BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25901_g1_i3 len=1845 path=[7255:0-191 7447:192-223 7478:224-248
12387:249-263 7515:264-391 3934:392-395 7643:396-450 7696:451-479
12495:480-482 12498:483-487 12503:488-496 7741:497-504 7749:505-551
4701:552-592 4742:593-627 12603:628-628 12604:629-633 9956:634-637
7878:638-661 7902:662-698 7937:699-744 12680:745-761 12697:762-785
10236:786-806 8042:807-855 8091:856-880 12839:881-881 12840:882-892
12851:893-913 8147:914-948 12887:949-955 8188:956-964 8197:965-967
12895:968-1015 12940:1016-1026 12951:1027-1030 12955:1031-1031
8259:1032-1054 4631:1055-1066 3340:1067-1117 12979:1118-1118
12980:1119-1122 8348:1123-1154 8380:1155-1157 4040:1158-1228
8452:1229-1241 4196:1242-1255 13051:1256-1259 13055:1260-1270
8492:1271-1326 8548:1327-1336 13099:1337-1353 13139:1354-1367
2359:1368-1486 2478:1487-1509 13163:1510-1523 13177:1524-1535
13189:1536-1556 8772:1557-1844]

Length=1845
                                                                      Score     E

ref|XP_009782424.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    630   0.0      
ref|XP_009624957.1|  PREDICTED: O-acyltransferase WSD1-like             612   0.0      
ref|XP_009759664.1|  PREDICTED: O-acyltransferase WSD1-like             589   0.0      
ref|XP_006367474.1|  PREDICTED: O-acyltransferase WSD1-like             588   0.0      
ref|XP_004243360.1|  PREDICTED: O-acyltransferase WSD1                  584   0.0      
ref|XP_009588555.1|  PREDICTED: O-acyltransferase WSD1-like             545   0.0      
ref|XP_011100361.1|  PREDICTED: O-acyltransferase WSD1-like             543   0.0      
emb|CDP20977.1|  unnamed protein product                                535   0.0      
ref|XP_009784406.1|  PREDICTED: O-acyltransferase WSD1-like             534   0.0      
ref|XP_004251786.1|  PREDICTED: O-acyltransferase WSD1-like             534   0.0      
ref|XP_002517893.1|  conserved hypothetical protein                     532   1e-180   Ricinus communis
ref|XP_009600771.1|  PREDICTED: O-acyltransferase WSD1-like             530   1e-179   
ref|XP_006350139.1|  PREDICTED: O-acyltransferase WSD1-like             528   1e-178   
ref|XP_002323705.2|  hypothetical protein POPTR_0017s04330g             519   3e-175   Populus trichocarpa [western balsam poplar]
ref|XP_006469879.1|  PREDICTED: O-acyltransferase WSD1-like             518   4e-175   
ref|XP_006447283.1|  hypothetical protein CICLE_v10015126mg             518   4e-175   
ref|XP_007043617.1|  O-acyltransferase family protein                   517   7e-175   
ref|XP_011001806.1|  PREDICTED: O-acyltransferase WSD1-like             516   1e-174   
ref|XP_011037140.1|  PREDICTED: O-acyltransferase WSD1-like             515   6e-174   
ref|XP_011001808.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    511   2e-172   
gb|KDP24112.1|  hypothetical protein JCGZ_25769                         509   1e-171   
gb|EYU28206.1|  hypothetical protein MIMGU_mgv1a021941mg                506   8e-171   
ref|XP_009782425.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    504   2e-170   
ref|XP_002274522.1|  PREDICTED: O-acyltransferase WSD1                  506   2e-170   Vitis vinifera
ref|XP_011001810.1|  PREDICTED: O-acyltransferase WSD1-like             505   4e-170   
ref|XP_006468957.1|  PREDICTED: O-acyltransferase WSD1-like             504   9e-170   
gb|EYU28207.1|  hypothetical protein MIMGU_mgv1a006155mg                503   2e-169   
ref|XP_011047658.1|  PREDICTED: O-acyltransferase WSD1-like             503   2e-169   
ref|XP_006446857.1|  hypothetical protein CICLE_v10015143mg             502   4e-169   
ref|XP_002323706.1|  hypothetical protein POPTR_0017s04300g             501   1e-168   Populus trichocarpa [western balsam poplar]
ref|XP_002310400.1|  hypothetical protein POPTR_0007s00950g             501   2e-168   Populus trichocarpa [western balsam poplar]
ref|XP_003552517.1|  PREDICTED: O-acyltransferase WSD1-like             498   1e-167   
ref|XP_007139590.1|  hypothetical protein PHAVU_008G042500g             497   7e-167   
gb|EYU28205.1|  hypothetical protein MIMGU_mgv1a006032mg                496   1e-166   
ref|XP_010272425.1|  PREDICTED: O-acyltransferase WSD1-like             493   1e-165   
ref|XP_007139588.1|  hypothetical protein PHAVU_008G042300g             492   3e-165   
ref|XP_010689024.1|  PREDICTED: O-acyltransferase WSD1-like             490   3e-164   
ref|XP_003534457.1|  PREDICTED: O-acyltransferase WSD1-like             487   5e-163   
ref|XP_008227240.1|  PREDICTED: O-acyltransferase WSD1-like             486   1e-162   
gb|KHN11595.1|  O-acyltransferase WSD1                                  485   2e-162   
ref|XP_003621165.1|  O-acyltransferase WSD1                             483   2e-161   
ref|XP_003551727.1|  PREDICTED: O-acyltransferase WSD1-like             482   4e-161   
emb|CBI21867.3|  unnamed protein product                                483   5e-161   
ref|XP_007214098.1|  hypothetical protein PRUPE_ppa015879mg             481   1e-160   
ref|XP_008229085.1|  PREDICTED: O-acyltransferase WSD1-like             480   2e-160   
ref|XP_011001811.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    480   3e-160   
ref|XP_007212723.1|  hypothetical protein PRUPE_ppa018856mg             479   4e-160   
ref|XP_007198906.1|  hypothetical protein PRUPE_ppa1027135mg            479   6e-160   
ref|XP_008227239.1|  PREDICTED: O-acyltransferase WSD1-like             477   4e-159   
ref|XP_002319796.2|  hypothetical protein POPTR_0013s08300g             475   1e-158   Populus trichocarpa [western balsam poplar]
ref|XP_008228990.1|  PREDICTED: O-acyltransferase WSD1-like             474   5e-158   
ref|XP_007198851.1|  hypothetical protein PRUPE_ppa016739mg             474   5e-158   
ref|XP_007198876.1|  hypothetical protein PRUPE_ppa022031mg             474   6e-158   
ref|XP_010260232.1|  PREDICTED: O-acyltransferase WSD1-like             473   1e-157   
ref|XP_004489154.1|  PREDICTED: O-acyltransferase WSD1-like             472   4e-157   
ref|XP_004516682.1|  PREDICTED: O-acyltransferase WSD1-like             469   3e-156   
ref|XP_004489155.1|  PREDICTED: O-acyltransferase WSD1-like             469   2e-155   
ref|XP_008365935.1|  PREDICTED: O-acyltransferase WSD1-like             468   2e-155   
ref|XP_004292434.1|  PREDICTED: O-acyltransferase WSD1-like             464   4e-154   
ref|XP_011001809.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    461   9e-154   
ref|XP_009334893.1|  PREDICTED: O-acyltransferase WSD1-like             461   5e-153   
ref|XP_009336217.1|  PREDICTED: O-acyltransferase WSD1-like             461   5e-153   
ref|XP_009336220.1|  PREDICTED: O-acyltransferase WSD1-like             460   1e-152   
ref|XP_002323911.2|  hypothetical protein POPTR_0017s04310g             457   3e-152   Populus trichocarpa [western balsam poplar]
ref|XP_009372230.1|  PREDICTED: O-acyltransferase WSD1-like             457   3e-151   
ref|XP_007203447.1|  hypothetical protein PRUPE_ppa022053mg             456   3e-151   
ref|XP_008229024.1|  PREDICTED: O-acyltransferase WSD1-like             456   4e-151   
ref|XP_008241433.1|  PREDICTED: O-acyltransferase WSD1-like             456   5e-151   
emb|CAN62907.1|  hypothetical protein VITISV_043611                     454   1e-150   Vitis vinifera
gb|KHN35245.1|  O-acyltransferase WSD1                                  452   2e-149   
ref|XP_010068985.1|  PREDICTED: O-acyltransferase WSD1-like             452   2e-149   
gb|KHN47659.1|  O-acyltransferase WSD1                                  452   2e-149   
ref|XP_003527429.1|  PREDICTED: O-acyltransferase WSD1-like             452   3e-149   
ref|XP_003541280.1|  PREDICTED: O-acyltransferase WSD1-like             451   4e-149   
ref|XP_008368650.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    450   1e-148   
gb|KHN35242.1|  O-acyltransferase WSD1                                  449   4e-148   
ref|XP_008362473.1|  PREDICTED: O-acyltransferase WSD1-like             454   6e-148   
ref|XP_007199626.1|  hypothetical protein PRUPE_ppa016286mg             448   6e-148   
ref|XP_008791832.1|  PREDICTED: O-acyltransferase WSD1-like             448   7e-148   
gb|KEH17310.1|  O-acyltransferase WSD1-like protein                     447   1e-147   
ref|XP_009396631.1|  PREDICTED: O-acyltransferase WSD1-like             447   6e-147   
ref|XP_007198908.1|  hypothetical protein PRUPE_ppa025020mg             445   7e-147   
ref|XP_009336219.1|  PREDICTED: O-acyltransferase WSD1-like             444   2e-146   
ref|XP_010260233.1|  PREDICTED: O-acyltransferase WSD1-like             444   2e-146   
ref|XP_009335177.1|  PREDICTED: O-acyltransferase WSD1-like             444   6e-146   
ref|XP_008237425.1|  PREDICTED: O-acyltransferase WSD1-like             443   6e-146   
gb|KEH30692.1|  O-acyltransferase WSD1-like protein                     441   3e-145   
ref|XP_010935670.1|  PREDICTED: O-acyltransferase WSD1-like             441   3e-145   
ref|XP_008342897.1|  PREDICTED: O-acyltransferase WSD1-like             439   2e-144   
gb|KHN07508.1|  O-acyltransferase WSD1                                  438   5e-144   
gb|KEH21614.1|  O-acyltransferase WSD1-like protein                     435   1e-143   
ref|NP_001241558.1|  uncharacterized protein LOC100777968               436   2e-143   
ref|XP_003539933.1|  PREDICTED: O-acyltransferase WSD1-like             435   7e-143   
ref|XP_007151640.1|  hypothetical protein PHAVU_004G063900g             432   8e-142   
ref|XP_004136846.1|  PREDICTED: O-acyltransferase WSD1-like             431   2e-141   
ref|XP_003607481.1|  O-acyltransferase WSD1                             431   3e-141   
ref|XP_008455536.1|  PREDICTED: O-acyltransferase WSD1-like             431   3e-141   
ref|XP_010035414.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    431   4e-141   
gb|KEH30693.1|  O-acyltransferase WSD1-like protein                     430   5e-141   
gb|KGN43650.1|  hypothetical protein Csa_7G051300                       430   7e-141   
ref|XP_006603695.1|  PREDICTED: uncharacterized protein LOC100777...    430   9e-141   
ref|XP_010038538.1|  PREDICTED: O-acyltransferase WSD1-like             429   3e-140   
ref|XP_010035413.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    427   2e-139   
gb|KEH30682.1|  O-acyltransferase WSD1-like protein                     424   9e-139   
gb|KEH30680.1|  O-acyltransferase WSD1-like protein                     423   5e-138   
ref|XP_004516681.1|  PREDICTED: O-acyltransferase WSD1-like             422   8e-138   
gb|KCW57195.1|  hypothetical protein EUGRSUZ_H00010                     419   4e-137   
gb|AES89670.2|  O-acyltransferase WSD1-like protein                     418   4e-136   
gb|KEH30678.1|  O-acyltransferase WSD1-like protein                     416   2e-135   
ref|XP_004137034.1|  PREDICTED: O-acyltransferase WSD1-like             416   2e-135   
ref|XP_008805672.1|  PREDICTED: O-acyltransferase WSD1-like             413   7e-135   
gb|KHN36647.1|  O-acyltransferase WSD1                                  414   2e-134   
ref|XP_003607478.1|  O-acyltransferase WSD1                             413   2e-134   
ref|XP_003541905.1|  PREDICTED: O-acyltransferase WSD1-like             412   1e-133   
ref|XP_008241432.1|  PREDICTED: O-acyltransferase WSD1-like             410   1e-133   
ref|XP_007132726.1|  hypothetical protein PHAVU_011G119700g             411   1e-133   
ref|XP_008381074.1|  PREDICTED: O-acyltransferase WSD1-like             410   2e-133   
gb|KEH17312.1|  O-acyltransferase (WSD1-like) family protein            408   3e-133   
gb|KCW57197.1|  hypothetical protein EUGRSUZ_H00012                     406   4e-132   
ref|XP_004516688.1|  PREDICTED: O-acyltransferase WSD1-like             401   2e-129   
ref|XP_006446860.1|  hypothetical protein CICLE_v10015616mg             395   1e-128   
gb|AES89684.2|  O-acyltransferase WSD1-like protein                     398   2e-128   
ref|XP_006446856.1|  hypothetical protein CICLE_v10015143mg             394   4e-128   
gb|KCW46801.1|  hypothetical protein EUGRSUZ_K00605                     396   5e-128   
ref|XP_004516680.1|  PREDICTED: O-acyltransferase WSD1-like             394   5e-127   
ref|XP_004505568.1|  PREDICTED: O-acyltransferase WSD1-like             393   1e-126   
gb|KDO53892.1|  hypothetical protein CISIN_1g036070mg                   391   2e-126   
gb|EYU24923.1|  hypothetical protein MIMGU_mgv1a007879mg                386   6e-125   
ref|XP_008455537.1|  PREDICTED: O-acyltransferase WSD1-like             392   6e-124   
ref|XP_004492761.1|  PREDICTED: O-acyltransferase WSD1-like             386   9e-124   
ref|XP_011001812.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    382   4e-123   
ref|XP_007149837.1|  hypothetical protein PHAVU_005G102500g             384   6e-123   
ref|XP_006582315.1|  PREDICTED: O-acyltransferase WSD1-like             382   6e-123   
ref|XP_010268803.1|  PREDICTED: O-acyltransferase WSD1-like             378   2e-120   
ref|XP_006469878.1|  PREDICTED: O-acyltransferase WSD1-like             374   3e-120   
ref|XP_007149838.1|  hypothetical protein PHAVU_005G102600g             375   2e-119   
gb|KGN43653.1|  hypothetical protein Csa_7G051330                       371   8e-119   
gb|KDO41203.1|  hypothetical protein CISIN_1g017622mg                   369   1e-118   
ref|XP_003623995.1|  O-acyltransferase WSD1                             364   4e-115   
gb|KEH30688.1|  O-acyltransferase WSD1-like protein                     355   7e-113   
gb|KCW46796.1|  hypothetical protein EUGRSUZ_K00600                     350   2e-110   
ref|XP_010690153.1|  PREDICTED: O-acyltransferase WSD1-like             351   5e-110   
ref|XP_006447284.1|  hypothetical protein CICLE_v10015554mg             338   2e-106   
ref|XP_003607474.1|  O-acyltransferase WSD1                             334   3e-105   
gb|KEH30689.1|  O-acyltransferase WSD1-like protein                     334   1e-104   
ref|XP_004173488.1|  PREDICTED: O-acyltransferase WSD1-like             332   3e-104   
gb|KEH23372.1|  O-acyltransferase WSD1-like protein                     313   6e-97    
emb|CDP20976.1|  unnamed protein product                                310   1e-96    
gb|KDP24113.1|  hypothetical protein JCGZ_25770                         308   3e-96    
emb|CDP14803.1|  unnamed protein product                                306   4e-95    
ref|XP_010242035.1|  PREDICTED: O-acyltransferase WSD1-like             309   4e-94    
ref|XP_010672070.1|  PREDICTED: O-acyltransferase WSD1-like             307   3e-93    
ref|XP_008455535.1|  PREDICTED: uncharacterized protein LOC103495687    291   2e-89    
ref|XP_004293155.1|  PREDICTED: O-acyltransferase WSD1-like             287   1e-88    
ref|XP_008244954.1|  PREDICTED: O-acyltransferase WSD1-like             270   6e-82    
gb|KDP24070.1|  hypothetical protein JCGZ_25727                         270   2e-81    
gb|KEH30690.1|  O-acyltransferase WSD1-like protein                     271   2e-81    
gb|ADE77834.1|  unknown                                                 275   1e-80    
gb|ADE76190.1|  unknown                                                 272   8e-80    
gb|KCW57203.1|  hypothetical protein EUGRSUZ_H00018                     266   3e-79    
ref|XP_008345468.1|  PREDICTED: O-acyltransferase WSD1-like             256   1e-76    
gb|EYU28203.1|  hypothetical protein MIMGU_mgv1a013012mg                252   2e-75    
gb|KDP24069.1|  hypothetical protein JCGZ_25726                         251   1e-74    
ref|XP_008368651.1|  PREDICTED: uncharacterized protein LOC103432...    248   2e-72    
ref|XP_004136847.1|  PREDICTED: O-acyltransferase WSD1-like             245   3e-72    
ref|XP_002517895.1|  conserved hypothetical protein                     246   3e-72    Ricinus communis
ref|XP_011012031.1|  PREDICTED: O-acyltransferase WSD1-like             244   7e-72    
gb|KCW57201.1|  hypothetical protein EUGRSUZ_H00016                     243   1e-71    
gb|KDO38197.1|  hypothetical protein CISIN_1g044955mg                   235   8e-69    
gb|KGN43651.1|  hypothetical protein Csa_7G051310                       234   5e-68    
emb|CDP21807.1|  unnamed protein product                                224   8e-65    
gb|KEH30694.1|  DNA repair and recombination RAD26-like protein, ...    238   1e-64    
gb|AES89677.2|  DNA repair and recombination RAD26-like protein, ...    239   3e-64    
ref|XP_006593082.1|  PREDICTED: O-acyltransferase WSD1-like             223   5e-64    
ref|XP_003607480.1|  Chromodomain-helicase-DNA-binding protein          238   1e-63    
gb|KHN35224.1|  O-acyltransferase WSD1                                  223   6e-63    
ref|XP_003607473.1|  O-acyltransferase WSD1                             219   7e-63    
ref|XP_008362450.1|  PREDICTED: O-acyltransferase WSD1-like             217   3e-62    
gb|KDO38023.1|  hypothetical protein CISIN_1g047091mg                   216   6e-62    
gb|KCW57200.1|  hypothetical protein EUGRSUZ_H00015                     216   3e-61    
gb|EPS63572.1|  hypothetical protein M569_11213                         209   2e-59    
ref|XP_007198862.1|  hypothetical protein PRUPE_ppa018325mg             198   3e-55    
ref|XP_003607477.1|  O-acyltransferase WSD1                             202   8e-54    
ref|XP_010911763.1|  PREDICTED: O-acyltransferase WSD1-like             191   6e-53    
ref|XP_008353775.1|  PREDICTED: uncharacterized protein LOC103417361    190   1e-52    
ref|XP_007042465.1|  O-acyltransferase family protein, putative i...    198   2e-52    
ref|XP_010025798.1|  PREDICTED: uncharacterized protein LOC104416056    194   4e-52    
ref|XP_007203282.1|  hypothetical protein PRUPE_ppa025603mg             189   5e-52    
gb|KGN43654.1|  hypothetical protein Csa_7G051340                       191   9e-52    
ref|XP_011088231.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    195   2e-51    
gb|KHG19380.1|  O-acyltransferase WSD1                                  191   4e-50    
gb|EPS67964.1|  hypothetical protein M569_06810                         183   5e-50    
ref|XP_010035244.1|  PREDICTED: O-acyltransferase WSD1-like             190   3e-49    
ref|XP_004309135.1|  PREDICTED: O-acyltransferase WSD1-like             189   6e-49    
ref|XP_010482729.1|  PREDICTED: O-acyltransferase WSD1-like             186   6e-48    
ref|XP_010095758.1|  O-acyltransferase WSD1                             185   1e-47    
ref|XP_006852653.1|  hypothetical protein AMTR_s00021p00243800          184   1e-47    
gb|KGN43652.1|  hypothetical protein Csa_7G051320                       175   2e-47    
ref|XP_008246217.1|  PREDICTED: uncharacterized protein LOC103344399    174   2e-47    
ref|XP_010426423.1|  PREDICTED: O-acyltransferase WSD1-like             185   2e-47    
ref|XP_002877655.1|  condensation domain-containing protein             184   2e-47    
ref|XP_010445768.1|  PREDICTED: O-acyltransferase WSD1-like             184   2e-47    
emb|CDY47071.1|  BnaA03g12270D                                          184   3e-47    
ref|XP_010503567.1|  PREDICTED: O-acyltransferase WSD1-like             184   3e-47    
ref|XP_009766774.1|  PREDICTED: O-acyltransferase WSD1-like             184   3e-47    
ref|XP_009132482.1|  PREDICTED: O-acyltransferase WSD1-like             183   4e-47    
ref|XP_010048502.1|  PREDICTED: O-acyltransferase WSD1-like             182   7e-47    
ref|XP_010442900.1|  PREDICTED: O-acyltransferase WSD1-like             181   2e-46    
gb|KCW57198.1|  hypothetical protein EUGRSUZ_H00013                     173   2e-46    
ref|XP_009396534.1|  PREDICTED: O-acyltransferase WSD1-like             182   2e-46    
ref|XP_004230765.1|  PREDICTED: O-acyltransferase WSD1-like             180   3e-46    
ref|XP_009601405.1|  PREDICTED: O-acyltransferase WSD1-like             181   3e-46    
gb|EMS49019.1|  O-acyltransferase WSD1                                  180   5e-46    
ref|XP_010537088.1|  PREDICTED: O-acyltransferase WSD1 isoform X1       180   5e-46    
gb|KCW78187.1|  hypothetical protein EUGRSUZ_D02376                     180   6e-46    
ref|XP_006282349.1|  hypothetical protein CARUB_v10028646mg             180   7e-46    
ref|XP_011092557.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    179   8e-46    
ref|NP_190488.1|  O-acyltransferase (WSD1-like) family protein          180   8e-46    Arabidopsis thaliana [mouse-ear cress]
emb|CDY54346.1|  BnaC03g14900D                                          179   9e-46    
gb|EYU42683.1|  hypothetical protein MIMGU_mgv1a006065mg                179   9e-46    
ref|XP_004979822.1|  PREDICTED: O-acyltransferase WSD1-like             179   1e-45    
emb|CBH32551.1|  conserved hypothetical protein, expressed              179   1e-45    
ref|XP_006346395.1|  PREDICTED: O-acyltransferase WSD1-like             178   1e-45    
ref|XP_011000126.1|  PREDICTED: O-acyltransferase WSD1-like             178   2e-45    
ref|XP_010515263.1|  PREDICTED: O-acyltransferase WSD1                  179   2e-45    
ref|XP_006293222.1|  hypothetical protein CARUB_v10019546mg             179   2e-45    
gb|KHG08035.1|  O-acyltransferase WSD1 -like protein                    178   2e-45    
ref|XP_004979823.1|  PREDICTED: O-acyltransferase WSD1-like             179   2e-45    
dbj|BAJ84892.1|  predicted protein                                      178   3e-45    
ref|XP_010519416.1|  PREDICTED: O-acyltransferase WSD1-like             177   4e-45    
ref|XP_002517896.1|  hypothetical protein RCOM_1173910                  169   4e-45    Ricinus communis
ref|XP_010054862.1|  PREDICTED: O-acyltransferase WSD1-like             177   5e-45    
ref|XP_011092556.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    176   5e-45    
ref|NP_001276179.1|  O-acyltransferase WSD1-like                        176   6e-45    
ref|XP_008227241.1|  PREDICTED: uncharacterized protein LOC103326781    174   7e-45    
emb|CDX96219.1|  BnaC02g14320D                                          177   7e-45    
ref|NP_200151.2|  bifunctional wax ester synthase/diacylglycerol ...    177   7e-45    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09801.1|  unnamed protein product                                176   8e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004235106.1|  PREDICTED: O-acyltransferase WSD1-like             177   8e-45    
ref|XP_002865972.1|  hypothetical protein ARALYDRAFT_918418             176   8e-45    
ref|XP_006401711.1|  hypothetical protein EUTSA_v10013378mg             176   1e-44    
gb|KDP25010.1|  hypothetical protein JCGZ_23993                         175   1e-44    
ref|XP_009588191.1|  PREDICTED: O-acyltransferase WSD1-like             176   2e-44    
