488

Query  869   NGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLIT  1048
             NG PI  S  +F VFAISNA SLF A+TS+L+FLS+LTSRYAE DFL  LP +L++GL +
Sbjct  489   NGFPILLSEISFKVFAISNAISLFAASTSILMFLSILTSRYAESDFLRLLPFKLMVGLTS  548

Query  1049  LFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
             LF SI  MM AF++T ++ F ++  WI + +  LA++P+  F   Q+PLL  +  +TY
Sbjct  549   LFVSIATMMVAFTATFFITFQRDSIWIPVPIALLAAIPVLLFGFQQYPLLWDIYRATY  606



>ref|XP_006448678.1| hypothetical protein CICLE_v10014877mg [Citrus clementina]
 gb|ESR61918.1| hypothetical protein CICLE_v10014877mg [Citrus clementina]
Length=530

 Score =   211 bits (536),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 185/296 (63%), Gaps = 9/296 (3%)
 Frame = +2

Query  377   EVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTI-----N  541
             E +  ++  YP + +  D    +I H A+  R E++F LI      +  ++D I      
Sbjct  204   EFLTILIREYPDLVWKVDEKFCSIFHYAVSERHEDVFKLIYE----IGAIKDIIVLSQEK  259

Query  542   GNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEM  721
               GN+I++LA KLAPQ +LN+VSGAALQMQREL WF+EV+ +    F    + + +TP  
Sbjct  260   ETGNNILHLAGKLAPQDRLNIVSGAALQMQRELLWFREVKNVIQSSFVEKENRHHETPRA  319

Query  722   HFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNA  901
              FT+ H+ L+ EGEKWMKDTATSC I A LI TVVFAAA TVPGG     GLP F    +
Sbjct  320   LFTKEHKKLREEGEKWMKDTATSCMIVATLIATVVFAAAFTVPGGTKGETGLPFFDKKVS  379

Query  902   FTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTA  1081
             F +FAIS+A SL +++ S++ FLS+LTSRYAE+DFL  LP +L+ GL+TLF SI+ MM  
Sbjct  380   FQIFAISDAISLVSSSASIVNFLSILTSRYAEEDFLELLPGKLLFGLLTLFISILTMMVV  439

Query  1082  FSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQRG  1249
             FS+T ++ F   + WI ++V   +S P+  F+     L + ++ STY      Q+G
Sbjct  440   FSTTFFIFFNHERLWIAVLVTVFSSFPVILFIYQHIQLFIDVLRSTYVINSLFQKG  495



>ref|XP_011020233.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Populus euphratica]
Length=612

 Score =   212 bits (540),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 166/416 (40%), Positives = 240/416 (58%), Gaps = 30/416 (7%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDC---PIINTANFSFWKRSIYYCI  175
             S  YD+A +++ +H  + + A     +  L A  +  C    I++ +   FW +    C+
Sbjct  194   SDIYDVAWKMLKEHRGLAY-ARDEHQLTALHAFSQKSCMPSNIVDQSPPGFWNK----CL  248

Query  176   SKNSASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLND------YNQVFSLA  337
                     N  S++ L +    K LMH+QA D+++ L +++  L+D        + F L 
Sbjct  249   --------NPFSEVKLAR---MKKLMHKQALDIIQYLWEQVVLLDDATISRQIGEPFPLI  297

Query  338   SDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLV  517
               A  R  +LD   +++ +   YP + +  +HN  +I HI+I NR E+IF +I     + 
Sbjct  298   FTAAERG-NLDFLTILIRL---YPELIFKVEHNMYSIFHISILNRHEDIFKIIYQIGSIK  353

Query  518   HNLQDTINGNGNDIMNLAAK-LAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCM  694
             + +    +  GN++++LAAK L    +LN++ GAALQ+QREL WF+EV+K+  P      
Sbjct  354   NLITTYKDREGNNMLHLAAKVLESPSRLNVIPGAALQLQRELLWFEEVKKVVQPRHIEEK  413

Query  695   DEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANG  874
             +  GKTP   F E H+ L  EGE+WM+DTA SC + A LI TVVFAAA TVPGGN    G
Sbjct  414   NTNGKTPGALFIEQHKDLMKEGEQWMRDTADSCMLVATLIATVVFAAAFTVPGGNLQDKG  473

Query  875   LPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLF  1054
              P+F    AF  FAIS+A SL T+A+SLL FLS+ TSRYAEQ+FL++LPNRLIIGL TLF
Sbjct  474   TPVFLKEIAFKFFAISDAISLVTSASSLLTFLSIRTSRYAEQNFLWSLPNRLIIGLTTLF  533

Query  1055  FSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
              SI  MM AF +T +LVF        I +  +AS P+  F+   F L V ++ STY
Sbjct  534   ISIGAMMVAFMATFFLVFSNKLLPYSIPIAVVASFPVIFFIWQHFRLFVDMIHSTY  589



>ref|XP_010649396.1| PREDICTED: uncharacterized protein LOC100245499 isoform X2 [Vitis 
vinifera]
Length=732

 Score =   214 bits (545),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 166/460 (36%), Positives = 243/460 (53%), Gaps = 55/460 (12%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVT----HHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYC  172
             +  YD+AL L+  H  +     ++  L M +     + +      + +   FW+R IY  
Sbjct  275   ANIYDIALHLLKHHRQLGFIKDYYGKLTMRI-----LAQKPSAFPSGSKLVFWERWIYSL  329

Query  173   I------------------------SKNSASTQNFVSQLLLW----------------KS  232
             I                         ++S   Q+ +S++  W                K 
Sbjct  330   IHIKPFDEQYQEHEQPHQAPADEDNPESSRQGQHLISRVPSWWHGLILRLLINFVPDFKH  389

Query  233   IPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPT  412
             I +   +H  ++ LL C+ +E+  L   +   +    AL  A+   I E V+ +++    
Sbjct  390   IYETKWVHVGSSQLLDCIFEEIPNLTMESLQMAGMDHALYDAIKHGIIEFVVKLMKQDHE  449

Query  413   MAYCSDHNDLNILHIAIENRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLA  583
               +        +   AI  R E IF+LI G  +   +V    D  +   N+I++LA KL+
Sbjct  450   SIWRKGVKGRTMFSHAIVLRQEKIFSLIYGLGIKKNIVARRHDIFH---NNILHLAGKLS  506

Query  584   PQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGE  763
             P  +L+ VSGAALQMQRELQWFKEV+ +    +    +EY KTP   FTE H  L  EGE
Sbjct  507   PPSQLDRVSGAALQMQRELQWFKEVESMVQAKYKEEFNEYHKTPSTVFTEEHATLVKEGE  566

Query  764   KWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslft  943
              WMK TA SC + A LI  ++F  A T+PGG     G+P+F  H AF VF ++++ SLF+
Sbjct  567   SWMKSTAASCMVVATLIAALMFTTAFTLPGGTKSDTGIPVFIGHGAFMVFIVADSLSLFS  626

Query  944   aatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKS  1123
             ++TS+L+FL +LTSRYAE+DFL +LPN+LIIGL +LFFS++ MM AF S IY+V     +
Sbjct  627   SSTSVLMFLGILTSRYAEEDFLKSLPNKLIIGLSSLFFSLLSMMVAFGSAIYVVLSHRIA  686

Query  1124  WIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             W+ I +  LA +PIT F LLQFPLLV +V  TYG  IF +
Sbjct  687   WVSIPLIVLACIPITFFALLQFPLLVEIVMCTYGRSIFDK  726



>ref|XP_010665689.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=623

 Score =   213 bits (541),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 207/346 (60%), Gaps = 11/346 (3%)
 Frame = +2

Query  212   QLLLWKSI--------PKKILMHQQATDLLKCLCDELKTLN--DYNQVFSLASDALLRAV  361
             QL +WKS          +K L  Q A  L  CL +E+  L   D + +       L  A 
Sbjct  196   QLSIWKSFSMKCGSINEEKRLEPQLAIQLTHCLWNEVIKLKEEDISNLIGYPWRLLFVAA  255

