BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25901_g1_i4 len=183 path=[3087:0-91 3179:92-128 3216:129-134
2956:135-145 8703:146-168 13163:169-182]

Length=183
                                                                      Score     E

ref|XP_004170040.1|  PREDICTED: uncharacterized protein LOC101229869  43.9    5e-04   
ref|XP_004136848.1|  PREDICTED: uncharacterized protein LOC101212852  43.9    5e-04   



>ref|XP_004170040.1| PREDICTED: uncharacterized protein LOC101229869 [Cucumis sativus]
Length=107

 Score = 43.9 bits (102),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  90   QNLLVTMLSYAENLRVTICSEKDFIDGKKL  179
            Q+L++TM+SY ENLR+   SEK+FID +KL
Sbjct  57   QSLIITMVSYMENLRIAFGSEKEFIDQEKL  86



>ref|XP_004136848.1| PREDICTED: uncharacterized protein LOC101212852 [Cucumis sativus]
Length=107

 Score = 43.9 bits (102),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  90   QNLLVTMLSYAENLRVTICSEKDFIDGKKL  179
            Q+L++TM+SY ENLR+   SEK+FID +KL
Sbjct  57   QSLIITMVSYMENLRIAFGSEKEFIDQEKL  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506872938168