ref|XP_010028434.1|  PREDICTED: O-acyltransferase WSD1-like             175   2e-44    
ref|XP_009127172.1|  PREDICTED: O-acyltransferase WSD1-like             175   3e-44    
ref|XP_010266526.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    175   3e-44    
dbj|BAC42871.1|  unknown protein                                        174   4e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009151884.1|  PREDICTED: O-acyltransferase WSD1-like             175   4e-44    
ref|XP_002523348.1|  conserved hypothetical protein                     174   7e-44    Ricinus communis
ref|XP_011024820.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    174   7e-44    
ref|XP_011088232.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    172   8e-44    
ref|XP_011024817.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    174   1e-43    
ref|XP_006390701.1|  hypothetical protein EUTSA_v10018486mg             172   1e-43    
ref|XP_010537089.1|  PREDICTED: O-acyltransferase WSD1 isoform X2       172   1e-43    
ref|XP_002318416.2|  hypothetical protein POPTR_0012s02150g             173   1e-43    Populus trichocarpa [western balsam poplar]
ref|XP_010030633.1|  PREDICTED: O-acyltransferase WSD1-like             172   2e-43    
gb|KDO38022.1|  hypothetical protein CISIN_1g043679mg                   162   2e-43    
ref|XP_009760691.1|  PREDICTED: O-acyltransferase WSD1-like             172   3e-43    
ref|XP_010266525.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    172   3e-43    
ref|XP_008233155.1|  PREDICTED: O-acyltransferase WSD1-like             172   4e-43    
ref|XP_009395725.1|  PREDICTED: O-acyltransferase WSD1-like             172   4e-43    
ref|XP_002440221.1|  hypothetical protein SORBIDRAFT_09g027970          172   5e-43    Sorghum bicolor [broomcorn]
dbj|BAJ93204.1|  predicted protein                                      171   6e-43    
ref|XP_007199357.1|  hypothetical protein PRUPE_ppa025347mg             171   7e-43    
ref|XP_007219258.1|  hypothetical protein PRUPE_ppa018127mg             171   7e-43    
ref|XP_003569566.1|  PREDICTED: O-acyltransferase WSD1-like             171   8e-43    
ref|XP_006339804.1|  PREDICTED: O-acyltransferase WSD1-like             170   1e-42    
ref|XP_007051549.1|  O-acyltransferase family protein, putative         171   1e-42    
gb|EAY75973.1|  hypothetical protein OsI_03895                          171   1e-42    Oryza sativa Indica Group [Indian rice]
ref|XP_003607487.1|  O-acyltransferase WSD1                             161   2e-42    
emb|CDX68518.1|  BnaC01g25960D                                          170   2e-42    
ref|XP_006404166.1|  hypothetical protein EUTSA_v10011067mg             170   2e-42    
ref|XP_009131282.1|  PREDICTED: O-acyltransferase WSD1-like             169   2e-42    
ref|XP_006487043.1|  PREDICTED: O-acyltransferase WSD1-like             169   2e-42    
ref|NP_001044374.1|  Os01g0770000                                       170   2e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002992800.1|  hypothetical protein SELMODRAFT_269987             169   2e-42    
dbj|BAJ97841.1|  predicted protein                                      170   2e-42    
emb|CDM84376.1|  unnamed protein product                                168   3e-42    
ref|XP_009149757.1|  PREDICTED: O-acyltransferase WSD1-like             170   3e-42    
ref|XP_010671458.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    169   3e-42    
emb|CDY08116.1|  BnaA06g16100D                                          170   3e-42    
gb|EAY75974.1|  hypothetical protein OsI_03896                          169   3e-42    
ref|XP_010662973.1|  PREDICTED: O-acyltransferase WSD1                  169   4e-42    
ref|XP_010030645.1|  PREDICTED: O-acyltransferase WSD1-like             168   4e-42    
emb|CDX78486.1|  BnaA03g03980D                                          168   4e-42    
ref|XP_010520978.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    168   6e-42    
ref|XP_004290593.1|  PREDICTED: O-acyltransferase WSD1-like             167   7e-42    
ref|XP_010445765.1|  PREDICTED: O-acyltransferase WSD1-like             166   8e-42    
emb|CBI23136.3|  unnamed protein product                                167   9e-42    
ref|XP_008236478.1|  PREDICTED: O-acyltransferase WSD1-like             167   1e-41    
ref|XP_006441074.1|  hypothetical protein CICLE_v10019854mg             167   1e-41    
ref|XP_007201626.1|  hypothetical protein PRUPE_ppa021430mg             166   2e-41    
ref|XP_006339705.1|  PREDICTED: O-acyltransferase WSD1-like             167   2e-41    
ref|XP_010672319.1|  PREDICTED: O-acyltransferase WSD1-like             161   2e-41    
ref|XP_010107910.1|  O-acyltransferase WSD1                             166   3e-41    
ref|XP_010040257.1|  PREDICTED: O-acyltransferase WSD1-like             164   3e-41    
gb|EAY98969.1|  hypothetical protein OsI_20927                          166   5e-41    
ref|XP_008236495.1|  PREDICTED: O-acyltransferase WSD1-like             166   5e-41    
ref|XP_002263409.1|  PREDICTED: O-acyltransferase WSD1                  166   6e-41    
ref|XP_004961273.1|  PREDICTED: O-acyltransferase WSD1-like             166   7e-41    
ref|XP_010503570.1|  PREDICTED: O-acyltransferase WSD1-like             165   8e-41    
ref|XP_004970103.1|  PREDICTED: O-acyltransferase WSD1-like             165   8e-41    
ref|XP_006390705.1|  hypothetical protein EUTSA_v10018487mg             164   9e-41    
ref|XP_009392540.1|  PREDICTED: O-acyltransferase WSD1-like             164   1e-40    
gb|KHG19161.1|  O-acyltransferase WSD1 -like protein                    164   1e-40    
ref|XP_006587545.1|  PREDICTED: O-acyltransferase WSD1                  164   1e-40    
ref|XP_004984321.1|  PREDICTED: O-acyltransferase WSD1-like             164   2e-40    
ref|XP_009151870.1|  PREDICTED: O-acyltransferase WSD1                  164   2e-40    
ref|XP_011075993.1|  PREDICTED: O-acyltransferase WSD1-like             164   2e-40    
dbj|BAJ33896.1|  unnamed protein product                                163   2e-40    
ref|XP_009415744.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    165   2e-40    
ref|XP_006390703.1|  hypothetical protein EUTSA_v10018482mg             163   2e-40    
ref|XP_010426433.1|  PREDICTED: O-acyltransferase WSD1-like             164   2e-40    
ref|XP_010426427.1|  PREDICTED: O-acyltransferase WSD1-like             164   2e-40    
ref|XP_004136970.1|  PREDICTED: O-acyltransferase WSD1-like             163   3e-40    
gb|AGT16887.1|  hypothetical protein SHCRBa_165_I15_F_280               164   3e-40    
gb|KHG26801.1|  O-acyltransferase WSD1 -like protein                    164   3e-40    
ref|XP_010671460.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    162   3e-40    
ref|XP_010520977.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    163   4e-40    
ref|XP_010507342.1|  PREDICTED: O-acyltransferase WSD1-like             163   5e-40    
gb|KHN38854.1|  O-acyltransferase WSD1                                  162   5e-40    
ref|XP_009630816.1|  PREDICTED: O-acyltransferase WSD1-like             163   5e-40    
ref|XP_007219046.1|  hypothetical protein PRUPE_ppa004668mg             162   5e-40    
gb|EMT14089.1|  hypothetical protein F775_13804                         162   6e-40    
ref|XP_010428073.1|  PREDICTED: O-acyltransferase WSD1-like             162   7e-40    
ref|XP_004511283.1|  PREDICTED: O-acyltransferase WSD1-like             161   7e-40    
emb|CDY05910.1|  BnaC08g20870D                                          162   1e-39    
ref|XP_007157237.1|  hypothetical protein PHAVU_002G054200g             161   1e-39    
ref|XP_006302204.1|  hypothetical protein CARUB_v10020216mg             161   1e-39    
emb|CDM83947.1|  unnamed protein product                                161   1e-39    
emb|CBI40547.3|  unnamed protein product                                166   1e-39    
gb|KDP28488.1|  hypothetical protein JCGZ_14259                         161   2e-39    
ref|XP_006302205.1|  hypothetical protein CARUB_v10020217mg             160   2e-39    
emb|CAN72806.1|  hypothetical protein VITISV_035309                     160   2e-39    
ref|XP_010028428.1|  PREDICTED: O-acyltransferase WSD1-like             160   2e-39    
emb|CDY14418.1|  BnaC03g21770D                                          160   2e-39    
ref|XP_010550528.1|  PREDICTED: O-acyltransferase WSD1-like             160   3e-39    
ref|XP_011024821.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    160   3e-39    
ref|XP_009625686.1|  PREDICTED: O-acyltransferase WSD1-like             160   3e-39    
gb|KFK34209.1|  hypothetical protein AALP_AA5G115000                    160   3e-39    
gb|KDP25009.1|  hypothetical protein JCGZ_23992                         159   4e-39    
ref|XP_010232394.1|  PREDICTED: O-acyltransferase WSD1-like             159   4e-39    
ref|XP_009127897.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    159   5e-39    
ref|XP_010661940.1|  PREDICTED: O-acyltransferase WSD1-like             160   5e-39    
gb|KHG19381.1|  O-acyltransferase WSD1                                  158   5e-39    
ref|XP_010041135.1|  PREDICTED: O-acyltransferase WSD1-like             159   5e-39    
ref|NP_001043877.1|  Os01g0681000                                       160   5e-39    
ref|XP_010428065.1|  PREDICTED: O-acyltransferase WSD1-like             159   6e-39    
gb|KDP24675.1|  hypothetical protein JCGZ_26453                         159   6e-39    
ref|NP_190489.1|  O-acyltransferase (WSD1-like) family protein          159   6e-39    
emb|CBI40540.3|  unnamed protein product                                160   7e-39    
ref|XP_010428063.1|  PREDICTED: O-acyltransferase WSD1-like             159   7e-39    
gb|ABF59162.1|  hypothetical protein At3g49200                          159   7e-39    
gb|KFK41644.1|  hypothetical protein AALP_AA2G154500                    158   7e-39    
ref|XP_008234742.1|  PREDICTED: O-acyltransferase WSD1-like             159   8e-39    
ref|XP_008376729.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    159   8e-39    
ref|NP_197641.1|  O-acyltransferase (WSD1-like) family protein          159   8e-39    
ref|XP_004228362.1|  PREDICTED: O-acyltransferase WSD1-like             159   9e-39    
ref|XP_010415938.1|  PREDICTED: O-acyltransferase WSD1-like             158   1e-38    
ref|XP_007199467.1|  hypothetical protein PRUPE_ppa027070mg             158   1e-38    
ref|XP_002877657.1|  hypothetical protein ARALYDRAFT_485279             159   1e-38    
ref|XP_009127896.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    158   1e-38    
ref|XP_010427904.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    158   1e-38    
dbj|BAK02325.1|  predicted protein                                      159   2e-38    
emb|CDX70475.1|  BnaC03g05590D                                          157   2e-38    
ref|NP_568275.1|  O-acyltransferase (WSD1-like) family protein          157   2e-38    
emb|CDX85687.1|  BnaA02g01260D                                          157   2e-38    
ref|XP_010270333.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    157   2e-38    
ref|XP_002263252.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    157   3e-38    
ref|XP_010428071.1|  PREDICTED: O-acyltransferase WSD1-like             157   3e-38    
ref|XP_006290854.1|  hypothetical protein CARUB_v10016964mg             158   4e-38    
ref|XP_009350397.1|  PREDICTED: O-acyltransferase WSD1-like             158   4e-38    
ref|XP_006292398.1|  hypothetical protein CARUB_v10018611mg             157   4e-38    
ref|XP_010028432.1|  PREDICTED: O-acyltransferase WSD1-like             156   4e-38    
ref|NP_177356.1|  O-acyltransferase (WSD1-like) family protein          156   5e-38    
ref|XP_010420325.1|  PREDICTED: O-acyltransferase WSD1-like             156   6e-38    
gb|EYU42685.1|  hypothetical protein MIMGU_mgv1a006752mg                155   6e-38    
emb|CBH32550.1|  conserved hypothetical protein                         156   8e-38    
ref|XP_008376728.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    156   8e-38    
ref|XP_010453795.1|  PREDICTED: O-acyltransferase WSD1-like             156   8e-38    
ref|XP_002987493.1|  hypothetical protein SELMODRAFT_235299             155   8e-38    
ref|XP_006404165.1|  hypothetical protein EUTSA_v10010299mg             156   9e-38    
ref|NP_190490.1|  O-acyltransferase (WSD1-like) family protein          156   9e-38    
ref|XP_008373840.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    155   9e-38    
ref|XP_006287603.1|  hypothetical protein CARUB_v10000814mg             155   9e-38    
ref|XP_010555728.1|  PREDICTED: O-acyltransferase WSD1-like             155   9e-38    
gb|EYU42684.1|  hypothetical protein MIMGU_mgv1a006065mg                154   1e-37    
ref|XP_002877656.1|  hypothetical protein ARALYDRAFT_906195             155   1e-37    
ref|XP_008376727.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    155   1e-37    
ref|XP_010690929.1|  PREDICTED: O-acyltransferase WSD1-like             155   1e-37    
ref|XP_010647731.1|  PREDICTED: O-acyltransferase WSD1-like             155   1e-37    
ref|XP_010474267.1|  PREDICTED: O-acyltransferase WSD1-like             155   1e-37    
ref|XP_002988280.1|  hypothetical protein SELMODRAFT_127447             155   1e-37    
ref|XP_008454962.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    155   1e-37    
ref|XP_010453319.1|  PREDICTED: O-acyltransferase WSD1-like             155   1e-37    
ref|XP_010231047.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    155   1e-37    
ref|XP_009357299.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    155   2e-37    
ref|XP_010028433.1|  PREDICTED: O-acyltransferase WSD1-like             155   2e-37    
ref|XP_006294091.1|  hypothetical protein CARUB_v10023084mg             155   2e-37    
ref|XP_009378764.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    154   3e-37    
emb|CDX83070.1|  BnaA01g20700D                                          154   3e-37    
ref|XP_002870738.1|  hypothetical protein ARALYDRAFT_916278             154   3e-37    
ref|XP_009133034.1|  PREDICTED: O-acyltransferase WSD1-like             154   3e-37    
ref|XP_008236483.1|  PREDICTED: O-acyltransferase WSD1-like             153   4e-37    
ref|XP_010520974.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    154   5e-37    
ref|XP_002873570.1|  hypothetical protein ARALYDRAFT_488089             154   5e-37    
ref|XP_010691738.1|  PREDICTED: O-acyltransferase WSD1-like             153   5e-37    
emb|CDX91162.1|  BnaC02g04350D                                          153   5e-37    
ref|XP_010315460.1|  PREDICTED: LOW QUALITY PROTEIN: O-acyltransf...    154   6e-37    
emb|CDX68517.1|  BnaC01g25950D                                          154   7e-37    
ref|XP_010492521.1|  PREDICTED: O-acyltransferase WSD1-like             152   7e-37    
gb|EMT13037.1|  hypothetical protein F775_19306                         153   7e-37    
ref|XP_010030641.1|  PREDICTED: O-acyltransferase WSD1-like             152   8e-37    
gb|EPS64282.1|  hypothetical protein M569_10500                         152   8e-37    
ref|XP_006399759.1|  hypothetical protein EUTSA_v10013397mg             152   1e-36    
ref|XP_002263137.1|  PREDICTED: O-acyltransferase WSD1-like             153   1e-36    
ref|XP_002963877.1|  hypothetical protein SELMODRAFT_80096              153   1e-36    
ref|XP_010492003.1|  PREDICTED: O-acyltransferase WSD1-like             152   1e-36    
ref|XP_002310402.1|  hypothetical protein POPTR_0007s00970g             146   1e-36    
ref|XP_010515262.1|  PREDICTED: O-acyltransferase WSD1                  153   1e-36    
ref|XP_007200992.1|  hypothetical protein PRUPE_ppa005024mg             152   1e-36    
ref|XP_009357297.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    152   1e-36    
gb|EMT09727.1|  hypothetical protein F775_13549                         152   1e-36    
ref|XP_007204115.1|  hypothetical protein PRUPE_ppb018294mg             145   2e-36    
emb|CDX79616.1|  BnaC03g19520D                                          152   2e-36    
ref|XP_009150159.1|  PREDICTED: O-acyltransferase WSD1-like             152   2e-36    
ref|XP_002458560.1|  hypothetical protein SORBIDRAFT_03g035790          152   2e-36    
gb|KFK34210.1|  hypothetical protein AALP_AA5G115100                    152   2e-36    
emb|CBI40536.3|  unnamed protein product                                151   2e-36    
ref|XP_009378763.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    152   2e-36    
ref|XP_002871716.1|  hypothetical protein ARALYDRAFT_488487             151   3e-36    
ref|XP_009378762.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    151   3e-36    
dbj|BAJ85619.1|  predicted protein                                      151   4e-36    
ref|NP_200150.1|  O-acyltransferase (WSD1-like) family protein          151   4e-36    
gb|KFK41631.1|  hypothetical protein AALP_AA2G152800                    149   4e-36    
ref|XP_007039033.1|  O-acyltransferase (WSD1-like) family protein...    151   4e-36    
emb|CDY14417.1|  BnaC03g21780D                                          150   5e-36    
ref|XP_006294114.1|  hypothetical protein CARUB_v10023110mg             150   5e-36    
ref|XP_008236479.1|  PREDICTED: O-acyltransferase WSD1-like             150   6e-36    
emb|CAN71951.1|  hypothetical protein VITISV_024308                     150   6e-36    
ref|XP_009144401.1|  PREDICTED: O-acyltransferase WSD1                  150   7e-36    
ref|XP_010661937.1|  PREDICTED: O-acyltransferase WSD1 isoform X2       150   8e-36    
ref|XP_004969548.1|  PREDICTED: O-acyltransferase WSD1-like             150   8e-36    
ref|XP_003588522.1|  O-acyltransferase WSD1                             149   1e-35    
ref|XP_009133323.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    149   1e-35    
emb|CDY07682.1|  BnaA03g18290D                                          149   1e-35    
ref|XP_010924517.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    150   1e-35    
ref|XP_002278404.1|  PREDICTED: O-acyltransferase WSD1 isoform X1       150   1e-35    
ref|XP_006401713.1|  hypothetical protein EUTSA_v10015825mg             149   1e-35    
ref|XP_006287621.1|  hypothetical protein CARUB_v10000833mg             149   1e-35    
ref|XP_002516707.1|  conserved hypothetical protein                     149   1e-35    
ref|XP_009133325.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    149   1e-35    
ref|XP_004231223.1|  PREDICTED: O-acyltransferase WSD1-like             149   1e-35    
ref|XP_002517894.1|  conserved hypothetical protein                     142   2e-35    
emb|CDP08677.1|  unnamed protein product                                149   2e-35    
ref|XP_010025797.1|  PREDICTED: uncharacterized protein LOC104416054    140   2e-35    
ref|XP_010665875.1|  PREDICTED: O-acyltransferase WSD1-like             148   2e-35    
ref|XP_009125863.1|  PREDICTED: O-acyltransferase WSD1-like             149   2e-35    
ref|XP_008793153.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    149   3e-35    
ref|NP_001189709.1|  O-acyltransferase (WSD1-like) family protein       148   3e-35    
ref|XP_003571567.2|  PREDICTED: O-acyltransferase WSD1-like             149   3e-35    
ref|XP_009140411.1|  PREDICTED: O-acyltransferase WSD1-like             148   3e-35    
ref|XP_004137035.1|  PREDICTED: uncharacterized protein LOC101219464    139   3e-35    
ref|NP_197139.1|  O-acyltransferase (WSD1-like) family protein          148   3e-35    
ref|XP_010509088.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    148   4e-35    
ref|XP_008793154.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    148   4e-35    
ref|NP_850307.2|  O-acyltransferase (WSD1-like) family protein          148   4e-35    
ref|XP_009760114.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    148   4e-35    
ref|XP_010505558.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    147   5e-35    
dbj|BAJ93623.1|  predicted protein                                      147   5e-35    
ref|XP_009127901.1|  PREDICTED: O-acyltransferase WSD1-like             147   5e-35    
emb|CDY03658.1|  BnaA02g15790D                                          147   6e-35    
ref|XP_008373842.1|  PREDICTED: O-acyltransferase WSD1-like             147   7e-35    
gb|EMT13687.1|  hypothetical protein F775_52291                         147   7e-35    
ref|XP_006411123.1|  hypothetical protein EUTSA_v10016602mg             147   7e-35    
ref|XP_009354302.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    147   7e-35    
ref|XP_010520975.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    147   8e-35    
ref|XP_010505559.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    147   9e-35    
ref|XP_010492524.1|  PREDICTED: O-acyltransferase WSD1-like             147   1e-34    
ref|XP_006345292.1|  PREDICTED: O-acyltransferase WSD1-like             149   1e-34    
ref|XP_010030646.1|  PREDICTED: O-acyltransferase WSD1-like             145   1e-34    
ref|XP_010492529.1|  PREDICTED: O-acyltransferase WSD1-like             147   1e-34    
emb|CDX78487.1|  BnaA03g03990D                                          146   1e-34    
ref|XP_009133324.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    146   1e-34    
emb|CDY60222.1|  BnaA06g39110D                                          146   2e-34    
ref|XP_002879777.1|  hypothetical protein ARALYDRAFT_321593             145   2e-34    
ref|XP_010471231.1|  PREDICTED: O-acyltransferase WSD1-like             145   2e-34    
emb|CDX82186.1|  BnaC02g21040D                                          146   2e-34    
ref|XP_010503571.1|  PREDICTED: O-acyltransferase WSD1-like             145   3e-34    
gb|EAZ13682.1|  hypothetical protein OsJ_03605                          144   3e-34    
ref|XP_006444839.1|  hypothetical protein CICLE_v10019739mg             145   4e-34    
ref|XP_010231048.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    144   4e-34    
ref|XP_010666700.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    145   4e-34    
gb|EEE55448.1|  hypothetical protein OsJ_03604                          144   4e-34    
ref|XP_008675193.1|  PREDICTED: O-acyltransferase WSD1-like             145   4e-34    
ref|XP_009354301.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    144   4e-34    
ref|XP_009627721.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    144   5e-34    
ref|XP_009627720.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    144   6e-34    
ref|XP_010415939.1|  PREDICTED: O-acyltransferase WSD1-like isofo...    144   6e-34    
gb|AJA71659.1|  hypothetical protein                                    144   6e-34    