Query  362   HLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTIN  541
              L   E + +++ +YP + +  D N   I HIAI +R E IF LI     +   +    +
Sbjct  256   KLGKVEFLTTLIRSYPDLIWKVDENRRTIFHIAIMHRHEEIFQLIYEIGAIKDLVATFKD  315

Query  542   GNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEM  721
              +GN++++LA+KLAP H+LN +SGAALQMQRE+ WFK V+K+  P ++   +E  KTP  
Sbjct  316   DHGNNMLHLASKLAPPHRLNSISGAALQMQREILWFKAVRKVVRPEYAEAENENQKTPHA  375

Query  722   HFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNA  901
              F+E H  L+++GE+WMK TA SC +   LI TVVF++A  +PGG +D  G  +     +
Sbjct  376   LFSEEHEGLRVKGEEWMKKTAESCALVGTLIATVVFSSAFQLPGGVND-KGSTVLLREPS  434

Query  902   FTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTA  1081
             F VFA SNA SLFT+  S+L+FLS+LTSRYAE DF+ +LP +L++GL  LF SI  M+ A
Sbjct  435   FVVFATSNAVSLFTSTASVLMFLSILTSRYAESDFVISLPTKLVLGLTLLFVSIATMIIA  494

Query  1082  FSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSST  1219
             F++T ++ F +   W  + +  +A +P+  FVL Q+PLLV +  ST
Sbjct  495   FTATFFITFREGIIWAPVPIALIAFVPVALFVLQQYPLLVDIYRST  540



>ref|XP_006379474.1| hypothetical protein POPTR_0008s02390g [Populus trichocarpa]
 ref|XP_006379475.1| hypothetical protein POPTR_0008s02390g [Populus trichocarpa]
 gb|ERP57271.1| hypothetical protein POPTR_0008s02390g [Populus trichocarpa]
 gb|ERP57272.1| hypothetical protein POPTR_0008s02390g [Populus trichocarpa]
Length=463

 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 153/394 (39%), Positives = 226/394 (57%), Gaps = 33/394 (8%)
 Frame = +2

Query  134   ANFSFWKRSIYYCISKNSASTQNFVSQLLLWKSIPKKILM-----------------HQQ  262
             +  +FW+R IY CI  N      F  Q+L   S P+K ++                 H  
Sbjct  75    SRLAFWQRWIYSCI--NIGPPIPFSDQMLQASSRPRKEVIKLLKFLGIKQIYDVKLNHIY  132

Query  263   ATDLLKCLCDELKTLN----DYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSD  430
             + +LL+ +   + TL+    D   +F     A   AV   I E+++ +V+  P + +  D
Sbjct  133   SDELLRRMVKHISTLDFEKYDECGLFR----AFNNAVKNGIVEMIVEMVKVCPNLMHTFD  188

Query  431   HNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVS  610
              N    L  ++ +R E IF+L  G      N     +   N +++ A +L+P  +L  +S
Sbjct  189   KNGRVFLMSSVAHRQEKIFSLFYGLEGRNGNFLSVTDVFDNTMLHCAGELSPSTQLARIS  248

Query  611   GAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATS  790
             GAALQMQRELQW++EV+ I  P   +  ++ G+TP   FT++H  L   GEKWMK  ATS
Sbjct  249   GAALQMQRELQWYREVESIVNPRAKTYCNQNGETPGQLFTKSHEKLMAAGEKWMKQVATS  308

Query  791   CtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfl  970
              T+  ALI+TV+F AA TVPGGN D  G P+F    +F +F IS+A SLF ++TS+L+FL
Sbjct  309   STVVGALIITVMFTAAFTVPGGNKD-TGFPVFLHEKSFLIFIISDAISLFASSTSVLMFL  367

Query  971   svltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPA-  1147
              +LTSRY+E DFL + P +L+IGL TLF S+  MM AF + + +V       + +++P  
Sbjct  368   GILTSRYSENDFLISFPRKLVIGLSTLFISVAAMMVAFCAALRIVMDGR---LEVVIPVS  424

Query  1148  -LASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
              LA +P+T F+LLQFPLLV +  STYGPGIF+++
Sbjct  425   LLAGIPVTLFILLQFPLLVEIFMSTYGPGIFNRK  458



>ref|XP_008341404.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Malus 
domestica]
Length=327

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 203/325 (62%), Gaps = 7/325 (2%)
 Frame = +2

Query  284   LCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAI  463
             +CDE+K L D      L  +A+  AV   I EVV+ + +A P + +    +  NI H A+
Sbjct  1     MCDEIKQLTDEEMRDGLVYEAVYSAVQNGIVEVVIHLCQARPELLFRGLEBGKNIFHYAV  60

Query  464   ENRCENIFNLIRGTSVLVHNLQDTINGN-GNDIMNLAAKLAP--QHKLNLVSGAALQMQR  634
             E R EN+++LI G  V   NL  T+  N GN I++ A  L+P    KL+ ++GAA QMQR
Sbjct  61    ECRQENVYSLIYG--VGQRNLITTLRDNSGNSILHYAGMLSPLASRKLDRIAGAAFQMQR  118

Query  635   ELQWFKEVQKIALPY-FSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaal  811
             E QW+KEV+ I +P   +S +++ G TP   FTE H+ L  +GEKWM+  A S T+  AL
Sbjct  119   ERQWYKEVESIVVPLSGASTLNKDGLTPPQLFTEEHKELLEDGEKWMRSAAKSYTVVNAL  178

Query  812   ivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRY  991
             I+T++FAA  TVPGGN+   G PIF +   F VF  S+A SL T+ATS L+FLS+LTSRY
Sbjct  179   IITIMFAAVYTVPGGNNQMTGFPIFLNGKVFMVFIGSDAISLCTSATSALIFLSILTSRY  238

Query  992   AEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITS  1171
             AE DFL +LP ++I+GL  L  SI  MM AFSS ++++F Q+K W       LA++P+  
Sbjct  239   AEDDFLKSLPTKMILGLSALLISIASMMVAFSSALFIMF-QDKLWFIYPFIFLAAIPVIL  297

Query  1172  FVLLQFPLLVALVSSTYGPGIFSQR  1246
             F+ +Q PLL  +  STY   +F ++
Sbjct  298   FIGMQLPLLFMIFKSTYCERVFDKK  322



>ref|XP_006431561.1| hypothetical protein CICLE_v10003229mg, partial [Citrus clementina]
 gb|ESR44801.1| hypothetical protein CICLE_v10003229mg, partial [Citrus clementina]
Length=573

 Score =   211 bits (538),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 151/336 (45%), Positives = 212/336 (63%), Gaps = 9/336 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             KSI ++ L H QA ++++ +C E+       ++      AL  A  L I E V   + AY
Sbjct  243   KSIHEQKLAHMQAVEIVRIICKEVVWTCQGIEL----DWALFTAARLGIHEFVNEFIMAY  298

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
                A   + +  NI  +A+ +R E +FNLI   +    +L  T   +GN+I++LAAKL P
Sbjct  299   NRTADVLNEDRRNIFDVAVLHRREKVFNLIHRVNYTT-DLFSTEGNSGNNILHLAAKLVP  357

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +   V+GAALQMQRELQWFK V+K+  P      +   KT    FTE H+ L  EGEK
Sbjct  358   SSE---VAGAALQMQRELQWFKAVEKLIHPAMLGDENSSKKTAREVFTEEHKELVKEGEK  414

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WMK+TA+SC++ AALI+TVVFAAA TVPGG SD+ G+P      +F +FAIS+  +LF++
Sbjct  415   WMKETASSCSVVAALIITVVFAAAFTVPGG-SDSRGIPNILHEPSFMIFAISDILALFSS  473