>ref|XP_009782424.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Nicotiana 
sylvestris]
Length=479

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/475 (63%), Positives = 378/475 (80%), Gaps = 6/475 (1%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E +  PASP SQY+NSS LS  +IAVLES +PIE ++S+ L+ ++DVF+PINPRFSSIM
Sbjct  6     EEEIFEPASPSSQYLNSSNLSLCVIAVLESKIPIEYEESLPLNLLKDVFVPINPRFSSIM  65

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             VTGK G + WK V+V  EDH+K PIFP  KPL+FY+ C S Y++ ++M+ FPQ QPLWEI
Sbjct  66    VTGKKGTRKWKRVEVNYEDHIKTPIFPSEKPLDFYNECFSNYISNLAMEQFPQNQPLWEI  125

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HIF+YPT++A G+ IFKLH SLGDGYSLMGALLSCLQR DNP+LPLTFP RQ +     +
Sbjct  126   HIFKYPTNDAAGSVIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQRTTLSSKD  185

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              + +V    K VPR   G+V+TV DF  + LKS+L++DD+TAIHS D+GVEFRPI VTT 
Sbjct  186   KAFSV---LKVVPRFFKGIVNTVYDFGESILKSTLVEDDRTAIHSGDEGVEFRPIVVTTK  242

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             TFSL  LKQIK+SLNVTINDVI+GIV YGTRLYMQE ++E+CNG+CTALVLFNTRA+ GG
Sbjct  243   TFSLDCLKQIKASLNVTINDVITGIVEYGTRLYMQEVKQESCNGKCTALVLFNTRAL-GG  301

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSS--NPLRFIYNAHRMVKRQRYS  1235
             YKSV++MIKPN++MPWGN  TFLP ++PKL +  + D S  NPL F+  AHRM+ R+R S
Sbjct  302   YKSVNDMIKPNSDMPWGNHFTFLPVSLPKLTNLANRDQSSINPLAFVQKAHRMIDRKRNS  361

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFA  1415
             AS++LT + L+F RKLRG EATA+F+  TLKNTS+ +TN+IGPVE+  LANHPVKG+YF 
Sbjct  362   ASVWLTSKLLDFLRKLRGPEATARFIHGTLKNTSMALTNLIGPVEEMALANHPVKGLYFI  421

Query  1416  VSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSSP  1580
             V+GAPQS  VT++SY  KLR+ ++ EK FID  KLKSCI+ AFD IF+  +KSSP
Sbjct  422   VTGAPQSCSVTIVSYVDKLRIAMVVEKGFIDPNKLKSCIDYAFDTIFKAAVKSSP  476



>ref|XP_009624957.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=479

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/475 (62%), Positives = 370/475 (78%), Gaps = 6/475 (1%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E    PASP SQY+NSS LS  +IAVLES +PIE ++S+ L+ ++DVF+PINPRFSSIM
Sbjct  6     EEEAFEPASPSSQYLNSSNLSLCVIAVLESKIPIEYEESLPLNLLKDVFVPINPRFSSIM  65

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             VTGK G + WK V+V  +DH+K PIFP  KPL+FYD C S Y++ ++M+ FPQ +P WEI
Sbjct  66    VTGKKGTRKWKRVEVNYQDHIKTPIFPSEKPLDFYDECFSNYISNLAMEQFPQNRPFWEI  125

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HIF+YPT++A G+ IFKLH SLGDGYSLMGALLSCLQR DNP+LPLTFP RQ +     +
Sbjct  126   HIFKYPTNDAAGSIIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQRTTLSSKD  185

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              + +V    K VPR   G+V+TV DF  + LK + ++DD+TAI S D+GVEFRPI VTT 
Sbjct  186   KAFSV---LKVVPRFFKGIVNTVYDFGESILKGTFVEDDRTAIRSGDEGVEFRPIVVTTK  242

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             TFSL  LKQIK+SLNVTINDVI+GIV YGTRLYMQ   +E+CNG+CTALVLFNTRA+ GG
Sbjct  243   TFSLDSLKQIKASLNVTINDVITGIVQYGTRLYMQGVNQESCNGKCTALVLFNTRAL-GG  301

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSS--NPLRFIYNAHRMVKRQRYS  1235
             YKSV++MIKPN++MPWGN  +FLP ++PKL +    D S  NPL F+  AHRM+ R+R S
Sbjct  302   YKSVNDMIKPNSDMPWGNHFSFLPVSLPKLTNLAKRDHSSINPLAFVQKAHRMIDRKRNS  361

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFA  1415
             AS++LT +FL+  RKLRG EATA+F+  +LKNTS+ +TN+IGPVE+  LANHPVKG+YF 
Sbjct  362   ASVWLTSKFLDTLRKLRGPEATARFIHGSLKNTSMGLTNLIGPVEEMALANHPVKGLYFM  421

Query  1416  VSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSSP  1580
             V+GAPQS  VTM+SY  KLR+ ++ EK FID  KLKSCI+ AFD IF+  +KSSP
Sbjct  422   VTGAPQSCSVTMVSYVDKLRIAMVVEKGFIDPNKLKSCIDYAFDTIFKAAVKSSP  476



>ref|XP_009759664.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=474

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/459 (63%), Positives = 349/459 (76%), Gaps = 7/459 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             PASP SQY+NSS LS S+I VLES +PIE ++S + S ++DVFLPINPRFSSIMVT K G
Sbjct  9     PASPGSQYLNSSNLSLSVIVVLESKIPIEIENSKVFSLLKDVFLPINPRFSSIMVTEKKG  68

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              + WK V+V +EDH+K P+FP  + L FYD   S YL+K++MDPF Q +P WEIH+ +Y 
Sbjct  69    ARKWKQVEVNIEDHVKTPVFPAEQSLIFYDEYFSNYLSKLAMDPFSQNKPFWEIHLLKYS  128

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TSNA GN IFKLH SLGDGYSLMGALLSCLQR DNP LPLTFP RQ   +      N   
Sbjct  129   TSNAAGNLIFKLHHSLGDGYSLMGALLSCLQRVDNPLLPLTFPSRQ---RTILSTKNKAI  185

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
                K VP +   +V+TV DF  + LKS+L++DD+T I S DDGVEFRPI + T TFSL  
Sbjct  186   NTVKCVPNVFMKLVNTVQDFGLSVLKSTLIEDDRTPIRSGDDGVEFRPIEIATTTFSLDS  245

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +KQIK+ L VTINDVI+G+V YGTRLYMQ   +ET NG+CTALVLFNTRA+ GGYKSVSE
Sbjct  246   IKQIKAKLKVTINDVITGVVIYGTRLYMQGINQETSNGKCTALVLFNTRAV-GGYKSVSE  304

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             MIKPN+EMPWGN  TFLP ++PKL S    DS NPL FI  A R++KRQR SAS++LTG+
Sbjct  305   MIKPNSEMPWGNHFTFLPVSLPKLTS---TDSLNPLGFIEKARRIIKRQRNSASVFLTGR  361

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              LE  RK+ G E TA+++  TLK+TS+ +TN+IGP+E+  LANHP+KG+YFAV+GAPQSL
Sbjct  362   LLEILRKVEGPETTAKYIHATLKHTSMGITNLIGPLEEMALANHPIKGLYFAVAGAPQSL  421

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
              VTM+SY  KLR+ I+ EK FID  KLKSCIE +FD IF
Sbjct  422   SVTMVSYVDKLRVAIVVEKGFIDPNKLKSCIEYSFDTIF  460



>ref|XP_006367474.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum]
Length=476

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/472 (62%), Positives = 370/472 (78%), Gaps = 5/472 (1%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E +  PASP +QY+NSS LS S+IAVLES +PIE +DS+ ++ ++DVF+PINPRFSSIM
Sbjct  6     EEEIFEPASPSAQYLNSSNLSLSVIAVLESKIPIEYEDSLPINLLKDVFVPINPRFSSIM  65

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             VTGK G K WK V+V  +DH+K PIFP  KP+EFYD C S Y++ ++M+ FPQ +PLWEI
Sbjct  66    VTGKKGTKKWKRVEVNYQDHIKTPIFPTQKPIEFYDECFSTYISNLAMEKFPQNRPLWEI  125

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             H+F+YPTS+A GN IFKLH SLGDGYSLMGALLSCLQR DNP+LPLTFP RQ S      
Sbjct  126   HLFKYPTSDAAGNIIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQKSN--FNN  183

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             N+      FK VPR   G+V+T+ DF W+ LKS+L++DD+TAIHS  DGVEFR   + T 
Sbjct  184   NNKGYISNFKIVPRFFKGIVNTLYDFGWSTLKSTLIEDDRTAIHSGVDGVEFRSPVLVTN  243

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             TF L  LKQIK++LNVTINDVI+GIV YGTRLYM+E  +ETCNG+C+ALVLFNTRA+GG 
Sbjct  244   TFLLDSLKQIKTNLNVTINDVITGIVIYGTRLYMEEVNKETCNGKCSALVLFNTRALGGS  303

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YKSVS+MI+PN++MPWGN  TFLP ++PKL    +  S+NPL F+  AHR++ R+R SAS
Sbjct  304   YKSVSDMIRPNSDMPWGNHFTFLPISLPKLT---NDKSNNPLYFVQKAHRIIDRKRNSAS  360

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             ++LT + L+  RKLRG EATA+F+  TLKNTS+ +TNMIGPVE+  LANHPVKG+YF V+
Sbjct  361   VWLTSKLLDLLRKLRGPEATARFIHGTLKNTSMALTNMIGPVEEMALANHPVKGLYFVVT  420

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             GAPQS  VT++SY  KLR+ I+ EKDFID  KLK CIE+A++ IF+  + SS
Sbjct  421   GAPQSCSVTIVSYVDKLRIAIVVEKDFIDPNKLKYCIENAYESIFKAAINSS  472



>ref|XP_004243360.1| PREDICTED: O-acyltransferase WSD1 [Solanum lycopersicum]
Length=471

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/472 (62%), Positives = 368/472 (78%), Gaps = 6/472 (1%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E +  PASP SQY+NSS LS S+IAVLES VPIE +DS+ ++ ++DVF+PINPRFSSIM
Sbjct  2     EEEIFEPASPSSQYLNSSNLSLSVIAVLESKVPIEYEDSLPINLLKDVFVPINPRFSSIM  61

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             VTGK G K WK V+V  +DH+K PIFP  KP+EFYD C S Y++ ++ + F Q +PLWEI
Sbjct  62    VTGKKGTKKWKRVEVNYQDHIKTPIFPTQKPIEFYDECFSTYISNLATEKFSQNRPLWEI  121

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             H+F+YPTS+A GN +FKLH SLGDGYSLMGALLSCLQR DNP+LPLTFP RQ S      
Sbjct  122   HVFKYPTSDAAGNIVFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQKSNLNNSN  181

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              +      FK VPR   G+V+T+ DF W+ LKS+L++DD+TAIHS DDGVEFR   + T 
Sbjct  182   KAKGYINNFKIVPRFFKGIVNTLYDFGWSTLKSTLIEDDRTAIHSGDDGVEFRSPVLVTK  241

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             TFSL  LKQIK++LNVTIN   +GIV YGTRLYM+E  +ETCNG+C+ALVLFNTRA+GG 
Sbjct  242   TFSLDRLKQIKANLNVTIN---AGIVIYGTRLYMEEVNKETCNGKCSALVLFNTRALGGS  298

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YKSVS+MI+PN++MPWGN  TFLP ++PKL    +  S+NPL FI  AHR+++R+R SAS
Sbjct  299   YKSVSDMIRPNSDMPWGNHFTFLPISLPKLT---NNKSNNPLYFIQKAHRIIERKRNSAS  355

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             ++LTG+ L+  RKLRG EATA+F+  TL+NTS+ +TNMIGPVE+  LANHPVKG+YF V+
Sbjct  356   IWLTGKLLDLLRKLRGTEATARFIHGTLRNTSMALTNMIGPVEEMALANHPVKGLYFVVT  415

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             GAPQS  VT++SY  KLR+ I+ EKDFID  KLKSCIE A++ IF+  + SS
Sbjct  416   GAPQSCSVTIVSYVDKLRIAIVVEKDFIDPNKLKSCIEYAYESIFKAAINSS  467



>ref|XP_009588555.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=427

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/418 (62%), Positives = 321/418 (77%), Gaps = 7/418 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             PASP SQY+NSS LS S+I VLES +PIE +DS + S ++DVFLPINPRFSSIM+T K G
Sbjct  13    PASPISQYLNSSNLSLSVIVVLESKIPIEIEDSKVFSLLKDVFLPINPRFSSIMITEKKG  72

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              + WK V+V +EDH+K P+ P  + L FYD C S YL+K++MDPF Q +PLWEIH+ +YP
Sbjct  73    ARKWKQVEVNIEDHVKTPVLPAEQSLIFYDECFSNYLSKLAMDPFQQNKPLWEIHLLKYP  132

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TSNA GN IFKLH SLGDGYSLMGALLSCLQR DNP+LPLTFP RQ +        N   
Sbjct  133   TSNAAGNLIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQSTIL---STKNRAI  189

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
                K VP +   +V++V DF  + LKS+L++DD+T I S DDGVEFRPI + T TFSL  
Sbjct  190   NIVKCVPNVFMKLVNSVQDFGLSVLKSTLIEDDRTPIRSGDDGVEFRPIEIATTTFSLES  249

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +KQIK++L VTINDVI+G+V YGTRLYMQ   +ET NG+CTALVLFNTRA+ GGYKSVSE
Sbjct  250   IKQIKANLKVTINDVITGVVIYGTRLYMQGINKETSNGKCTALVLFNTRAV-GGYKSVSE  308

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             MIKPN+EMPWGN  TFLP ++PKL S    DS NPL F+  A R++KRQR SAS++LTG+
Sbjct  309   MIKPNSEMPWGNHFTFLPVSLPKLTS---TDSLNPLGFVQKARRVIKRQRNSASVFLTGR  365

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
              LE  RK+ G E TA+++  TLK+TS+ +TN+IGP+E+  LANHP+KG+YFAV GAPQ
Sbjct  366   LLEILRKVEGPETTAKYIHATLKHTSMGITNLIGPLEEMALANHPIKGLYFAVVGAPQ  423



>ref|XP_011100361.1| PREDICTED: O-acyltransferase WSD1-like [Sesamum indicum]
Length=472

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/473 (58%), Positives = 340/473 (72%), Gaps = 13/473 (3%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E VL P SP +QY+ SSVLS +I+ VLES  PI  DDS+ +  ++DVFLPINPRFSSIMV
Sbjct  10    EEVLEPMSPSAQYLKSSVLSLTILGVLESEDPI--DDSMTIPLLKDVFLPINPRFSSIMV  67

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
             TGK G K WK V+V L++H+ +P FP G   ++YD C ++YLTK+ M+  PQ +PLWEIH
Sbjct  68    TGKKGVKKWKKVEVNLQEHVNIPTFPSGMSTDYYDECFTDYLTKLGMEQLPQNRPLWEIH  127

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             I +YPT NA GN IFKLH SLGDGYSLMGALLSCLQR DNP +PLTFP RQ    K G N
Sbjct  128   ILKYPTKNAAGNLIFKLHHSLGDGYSLMGALLSCLQRLDNPLMPLTFPSRQS---KDGGN  184

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
                + R    VPR  +G++ T  DF W+ LKSSL+ DDK+ I S +DGVEFRPI  TT  
Sbjct  185   HTLLGR----VPRFFTGLLHTACDFGWSLLKSSLIKDDKSPIRSGEDGVEFRPIVTTTTA  240

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
             FS+  +++IKS L VT+NDVI+GI+ YGTRLYMQ+   E+     TALVL NTRA+ GGY
Sbjct  241   FSIDQIREIKSRLKVTVNDVITGIIIYGTRLYMQKRSEESGKANSTALVLLNTRAI-GGY  299

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
             KSV EM KP++EMPWGNR  FL   +PKL   G  +  NPL+F+  A RM+KRQR SA++
Sbjct  300   KSVDEMTKPDSEMPWGNRFAFLQVPVPKL---GAAEQENPLKFVKTARRMIKRQRNSATV  356

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             YLTGQ L   RK+RG E TA+++  TLKNTS+ ++N+IGPVE+  LAN P+KG+YF V+G
Sbjct  357   YLTGQLLNVVRKIRGPETTARYIHGTLKNTSMAISNLIGPVEQMALANQPIKGLYFVVAG  416

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSSPP  1583
             APQSL VT++SY  KLR+ +  EK FID    KSCIE AF+ I +  L S  P
Sbjct  417   APQSLSVTLISYVRKLRIAMTMEKGFIDPNTFKSCIEYAFEAISKAALASPTP  469



>emb|CDP20977.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/464 (52%), Positives = 346/464 (75%), Gaps = 7/464 (2%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             DE    P SP  QY NSS++S ++I VLES +PI++DDS+ L  ++++FLPINPR SSIM
Sbjct  7     DEEFQVPVSPTGQYFNSSIMSAAVIGVLESEIPIQEDDSLTLKLLQELFLPINPRLSSIM  66

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  + G K WK V+VI ++H+ VP+FP GK +EFYD C ++YL+ +++ P PQ+QPLWE+
Sbjct  67    VQDEKGVKLWKKVEVIPKNHIHVPVFPEGKSIEFYDECFNDYLSNMALQPLPQSQPLWEV  126

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI +YPT NA GN +FKLH +LGDGYS+MGALLSCLQRAD+P+LP+TFP  Q + K +  
Sbjct  127   HIIKYPTKNAAGNLVFKLHHALGDGYSIMGALLSCLQRADDPSLPITFPEFQTNPKGKNN  186

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             +  ++   FK VPR+LSG+ +T++DF+W+ LKS+ L DD+T I S +DGVEFRP+++TTM
Sbjct  187   DEGSI---FKKVPRVLSGIGNTISDFAWSMLKSTFLQDDQTPIRSGEDGVEFRPMTITTM  243

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             TF +  +KQ+K++L+V++NDVI G++  GTRLYMQ  + E  NG+ +ALVL +TRA+  G
Sbjct  244   TFCIDQIKQMKANLDVSVNDVICGVIFLGTRLYMQAIDPEKTNGKSSALVLLSTRAI-RG  302

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YK+V EM++PN++ PWGN   F+  ++P L   G   S NPL F+  A ++++ +R SA 
Sbjct  303   YKTVKEMVEPNSKTPWGNHFAFMHVSVPNLAKAG---SQNPLNFVLEAQKIIRSKRNSAG  359

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             +YL G+ LE  RK RG EATA+F+ +TL N+S+T++N+ GPV++  LANHP KGMYF ++
Sbjct  360   VYLNGKLLETMRKCRGPEATAKFIHKTLTNSSMTVSNVFGPVDRLALANHPAKGMYFMMA  419

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             G+PQ+L +TM+SY  KLR+ I  EK  ID +K KS I+ AF+ I
Sbjct  420   GSPQNLTITMVSYMKKLRVAIGVEKGMIDAEKFKSSIDEAFNMI  463



>ref|XP_009784406.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=484

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/467 (56%), Positives = 339/467 (73%), Gaps = 8/467 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY  SS LS S+I+VLES +PI  DDS  ++ ++DVFLPINPRFSSIMV  KNG
Sbjct  24    PVSPTGQYFTSSALSISVISVLESEIPI--DDSCTMTLLKDVFLPINPRFSSIMVRDKNG  81

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K WK V+V  +DH+ VPIFP GK  EFYD C +EYLTKI+M+  PQT+PLWEIHIF+YP
Sbjct  82    VKQWKKVEVKYKDHINVPIFPEGKSKEFYDNCFNEYLTKIAMEQLPQTRPLWEIHIFKYP  141

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TS + GN +FKLH SLGDG+SLMGALLSCLQRADNP+LPLTFP            ++   
Sbjct  142   TSKSAGNLVFKLHHSLGDGFSLMGALLSCLQRADNPSLPLTFP---AFNSNPNSGNDYKK  198

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             R    V +++SGVV+T  DF W+ LKS+ L+D++T I S D+GVEFRPI ++TM FSL H
Sbjct  199   RFCTNVAQMVSGVVNTFVDFGWSLLKSTSLEDERTPIRSGDEGVEFRPIHISTMDFSLDH  258

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             LKQIK++L VTINDVI G++  G RLYM+E + E  N   TALVL NTR +  GYKSV E
Sbjct  259   LKQIKTNLKVTINDVICGVLFLGVRLYMEEMKYEEKNANSTALVLLNTRNI-AGYKSVKE  317

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M++P+ E  WGN+  FL  ++PKL   G+  SSNPL F+  A  ++KR+R SA++ LTG+
Sbjct  318   MLQPSNESKWGNQFAFLHVSVPKL-DKGES-SSNPLSFVSKAQDVIKRKRNSAAVILTGK  375

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              L+  +K RG E TA+++  TLKN+S+T++NMIGP+E+  LANHP KG+YF V G P+SL
Sbjct  376   LLDTLQKYRGPEVTAKYIHSTLKNSSMTISNMIGPMEQMALANHPCKGLYFMVVGVPESL  435

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSSP  1580
              +TM+SY G+LR+ + +EK  +D  K K+ IE+AFD IF+  + S P
Sbjct  436   TITMMSYMGRLRVAVGTEKGLVDPHKFKTSIENAFDSIFKAAVPSKP  482



>ref|XP_004251786.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum]
Length=491

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/491 (54%), Positives = 350/491 (71%), Gaps = 8/491 (2%)
 Frame = +3

Query  111   LSSIQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILS  290
             + +I VK  +E   E  DE    P SP  QY  SSV+S S+I VLES +PI  DDS  ++
Sbjct  1     MKNINVKKIVEEE-EDYDETSSFPVSPTGQYFTSSVMSISVICVLESEIPI--DDSCTIT  57

Query  291   EIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYL  470
              ++DVF+PINPRFSSIMV  KNG K WK V+V  +DH+ VPIFP GK  EFYD C +EY+
Sbjct  58    LLKDVFIPINPRFSSIMVKDKNGVKQWKKVEVKHKDHINVPIFPQGKSKEFYDNCFNEYM  117

Query  471   TKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPA  650
             TKISM+ FPQ++PLWEIHIF+YPT+ + GN +FKLH SLGDG+SLMGALLSCLQRADNP+
Sbjct  118   TKISMEQFPQSRPLWEIHIFKYPTTKSAGNLVFKLHHSLGDGFSLMGALLSCLQRADNPS  177

Query  651   LPLTFPRRQGSGKKQGE--NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKT  824
             LPLTFP    +         S+   R    V + ++GVV+T+ DF W+ +KS+ L+D++T
Sbjct  178   LPLTFPSFTSNNNNYNHNLESDYKKRLCTNVVQRVNGVVNTLLDFGWSLMKSTNLEDERT  237

Query  825   AIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERET  1004
             +I S D+GVEFRPI +TTM FSL HLK IKS+L VTINDVI G++  G RLYM+E + + 
Sbjct  238   SIRSGDEGVEFRPIDITTMEFSLDHLKVIKSNLKVTINDVICGVLFLGVRLYMEEMKYDQ  297

Query  1005  CNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNP  1184
              N   TALVL NTR +  GYKSV EM++P  E  WGN+  FL  ++PK+    +  S+NP
Sbjct  298   KNANSTALVLLNTRNI-AGYKSVKEMLQPKNESKWGNQFAFLHVSLPKIDK--EESSTNP  354

Query  1185  LRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGP  1364
             L F++ A  +++R+R SA++ LTG+ L+  +K +G E TA+++  TLKN+S+T++NMIGP
Sbjct  355   LSFVFKAQDVIQRKRNSAAVILTGKLLDTLQKYKGPEVTAKYIHNTLKNSSMTISNMIGP  414

Query  1365  VEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAF  1544
             VEK  LANHPVK +YF V G P+SL +TM+SY GKLR+ + +EK  ID +K K  IE+AF
Sbjct  415   VEKMALANHPVKSLYFMVVGVPESLTITMMSYMGKLRVAVGTEKGLIDPQKFKCSIENAF  474

Query  1545  DEIFRLTLKSS  1577
             D IF+  + S+
Sbjct  475   DRIFKAAVPSA  485



>ref|XP_002517893.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44411.1| conserved hypothetical protein [Ricinus communis]
Length=483

 Score =   532 bits (1371),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 255/467 (55%), Positives = 345/467 (74%), Gaps = 9/467 (2%)
 Frame = +3

Query  159   DDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI  338
             ++E+++ P SP  QY NSSVLS  ++ VLES +PI  DDS  ++ ++DVFLPINPRFSSI
Sbjct  16    EEEIIVEPVSPTGQYFNSSVLSICVLGVLESEIPI--DDSPTMTLLQDVFLPINPRFSSI  73

Query  339   MVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWE  518
             MVT KNG K WK V V L++H+ VP FP G   + YD   ++Y+++++++P PQ QPLWE
Sbjct  74    MVTDKNGGKQWKRVAVKLKNHVNVPNFPTGLSPKSYDKYFNDYISRVALEPLPQNQPLWE  133

Query  519   IHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQG  698
             IH+ +YPTSNA GN IFKLH +LGDG+SLMGALLSCLQR DNP+LPLTFP  Q   K + 
Sbjct  134   IHVIKYPTSNAAGNLIFKLHHALGDGFSLMGALLSCLQRVDNPSLPLTFPSLQLPSKPEI  193

Query  699   ENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTT  878
              + +      K+   L+S + +T++DF W+ LKSSL++D ++ I S +DGVEF+P +++T
Sbjct  194   MSKSKKGIVAKS---LVSSIFNTMSDFGWSLLKSSLVEDVQSPIRSGEDGVEFKPTTLST  250

Query  879   MTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGG  1058
             MTFSL  +KQIKS L VTINDVI+GI+ YG RLYMQ    E  N   TALVL NTR + G
Sbjct  251   MTFSLDRIKQIKSRLGVTINDVITGIIFYGIRLYMQAVGDEAANSHSTALVLLNTRIV-G  309

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
             GYKSV EM+KPNAE PWGN+  FL  ++P+L        SNPL+F+  A +++K++R S 
Sbjct  310   GYKSVKEMVKPNAESPWGNQFGFLHVSMPELT---KAAVSNPLQFVEKAQQIIKKKRSSL  366

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
             ++ LTG+ LE  RKLRG E TA+++  TLKN+S+T++N+IGPVEK  LANHP+KG+YF V
Sbjct  367   AVNLTGRLLEALRKLRGPEVTAKYIHSTLKNSSMTISNVIGPVEKMALANHPIKGLYFMV  426

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              G PQSL +TM+SY G+LR+ + +EKDFID +K +SCIE++F+ I+ 
Sbjct  427   VGVPQSLTITMVSYTGQLRIAVGTEKDFIDPQKFRSCIENSFEMIYE  473



>ref|XP_009600771.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=481

 Score =   530 bits (1365),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 258/467 (55%), Positives = 335/467 (72%), Gaps = 8/467 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY  SS LS S+I+VLES +PI  DDS  +  ++DVFLPINPRFSSIMV  KNG
Sbjct  21    PVSPTGQYFTSSALSISVISVLESEIPI--DDSCTMKLLKDVFLPINPRFSSIMVRDKNG  78

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K WK V+V  +DH+ VPIFP GK  EFYD C +EYLTKI+M   PQT+PLWEIH+F+YP
Sbjct  79    VKQWKKVEVKYKDHINVPIFPEGKSKEFYDNCFNEYLTKIAMGQLPQTRPLWEIHLFKYP  138

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TS + GN +FKLH SLGDG+SLMGALLSCLQRADNP+LPLTFP            ++   
Sbjct  139   TSKSAGNLVFKLHHSLGDGFSLMGALLSCLQRADNPSLPLTFP---AFNSNPNSGNDYKK  195

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             R    V +++SGVV+T  DF W+ LKS+ L+D++T + S D+GVEFRPI ++TM FSL H
Sbjct  196   RFCTNVAQMVSGVVNTFLDFGWSLLKSTSLEDERTPVRSGDEGVEFRPIDISTMDFSLDH  255

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             LKQIK++L VTINDVI G++  G RLYM+E + E  N   TALVL NTR +  GYKSV E
Sbjct  256   LKQIKTNLKVTINDVICGVLFLGVRLYMEEMKYEQKNANSTALVLLNTRNI-AGYKSVKE  314

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M++P+ E  WGN+  FL  ++PKL    +  S NPL F++ A  ++KR+R SA++ LTG+
Sbjct  315   MLQPSNESKWGNQFAFLHVSVPKLDK--EESSLNPLSFVFKAQDVIKRKRNSAAVILTGK  372

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              L+  +K RG E TA+++  TLKN+S+T++NMIGP+E+  LANHP KG YF V G P+SL
Sbjct  373   LLDTLQKYRGPEVTAKYIHSTLKNSSMTISNMIGPMEQMALANHPCKGFYFMVVGVPESL  432

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSSP  1580
              +TM+SY G+LR+ + +EK  +D  K KS IE+AFD IF+  + S P
Sbjct  433   TITMMSYMGRLRVAVGTEKGLVDPHKFKSSIENAFDMIFKAAVPSKP  479



>ref|XP_006350139.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum]
Length=503

 Score =   528 bits (1360),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 257/484 (53%), Positives = 347/484 (72%), Gaps = 19/484 (4%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY  SSV+S S+I VLES +PI  DDS  ++ ++DVF+PINPRFSSIMV  KNG
Sbjct  23    PVSPTGQYFTSSVMSISVICVLESEIPI--DDSCTVTMLKDVFIPINPRFSSIMVKDKNG  80

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K WK V+V  +DH+ VPIFP GK  EFYD C +EY+TKI+M+ FPQ++PLWEIHIF+YP
Sbjct  81    VKQWKKVEVKHKDHIYVPIFPQGKSKEFYDNCFNEYMTKIAMEQFPQSRPLWEIHIFKYP  140