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
              +S+L+FL +LTSRYAE DFL +LP +LIIGL+TLFFSI  MM AF +T+++      + 
Sbjct  474   ISSVLMFLGILTSRYAEDDFLLSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNL  533

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGI  1234
             + I +  +  +P+T F LLQFPLL+ + SSTYG  I
Sbjct  534   VIIPIALVGCVPVTLFALLQFPLLLDMYSSTYGRSI  569



>ref|XP_009763965.1| PREDICTED: uncharacterized protein LOC104215763 isoform X2 [Nicotiana 
sylvestris]
Length=723

 Score =   214 bits (544),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 162/417 (39%), Positives = 233/417 (56%), Gaps = 22/417 (5%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISK-  181
             S  YD A  LV    D+  ++  N G  PL  +       ++T++ S  K   Y   S  
Sbjct  294   SDLYDFATHLVKCFPDLAKYSTSN-GSSPLAQLATKTSSFVSTSHISSPKPLSYIVTSAT  352

Query  182   --------NSASTQNFVSQLLLWKS----------IPKKILMHQQATDLLKCLCDELKTL  307
                     N+   +N V++ LL K           I  K   +Q A  L +CLC++L++ 
Sbjct  353   SWIFQDRANANDIENAVNEALLNKPKTNNSPELEYIRDKEWKYQNAIKLAECLCEKLESS  412

Query  308   NDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIF  487
             ++  ++ S+     L+AV  D  ++V  IV  +P + Y  + N  NIL IA+ENRC N++
Sbjct  413   SE-KEIKSIVGGPFLQAVRFDNYKLVEIIVGKFPLLIYHCNKNGKNILPIAVENRCTNVY  471

Query  488   NLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKI  667
             NL+   S   H+L  +++   N +++LA +L+P++K+N   GAAL+MQ EL+WF+ V+++
Sbjct  472   NLVCQMSQHRHHLMTSLDSFNNTMLHLAGQLSPENKVNHTFGAALRMQEELRWFEAVKQM  531

Query  668   ALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitv  847
               P +   ++  GKT    F E H  LKIEGEKWMK+ A SC I A L +T+ FAAAITV
Sbjct  532   LPPSYYERLNNKGKTAHQVFIEQHGNLKIEGEKWMKEIANSCAILAMLAITIAFAAAITV  591

Query  848   PGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNR  1027
             PGG +  NGLPIFS +  F  FA SN  SL TA  SL  F+S+LTS YAE+DFL  LP R
Sbjct  592   PGGRNCENGLPIFSKNGYFNAFAFSNTVSLSTACISLFAFVSILTSSYAEEDFLRVLPKR  651

Query  1028  LIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLL  1198
             L+ GL+TL+ SI  MM +F   +Y VF  N     +    L  LPI +F   + PL+
Sbjct  652   LLWGLLTLYASIEAMMLSFGCALYFVFKDNDILFYVGF-ILGVLPILAFQHWRGPLV  707



>ref|XP_009763957.1| PREDICTED: uncharacterized protein LOC104215763 isoform X1 [Nicotiana 
sylvestris]
Length=724

 Score =   214 bits (544),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 162/417 (39%), Positives = 233/417 (56%), Gaps = 22/417 (5%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVTHHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYCISK-  181
             S  YD A  LV    D+  ++  N G  PL  +       ++T++ S  K   Y   S  
Sbjct  295   SDLYDFATHLVKCFPDLAKYSTSN-GSSPLAQLATKTSSFVSTSHISSPKPLSYIVTSAT  353

Query  182   --------NSASTQNFVSQLLLWKS----------IPKKILMHQQATDLLKCLCDELKTL  307
                     N+   +N V++ LL K           I  K   +Q A  L +CLC++L++ 
Sbjct  354   SWIFQDRANANDIENAVNEALLNKPKTNNSPELEYIRDKEWKYQNAIKLAECLCEKLESS  413

Query  308   NDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIF  487
             ++  ++ S+     L+AV  D  ++V  IV  +P + Y  + N  NIL IA+ENRC N++
Sbjct  414   SE-KEIKSIVGGPFLQAVRFDNYKLVEIIVGKFPLLIYHCNKNGKNILPIAVENRCTNVY  472

Query  488   NLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKI  667
             NL+   S   H+L  +++   N +++LA +L+P++K+N   GAAL+MQ EL+WF+ V+++
Sbjct  473   NLVCQMSQHRHHLMTSLDSFNNTMLHLAGQLSPENKVNHTFGAALRMQEELRWFEAVKQM  532

Query  668   ALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitv  847
               P +   ++  GKT    F E H  LKIEGEKWMK+ A SC I A L +T+ FAAAITV
Sbjct  533   LPPSYYERLNNKGKTAHQVFIEQHGNLKIEGEKWMKEIANSCAILAMLAITIAFAAAITV  592

Query  848   PGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNR  1027
             PGG +  NGLPIFS +  F  FA SN  SL TA  SL  F+S+LTS YAE+DFL  LP R
Sbjct  593   PGGRNCENGLPIFSKNGYFNAFAFSNTVSLSTACISLFAFVSILTSSYAEEDFLRVLPKR  652

Query  1028  LIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLL  1198
             L+ GL+TL+ SI  MM +F   +Y VF  N     +    L  LPI +F   + PL+
Sbjct  653   LLWGLLTLYASIEAMMLSFGCALYFVFKDNDILFYVGF-ILGVLPILAFQHWRGPLV  708



>ref|XP_010649395.1| PREDICTED: uncharacterized protein LOC100245499 isoform X1 [Vitis 
vinifera]
Length=734

 Score =   214 bits (544),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 166/460 (36%), Positives = 243/460 (53%), Gaps = 55/460 (12%)
 Frame = +2

Query  5     SKFYDMALELVGQHHDVT----HHAALNMGVPPLDAIVKYDCPIINTANFSFWKRSIYYC  172
             +  YD+AL L+  H  +     ++  L M +     + +      + +   FW+R IY  
Sbjct  277   ANIYDIALHLLKHHRQLGFIKDYYGKLTMRI-----LAQKPSAFPSGSKLVFWERWIYSL  331

Query  173   I------------------------SKNSASTQNFVSQLLLW----------------KS  232
             I                         ++S   Q+ +S++  W                K 
Sbjct  332   IHIKPFDEQYQEHEQPHQAPADEDNPESSRQGQHLISRVPSWWHGLILRLLINFVPDFKH  391

Query  233   IPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPT  412
             I +   +H  ++ LL C+ +E+  L   +   +    AL  A+   I E V+ +++    
Sbjct  392   IYETKWVHVGSSQLLDCIFEEIPNLTMESLQMAGMDHALYDAIKHGIIEFVVKLMKQDHE  451

Query  413   MAYCSDHNDLNILHIAIENRCENIFNLIRGTSV---LVHNLQDTINGNGNDIMNLAAKLA  583
               +        +   AI  R E IF+LI G  +   +V    D  +   N+I++LA KL+
Sbjct  452   SIWRKGVKGRTMFSHAIVLRQEKIFSLIYGLGIKKNIVARRHDIFH---NNILHLAGKLS  508

Query  584   PQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGE  763
             P  +L+ VSGAALQMQRELQWFKEV+ +    +    +EY KTP   FTE H  L  EGE
Sbjct  509   PPSQLDRVSGAALQMQRELQWFKEVESMVQAKYKEEFNEYHKTPSTVFTEEHATLVKEGE  568

Query  764   KWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslft  943
              WMK TA SC + A LI  ++F  A T+PGG     G+P+F  H AF VF ++++ SLF+
Sbjct  569   SWMKSTAASCMVVATLIAALMFTTAFTLPGGTKSDTGIPVFIGHGAFMVFIVADSLSLFS  628