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK---------  692
             T+ + GN +FKLH SLGDG+SLMGALLSCLQRADNP+LPLTFP    +            
Sbjct  141   TTKSAGNLVFKLHHSLGDGFSLMGALLSCLQRADNPSLPLTFPSFTSNNNNNNNNNNHNL  200

Query  693   QGENSNAVARAFKA-----VPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEF  857
             + +N++ +   +K      V + ++GVV+T+ DF W+ +KS+ L+D++T I S D+GVEF
Sbjct  201   ESDNNHNLESDYKKSFCTNVVQSVNGVVNTLLDFGWSLMKSTNLEDERTTIRSGDEGVEF  260

Query  858   RPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLF  1037
             RPI +TTM FSL HLK+IKS+L VTINDVI G++  G RLYM+E++ +  N   TALVL 
Sbjct  261   RPIDITTMEFSLDHLKEIKSNLKVTINDVICGVLFLGVRLYMEETKYDQKNTNSTALVLL  320

Query  1038  NTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMV  1217
             NTR +  GYKSV EM++P  E  WGN+  FL  ++PK+    +  SSNPL F++ A  ++
Sbjct  321   NTRNI-AGYKSVKEMLQPKNESKWGNQFAFLHVSLPKIDK--EESSSNPLSFVFKAQDVI  377

Query  1218  KRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPV  1397
             +R+R SA++ LTG+ L   +K RG E TA+++  TLKN+S+T++NMIGPVEK  LANHPV
Sbjct  378   QRKRNSAAVILTGKLLNTLQKYRGPEVTAKYIHSTLKNSSMTISNMIGPVEKMALANHPV  437

Query  1398  KGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             K +YF V G P+SL +TM+SY GKLR+ + +EK  ID +K K  IE+AFD IF+  + S+
Sbjct  438   KSLYFMVIGVPESLTITMMSYMGKLRVAVGTEKGLIDPQKFKCSIENAFDRIFKAAMPSA  497

Query  1578  PPRA  1589
               ++
Sbjct  498   SSKS  501



>ref|XP_002323705.2| hypothetical protein POPTR_0017s04330g [Populus trichocarpa]
 gb|EEF03838.2| hypothetical protein POPTR_0017s04330g [Populus trichocarpa]
Length=483

 Score =   519 bits (1336),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 247/463 (53%), Positives = 339/463 (73%), Gaps = 10/463 (2%)
 Frame = +3

Query  171   VLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTG  350
             V  P SP  QY NSSVLS  ++AVLES VPI  DDS+ ++ ++DVFLPINPRFSSIMV  
Sbjct  21    VTEPVSPTGQYFNSSVLSICVLAVLESEVPI--DDSLTMTLLKDVFLPINPRFSSIMVND  78

Query  351   KNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
             KNGEK WK V+V L++H+ +PIFP+G     YD   ++Y+++ ++  FPQ+QPLWEIH+ 
Sbjct  79    KNGEKQWKRVEVQLQNHVNIPIFPIGLSTTSYDNYFNDYISRTALKQFPQSQPLWEIHLV  138

Query  531   RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSN  710
             +YPTS A GN IFKLH +LGDG+SLMGALLSCLQRADNP+L LTFP  Q           
Sbjct  139   KYPTSKAAGNIIFKLHHALGDGFSLMGALLSCLQRADNPSLSLTFPSLQYPSNPDC----  194

Query  711   AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFS  890
             + ++    VP+ +  + +T++DF W+ LKSS ++D ++ I S D+ V+F+PI ++T+TFS
Sbjct  195   SFSKLNITVPKCIGSIFNTISDFGWSLLKSSFVEDSRSPIRSGDEEVQFKPIVISTITFS  254

Query  891   LYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKS  1070
             L H+KQIKS L VTINDVI+GI+ YGTRLYMQ  + ++ N   TALVL NTR +  GY+S
Sbjct  255   LDHIKQIKSRLGVTINDVITGIIFYGTRLYMQNVDDKSTNAHSTALVLLNTRVI-SGYRS  313

Query  1071  VSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYL  1250
             V EM+KP+AE PWGN+  FL  ++P+L    D   S PL  +  A  +++R+R S ++ L
Sbjct  314   VKEMVKPDAESPWGNQFGFLHVSVPELT---DSRFSKPLECVTIAQEIIQRKRSSLAVNL  370

Query  1251  TGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAP  1430
             TG+ LE  RK RG EATA+++++TL N+S+T++N+IGPV+K  LANHP+KG YF V G P
Sbjct  371   TGRLLEVLRKFRGPEATAKYIKQTLFNSSMTISNIIGPVDKMALANHPIKGFYFMVVGVP  430

Query  1431  QSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             QSL +TM+SYAGKL++ + +EK F+D +K KSC+E+AF+ IF+
Sbjct  431   QSLTITMVSYAGKLKVAVGTEKGFMDSQKFKSCMETAFEMIFK  473



>ref|XP_006469879.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
Length=465

 Score =   518 bits (1333),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 257/466 (55%), Positives = 332/466 (71%), Gaps = 12/466 (3%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             + P SP  QY+NSS LS S++ VLES +PI  DDS   S ++D+FLPINPRFSSIMV  +
Sbjct  9     MEPVSPSGQYLNSSALSLSVLGVLESEIPI--DDSQCFSLLKDIFLPINPRFSSIMVVDE  66

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             NGEK WK V+V L +H+KVPIFP G   E YD    +Y+++I M+ FPQ+QPLWE+HI +
Sbjct  67    NGEKQWKRVEVKLRNHVKVPIFPSGLSPEAYDKYFDDYISEIGMELFPQSQPLWEVHIIK  126

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFP--RRQGSGKKQGENS  707
             YPTS+A G  IFKLH SLGDG+SLMGALLSCLQRAD+P++PLTFP   R  S KK G NS
Sbjct  127   YPTSHAAGFLIFKLHHSLGDGFSLMGALLSCLQRADDPSVPLTFPSVNRFPSNKKDGNNS  186

Query  708   NAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTF  887
             N  +  +K        V +TV+DF W+F+KS+ L DD+T I+S DDG+EFRP+SV T  F
Sbjct  187   NIFSNMYKT----FCVVSETVSDFCWSFVKSAWLQDDRTPIYSGDDGIEFRPVSVATTAF  242

Query  888   SLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYK  1067
             SL  +KQIK+ ++ T+NDVI+GI+  GTRLYMQE  + +     T LVL NTRA    Y+
Sbjct  243   SLDQIKQIKTKVDATVNDVIAGIIFLGTRLYMQEMRQGSGEANSTTLVLLNTRAF-RSYE  301

Query  1068  SVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLY  1247
             SV +M+KP+A+ PWGN   FL  +IPKL    D  SSNPL F+  A +++  ++ S   Y
Sbjct  302   SVKDMVKPDAKSPWGNYFAFLHVSIPKL---ADDWSSNPLDFVVKARQIMNVKKNSLGAY  358

Query  1248  LTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGA  1427
             LTG+ LE  RK RG EA A+++  TLKN+S+T+TN+IGPVEK  L NHP KG+YF V+GA
Sbjct  359   LTGRLLEIVRKFRGPEAAARYIHSTLKNSSMTITNVIGPVEKMALNNHPCKGLYFVVTGA  418

Query  1428  PQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLT  1565
             PQSL VT++SY GKLR+ ++ E  FID  KLKS IE+AF+ +   T
Sbjct  419   PQSLSVTIVSYMGKLRIAVVGEDGFIDSHKLKSSIENAFEMMLNGT  464



>ref|XP_006447283.1| hypothetical protein CICLE_v10015126mg [Citrus clementina]
 gb|ESR60523.1| hypothetical protein CICLE_v10015126mg [Citrus clementina]
Length=471

 Score =   518 bits (1333),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 256/460 (56%), Positives = 330/460 (72%), Gaps = 12/460 (3%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             + P SP  QY+NSS LS S++ VLES +PI  DDS   S ++D+FLPINPRFSSIMV  +
Sbjct  9     MEPVSPSGQYLNSSALSLSVLGVLESEIPI--DDSQCFSLLKDIFLPINPRFSSIMVVDE  66

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             NGEK WK V+V L +H+KVPIFP G   E YD    +Y+++I M+ FPQ+QPLWE+HI +
Sbjct  67    NGEKQWKRVEVKLRNHVKVPIFPSGLSPEAYDKYFDDYISEIGMELFPQSQPLWEVHIIK  126

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFP--RRQGSGKKQGENS  707
             YPTS+A G  IFKLH SLGDG+SLMGALLSCLQRAD+P++PLTFP   R  S KK G NS
Sbjct  127   YPTSHAAGFLIFKLHHSLGDGFSLMGALLSCLQRADDPSVPLTFPSVNRFPSNKKDGNNS  186

Query  708   NAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTF  887
             N  +  +K        V +TV+DF W+F+KS+ L DD+T I+S DDG+EFRP+SV T  F
Sbjct  187   NIFSNMYKT----FCVVSETVSDFCWSFVKSAWLQDDRTPIYSGDDGIEFRPVSVATTAF  242

Query  888   SLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYK  1067
             SL  +KQIK+ ++ T+NDVI+GI+  GTRLYMQE  + +     T LVL NTRA    Y+
Sbjct  243   SLDQIKQIKTKVDATVNDVIAGIIFLGTRLYMQEMRQGSGEANSTTLVLLNTRAF-RSYE  301

Query  1068  SVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLY  1247
             SV +M+KP+A+ PWGN   FL  +IPKL    D  SSNPL F+  A +++  ++ S   Y
Sbjct  302   SVKDMVKPDAKSPWGNYFAFLHVSIPKL---ADDWSSNPLDFVVKARQIMNVKKNSLGAY  358

Query  1248  LTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGA  1427
             LTG+ LE  RK RG EA A+++  TLKN+S+T+TN+IGPVEK  L NHP KG+YF V+GA
Sbjct  359   LTGRLLEIVRKFRGPEAAARYIHSTLKNSSMTITNVIGPVEKMALNNHPCKGLYFVVTGA  418

Query  1428  PQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFD  1547
             PQSL VT++SY GKLR+ ++ E  FID  KLKS IE+AF+
Sbjct  419   PQSLSVTIVSYMGKLRIAVVGEDGFIDSHKLKSSIENAFE  458



>ref|XP_007043617.1| O-acyltransferase family protein [Theobroma cacao]
 gb|EOX99448.1| O-acyltransferase family protein [Theobroma cacao]
Length=476

 Score =   517 bits (1332),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 341/483 (71%), Gaps = 16/483 (3%)
 Frame = +3

Query  114   SSIQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSE  293
             S  Q K  M   L G++     P SP  QY NSS LS  ++ VL+S +PI  DDS  +  
Sbjct  3     SEAQYKNAMA--LNGEEGEYSEPVSPTGQYFNSSALSIGVLGVLDSEIPI--DDSPTMKL  58

Query  294   IRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLT  473
             + DVFLPINPRFSS+MV  +NG K WK V+V L DH+ VP+FP G   E YD  LS+YL+
Sbjct  59    LEDVFLPINPRFSSVMVQDENGAKQWKKVEVKLVDHVNVPVFPPGLSPESYDNYLSDYLS  118

Query  474   KISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPAL  653
             KI+ +  PQ +PLW IHI +Y TSNA G+ IFKLH +LGDGYSLMGALLSCLQRA+NP++
Sbjct  119   KIATEQLPQNRPLWNIHIVKYTTSNAAGSLIFKLHHALGDGYSLMGALLSCLQRAENPSV  178

Query  654   PLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIH  833
             PLTFP    S     ENSN+V R+       L    +T++DF W+ LKSS L+DD+T I 
Sbjct  179   PLTFPALS-SAPNLSENSNSVFRS-------LYSAFNTISDFGWSLLKSSFLEDDRTMIR  230

Query  834   SQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQ-ESERETCN  1010
             S D GV+F+P+ ++TMTFSL H+KQIK+ L VTIND I+GI+ +GTRLYMQ  S  +  N
Sbjct  231   SGDPGVQFKPVVISTMTFSLDHIKQIKTKLGVTINDAITGIIFFGTRLYMQGTSSDKLSN  290

Query  1011  GECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLR  1190
             G  TALVL NTR + GGYKSV +M+KP+A+ PWGN+  FL  ++P+L S    +S NPL 
Sbjct  291   GNSTALVLLNTRTI-GGYKSVKDMVKPDADSPWGNQFGFLHVSLPELAS--TAESCNPLE  347

Query  1191  FIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVE  1370
             FI+ A ++++R+R S +++ TGQ LE  RK RG EATA+++  TLKN+S+T++N+IGPVE
Sbjct  348   FIWKAQKLIQRKRNSKAVFFTGQLLEGLRKYRGPEATAKYIHSTLKNSSMTISNLIGPVE  407

Query  1371  KTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDE  1550
             +  LA+HPVK +YF V G PQSL +TM+SY GKL + I +EKDF+D +K KS +E+AF  
Sbjct  408   RMALADHPVKSLYFMVVGVPQSLTITMVSYMGKLTVAIGTEKDFVDPQKFKSSVENAFQM  467

Query  1551  IFR  1559
             + +
Sbjct  468   MLK  470



>ref|XP_011001806.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=458

 Score =   516 bits (1330),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 253/459 (55%), Positives = 334/459 (73%), Gaps = 11/459 (2%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E  L P SP +QY+NSS L+ S++ VLE+ VPI+D  ++ L  +RDVFLPINPRFSSIM
Sbjct  6     EEDALEPVSPSAQYLNSSALNVSVLVVLETEVPIDDSKTIPL--VRDVFLPINPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  +NGEK WK V+V LEDH+ VPIFP     +FYD    +YL+K+SM   PQ+QPLWEI
Sbjct  64    VIDENGEKRWKRVEVKLEDHVYVPIFPEEMSPQFYDEYFEDYLSKLSMLQLPQSQPLWEI  123

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             H+ +YPTSNA G  IFK+H ++GDGYSLMGALLSCLQRADNP+LPLT P  Q      G+
Sbjct  124   HLIKYPTSNAAGTVIFKIHHAIGDGYSLMGALLSCLQRADNPSLPLTLPSVQPRVDTSGD  183

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             +       FK VP++ S + +TV+DF  + LKSSL++DD + I S D G+EFRPI+ TTM
Sbjct  184   HRT----IFKTVPQIFSLLFNTVSDFLGSLLKSSLVEDDLSPIRSGDIGIEFRPIAPTTM  239

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGG  1058
             TFSL  +KQIK++L VTINDVI+G +  GTRLYMQE S+  + +  CTALV+ NTR M  
Sbjct  240   TFSLGQIKQIKATLGVTINDVITGAIFLGTRLYMQEMSKGSSDHSNCTALVMLNTR-MFR  298

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
              Y+S+ EM+KP AE PWGN   FL   +P+L +  +    NP+ F+  A ++ KR+R S 
Sbjct  299   SYQSIKEMVKPKAESPWGNHFAFLHVQLPELVASTE---LNPIEFVRKAQQITKRKRSSL  355

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
             ++YLT  F+EF +KL+G E  AQ++ +T+ N S+T+TNMIGPVEK +LANHP+KGMYFAV
Sbjct  356   AVYLTAAFVEFMKKLKGHEVAAQYIHKTMVNASMTITNMIGPVEKMSLANHPIKGMYFAV  415

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIE  1535
             +G PQ L +T++SY   LR+T+ +EK F+D +KLKSCIE
Sbjct  416   AGNPQRLNITIVSYVDNLRVTVGAEKGFLDAQKLKSCIE  454



>ref|XP_011037140.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=472

 Score =   515 bits (1326),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 247/469 (53%), Positives = 341/469 (73%), Gaps = 10/469 (2%)
 Frame = +3

Query  147   HLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPR  326
               + ++E V  P SP  QY NSSVLS  I+AVLES VPI  DDS  ++ ++DVFLPINPR
Sbjct  2     EFKKEEEEVTEPVSPTGQYFNSSVLSICILAVLESEVPI--DDSHTMTLLKDVFLPINPR  59

Query  327   FSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQ  506
             FSSIMV  KNG K WK V+V L++H+ +PIFP+G     YD   ++Y++++++  FPQ+Q
Sbjct  60    FSSIMVNDKNGVKQWKRVEVQLQNHVSIPIFPIGLSTTSYDSYFNDYISRLALKQFPQSQ  119

Query  507   PLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG  686
             PLWEIH+ +YPTS A GN IFKLH +LGDG+SLMGALLSCLQRADNP+L LTFP  Q   
Sbjct  120   PLWEIHVVKYPTSKAAGNIIFKLHHALGDGFSLMGALLSCLQRADNPSLSLTFPSLQFPS  179

Query  687   KKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPI  866
                     + ++    VP+ +S + +T++DF W+ LKSS ++D ++ I S D+ V+F+PI
Sbjct  180   YPDC----SFSKLNITVPKCISSIFNTISDFGWSLLKSSFVEDSRSPIRSGDEEVQFKPI  235

Query  867   SVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTR  1046
              ++T+ FSL H+KQIKS+L VTINDVI+GI+ YGTRLYMQ  + ++ N   TALVL NTR
Sbjct  236   VISTIAFSLDHIKQIKSTLGVTINDVITGIIFYGTRLYMQRVDDKSTNANSTALVLLNTR  295

Query  1047  AMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQ  1226
              +  GY+SV EM++P+AE PWGN+  FL  ++P+L    D   SNPL  +  A  +++R+
Sbjct  296   VI-SGYRSVKEMVEPDAESPWGNQFGFLHVSVPELT---DSRFSNPLECVTIAQEIIQRK  351

Query  1227  RYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGM  1406
             + S ++ LTG+ LE  RK RG EATA+ +++TL N+S+T++N+IGPV+K  LANHP+KG 
Sbjct  352   KSSLAVNLTGRLLEVLRKFRGPEATAKHIKKTLFNSSMTISNIIGPVDKMALANHPIKGF  411

Query  1407  YFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             YF V G PQSL +TM+SYAGKLR+ + +EK F+D +K KSC+E+AF+ I
Sbjct  412   YFMVVGVPQSLTITMVSYAGKLRVAVGTEKGFMDSQKFKSCLETAFEMI  460



>ref|XP_011001808.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Populus euphratica]
Length=472

 Score =   511 bits (1316),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/458 (54%), Positives = 335/458 (73%), Gaps = 10/458 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY NSSVLS  I+AVLES VPI  DDS  ++ ++DVFLPINPRFSSIMV  KNG
Sbjct  13    PVSPTGQYFNSSVLSICILAVLESEVPI--DDSHTMTLLKDVFLPINPRFSSIMVNDKNG  70

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K WK V+V L++H+ +PIFP+G     YD   ++Y++++++  FPQ+QPLWEIH+ +YP
Sbjct  71    VKQWKRVEVQLQNHVSIPIFPIGLSTTSYDSYFNDYISRLALKQFPQSQPLWEIHVVKYP  130

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TS A GN IFKLH +LGDG+SLMGALLSCLQRADNP+L LTFP  Q           + +
Sbjct  131   TSKAAGNIIFKLHHALGDGFSLMGALLSCLQRADNPSLSLTFPSLQFPSYPDC----SFS  186

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             +    VP+ +S + +T++DF W+ LKSS ++D ++ I S D+ V+F+PI ++T+ FSL H
Sbjct  187   KLNITVPKCISSIFNTISDFGWSLLKSSFVEDSRSPIRSGDEEVQFKPIVISTIAFSLDH  246