Query  944   aatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKS  1123
             ++TS+L+FL +LTSRYAE+DFL +LPN+LIIGL +LFFS++ MM AF S IY+V     +
Sbjct  629   SSTSVLMFLGILTSRYAEEDFLKSLPNKLIIGLSSLFFSLLSMMVAFGSAIYVVLSHRIA  688

Query  1124  WIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             W+ I +  LA +PIT F LLQFPLLV +V  TYG  IF +
Sbjct  689   WVSIPLIVLACIPITFFALLQFPLLVEIVMCTYGRSIFDK  728



>gb|KDO41012.1| hypothetical protein CISIN_1g021201mg [Citrus sinensis]
Length=316

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/267 (48%), Positives = 173/267 (65%), Gaps = 2/267 (1%)
 Frame = +2

Query  428   DHNDLNILHIAIENRCENIFNLIRGTSV--LVHNLQDTINGNGNDIMNLAAKLAPQHKLN  601
             D N   I HIA+ NR   +F  I    +  +   L D+ +G GN+I++LA KLAP  +LN
Sbjct  5     DENRYTIFHIAVSNRQVELFKFIDADDMKAIADLLVDSTDGEGNNILHLAGKLAPPDRLN  64

Query  602   LVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDT  781
             +VSG+ALQMQREL WF+ V+K+     +   ++ G TP   F+E HR LK +GEKWMKDT
Sbjct  65    VVSGSALQMQRELLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDT  124

Query  782   ATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsll  961
             A+SC I A LI TVVFAAA+TVPGGN +  GLP F  + +F +FA+SN  SL  +  S++
Sbjct  125   ASSCMIVATLIATVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIV  184

Query  962   vflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIV  1141
             VFLS++T RYAE+DFL  LP +L +GL TLF +I  MM  FS+T ++VF    +WI I+V
Sbjct  185   VFLSLVTPRYAEKDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILV  244

Query  1142  PALASLPITSFVLLQFPLLVALVSSTY  1222
               + S+P   F  L F L   ++ S +
Sbjct  245   IVVPSVPAILFFYLHFRLFDDILRSVF  271



>ref|XP_011020234.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Populus euphratica]
Length=559

 Score =   210 bits (535),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 150/334 (45%), Positives = 207/334 (62%), Gaps = 11/334 (3%)
 Frame = +2

Query  242   KILMHQQATDLLKCLCDELKTLND------YNQVFSLASDALLRAVHLDIAEVVLSIVEA  403
             K LMH+QA D+++ L +++  L+D        + F L   A  R  +LD   +++ +   
Sbjct  207   KKLMHKQALDIIQYLWEQVVLLDDATISRQIGEPFPLIFTAAERG-NLDFLTILIRL---  262

Query  404   YPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAK-L  580
             YP + +  +HN  +I HI+I NR E+IF +I     + + +    +  GN++++LAAK L
Sbjct  263   YPELIFKVEHNMYSIFHISILNRHEDIFKIIYQIGSIKNLITTYKDREGNNMLHLAAKVL  322

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
                 +LN++ GAALQ+QREL WF+EV+K+  P      +  GKTP   F E H+ L  EG
Sbjct  323   ESPSRLNVIPGAALQLQRELLWFEEVKKVVQPRHIEEKNTNGKTPGALFIEQHKDLMKEG  382

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             E+WM+DTA SC + A LI TVVFAAA TVPGGN    G P+F    AF  FAIS+A SL 
Sbjct  383   EQWMRDTADSCMLVATLIATVVFAAAFTVPGGNLQDKGTPVFLKEIAFKFFAISDAISLV  442

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             T+A+SLL FLS+ TSRYAEQ+FL++LPNRLIIGL TLF SI  MM AF +T +LVF    
Sbjct  443   TSASSLLTFLSIRTSRYAEQNFLWSLPNRLIIGLTTLFISIGAMMVAFMATFFLVFSNKL  502

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
                 I +  +AS P+  F+   F L V ++ STY
Sbjct  503   LPYSIPIAVVASFPVIFFIWQHFRLFVDMIHSTY  536



>ref|XP_004291593.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Fragaria 
vesca subsp. vesca]
Length=615

 Score =   211 bits (538),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 207/330 (63%), Gaps = 2/330 (1%)
 Frame = +2

Query  260   QATDLLKCLCDEL--KTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDH  433
             QA  L++ L +E+     +D  ++    S+ +  A  L   E +  ++ +YP + + +D+
Sbjct  279   QALQLVERLWEEILKDEHDDVMRLIKYPSNLIFDAAELGNYEFLAVLMSSYPELVWETDN  338

Query  434   NDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSG  613
              +  I+H+A+ +R  +IFNL+     +   +    +  GN+I+++AAK+APQ++LNLVSG
Sbjct  339   KNRTIIHVAVLHRHASIFNLVHEIGSIKDVIVTYEDKEGNNIVHMAAKVAPQNQLNLVSG  398

Query  614   AALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSC  793
              ALQMQREL WF+EV+KI  P +    ++ GKTP+  FT+ HR L  +GEKWMK+TATSC
Sbjct  399   VALQMQRELVWFEEVKKIVQPQYIEMENKKGKTPQELFTKEHRTLMRQGEKWMKETATSC  458

Query  794   tiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvfls  973
              + A +I TVVF+AA ++PGG  D  G P F +  AF  F I++  +LF+++T++L+FL 
Sbjct  459   LLVATIIATVVFSAAFSIPGGTDDKTGKPNFLTEKAFLYFTIADGVALFSSSTAMLMFLF  518

Query  974   vltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALA  1153
             +LTSRYAE DFL +LP +L++GL  LF SI  MM AFS+  YL       W+  +    A
Sbjct  519   ILTSRYAENDFLMSLPLKLMVGLSCLFISIASMMMAFSTAFYLSCQYGSKWVPDLTFFFA  578

Query  1154  SLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
              +P+  +  LQFPL+  + SST+   +  Q
Sbjct  579   IVPVALYAFLQFPLVSDMSSSTFCSSLLFQ  608



>ref|XP_006431563.1| hypothetical protein CICLE_v10003303mg, partial [Citrus clementina]
 gb|ESR44803.1| hypothetical protein CICLE_v10003303mg, partial [Citrus clementina]
Length=545

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 149/336 (44%), Positives = 212/336 (63%), Gaps = 9/336 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K+I ++ L H Q  ++++ +C E+       ++      AL  A  L I E V   + AY
Sbjct  215   KAIHEQKLAHMQTVEIVRIICKEVIWTCHRREL----KGALFTAARLGIHEFVNEFIMAY  270

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAP  586
                A   + +  +I  +A+ +R E +FNLI   +    NL  T   +GN+I++LAAKL P
Sbjct  271   NKTANVLNEDRRSIFDVAVLHRREKVFNLIHRVN-FTTNLFLTEGNSGNNILHLAAKLVP  329

Query  587   QHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEK  766
               +   V+GAALQMQRELQWFK V+K+  P      +   +T    FTE H+ L  EGEK
Sbjct  330   SSE---VAGAALQMQRELQWFKAVEKLIHPDMLGDENSSNQTAREVFTEEHKELVKEGEK  386

Query  767   WMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslfta  946
             WMK+TA+SC++ AALI+TVVFAAA TVPGG SD+ G+P      +F +FAIS+  +LF++
Sbjct  387   WMKETASSCSVVAALIITVVFAAAFTVPGG-SDSKGIPNILHEPSFMIFAISDILALFSS  445

Query  947   atsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSW  1126
              +S+L+FL +LTSRYAE DFL +LP +LIIGL+TLFFSI  MM AF +T+++      + 
Sbjct  446   ISSVLMFLGILTSRYAEDDFLLSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNL  505

Query  1127  IRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGI  1234
             + I +  +  +P+T FVLLQFPLL+ + SSTYG  I
Sbjct  506   VIIPIALVGCVPVTLFVLLQFPLLLDMYSSTYGRSI  541