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +KQIKS+L VTINDVI+GI+ YGTRLYMQ  + ++ N   TALVL NTR +  GY+SV E
Sbjct  247   IKQIKSTLGVTINDVITGIIFYGTRLYMQRVDDKSTNANSTALVLLNTRVI-SGYRSVKE  305

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M +P+AE PWGN+  FL  ++P+L    D   SNPL  +  A  +++R+R S ++ LTG+
Sbjct  306   MFEPDAESPWGNQFGFLHVSVPELT---DSRFSNPLECVTIAQEIIQRKRSSLAVNLTGR  362

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              LE  RK RG EATA+ +++TL N+S+T++N+IGPV+K  LANHP+KG YF V G PQSL
Sbjct  363   LLEVLRKFRGPEATAKHIKKTLFNSSMTISNIIGPVDKMALANHPIKGFYFMVVGVPQSL  422

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
              +TM+SYAGKLR+ + +EK F+D +K KSC+E+AF+ I
Sbjct  423   TITMVSYAGKLRVAVGTEKGFMDSQKFKSCLETAFEMI  460



>gb|KDP24112.1| hypothetical protein JCGZ_25769 [Jatropha curcas]
Length=471

 Score =   509 bits (1310),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 250/480 (52%), Positives = 334/480 (70%), Gaps = 11/480 (2%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +E + EV+L P SP  QY+++SVLS  II+V+ES VPI  DDS  +S ++DVFLPINPRF
Sbjct  1     METEQEVILEPVSPTGQYLSNSVLSLCIISVVESQVPI--DDSQAMSLLKDVFLPINPRF  58

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SS+MV  K+GEK WK V+V L+DH+KVPIFP G   +FY  CL +YL+ ++M+  PQ QP
Sbjct  59    SSVMVMNKDGEKRWKKVEVQLKDHIKVPIFPTGMSTKFYSDCLDDYLSNLAMETLPQDQP  118

Query  510   LWEIHIFRYPTSN-AGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG  686
             LWEIHI +YPTS    GN IFKLH SLGDG+SLMGALLSCLQRAD+P++PLTFP  Q   
Sbjct  119   LWEIHILKYPTSTEVAGNVIFKLHHSLGDGFSLMGALLSCLQRADDPSIPLTFPSVQLHT  178

Query  687   KKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPI  866
               + +  +      K+  R+ S + +T++DF  + + SS L DD + I S   GVEF P+
Sbjct  179   NIESKKKSIC----KSWLRIFSSISNTISDFCSSVVISSFLKDDISPIRSGHPGVEFLPV  234

Query  867   SVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTR  1046
             S  TM+FSL  +KQI++ L VTINDVISG +  GTR+YM+   + +      ALVL NTR
Sbjct  235   SAVTMSFSLDQIKQIRTKLGVTINDVISGTIFLGTRMYMEAMSKGSGKARTPALVLLNTR  294

Query  1047  AMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQ  1226
              M GGYKS  EM KPN E+PWGN   FL   IPKL      +  +PL+F + A + ++R+
Sbjct  295   -MFGGYKSGQEMTKPNEELPWGNHFAFLSVTIPKLSG---SEPKDPLQFAWKARKTIQRK  350

Query  1227  RYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGM  1406
             R S ++YLT ++LE   K RG EA +++LR TLKN+S  +TN+IGP+E+  LANHP+KG 
Sbjct  351   RASFAVYLTAKYLELVNKFRGPEAVSKYLRNTLKNSSTGLTNLIGPMEQMALANHPIKGF  410

Query  1407  YFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSSPPR  1586
             YF V+ APQSL+  ++SY GKLR+  + EKDFID +K KSCIE+AF+ IF+   ++  P+
Sbjct  411   YFVVTNAPQSLMAGIVSYMGKLRVAALVEKDFIDQQKYKSCIENAFEMIFKAACEAPAPQ  470



>gb|EYU28206.1| hypothetical protein MIMGU_mgv1a021941mg [Erythranthe guttata]
Length=459

 Score =   506 bits (1304),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 251/471 (53%), Positives = 332/471 (70%), Gaps = 22/471 (5%)
 Frame = +3

Query  171   VLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTG  350
             +L P SP  QY  SS +S S+I VLE   PI  D S   + +  VFLPINPRFSS+MV  
Sbjct  5     ILEPVSPTGQYFTSSAISVSVIVVLELEFPI--DQSRFDTLLETVFLPINPRFSSLMVKD  62

Query  351   KNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
             KNG+K+WK V+V +++H+K P FP GK  EFY+ CLSEYL+KIS++  P+++ LWE HI 
Sbjct  63    KNGKKHWKKVEVDIQEHIKTPNFPRGKSSEFYEDCLSEYLSKISLEQLPESRALWEFHII  122

Query  531   RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE---  701
              YPT NA  N +FKLH SLGDGYSLM ALLSCLQRADNP LPLTFP       K  +   
Sbjct  123   NYPTRNAAQNLVFKLHHSLGDGYSLMRALLSCLQRADNPQLPLTFPSLNNKKPKTRKINI  182

Query  702   -NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHS-QDDGVEFRPISVT  875
               +N ++RAF           D+V DF W+ LKS +L+DDKT I S  DDGVEFRPIS+T
Sbjct  183   CENNILSRAF-----------DSVYDFGWSVLKSIVLEDDKTPIRSGDDDGVEFRPISIT  231

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
             TM FS+  +K++K+SL+VTINDVI G +  G RLY++ ++ +  N + TALVL NTR + 
Sbjct  232   TMVFSVDQIKKVKASLHVTINDVICGALFLGIRLYIKSTKHDQSNAKSTALVLLNTRNI-  290

Query  1056  GGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYS  1235
              GYKS+SEM++P+AE PWGN+  F+  ++PKL      +  +PL F+  AH+++KR+R S
Sbjct  291   NGYKSISEMVEPDAESPWGNQFAFIHVSVPKL---AFSNPIDPLSFVLKAHKVIKRKRNS  347

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFA  1415
             A+L LTG+ L+  RKLRG E TA+++ RTLKNTS+T++N+IGPVEK  L+N P+KGMYF 
Sbjct  348   AALILTGKLLDTLRKLRGPEVTAKYIHRTLKNTSMTISNIIGPVEKMALSNQPIKGMYFM  407

Query  1416  VSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTL  1568
             V G PQSL VTM+SY G+LR+ + +E D ID  K + C+++AFD IF+  L
Sbjct  408   VVGVPQSLTVTMVSYMGELRVALGTENDLIDAPKFRQCVQNAFDMIFKAAL  458



>ref|XP_009782425.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Nicotiana 
sylvestris]
Length=439

 Score =   504 bits (1299),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 242/385 (63%), Positives = 304/385 (79%), Gaps = 6/385 (2%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E +  PASP SQY+NSS LS  +IAVLES +PIE ++S+ L+ ++DVF+PINPRFSSIM
Sbjct  6     EEEIFEPASPSSQYLNSSNLSLCVIAVLESKIPIEYEESLPLNLLKDVFVPINPRFSSIM  65

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             VTGK G + WK V+V  EDH+K PIFP  KPL+FY+ C S Y++ ++M+ FPQ QPLWEI
Sbjct  66    VTGKKGTRKWKRVEVNYEDHIKTPIFPSEKPLDFYNECFSNYISNLAMEQFPQNQPLWEI  125

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HIF+YPT++A G+ IFKLH SLGDGYSLMGALLSCLQR DNP+LPLTFP RQ +     +
Sbjct  126   HIFKYPTNDAAGSVIFKLHHSLGDGYSLMGALLSCLQRVDNPSLPLTFPSRQRTTLSSKD  185

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              + +V    K VPR   G+V+TV DF  + LKS+L++DD+TAIHS D+GVEFRPI VTT 
Sbjct  186   KAFSV---LKVVPRFFKGIVNTVYDFGESILKSTLVEDDRTAIHSGDEGVEFRPIVVTTK  242

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             TFSL  LKQIK+SLNVTINDVI+GIV YGTRLYMQE ++E+CNG+CTALVLFNTRA+ GG
Sbjct  243   TFSLDCLKQIKASLNVTINDVITGIVEYGTRLYMQEVKQESCNGKCTALVLFNTRAL-GG  301

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSS--NPLRFIYNAHRMVKRQRYS  1235
             YKSV++MIKPN++MPWGN  TFLP ++PKL +  + D S  NPL F+  AHRM+ R+R S
Sbjct  302   YKSVNDMIKPNSDMPWGNHFTFLPVSLPKLTNLANRDQSSINPLAFVQKAHRMIDRKRNS  361

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQF  1310
             AS++LT + L+F RKLRG E T + 
Sbjct  362   ASVWLTSKLLDFLRKLRGPEVTGRL  386



>ref|XP_002274522.1| PREDICTED: O-acyltransferase WSD1 [Vitis vinifera]
Length=473

 Score =   506 bits (1303),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 245/468 (52%), Positives = 332/468 (71%), Gaps = 11/468 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY NSSVL  SI+++LES +PI  DDS  LS ++DVFLPINPRFSS+MV  K G
Sbjct  14    PVSPTGQYFNSSVLQVSIMSILESDIPI--DDSPTLSLLKDVFLPINPRFSSLMVEDKKG  71

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K+WK V+V LEDH+ VPIFP G   E YD    +YLTKI+M  FPQ++PLWEIHI +YP
Sbjct  72    VKHWKRVEVKLEDHVNVPIFPDGLSPESYDDYFDDYLTKIAMKEFPQSRPLWEIHIIKYP  131

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TSNA G  +FKLH +LGDG+SLMGALLSCLQRADNP LP+TFP       K   N ++  
Sbjct  132   TSNAAGTVVFKLHHALGDGFSLMGALLSCLQRADNPNLPITFP-----SFKVSSNLDSGR  186

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
                +AVPR LS   +TV+DF W  LKS+ ++DD+T I S D GVEFRP+S+ T++FSL +
Sbjct  187   SIIRAVPRALSAAFNTVSDFGWGLLKSTAVEDDRTPIRSGDPGVEFRPMSIATISFSLDN  246

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +++IK+ L VTINDV++GI+ +GTRLYMQ     + N   TALVL NTR +  GYKS+ E
Sbjct  247   IQKIKAKLGVTINDVLTGIIFFGTRLYMQSMNHASRNANSTALVLLNTRVI-SGYKSIKE  305

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M   ++   WGN+  FL   +P+L    D   ++PL F+  A + ++R+R S +++LTG+
Sbjct  306   MTASDSSSQWGNQFAFLHVTLPEL---ADAKFTSPLDFVAKAQQTIQRKRNSLAVHLTGR  362

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              LE  RK RG E TA+++  TLKN+S+T++NMIGP+E+  LANHP +G+YF V G+P+S+
Sbjct  363   LLETLRKYRGPEVTARYIHGTLKNSSMTISNMIGPMEQLALANHPCRGIYFMVLGSPESM  422

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSSPP  1583
              +++LSY GK+R+ + +EK FID +K  +CIE+AF  +F   + + PP
Sbjct  423   TISILSYMGKVRIAVGTEKGFIDPRKFNACIENAFQRVFEAAVGTPPP  470



>ref|XP_011001810.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=465

 Score =   505 bits (1300),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 250/467 (54%), Positives = 334/467 (72%), Gaps = 11/467 (2%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E  L PASP  QY NSS L+ SI++VLE+ VPI+D +++ L  +RDVFLPINPRFSSIM
Sbjct  6     EEDALEPASPTGQYFNSSALNVSILSVLETEVPIDDSNTIPL--LRDVFLPINPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  +NGEK WK V+V L+DH+ VPIFP     +FYD  L +YL+K+SM   PQ+QPLWEI
Sbjct  64    VIDENGEKKWKKVEVELKDHVSVPIFPEEMSPQFYDNYLEDYLSKLSMLQLPQSQPLWEI  123

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             H+ +YPTSNA G  IFK+H ++GDGYSLMGALLSCLQR DNP+LPLT P  Q      G+
Sbjct  124   HLIKYPTSNAAGTIIFKIHHAIGDGYSLMGALLSCLQRVDNPSLPLTLPSVQPRVDTFGD  183

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             +       FK VP++ S + DTV+DF  + +KSSL++DD + I S D G+EFRPI+  +M
Sbjct  184   HGT----IFKTVPKIFSLLFDTVSDFWESLMKSSLVEDDLSPIRSGDIGIEFRPIAHASM  239

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGG  1058
             TFSL  +KQIK++L VTINDVI+G +  GTRLYMQE S+  + +  CTALVL NTR M  
Sbjct  240   TFSLGQIKQIKATLGVTINDVITGAIFLGTRLYMQEMSKGSSDHSNCTALVLLNTR-MFR  298

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
              Y+S+ EM+KP AE PWGN   FL   +P+L +  +    NP+ F+  A +++KR+R S 
Sbjct  299   SYQSIKEMVKPKAESPWGNHFAFLHVQLPELVASTE---LNPIEFVRKAQQIIKRKRSSL  355

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
             ++YLT  F+E  +KL+G E  AQ++ +TL N+S+++TN+IGPVEK +LANHP+K MYF +
Sbjct  356   AVYLTAAFIEIVKKLKGHEVAAQYIYKTLLNSSMSITNIIGPVEKMSLANHPIKDMYFVL  415

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              G PQ L +T++SY   LR+ + + K FIDV+KLKS IE AF  I +
Sbjct  416   GGNPQGLTITIISYMDNLRVIVGAVKGFIDVQKLKSYIEEAFQMILK  462



>ref|XP_006468957.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
Length=481

 Score =   504 bits (1299),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 243/468 (52%), Positives = 329/468 (70%), Gaps = 12/468 (3%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E  DEVV  P SP  QY NSS+LS SI+AVLES VP +D  ++ L  ++D+FLPINPRFS
Sbjct  4     EKADEVVAEPVSPIGQYFNSSILSISILAVLESEVPFDDSRAIPL--LKDIFLPINPRFS  61

Query  333   SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
             SIMV  KNG K+WK V+V L++H+ VP FPVG   +FYD CL +YL+K+S +  PQ+QPL
Sbjct  62    SIMVVDKNGVKHWKSVEVKLKNHVYVPNFPVGMSQQFYDKCLQDYLSKLSAEQMPQSQPL  121

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK  692
             WE+HI +YPTSNA  + I KLH +LGDG+SLMGALLSCLQRAD+P+ PLTFP  +     
Sbjct  122   WEVHIVKYPTSNAASSVILKLHHALGDGFSLMGALLSCLQRADDPSRPLTFPSVRMRPDI  181

Query  693   QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
              G      +  FK VP+  + V +T +DF W+ +KSSL++DDKT I S      + PI++
Sbjct  182   NG------SSIFKNVPKFFNTVFNTASDFCWSMIKSSLIEDDKTPIRSGSAAAGWLPITI  235

Query  873   TTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAM  1052
             TTMTF L+ +KQIK +L  T+NDVI+G +  G RLYMQ   +E+ N   TA+VL NTR M
Sbjct  236   TTMTFPLHQIKQIKDNLGATLNDVITGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTR-M  294

Query  1053  GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
                  S+ EM+KP+++ PWGN   FL  ++P+L    + +  NPL+FI  A  +++ +R 
Sbjct  295   FKSISSIKEMVKPDSKAPWGNHFAFLHISVPQLT---NAEVQNPLKFIQKAQEIIQSKRS  351

Query  1233  SASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             S   YLT + LE  +KLRG E  A+F+  +L N+S+ +TNM+GPVEK  LANHP+KG+YF
Sbjct  352   SFGAYLTAKLLETVKKLRGHETAAKFIHGSLNNSSLAITNMMGPVEKMALANHPIKGLYF  411

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
              V+G+PQSLVVT+++Y G LR+++ +E+ FID  KLKSCIE+AF+ I 
Sbjct  412   MVAGSPQSLVVTIVTYMGNLRVSLGAEEGFIDSPKLKSCIENAFEMIL  459



>gb|EYU28207.1| hypothetical protein MIMGU_mgv1a006155mg [Erythranthe guttata]
Length=455

 Score =   503 bits (1294),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 245/466 (53%), Positives = 333/466 (71%), Gaps = 20/466 (4%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E +  P SP  QY  SSV+S S+IAVLE   PI+D  +  L E  +VFLPINPRFSS+M
Sbjct  2     EEEITEPVSPTGQYFTSSVISVSVIAVLEFEFPIDDSQTATLLE--NVFLPINPRFSSLM  59

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V GKNG+K+WK V+V +++H+K P FP GK  EFY+ CLSEYL+KIS++ F +++PLWEI
Sbjct  60    VKGKNGKKHWKKVEVNVKEHVKTPNFPRGKSPEFYEECLSEYLSKISLEQFQESRPLWEI  119

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI +YPT +  GN +FKLH SLGDGYSLMGALLSCLQRADNP LPLTFP      +    
Sbjct  120   HIIKYPTKSTAGNLVFKLHHSLGDGYSLMGALLSCLQRADNPQLPLTFPLLNQKIQTNDN  179

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              SN ++RAF           D+V DF W+ LKS +L+DDKT I S DDGVEFRPI+VTT+
Sbjct  180   KSNILSRAF-----------DSVYDFGWSVLKSLVLEDDKTPIRSGDDGVEFRPITVTTL  228

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
              FSL  +K++K+SL+V+INDVI G++  G  LY + ++    +   TALVL NTR +  G
Sbjct  229   NFSLDQIKKVKASLHVSINDVICGVLFLGIGLYAKSTK---VDQSSTALVLLNTRNI-NG  284

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YKS+SEM++P+AE PWGN+  FL  ++PKL      D  +PL F+ +A + + R+R SA+
Sbjct  285   YKSISEMVEPDAESPWGNQFAFLHVSVPKLVF---SDQIDPLSFVLDAQKEITRKRNSAA  341

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             + LTG+ LE   KLRG E TA+++ RTLKNTS+T++N++GP+EK  L+N P+KGMYF V 
Sbjct  342   VVLTGKLLEMLMKLRGPEVTAKYIHRTLKNTSMTISNIMGPLEKMALSNQPIKGMYFMVV  401

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             G PQ+L +TM+SY G+LR+ + +E   I+  K + C+++AFD I++
Sbjct  402   GVPQNLTITMVSYMGQLRVALGTENGLIEAPKFRECVQNAFDMIYK  447



>ref|XP_011047658.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=474

 Score =   503 bits (1296),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 247/477 (52%), Positives = 339/477 (71%), Gaps = 13/477 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             D+ +  P SP  Q++N+SVLS SIIAVLE   P   DDS+ +  + D+FLPINPRFSSIM
Sbjct  6     DQEISEPVSPSGQFLNNSVLSISIIAVLELEEPF--DDSLAIPLLNDIFLPINPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             VT K+G K WK V+V L+DH+ VP+F  G   +FYD CL +YL+K++M+ FPQ+QPLWE+
Sbjct  64    VTDKDGVKRWKKVEVRLKDHVSVPVFASGMSTQFYDECLDDYLSKMAMEQFPQSQPLWEV  123

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI +YPTS+A  N +FK H SLGDG SLMGALLSCL+RADNP+LPLTFP  Q    K G 
Sbjct  124   HIIKYPTSHAASNIVFKFHHSLGDGISLMGALLSCLKRADNPSLPLTFPSVQLHANKNGR  183

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             + +     F+ VPR LS V +T+++      KSSL +DDKT I S+  GVEF P+S+TTM
Sbjct  184   DLS----MFRKVPRFLSSVYNTLSEMCSTIAKSSLFEDDKTPIRSRHSGVEFLPVSITTM  239