>ref|XP_006490203.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Citrus sinensis]
Length=653

 Score =   212 bits (540),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/375 (39%), Positives = 220/375 (59%), Gaps = 5/375 (1%)
 Frame = +2

Query  113   DCPIINTANFSFWKRSIYYCISKN-SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLC  289
             D P + T      + +++    KN ++S QN       + ++  K   ++QA  L++ L 
Sbjct  234   DRPQLATKRDRNEETALHVLARKNLTSSNQNPCGAFQRYFNLGAKNRKNKQALKLVESLW  293

Query  290   DELKTLN--DYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAI  463
             +++  L   D +++    +  +  A +    + +  ++  YP + +  D N   I HIA+
Sbjct  294   EQVILLREPDISKLIKEPTRIIFDAANHGNVQFLSILIREYPDLMWKCDENRYTIFHIAV  353

Query  464   ENRCENIFNLIRGTSV--LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRE  637
              NR   +F  I    +  +   L D+ +G GN+I++LA KLAP  +LN+VSG+ALQMQRE
Sbjct  354   SNRQVELFKFIDADDMKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRE  413

Query  638   LQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaaliv  817
             L WF+ V+K+     +   ++ G TP   F+E HR LK +GEKWMKDTA+SC I A LI 
Sbjct  414   LLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIA  473

Query  818   tvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAE  997
             TVVFAAA+TVPGGN +  GLP F  + +F +FA+SN  SL  +  S++VFLS++T RYAE
Sbjct  474   TVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAE  533

Query  998   QDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFV  1177
             +DFL  LP +L +GL TLF +I  MM  FS+T ++VF    +WI I+V  + S+P   F 
Sbjct  534   KDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFF  593

Query  1178  LLQFPLLVALVSSTY  1222
              L F L   ++ S +
Sbjct  594   YLHFRLFDDILRSVF  608



>ref|XP_006490206.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X4 [Citrus sinensis]
Length=647

 Score =   212 bits (539),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/375 (39%), Positives = 220/375 (59%), Gaps = 5/375 (1%)
 Frame = +2

Query  113   DCPIINTANFSFWKRSIYYCISKN-SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLC  289
             D P + T      + +++    KN ++S QN       + ++  K   ++QA  L++ L 
Sbjct  228   DRPQLATKRDRNEETALHVLARKNLTSSNQNPCGAFQRYFNLGAKNRKNKQALKLVESLW  287

Query  290   DELKTLN--DYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAI  463
             +++  L   D +++    +  +  A +    + +  ++  YP + +  D N   I HIA+
Sbjct  288   EQVILLREPDISKLIKEPTRIIFDAANHGNVQFLSILIREYPDLMWKCDENRYTIFHIAV  347

Query  464   ENRCENIFNLIRGTSV--LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRE  637
              NR   +F  I    +  +   L D+ +G GN+I++LA KLAP  +LN+VSG+ALQMQRE
Sbjct  348   SNRQVELFKFIDADDMKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRE  407

Query  638   LQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaaliv  817
             L WF+ V+K+     +   ++ G TP   F+E HR LK +GEKWMKDTA+SC I A LI 
Sbjct  408   LLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIA  467

Query  818   tvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAE  997
             TVVFAAA+TVPGGN +  GLP F  + +F +FA+SN  SL  +  S++VFLS++T RYAE
Sbjct  468   TVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAE  527

Query  998   QDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFV  1177
             +DFL  LP +L +GL TLF +I  MM  FS+T ++VF    +WI I+V  + S+P   F 
Sbjct  528   KDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFF  587

Query  1178  LLQFPLLVALVSSTY  1222
              L F L   ++ S +
Sbjct  588   YLHFRLFDDILRSVF  602



>ref|XP_007221263.1| hypothetical protein PRUPE_ppa008654mg [Prunus persica]
 gb|EMJ22462.1| hypothetical protein PRUPE_ppa008654mg [Prunus persica]
Length=323

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 196/307 (64%), Gaps = 9/307 (3%)
 Frame = +2

Query  341   DALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLI-----RGT  505
              A+ RA+ L + E   S+++A P + + S+    N++H AIE R E I++LI        
Sbjct  16    QAIFRAIELGMFEFTDSVLQARPNLIWLSNQAGRNLVHFAIECRQEKIYSLIINRLDERE  75

Query  506   SVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFS  685
               L+ N+ D    +GN  +++A  L+   KLN +SGAALQMQRELQWFKEV+ I LP   
Sbjct  76    RKLIGNIADM---SGNCALHVAGMLSKFAKLNDISGAALQMQRELQWFKEVETIGLPRLK  132

Query  686   SCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSD  865
                ++   TP   FT+NH+ L  EGE+WMK+TATSCT+  ALI+T++FAAA TVPGGN+ 
Sbjct  133   ERRNKDHMTPRELFTDNHKELVKEGERWMKETATSCTVVGALIITIMFAAAFTVPGGNNG  192

Query  866   ANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLI  1045
               G PIF   N F  F + +A SLF++ TS+L+FL +LTSRYAE DFL +LP ++IIGL 
Sbjct  193   ETGFPIFLHKNLFMAFIVLDAISLFSSTTSVLMFLGILTSRYAENDFLKSLPTKMIIGLS  252

Query  1046  TLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYG  1225
             TL  SI  MM AFS  ++++  ++ SWI I    LA +P+  F L Q  LLV +  STYG
Sbjct  253   TLIISIATMMGAFSFALFIMIHEH-SWIVIPTIVLAIIPVILFSLTQCRLLVDMCISTYG  311

Query  1226  PGIFSQR  1246
              GI  ++
Sbjct  312   RGIVDRK  318



>ref|XP_006490204.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X2 [Citrus sinensis]
Length=652

 Score =   212 bits (539),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/375 (39%), Positives = 220/375 (59%), Gaps = 5/375 (1%)
 Frame = +2

Query  113   DCPIINTANFSFWKRSIYYCISKN-SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLC  289
             D P + T      + +++    KN ++S QN       + ++  K   ++QA  L++ L 
Sbjct  233   DRPQLATKRDRNEETALHVLARKNLTSSNQNPCGAFQRYFNLGAKNRKNKQALKLVESLW  292

Query  290   DELKTLN--DYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAI  463
             +++  L   D +++    +  +  A +    + +  ++  YP + +  D N   I HIA+
Sbjct  293   EQVILLREPDISKLIKEPTRIIFDAANHGNVQFLSILIREYPDLMWKCDENRYTIFHIAV  352

Query  464   ENRCENIFNLIRGTSV--LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRE  637
              NR   +F  I    +  +   L D+ +G GN+I++LA KLAP  +LN+VSG+ALQMQRE
Sbjct  353   SNRQVELFKFIDADDMKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRE  412

Query  638   LQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaaliv  817
             L WF+ V+K+     +   ++ G TP   F+E HR LK +GEKWMKDTA+SC I A LI 
Sbjct  413   LLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIA  472

Query  818   tvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAE  997
             TVVFAAA+TVPGGN +  GLP F  + +F +FA+SN  SL  +  S++VFLS++T RYAE
Sbjct  473   TVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAE  532

Query  998   QDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFV  1177
             +DFL  LP +L +GL TLF +I  MM  FS+T ++VF    +WI I+V  + S+P   F 
Sbjct  533   KDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFF  592

Query  1178  LLQFPLLVALVSSTY  1222
              L F L   ++ S +
Sbjct  593   YLHFRLFDDILRSVF  607



>ref|XP_006490205.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X3 [Citrus sinensis]
Length=648

 Score =   212 bits (539),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 145/375 (39%), Positives = 220/375 (59%), Gaps = 5/375 (1%)
 Frame = +2

Query  113   DCPIINTANFSFWKRSIYYCISKN-SASTQNFVSQLLLWKSIPKKILMHQQATDLLKCLC  289
             D P + T      + +++    KN ++S QN       + ++  K   ++QA  L++ L 
Sbjct  229   DRPQLATKRDRNEETALHVLARKNLTSSNQNPCGAFQRYFNLGAKNRKNKQALKLVESLW  288