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             TFSL H+KQIK+ L VT+NDVI+G +  G R+YM+   + + N   T+LVL NTR + GG
Sbjct  240   TFSLDHIKQIKARLGVTLNDVITGTIFLGIRIYMETVSQGSGNARSTSLVLLNTR-VHGG  298

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDS-SNPLRFIYNAHRMVKRQRYSA  1238
             Y+SV EM+KP AE+PWGN   FL   IPKL    D ++ +NPL+F+  A +++KR+R S 
Sbjct  299   YRSVQEMLKPGAELPWGNHFAFLNIPIPKLT---DAEARNNPLQFVLKARKVIKRRRSSF  355

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
              +YLT ++L+   K  G +  ++++  TL+NTS+ +TN++GPVE+  + N P+KG+YF V
Sbjct  356   GVYLTAKYLQLVGKFSGPKRASKYIHGTLENTSMGITNLMGPVEQLVVGNSPIKGLYFVV  415

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS--PP  1583
             +GAPQSL+  ++SYAGKLR+ ++ EK+FID +KL+S I+ AF  IF+    +S  PP
Sbjct  416   TGAPQSLMAGIVSYAGKLRVALLVEKNFIDPQKLRSHIDMAFGMIFKAACGTSTDPP  472



>ref|XP_006446857.1| hypothetical protein CICLE_v10015143mg [Citrus clementina]
 gb|ESR60097.1| hypothetical protein CICLE_v10015143mg [Citrus clementina]
Length=466

 Score =   502 bits (1293),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 243/468 (52%), Positives = 328/468 (70%), Gaps = 12/468 (3%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E  DEVV  P SP  QY NSS+LS SI+AVLE  VP   DDS  +  ++D+FLPINPRFS
Sbjct  4     EKADEVVAEPVSPIGQYFNSSILSISILAVLELEVPF--DDSWAIPLLKDIFLPINPRFS  61

Query  333   SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
             SIMV  KNG K+WK V+V L++H+ VP FPVG   +FYD CL +YL+K+S +  PQ+QPL
Sbjct  62    SIMVVEKNGVKHWKSVEVKLKNHVYVPNFPVGMSQQFYDKCLQDYLSKLSAEQMPQSQPL  121

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK  692
             WE+HI +YPTSNA  + IFKLH +LGDG+SLMGALLSCLQRAD+P+ PLTFP  +     
Sbjct  122   WEVHIVKYPTSNAASSVIFKLHHALGDGFSLMGALLSCLQRADDPSRPLTFPSVRMRPDI  181

Query  693   QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
              G      +  FK VP+  + V +T +DF W+ +KSSL++DDKT I S      + PI++
Sbjct  182   NG------SSIFKNVPKFFNTVFNTASDFCWSMIKSSLIEDDKTPIRSGSAAAGWLPITI  235

Query  873   TTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAM  1052
             TTMTF L+ +KQIK +L  T+NDV++G +  G RLYMQ   +E+ N   TA+VL NTR M
Sbjct  236   TTMTFPLHQIKQIKDNLGATLNDVVTGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTR-M  294

Query  1053  GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
                  S+ EM+KP ++ PWGN  +FL  ++P+L    + +  NPL+FI  A  +++ +R 
Sbjct  295   FKSISSIKEMVKPGSKAPWGNHFSFLHISVPQLT---NAEVQNPLKFIQKAQEIIQSKRG  351

Query  1233  SASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             S   YLT + LE  +KLRG E  A+F+  +L N+S+ +TNM+GPVEK  LANHP+KG+YF
Sbjct  352   SFGAYLTAKLLETVKKLRGHETAAKFIHGSLNNSSLAITNMMGPVEKMALANHPIKGLYF  411

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
              V+G+PQSLVVT+++Y G LR+++ +E+ FID  KLKSCIE+AF+ I 
Sbjct  412   MVAGSPQSLVVTIVTYMGNLRVSLGTEEGFIDSPKLKSCIENAFEMIL  459



>ref|XP_002323706.1| hypothetical protein POPTR_0017s04300g [Populus trichocarpa]
 gb|EEF03839.1| hypothetical protein POPTR_0017s04300g [Populus trichocarpa]
Length=473

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 246/477 (52%), Positives = 328/477 (69%), Gaps = 11/477 (2%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             D+ +  P SP  Q++++S+LS SIIAV+E   P   DDS  +  ++DVFLP+NPRFSSIM
Sbjct  6     DQEISEPVSPSGQFLSNSILSLSIIAVMEFEAPF--DDSQAIPFLKDVFLPVNPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  K+G K WK V+V L DH+  P+F  G   +FYD C  EYL+K +M+  PQ+QPLWE+
Sbjct  64    VVDKDGVKRWKRVEVRLTDHVNFPVFTTGMSTQFYDECFDEYLSKTAMEQLPQSQPLWEV  123

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI  YPTS+A  N IFKLH SLGDG+SLMGALLSCLQRAD P LPLTFP         G 
Sbjct  124   HIINYPTSHAASNMIFKLHHSLGDGFSLMGALLSCLQRADAPPLPLTFPSVHLHTNTYGR  183

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             NS+     F+ VPR  S V +T +DF  +F+KS L+ DDKT I S   GVEF P+++TTM
Sbjct  184   NSS----MFRKVPRFFSSVYNTASDFCSSFIKSCLVKDDKTPIRSGHSGVEFLPVAITTM  239

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
              FSL  +KQIK+ L VTIND I+GI+  G R+YM+   + + +   T+LVL NTR M GG
Sbjct  240   AFSLDQIKQIKAKLGVTINDAITGIIFLGARMYMETVSQGSGSACSTSLVLLNTR-MHGG  298

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGD-SSNPLRFIYNAHRMVKRQRYSA  1238
             YK + EM+KP+AE PWGN   FL   IPKLR   D +  +NPL+F+ NA +++KR+R S 
Sbjct  299   YKPIQEMVKPDAESPWGNHFAFLNVRIPKLR---DAEVKNNPLKFVLNARKIIKRKRSSF  355

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
              +YLT ++L+   K RG    ++++  T+KNTS+ ++N+ GP+E+  LAN+P+ G+YF V
Sbjct  356   GVYLTAKYLQLAAKFRGPNGASKYIYGTMKNTSMGISNVRGPMEQMALANNPINGLYFVV  415

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSSPPRA  1589
             +GAPQSL+  + SY GKLR++++ EKDFID +KLKS IE AFD IF    + S P A
Sbjct  416   TGAPQSLMAGVTSYVGKLRVSLLVEKDFIDPQKLKSHIEKAFDMIFEAACRESTPPA  472



>ref|XP_002310400.1| hypothetical protein POPTR_0007s00950g [Populus trichocarpa]
 gb|EEE90850.1| hypothetical protein POPTR_0007s00950g [Populus trichocarpa]
Length=474

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 245/476 (51%), Positives = 335/476 (70%), Gaps = 11/476 (2%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             D+    P SP  Q++N+SVLS SIIAVLE   P   DDS+ +  + D+FLPINPRFSSIM
Sbjct  6     DQETSEPVSPSGQFLNNSVLSISIIAVLELEEPF--DDSLAIPLLNDLFLPINPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             VT K+G K WK V+V L+DH+ VP+F  G   +FYD CL +YL+K++M+ FPQ+QPLWE+
Sbjct  64    VTDKDGVKRWKKVEVRLKDHVSVPVFASGMSTQFYDECLDDYLSKMAMEQFPQSQPLWEV  123

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI +YPTS+A  N +FK H SLGDG SLMGALLSCL+RADNP+LPLTFP  Q    K G 
Sbjct  124   HIIKYPTSHAASNIVFKFHHSLGDGISLMGALLSCLKRADNPSLPLTFPSVQLHANKNGR  183

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             + +     F+ VPR LS V +T+++      KSSL +DDKT I S+  GVEF P+S+TTM
Sbjct  184   DLS----MFRKVPRFLSSVYNTLSEMCSTIAKSSLFEDDKTPIRSRHSGVEFLPVSITTM  239

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
              FSL H+KQIK+ L VT+NDVI+G +  G R+YM+   + + N   T+LVL NTR +  G
Sbjct  240   AFSLDHIKQIKARLGVTLNDVITGTIFLGVRIYMETVSQGSGNARSTSLVLLNTR-VHRG  298

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             Y+SV EM+KP AE+PWGN   FL   IPKLR   +   +NPL+F+  A +++KR+R S  
Sbjct  299   YRSVQEMLKPGAELPWGNHFAFLNIPIPKLRD--EEARNNPLQFVLKARKVIKRRRSSFG  356

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             +YLT ++L+   K  G +  ++++  TL+NTSI +TN++GP+E+  + N P+KG+YF V+
Sbjct  357   VYLTAKYLQLVGKFSGPKRASKYIHGTLENTSIGITNLMGPIEQLAVGNSPIKGLYFVVT  416

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS--PP  1583
             G+PQSL+  ++SYAGKLR+ ++ EKDFID +KL+S I+ AF  IF+    +S  PP
Sbjct  417   GSPQSLMTGIVSYAGKLRVALLVEKDFIDPQKLRSHIDKAFGMIFKAACGTSTDPP  472



>ref|XP_003552517.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=467

 Score =   498 bits (1283),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 241/474 (51%), Positives = 336/474 (71%), Gaps = 11/474 (2%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +E   E    P SP  QY NSSVL   II VLE  VPI+D  +  L  ++DVFLPINPRF
Sbjct  1     MEHQKEEQAEPVSPVGQYFNSSVLCIYIIGVLEFEVPIDDLQTYAL--LKDVFLPINPRF  58

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIMV  K+GEK WK V V L+DH+K+P FP GK +E YD    +YL+ I+M+  PQ++P
Sbjct  59    SSIMVQDKDGEKRWKQVAVNLKDHVKIPTFPEGKTVETYDKYFQDYLSSIAMEQLPQSRP  118

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LW+IHI  + TS+A    IFKLH +LGDGYSLMGALLSCLQRADNP+LPL+FP       
Sbjct  119   LWDIHIINHRTSDASSTIIFKLHHALGDGYSLMGALLSCLQRADNPSLPLSFP-----SL  173

Query  690   KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPIS  869
             KQ +   +     + +  + S   +TV+DF W+ LKSS++ DDKT I   D+G +F+PIS
Sbjct  174   KQSKPEPSTKSFSRKISWMCSSAFNTVSDFGWSVLKSSIITDDKTPIRFGDEGADFQPIS  233

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRA  1049
             +++MTFS+ H+++IKS L VTINDV++GI+ YGTRLYMQ+ + ++   + TALVL NTR 
Sbjct  234   ISSMTFSIDHIREIKSRLEVTINDVVTGIIFYGTRLYMQDIDSKSKTAQSTALVLLNTRN  293

Query  1050  MGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
             +  GY+S+++M+   A+ PWGNRITFL   IPKL    +  +SNPL F++++H ++KR++
Sbjct  294   I-EGYQSINDMLNTKAKGPWGNRITFLHVPIPKL---NETRNSNPLEFVWDSHNIIKRKK  349

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
              S  + LTG  LE   KLRG EA A+ +R TL  +S  ++N++GP+++  LANHPVKG+Y
Sbjct  350   QSLGVVLTGTLLEIEGKLRGQEAVAKRIRGTLTKSSAVISNLVGPIQQMALANHPVKGLY  409

Query  1410  FAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             F ++G P+SLV++++SY G LR+T+ +EK FID  KLKSC++SAFD+I +  ++
Sbjct  410   FTLAGGPESLVISIMSYMGVLRVTLKTEKGFIDEHKLKSCMQSAFDKILQAAME  463



>ref|XP_007139590.1| hypothetical protein PHAVU_008G042500g [Phaseolus vulgaris]
 gb|ESW11584.1| hypothetical protein PHAVU_008G042500g [Phaseolus vulgaris]
Length=470

 Score =   497 bits (1279),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 246/474 (52%), Positives = 334/474 (70%), Gaps = 11/474 (2%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +E   E +  P SP  QY NSSVL   II VLE  VPI+D  +  L  +RDVFLPINPRF
Sbjct  1     MEHQKEELAEPVSPVGQYFNSSVLCIYIIGVLEFDVPIDDLQTYAL--LRDVFLPINPRF  58

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIMV  K GEK WK V V L+DH+ +PIFP GK +E +D    +YL+ ISM+  PQ++P
Sbjct  59    SSIMVQDKEGEKQWKQVDVNLKDHVNIPIFPEGKTVEVHDKYFHDYLSSISMEQLPQSRP  118

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LWEIH+  YPTS A    IFKLH +LGDGYSLMGALLSCL RADNP LPL+FP  + S  
Sbjct  119   LWEIHMINYPTSAACSTIIFKLHHALGDGYSLMGALLSCLHRADNPLLPLSFPSLKQSNP  178

Query  690   KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPIS  869
             +   ++ +++R F     +LS   +TV+DF W+ LKSS++ DDKT I   DDG +F+PIS
Sbjct  179   E--PSTKSLSRKFSW---MLSSAFNTVSDFGWSVLKSSIISDDKTPIRFGDDGADFQPIS  233

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRA  1049
             +++MTFS+ H+K IKS L VTINDVI+GIV YGTRLYMQ+ + ++ +   TALVL NTR 
Sbjct  234   ISSMTFSIDHIKDIKSRLGVTINDVITGIVFYGTRLYMQDMDSKSKSSHSTALVLLNTRN  293

Query  1050  MGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
             +  GY+S+++M+   A+ PWGN+ITFL   IPKL    +   S PL FI ++H ++KR++
Sbjct  294   I-EGYQSINDMLNTKAKGPWGNKITFLHVPIPKL---NETRISTPLEFIRDSHNIIKRKK  349

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
              S  + LTG  L+   KLRG EA A+ +R TL  +S  ++N++GPV++  L NHPVKG+Y
Sbjct  350   QSFGVVLTGTLLDMEGKLRGQEAVAKRIRGTLTKSSAVISNLVGPVQQMALVNHPVKGLY  409

Query  1410  FAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             F ++G P+SLV++++SY G +R+T+ +EKDFID +KL +CI+SAF+ I R  ++
Sbjct  410   FTLAGGPESLVISIMSYMGVIRVTLKTEKDFIDEQKLMACIQSAFEMILRAAME  463



>gb|EYU28205.1| hypothetical protein MIMGU_mgv1a006032mg [Erythranthe guttata]
Length=460

 Score =   496 bits (1276),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 248/468 (53%), Positives = 329/468 (70%), Gaps = 20/468 (4%)
 Frame = +3

Query  159   DDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI  338
             +DE+ L P SP  QY  SSV+S SIIAVLE   PI  D S + + ++ +FLPINPRFSS+
Sbjct  2     EDEI-LEPVSPTGQYFTSSVISVSIIAVLELEFPI--DQSRLDTLLQTLFLPINPRFSSL  58

Query  339   MVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWE  518
             MV  KNG+K WK V+V +++H+K+P FP GK  EFY+ CLS YL+KIS++ F +++ LWE
Sbjct  59    MVKDKNGKKYWKKVEVDIQEHIKIPNFPRGKSPEFYEDCLSRYLSKISLEQFLESRALWE  118

Query  519   IHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQG  698
              HI  YPT NA  N +FKLH SLGDGYSLMGALLSCLQRADNP LPLTFP      +   
Sbjct  119   FHIINYPTKNAAQNLVFKLHHSLGDGYSLMGALLSCLQRADNPQLPLTFPLLNQKIQTND  178

Query  699   ENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTT  878
               +N ++RAF           D+V DF W+ LKS +L+DD+TAI S DDGVEFRPI++TT
Sbjct  179   NKNNILSRAF-----------DSVYDFGWSVLKSIVLEDDQTAIRSGDDGVEFRPITITT  227

Query  879   MTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQ--ESERETCNGECTALVLFNTRAM  1052
             M FS   +K++K+SL+VTINDVI G +  G RLY++  E E +  N + TALVL NTR +
Sbjct  228   MVFSFDMIKKVKASLHVTINDVICGALFLGIRLYIKSTEHEHDQSNAKTTALVLLNTRNI  287

Query  1053  GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
               GYKS+SEM+KP+ E  WGN+  FL   +PKL      D  +PL F+ +A +++K++R 
Sbjct  288   -NGYKSISEMVKPDGESLWGNQFAFLHVPVPKL---AISDPIDPLSFVLDAQKVIKKKRN  343

Query  1233  SASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             SA++ LT + LE  RKLRG E TA+++ +TLKNTS+T++NMIGP+E+  L+N P+KGMY 
Sbjct  344   SAAVILTSKLLETLRKLRGPEVTAEYIHKTLKNTSMTISNMIGPMERMALSNQPIKGMYV  403

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
                G PQSL VT+LSY G+LR+ + +E D ID  K + C++ AFD IF
Sbjct  404   MNVGVPQSLTVTILSYMGQLRIALGTENDLIDAPKFRQCVQDAFDMIF  451



>ref|XP_010272425.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=468

 Score =   493 bits (1270),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 243/460 (53%), Positives = 327/460 (71%), Gaps = 14/460 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P +P  Q+ NSSVLS  I+A LE  +PI+D  ++ L  I+D+FLPINPRFSSIMV   NG
Sbjct  17    PVTPTGQFFNSSVLSVCILAALEIEIPIDDSPTITL--IKDMFLPINPRFSSIMVRDDNG  74

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K WK V+V  EDH+++P FP G   E YD  L +YL KI+M+  PQT+PLWEIH+ +YP
Sbjct  75    VKQWKRVEVKPEDHVRIPAFPDGLSPETYDGYLQDYLEKIAMERLPQTRPLWEIHLIKYP  134

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             T NA G  +FKLH +LGDG+SLMGAL SCL+RAD+P+LPLTFP    S  K+G +S    
Sbjct  135   TRNAAGTLVFKLHHALGDGFSLMGALFSCLKRADDPSLPLTFP---SSRFKKGSHS----  187

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
                K VPRL S   +T++DFSW+ LKSSL++DD+T I S + GVEFRP++++T+T SL  
Sbjct  188   -ILKKVPRLFSIFFNTISDFSWSLLKSSLVEDDRTTIRSGEIGVEFRPVTISTVTLSLDR  246

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             + QIK+++  TINDVISGIV YGTRLYM  S   +   + TALVL NTR +   Y+S+ E
Sbjct  247   ISQIKANIGGTINDVISGIVFYGTRLYMHASSPGSSKLQSTALVLLNTRII-NNYQSIQE  305

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M KP A+ PWGN+  FL  ++P+     D D++NPL F++ A + +KR+R S ++YLTG+
Sbjct  306   MTKPGAKSPWGNQFGFLHVSVPE---SIDADTANPLDFVFKAKKTIKRKRSSLAVYLTGK  362

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              LE  RK RG E TA+++  TLKN+S+T++N+IGP EK  LA+HP  G+YF V G PQSL
Sbjct  363   LLEMMRKFRGPEITARYIYSTLKNSSMTVSNLIGPTEKMALADHPSCGIYFMVVGVPQSL  422

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              +T++SY GKLR+ +  EK FID +K   CIE+AF+ I++
Sbjct  423   TITVMSYMGKLRVAVGVEKGFIDSQKFNLCIENAFERIYK  462



>ref|XP_007139588.1| hypothetical protein PHAVU_008G042300g [Phaseolus vulgaris]
 gb|ESW11582.1| hypothetical protein PHAVU_008G042300g [Phaseolus vulgaris]
Length=465