Query  290   DELKTLN--DYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAI  463
             +++  L   D +++    +  +  A +    + +  ++  YP + +  D N   I HIA+
Sbjct  289   EQVILLREPDISKLIKEPTRIIFDAANHGNVQFLSILIREYPDLMWKCDENRYTIFHIAV  348

Query  464   ENRCENIFNLIRGTSV--LVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRE  637
              NR   +F  I    +  +   L D+ +G GN+I++LA KLAP  +LN+VSG+ALQMQRE
Sbjct  349   SNRQVELFKFIDADDMKAIADLLVDSTDGEGNNILHLAGKLAPPDRLNVVSGSALQMQRE  408

Query  638   LQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaaliv  817
             L WF+ V+K+     +   ++ G TP   F+E HR LK +GEKWMKDTA+SC I A LI 
Sbjct  409   LLWFQAVKKVVPRKLAEAKNKKGLTPRALFSEQHRDLKEKGEKWMKDTASSCMIVATLIA  468

Query  818   tvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAE  997
             TVVFAAA+TVPGGN +  GLP F  + +F +FA+SN  SL  +  S++VFLS++T RYAE
Sbjct  469   TVVFAAALTVPGGNKEDTGLPFFLHNVSFKIFAVSNVISLVASTLSIVVFLSLVTPRYAE  528

Query  998   QDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFV  1177
             +DFL  LP +L +GL TLF +I  MM  FS+T ++VF    +WI I+V  + S+P   F 
Sbjct  529   KDFLSLLPRKLYVGLGTLFIAIAAMMVVFSATSFIVFTDGSTWIAILVIVVPSVPAILFF  588

Query  1178  LLQFPLLVALVSSTY  1222
              L F L   ++ S +
Sbjct  589   YLHFRLFDDILRSVF  603



>ref|XP_004296497.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Fragaria 
vesca subsp. vesca]
Length=701

 Score =   213 bits (541),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 153/360 (43%), Positives = 219/360 (61%), Gaps = 20/360 (6%)
 Frame = +2

Query  191   STQNFVSQLLLWK----SIP------KKILMHQQATDLLKCLCDELKTLND---YNQVFS  331
             ST   VSQ  LWK    S+P       K L H QAT+L+  L  ++ TL+     N + +
Sbjct  332   STCYSVSQRGLWKRFILSVPYIQDSYHKYLNHMQATELVTLLWKKVLTLDSDSRINDLIN  391

Query  332   LASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLI---RG  502
             + S  L  A  L   + ++  +  YP++ +  D  + +I H A+ +R E +FNLI    G
Sbjct  392   VPSRILFTAAELGNIDFLIICMRLYPSLIWQIDEQNRSIFHAAVIHRQEKVFNLIYDLGG  451

Query  503   TSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYF  682
                L+   +D  N   N++++LAA+ A   +L+  +GAALQ++REL WFKEV+KI  P +
Sbjct  452   LKDLIAAYKDVTN---NNMLHLAAR-ASASRLSTDTGAALQLRRELIWFKEVEKIVQPLY  507

Query  683   SSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNS  862
                 +  G+ P++ FT+ H+ L  EGE WMK TA+SC + A LI TV+FA   TVPGGN+
Sbjct  508   KEMRNSDGEIPQLLFTKEHKELLREGEVWMKGTASSCMVVATLIATVMFAVISTVPGGNN  567

Query  863   DANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGL  1042
             +  G+PIF    AFTVF IS+A SL T+ TS+L FLS+LTSRY E DFL +LPNRLI+GL
Sbjct  568   NNTGIPIFLKSRAFTVFVISDAISLITSTTSILSFLSILTSRYHEGDFLNSLPNRLIVGL  627

Query  1043  ITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTY  1222
              TLF SI  MM  F +T+ +V G     I++ +  +A++P+  + LLQFPLL  ++S  Y
Sbjct  628   ATLFISIATMMITFVATLLMVLGPGFHEIKVPITLVAAVPVGFYALLQFPLLADMISHAY  687



>ref|XP_006494240.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Citrus 
sinensis]
Length=341

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 145/325 (45%), Positives = 205/325 (63%), Gaps = 9/325 (3%)
 Frame = +2

Query  260   QATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHND  439
             Q  ++++ +C E+       ++      AL  A  L I E V   + AY   A   + + 
Sbjct  2     QTVEIVRIICKEVIWTCHRREL----KGALFTAARLGIHEFVNEFIMAYNKTANVLNEDR  57

Query  440   LNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAA  619
              +I  +A+ +R E +FNLI   +    NL  T   +GN+I++LAAKL P  +   V+GAA
Sbjct  58    RSIFDVAVLHRREKVFNLIHRVN-FTTNLFLTEGNSGNNILHLAAKLVPSSE---VAGAA  113

Query  620   LQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCti  799
             LQMQRELQWFK V+K+  P      +   +T    FTE H+ L  EGEKWMK+TA+SC++
Sbjct  114   LQMQRELQWFKAVEKLIHPDMLGDENSSNQTAREVFTEEHKELVKEGEKWMKETASSCSV  173

Query  800   aaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvl  979
              AALI+TVVFAAA TVPGG SD+ G+P      +F +FAIS+  +LF++ +S+L+FL +L
Sbjct  174   VAALIITVVFAAAFTVPGG-SDSRGIPNILHEPSFMIFAISDILALFSSISSVLMFLGIL  232

Query  980   tsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASL  1159
             TSRYAE DFL +LP +LIIGL+TLFFSI  MM AF +T+++      + + I +  +  +
Sbjct  233   TSRYAEDDFLLSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKWNLVIIPIALVGCV  292

Query  1160  PITSFVLLQFPLLVALVSSTYGPGI  1234
             P+T FVLLQFPLL+ + SSTYG  I
Sbjct  293   PVTLFVLLQFPLLLDMYSSTYGRSI  317



>ref|XP_006487636.1| PREDICTED: uncharacterized protein LOC102628868 isoform X2 [Citrus 
sinensis]
Length=770

 Score =   213 bits (543),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 217/341 (64%), Gaps = 11/341 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I  + L H +  ++++ +C  +   N  N+   L   A+  A  L I E V   + AY
Sbjct  414   KVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLG--AMFTAARLGIPEFVNEFIMAY  471

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGT--SVLVHNLQDTINGNGNDIMNLAAKL  580
                A+    ++  I  +A+ +R E +FNLI G   +  + + +D +   GN+I++LA +L
Sbjct  472   DNSAHLFAQDEQRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFL---GNNILHLAGRL  528

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
              P  +   V+GAALQMQRELQWFK V+ +  P      ++  +TP   FT+ H+ L  EG
Sbjct  529   VPSSE---VAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEG  585

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK+TA+SC++ AALI+TVVFAAA TVPGG SD+ G+P +    +F +FAIS+  +LF
Sbjct  586   EKWMKETASSCSVVAALIITVVFAAAFTVPGG-SDSRGIPNYLHEPSFMIFAISDMLALF  644

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++ TS+L+FL +LTSRYAE+DFL +LP +LIIGL+TLFFSI  MM AF +T+++      
Sbjct  645   SSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKW  704

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             + + I +  +  +P+T F LLQFPLL+ + SSTYG GIF Q
Sbjct  705   NLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQ  745



>gb|KDO48316.1| hypothetical protein CISIN_1g004089mg [Citrus sinensis]
Length=770

 Score =   213 bits (543),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 217/341 (64%), Gaps = 11/341 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I  + L H +  ++++ +C  +   N  N+   L   A+  A  L I E V   + AY
Sbjct  414   KVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLG--AMFTAARLGIPEFVNEFIMAY  471

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGT--SVLVHNLQDTINGNGNDIMNLAAKL  580
                A+    ++  I  +A+ +R E +FNLI G   +  + + +D +   GN+I++LA +L
Sbjct  472   DNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFL---GNNILHLAGRL  528

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
              P  +   V+GAALQMQRELQWFK V+ +  P      ++  +TP   FT+ H+ L  EG
Sbjct  529   VPSSE---VAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEG  585

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK+TA+SC++ AALI+TVVFAAA TVPGG SD+ G+P +    +F +FAIS+  +LF
Sbjct  586   EKWMKETASSCSVVAALIITVVFAAAFTVPGG-SDSRGIPNYLHEPSFMIFAISDMLALF  644

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++ TS+L+FL +LTSRYAE+DFL +LP +LIIGL+TLFFSI  MM AF +T+++      
Sbjct  645   SSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKW  704

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             + + I +  +  +P+T F LLQFPLL+ + SSTYG GIF Q
Sbjct  705   NLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQ  745



>ref|XP_010665688.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=677

 Score =   212 bits (540),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 142/346 (41%), Positives = 207/346 (60%), Gaps = 11/346 (3%)
 Frame = +2

Query  212   QLLLWKSI--------PKKILMHQQATDLLKCLCDELKTLN--DYNQVFSLASDALLRAV  361
             QL +WKS          +K L  Q A  L  CL +E+  L   D + +       L  A 
Sbjct  250   QLSIWKSFSMKCGSINEEKRLEPQLAIQLTHCLWNEVIKLKEEDISNLIGYPWRLLFVAA  309

Query  362   HLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTIN  541
              L   E + +++ +YP + +  D N   I HIAI +R E IF LI     +   +    +
Sbjct  310   KLGKVEFLTTLIRSYPDLIWKVDENRRTIFHIAIMHRHEEIFQLIYEIGAIKDLVATFKD  369

Query  542   GNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEM  721
              +GN++++LA+KLAP H+LN +SGAALQMQRE+ WFK V+K+  P ++   +E  KTP  
Sbjct  370   DHGNNMLHLASKLAPPHRLNSISGAALQMQREILWFKAVRKVVRPEYAEAENENQKTPHA  429

Query  722   HFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNA  901
              F+E H  L+++GE+WMK TA SC +   LI TVVF++A  +PGG +D  G  +     +
Sbjct  430   LFSEEHEGLRVKGEEWMKKTAESCALVGTLIATVVFSSAFQLPGGVND-KGSTVLLREPS  488

Query  902   FTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTA  1081
             F VFA SNA SLFT+  S+L+FLS+LTSRYAE DF+ +LP +L++GL  LF SI  M+ A
Sbjct  489   FVVFATSNAVSLFTSTASVLMFLSILTSRYAESDFVISLPTKLVLGLTLLFVSIATMIIA  548

Query  1082  FSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSST  1219
             F++T ++ F +   W  + +  +A +P+  FVL Q+PLLV +  ST
Sbjct  549   FTATFFITFREGIIWAPVPIALIAFVPVALFVLQQYPLLVDIYRST  594



>ref|XP_006487635.1| PREDICTED: uncharacterized protein LOC102628868 isoform X1 [Citrus 
sinensis]
Length=774

 Score =   213 bits (542),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 217/341 (64%), Gaps = 11/341 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I  + L H +  ++++ +C  +   N  N+   L   A+  A  L I E V   + AY
Sbjct  418   KVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLG--AMFTAARLGIPEFVNEFIMAY  475

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGT--SVLVHNLQDTINGNGNDIMNLAAKL  580
                A+    ++  I  +A+ +R E +FNLI G   +  + + +D +   GN+I++LA +L
Sbjct  476   DNSAHLFAQDEQRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFL---GNNILHLAGRL  532

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
              P  +   V+GAALQMQRELQWFK V+ +  P      ++  +TP   FT+ H+ L  EG
Sbjct  533   VPSSE---VAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEG  589

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK+TA+SC++ AALI+TVVFAAA TVPGG SD+ G+P +    +F +FAIS+  +LF
Sbjct  590   EKWMKETASSCSVVAALIITVVFAAAFTVPGG-SDSRGIPNYLHEPSFMIFAISDMLALF  648

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++ TS+L+FL +LTSRYAE+DFL +LP +LIIGL+TLFFSI  MM AF +T+++      
Sbjct  649   SSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKW  708

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             + + I +  +  +P+T F LLQFPLL+ + SSTYG GIF Q
Sbjct  709   NLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQ  749



>ref|XP_008229295.1| PREDICTED: ankyrin repeat-containing protein At5g02620 isoform 
X1 [Prunus mume]
Length=316

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 133/302 (44%), Positives = 189/302 (63%), Gaps = 0/302 (0%)
 Frame = +2

Query  338   SDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLV  517
             S+ L  A  L   E +  ++ AYP + + +D  +  I H+A+  R  +IFNL+  T  + 
Sbjct  8     SEVLFDATRLGNYEFLSVLINAYPDLLWETDDENRTIFHVAVLYRHASIFNLVHETGSIK  67

Query  518   HNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMD  697
               +    +   N+I++LAAKLAPQ++LNLVSGAALQMQREL WF+EV+KI  P      +
Sbjct  68    DIIVTYTDDENNNILHLAAKLAPQNQLNLVSGAALQMQRELVWFEEVKKIVQPLSIDMKN  127

Query  698   EYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGL  877
             + GKTP+  FT  H  L  +GE WMK+TA SC + A +I TVVF+AA T+PGG +D  G 
Sbjct  128   KDGKTPQELFTSEHEGLLCKGESWMKNTANSCMLVATIITTVVFSAAFTIPGGIADNTGA  187

Query  878   PIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFF  1057
             P F    AF +F IS+  +LF+++TS+L+FL +LTSRYAE DFL +LP +L++GL +LF 
Sbjct  188   PKFLKDTAFLIFVISDGVALFSSSTSMLMFLYILTSRYAENDFLKSLPLKLMVGLASLFI  247

Query  1058  SIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIF  1237
             S+  MM AFS+  YL       ++   +   A +P+  FV LQ+PLL  +  STY   + 
Sbjct  248   SMTSMMIAFSTAFYLSCHDGLGFVSDFIFIFAFVPVVLFVFLQYPLLCDMFLSTYYSSLI  307

Query  1238  SQ  1243
              Q
Sbjct  308   FQ  309



>gb|KDO48317.1| hypothetical protein CISIN_1g004089mg [Citrus sinensis]
Length=774

 Score =   213 bits (542),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 217/341 (64%), Gaps = 11/341 (3%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K I  + L H +  ++++ +C  +   N  N+   L   A+  A  L I E V   + AY
Sbjct  418   KVIHDQKLTHMRTVEIVRIICQGVIWTNPENRDRLLG--AMFTAARLGIPEFVNEFIMAY  475

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLIRGT--SVLVHNLQDTINGNGNDIMNLAAKL  580
                A+    ++  I  +A+ +R E +FNLI G   +  + + +D +   GN+I++LA +L
Sbjct  476   DNSAHLFAQDEHRIFDLAVLHRREKVFNLIHGVNFTTFLFSFRDFL---GNNILHLAGRL  532

Query  581   APQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEG  760
              P  +   V+GAALQMQRELQWFK V+ +  P      ++  +TP   FT+ H+ L  EG
Sbjct  533   VPSSE---VAGAALQMQRELQWFKMVENLVHPSDREAENKLRQTPREVFTQEHKELVKEG  589

Query  761   EKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaaslf  940
             EKWMK+TA+SC++ AALI+TVVFAAA TVPGG SD+ G+P +    +F +FAIS+  +LF
Sbjct  590   EKWMKETASSCSVVAALIITVVFAAAFTVPGG-SDSRGIPNYLHEPSFMIFAISDMLALF  648

Query  941   taatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNK  1120
             ++ TS+L+FL +LTSRYAE+DFL +LP +LIIGL+TLFFSI  MM AF +T+++      
Sbjct  649   SSITSVLMFLGILTSRYAEEDFLVSLPRKLIIGLVTLFFSIASMMVAFGATVHISLSHKW  708

Query  1121  SWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
             + + I +  +  +P+T F LLQFPLL+ + SSTYG GIF Q
Sbjct  709   NLVFIPIALVGFVPVTLFALLQFPLLLDMYSSTYGRGIFIQ  749



>ref|XP_009346492.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like isoform 
X1 [Pyrus x bretschneideri]
Length=622

 Score =   211 bits (536),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 146/351 (42%), Positives = 209/351 (60%), Gaps = 4/351 (1%)
 Frame = +2

Query  200   NFVSQLLLWKSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSL---ASDALLRAVHLD  370
             N    LL  K   K+ L   +A  L++ L  E+   +D ++V  L    S  +  AV L 
Sbjct  261   NTCKVLLDMKVSSKRNLKQAEALKLVEYLWKEMLKHDD-DKVMRLIREPSKLVFDAVKLG  319

Query  371   IAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCENIFNLIRGTSVLVHNLQDTINGNG  550
               E +  ++++YP + +  D N+  I HIA+ +R  +IFNL+  T  +   +   I+   
Sbjct  320   NYEFLSVLIDSYPELLWEYDDNNRTIFHIAVLHRHASIFNLVHETGSIKDIIATYIDNEN  379

Query  551   NDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFT  730
             N+I++ AAKLAPQ +LNLVSGAALQMQREL WF+EV+KI  P F    +   KTP   FT
Sbjct  380   NNILHQAAKLAPQDQLNLVSGAALQMQRELVWFEEVEKIVQPPFMDMKNNQDKTPRELFT  439

Query  731   ENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTV  910
               H+ L  +GE WMKDTA  C + + +I TVVF+AA ++PGG SD  G P F    AF +
Sbjct  440   SEHKDLLCKGESWMKDTANYCMLVSTIIATVVFSAAFSIPGGISDNKGTPNFVKETAFLI  499

Query  911   FAISNaaslftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSS  1090
             F IS+  +LF+++T++L+FL +LTSRYAE DFL +LP +L+IGL +LF SI  MM AFS+
Sbjct  500   FTISDGIALFSSSTAILMFLYILTSRYAENDFLKSLPLKLMIGLTSLFVSITSMMVAFST  559

Query  1091  TIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQ  1243
               YL       W+  ++   + +P+  F  LQ+PLL  +  STY   +  Q
Sbjct  560   AFYLSCHHELRWVPDLLFIFSFVPVALFAFLQYPLLSDMFFSTYCSSLLFQ  610



>ref|XP_008244945.1| PREDICTED: cytochrome P450 71B34-like [Prunus mume]
Length=504

 Score =   208 bits (529),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 148/345 (43%), Positives = 218/345 (63%), Gaps = 18/345 (5%)
 Frame = +2

Query  227   KSIPKKILMHQQATDLLKCLCDELKTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAY  406
             K + +  L H QA +LL  +C+ +K   D N+   L + A+ RA  L + E ++ +++A 
Sbjct  168   KRLREMKLAHIQALELLDNMCEVIKH-EDINE---LLTAAVFRATKLGMFEFIVRVLQAK  223

Query  407   PTMAYCSDHNDLNILHIAIENRCENIFNLI-----RGTSVLVHNLQDTINGNGNDIMNLA  571
             P + + S     N+   AIE R E +++LI     +    ++ +L D+ N   N  +++A
Sbjct  224   PNLVWTSMRR--NLFQFAIECRQEKVYSLIYYKLDKKQRAVIGSLADSDN---NCALHVA  278

Query  572   AKLAPQHKLNLVSGAALQMQRELQWFKEVQKIALPYFSSCMDEYGKTPEMHFTENHRLLK  751
               L+P  +L+ +SGAAL+MQRELQWFKEV+ I        ++   K   + F+ENH  L 
Sbjct  279   GMLSPLARLDNISGAALKMQRELQWFKEVENIVRLRLKESLN---KEYTIMFSENHNQLV  335

Query  752   IEGEKWMKDTATSCtiaaalivtvvfaaaitvPGGNSDANGLPIFSSHNAFTVFAISNaa  931
              EGE+WMK+TA SCT+  ALI+T++FAAA  +PGGN+   G PIF     F  F +S+A 
Sbjct  336   KEGERWMKETAFSCTVVGALIITIMFAAAFIIPGGNNGEIGFPIFLHKKLFMAFIVSDAI  395

Query  932   slftaatsllvflsvltsRYAEQDFLYALPNRLIIGLITLFFSIILMMTAFSSTIYLVFG  1111
             SLF++ TS+L+FL +LTSRYA  DFL +LP ++IIGL TLF SI  MM AFSS ++++  
Sbjct  396   SLFSSTTSVLMFLGILTSRYAVDDFLTSLPTKMIIGLSTLFISIATMMVAFSSALFIMI-  454

Query  1112  QNKSWIRIIVPALASLPITSFVLLQFPLLVALVSSTYGPGIFSQR  1246
               +SWI I +  LAS+P+TSF+ +QFPLLV +  STYG GIF ++
Sbjct  455   HEQSWIVIPMIFLASVPVTSFIWMQFPLLVEMHVSTYGRGIFDRK  499



>gb|KCW75495.1| hypothetical protein EUGRSUZ_E04253 [Eucalyptus grandis]
Length=326

 Score =   203 bits (516),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 133/305 (44%), Positives = 189/305 (62%), Gaps = 0/305 (0%)
 Frame = +2

Query  299   KTLNDYNQVFSLASDALLRAVHLDIAEVVLSIVEAYPTMAYCSDHNDLNILHIAIENRCE  478
             K L    +  S  SD  L A+       +  ++  +P + +  D   L+I H A+ +R E
Sbjct  5     KLLELMRKKVSARSDEELPALEFGNYGFLTVLIRFHPELLWKVDDQKLSIFHAAVAHRHE  64

Query  479   NIFNLIRGTSVLVHNLQDTINGNGNDIMNLAAKLAPQHKLNLVSGAALQMQRELQWFKEV  658
              IF LI         +    + N N+I++LA KLAP+ +L + SGAALQMQ EL WFKEV
Sbjct  65    KIFRLIYDIGARKDMIAAYKDENDNNILHLAGKLAPRIQLKIDSGAALQMQEELLWFKEV  124

Query  659   QKIALPYFSSCMDEYGKTPEMHFTENHRLLKIEGEKWMKDTATSCtiaaalivtvvfaaa  838
             + I  P +    +  GKTP + FTE H+ L+ E EKWMK TA+SC + A LI T+ F+A 
Sbjct  125   EVIVQPSYREMKNSEGKTPYLLFTEEHKELRQEAEKWMKHTASSCMVVATLICTMAFSAT  184

Query  839   itvPGGNSDANGLPIFSSHNAFTVFAISNaaslftaatsllvflsvltsRYAEQDFLYAL  1018
              T+PGGN +  G PIF  +  F +F +S A ++F++ATS+L+FLS+LTSRYAE+DFLY+L
Sbjct  185   FTIPGGNDNNTGKPIFLHNRLFMIFTVSTALAVFSSATSVLMFLSILTSRYAEEDFLYSL  244

Query  1019  PNRLIIGLITLFFSIILMMTAFSSTIYLVFGQNKSWIRIIVPALASLPITSFVLLQFPLL  1198
             P+RL++G+ +LF SI  MM AF +T ++  G + + I I + A AS  +T F LLQFPLL
Sbjct  245   PSRLVLGIGSLFVSIASMMVAFGATHFIFLGHDYARIAIPIAAFASGTVTLFALLQFPLL  304

Query  1199  VALVS  1213
               L+ 
Sbjct  305   SDLIG  309



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4051968341967