 Score =   492 bits (1267),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 239/466 (51%), Positives = 332/466 (71%), Gaps = 11/466 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY NSS L   II VLE  VPI D  +  L  I+DVFLPINPRFSSIMV  K+G
Sbjct  11    PVSPMGQYFNSSALCIYIIGVLEFEVPIHDLQTFTL--IKDVFLPINPRFSSIMVQDKDG  68

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             EK WK V+V L+DH+  P FP GK +E YD    +YL+ I+M+  PQ++PLWEIH+  YP
Sbjct  69    EKRWKQVEVNLKDHVHFPKFPKGKTVESYDKFFHDYLSSIAMEQLPQSRPLWEIHVISYP  128

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             + +A G+ IFKLH +LGDGYSL+GALLSCLQRAD+P+LPL+FP  +    K   ++ +  
Sbjct  129   SKDASGSIIFKLHHALGDGYSLVGALLSCLQRADDPSLPLSFPTLR--SLKPQSSTKSFW  186

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             R F     + S  ++T TDF W+ LKSS++ DDKT I S D+G EFRPIS++TM FS+ H
Sbjct  187   RRFSW---MFSSAINTATDFGWSVLKSSIISDDKTPIRSGDEGTEFRPISISTMNFSIDH  243

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +K IKS L VTINDVI+GIV YGTRLYMQ+ + ++   + TALVL NTR +  GY+++++
Sbjct  244   IKIIKSRLGVTINDVITGIVFYGTRLYMQDVDLKSKTADSTALVLLNTRNI-EGYQTIND  302

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M+   A+ PWGN+I+FL   IPKL        SNPL FI+++H ++KR++ S ++ LTG 
Sbjct  303   MLNSKAKGPWGNKISFLHVPIPKL---NQNRMSNPLDFIWDSHNIIKRKKQSLAVALTGT  359

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              L+   K +G EA A+ LR T+ N+S  +++++GP+++ +LANHPVKG+YF ++G P+SL
Sbjct  360   LLDMESKFKGQEAVAKHLRGTVTNSSAVISSLVGPIQQMSLANHPVKGLYFTLAGGPESL  419

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
              ++++SY G LR+T+ +EKDFID +KLKSCI++AF  I +   ++S
Sbjct  420   AISIMSYVGVLRITLKTEKDFIDEEKLKSCIQNAFHTILKAATENS  465



>ref|XP_010689024.1| PREDICTED: O-acyltransferase WSD1-like [Beta vulgaris subsp. 
vulgaris]
Length=474

 Score =   490 bits (1261),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 244/487 (50%), Positives = 329/487 (68%), Gaps = 15/487 (3%)
 Frame = +3

Query  114   SSIQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSE  293
             S +Q+KT  +     D++    P SP  QY NS  +S  ++ +LES + I  D S  +  
Sbjct  3     SKLQIKTEYK-----DEDTEDEPVSPTGQYFNSKTMSVRVLGILESEISI--DTSCAVPL  55

Query  294   IRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLT  473
             ++++FLPINPRFSSIMV+ K G K WK V+V L DH+ +P FP G   E YD    EYLT
Sbjct  56    LQELFLPINPRFSSIMVSDKKGVKKWKRVEVNLPDHVNIPNFPEGLSPEAYDDYFDEYLT  115

Query  474   KISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPAL  653
             +I+M P P  +PLW+IH+  YPTS A G+ IFKLH +LGDG+SLMGALLSC+QRADNP++
Sbjct  116   EIAMKPLPSDRPLWDIHLITYPTSKAAGHLIFKLHHALGDGFSLMGALLSCMQRADNPSM  175

Query  654   PLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIH  833
             PLTFP  Q + K   +  + V      +P+ LS   +T  DF W+FLKSSL+ DDKT I 
Sbjct  176   PLTFPTLQPTSKTNSKPVDDVG----CLPKTLSVTYNTTCDFGWSFLKSSLIVDDKTPIR  231

Query  834   SQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNG  1013
             S  DGVEF P+ ++T+  SL  +KQIK+++  TINDV++GI+ +GTRLYMQ + R+ CN 
Sbjct  232   SGGDGVEFHPVQISTIALSLDQIKQIKTNIGATINDVLTGIIFFGTRLYMQATGRDFCNS  291

Query  1014  ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRF  1193
             E TALVL NTR +  GYKS+ EM+K ++E  WGN+  F+  A+P L    D  SSNPL F
Sbjct  292   ESTALVLLNTRNI-DGYKSIQEMVKNDSETKWGNQFAFMHVALPALI---DNKSSNPLEF  347

Query  1194  IYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEK  1373
             I  A  ++KR++ S  +YLTGQ LE  RK RG E  AQF+  TL+ +++T+++MIGPVEK
Sbjct  348   ISEAKEIIKRKKNSLGVYLTGQSLELIRKCRGPEVAAQFIHSTLQKSTMTVSSMIGPVEK  407

Query  1374  TTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
               LANH  KG+YF V G PQSL +T+LSY   +R+ I  EK +ID +K KSCIE+AF  I
Sbjct  408   MALANHECKGLYFMVVGVPQSLTITVLSYMRTIRIAIGVEKGYIDEQKFKSCIENAFQLI  467

Query  1554  FRLTLKS  1574
             ++  +K+
Sbjct  468   YKAAVKN  474



>ref|XP_003534457.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=471

 Score =   487 bits (1253),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 240/474 (51%), Positives = 331/474 (70%), Gaps = 10/474 (2%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +E   E  L P SP  QY NSSVL   II VLE  VPI+D  +  L  ++DVFLPINPRF
Sbjct  1     MEHQKEEQLEPVSPVGQYFNSSVLCIYIIGVLEFEVPIDDLQTYAL--LKDVFLPINPRF  58

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIMV  K+GEK WK V V L DH+ +P FP GK  E YD    +YL+ I+M+  PQ++P
Sbjct  59    SSIMVQDKDGEKRWKQVDVNLTDHVNIPTFPEGKTAESYDKYFHDYLSSIAMEQLPQSRP  118

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LW+IHI  Y TS+A    IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP  + S K
Sbjct  119   LWDIHIINYLTSDASSTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSLKQS-K  177

Query  690   KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPIS  869
             ++  ++ +  R F     + S   +TV+DF W+ LKSS++ DDKT I   D+G +++PIS
Sbjct  178   QEPSSTKSFCRKFSW---MCSSAFNTVSDFGWSVLKSSIISDDKTPIRFGDEGADYQPIS  234

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRA  1049
             +++MTFS+ H++ IKS L VTINDV++GIV YGTRLYMQ+ + ++     TALVL NTR 
Sbjct  235   ISSMTFSIDHIRDIKSRLGVTINDVVTGIVFYGTRLYMQDMDSKSKTAHSTALVLLNTRN  294

Query  1050  MGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
             +  GY+S+++M+   A  PWGNRITFL   IPKL    +  ++NPL FI++ H ++KR++
Sbjct  295   V-EGYQSINDMLNTKATGPWGNRITFLHVPIPKL---NETRTTNPLEFIWDTHNIIKRKK  350

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
              S  + LTG  L+   KLRG EA A+ +R TL  +S  ++N+ GP+++  LANHPVKG+Y
Sbjct  351   QSLGVVLTGTLLKIEGKLRGQEAVAKRIRGTLTKSSAVISNLAGPIQQMALANHPVKGLY  410

Query  1410  FAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             F ++G P+SLV++++SY G L +T+ +EKDFID  KLK C++SAF+ I +  ++
Sbjct  411   FTLAGGPESLVISVMSYMGVLSVTLKTEKDFIDEHKLKLCMQSAFEIILQAAME  464



>ref|XP_008227240.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=468

 Score =   486 bits (1250),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 249/476 (52%), Positives = 329/476 (69%), Gaps = 21/476 (4%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
             ME   EG+ E    P SP  QY NSS+LS +I+AVLE  +PI  +DS  LS ++DVFLPI
Sbjct  1     MEFREEGEVE----PVSPTGQYFNSSILSVAILAVLEFELPI--NDSQALSLLQDVFLPI  54

Query  318   NPRFSSIMVTGK-NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPF  494
             NPRFSSIMV+   + +K WK V+V LEDH+ VPIFP     + YD    +Y++ I+ +  
Sbjct  55    NPRFSSIMVSDNVDQKKQWKRVEVKLEDHVHVPIFPSKMSPQSYDEYFDDYISNIAAERL  114

Query  495   PQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRR  674
             PQ +PLWEIHI +YPTS+A G  IFKLH +LGDGYSLMGALLSCLQ A NP++PLTFP  
Sbjct  115   PQNRPLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQNAQNPSVPLTFPSL  174

Query  675   QGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVE  854
             + SG K    +  V++ F       S V  TV+DFSW+ LKS+ ++DD+T I S +DGVE
Sbjct  175   KSSGPKTTHKTKTVSQFF-------SSVFQTVSDFSWSILKSNFVEDDRTPIRSGEDGVE  227

Query  855   FRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVL  1034
             FRPI+++T+TFS+  +K IK+ L VTINDVI+GI+  GTR+YMQE  +++ N  CTALVL
Sbjct  228   FRPITLSTLTFSIDEIKLIKNKLGVTINDVIAGIIFLGTRIYMQEVTQKSSNERCTALVL  287

Query  1035  FNTRAMGGGYKSVSEMIKP-NAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHR  1211
               TR +  GY S+ EMI+P NA+M WGN+  FL   +PK       ++SNPL F++ A +
Sbjct  288   LRTRNI-EGYTSIKEMIEPNNAKMSWGNQFAFLHLPVPK-----STETSNPLDFVWEAQK  341

Query  1212  MVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANH  1391
             M+K++R SA+ YLT   L+  +K RG E  A+++  TLKN+SIT++NMIGPVEK  L N 
Sbjct  342   MIKKKRSSAASYLTSWLLDVLKKFRGPEVAARYIHGTLKNSSITVSNMIGPVEKMALDNQ  401

Query  1392  PVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             PV G+YF   GAPQ L VT LSY GKLR+   +EK FID +KLK+ +++AF  I  
Sbjct  402   PVGGLYFMAVGAPQCLTVTALSYMGKLRVAFGAEKGFIDSQKLKASMQNAFGVILE  457



>gb|KHN11595.1| O-acyltransferase WSD1 [Glycine soja]
Length=471

 Score =   485 bits (1249),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 239/474 (50%), Positives = 331/474 (70%), Gaps = 10/474 (2%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +E   E  L P SP  QY NSS+L   II VLE  VPI+D  +  L  ++DVFLPINPRF
Sbjct  1     MEHQKEEQLEPVSPVGQYFNSSMLCIYIIGVLEFEVPIDDLQTYAL--LKDVFLPINPRF  58

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIMV  K+GEK WK V V L DH+ +P FP GK  E YD    +YL+ I+M+  PQ++P
Sbjct  59    SSIMVQDKDGEKRWKQVDVNLTDHVNIPTFPEGKTAESYDKYFHDYLSSIAMEQLPQSRP  118

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LW+IHI  Y TS+A    IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP  + S K
Sbjct  119   LWDIHIINYLTSDASSTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSLKQS-K  177

Query  690   KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPIS  869
             ++  ++ +  R F     + S   +TV+DF W+ LKSS++ DDKT I   D+G +++PIS
Sbjct  178   QEPSSTKSFCRKFSW---MCSSAFNTVSDFGWSVLKSSIISDDKTPIRFGDEGADYQPIS  234

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRA  1049
             +++MTFS+ H++ IKS L VTINDV++GIV YGTRLYMQ+ + ++     TALVL NTR 
Sbjct  235   ISSMTFSIDHIRAIKSRLGVTINDVVTGIVFYGTRLYMQDMDSKSKTAHSTALVLLNTRN  294

Query  1050  MGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
             +  GY+S+++M+   A  PWGNRITFL   IPKL    +  ++NPL FI++ H ++KR++
Sbjct  295   V-EGYQSINDMLNTKATGPWGNRITFLHVPIPKL---NETRTTNPLEFIWDTHNIIKRKK  350

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
              S  + LTG  L+   KLRG EA A+ +R TL  +S  ++N+ GP+++  LANHPVKG+Y
Sbjct  351   QSLGVVLTGTLLKIEGKLRGQEAVAKRIRGTLTKSSAVISNLAGPIQQMALANHPVKGLY  410

Query  1410  FAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             F ++G P+SLV++++SY G L +T+ +EKDFID  KLK C++SAF+ I +  ++
Sbjct  411   FTLAGGPESLVISVMSYMGVLSVTLKTEKDFIDEHKLKLCMQSAFEIILQAAME  464



>ref|XP_003621165.1| O-acyltransferase WSD1 [Medicago truncatula]
 gb|AES77383.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=471

 Score =   483 bits (1243),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 240/471 (51%), Positives = 332/471 (70%), Gaps = 12/471 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E +  P SP  QY NSS L   IIAVLE  V I+D  +  L  +RDVFLPI+PRFSSIM
Sbjct  6     EEQLQEPVSPIGQYFNSSSLCLYIIAVLEFEVSIDDLQAFTL--LRDVFLPISPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  KN +K WK V V L+DH+K PIF  GK +EFYD    +YL+ I+++P PQ +PLWE+
Sbjct  64    VQDKNEDKRWKQVDVNLKDHVKKPIFSKGKKVEFYDKSFQDYLSTIAIEPLPQGKPLWEV  123

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI  YPT N+ G  IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP  + S  K   
Sbjct  124   HIVNYPTKNSLGTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSLKPS--KLEP  181

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              + +  R F      +S V +T +DF W+ LKSS++ DDKT I S D+G +F+PIS++ +
Sbjct  182   YNKSFWRKFSWT---MSSVFNTASDFGWSVLKSSIIVDDKTPIRSGDEGADFQPISISNI  238

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
              FS+ H+K IKS L VT+NDV++GIV YGTRLYMQE + ++     TALVL NTR +  G
Sbjct  239   AFSIDHIKDIKSKLGVTMNDVVTGIVFYGTRLYMQEMDSKSKTSNSTALVLLNTRNV-EG  297

Query  1062  YKSVSEMIK-PNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
             Y+S+ +M+    ++ PWGN+++FL   IPKL    +   SNPL FIY+ H ++ R++ S 
Sbjct  298   YQSIDDMLNTKKSKGPWGNKLSFLHVPIPKL---NENRISNPLEFIYDTHNIINRKKQSL  354

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
             ++ LTG  L+   KLRG EA AQ +RRT+  +S  +TN++GPV++ +LANHPVKG+YF +
Sbjct  355   AVALTGTLLDIEGKLRGQEAVAQHIRRTITMSSTVVTNLVGPVQQMSLANHPVKGLYFTL  414

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             +G P+SLV++++SY G LR+T  +EK FID ++L+SC++SAF+ I++  +K
Sbjct  415   AGGPESLVISIMSYMGVLRVTFKTEKGFIDEQRLESCMQSAFEMIYQSAMK  465



>ref|XP_003551727.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
 gb|KHN13629.1| O-acyltransferase WSD1 [Glycine soja]
Length=465

 Score =   482 bits (1240),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 238/460 (52%), Positives = 324/460 (70%), Gaps = 11/460 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY NSSVL   II VLE  VPI D  +  L  I+DVFLPINPRFSS+MV  K+G
Sbjct  11    PVSPMGQYFNSSVLCIYIIGVLEFEVPIHDLQTFAL--IKDVFLPINPRFSSVMVQDKDG  68

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             EK WK V V L++H+  P FP GK +E YD    +YL+ ++M+  PQ++PLW IHI  YP
Sbjct  69    EKRWKQVDVNLKEHVHFPKFPKGKTVESYDKFFHDYLSSMAMEQLPQSKPLWSIHIINYP  128

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             T++A  + IFKLH +LGDGYSL+GALLSCLQRAD+P+LPL+FP  + S K Q    N   
Sbjct  129   TNDASSSIIFKLHHALGDGYSLVGALLSCLQRADDPSLPLSFPSLRPS-KPQSSTENFWR  187

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             R       + S   +TV+DF W+ LKSS++ DD+T I S D+G EFRPI +++M FS+ H
Sbjct  188   R----FSWMCSSAFNTVSDFGWSVLKSSIISDDETPIRSGDEGTEFRPICISSMDFSIDH  243

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +K IKS L VTINDVI+GIV YGTRLYMQ+ + ++   + TALVL NTR +  GY+S++E
Sbjct  244   IKDIKSRLGVTINDVITGIVFYGTRLYMQDMDSKSKTADSTALVLLNTRNI-EGYQSINE  302

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M+   A+ PWGN+I+FL   IPKL        SNPL FI+++H ++KR++ S ++ LTG 
Sbjct  303   MLNNKAKGPWGNKISFLHVPIPKL---NQNKMSNPLDFIWDSHNIIKRKKQSLAVALTGI  359

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              L+   K RG EA A+ LR T+  +S  +++++GP+++ +LANHPVKG+YF ++G P+SL
Sbjct  360   LLDTESKFRGQEAVAKHLRGTVTKSSAVISSLVGPMQQMSLANHPVKGLYFTLAGGPESL  419

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              ++++SY G LR+T+ +EKDFID +KLKSCI+SAF  I  
Sbjct  420   AISIMSYVGVLRVTLKTEKDFIDEEKLKSCIQSAFQMILE  459



>emb|CBI21867.3| unnamed protein product [Vitis vinifera]
Length=494

 Score =   483 bits (1242),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 233/450 (52%), Positives = 320/450 (71%), Gaps = 11/450 (2%)
 Frame = +3

Query  234   IAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVP  413
             +++LES +PI  DDS  LS ++DVFLPINPRFSS+MV  K G K+WK V+V LEDH+ VP
Sbjct  1     MSILESDIPI--DDSPTLSLLKDVFLPINPRFSSLMVEDKKGVKHWKRVEVKLEDHVNVP  58

Query  414   IFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGD  593
             IFP G   E YD    +YLTKI+M  FPQ++PLWEIHI +YPTSNA G  +FKLH +LGD
Sbjct  59    IFPDGLSPESYDDYFDDYLTKIAMKEFPQSRPLWEIHIIKYPTSNAAGTVVFKLHHALGD  118

Query  594   GYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVT  773
             G+SLMGALLSCLQRADNP LP+TFP       K   N ++     +AVPR LS   +TV+
Sbjct  119   GFSLMGALLSCLQRADNPNLPITFP-----SFKVSSNLDSGRSIIRAVPRALSAAFNTVS  173

Query  774   DFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISG  953
             DF W  LKS+ ++DD+T I S D GVEFRP+S+ T++FSL ++++IK+ L VTINDV++G
Sbjct  174   DFGWGLLKSTAVEDDRTPIRSGDPGVEFRPMSIATISFSLDNIQKIKAKLGVTINDVLTG  233

Query  954   IVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLP  1133
             I+ +GTRLYMQ     + N   TALVL NTR +  GYKS+ EM   ++   WGN+  FL 
Sbjct  234   IIFFGTRLYMQSMNHASRNANSTALVLLNTRVI-SGYKSIKEMTASDSSSQWGNQFAFLH  292

Query  1134  FAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFL  1313
               +P+L    D   ++PL F+  A + ++R+R S +++LTG+ LE  RK RG E TA+++
Sbjct  293   VTLPEL---ADAKFTSPLDFVAKAQQTIQRKRNSLAVHLTGRLLETLRKYRGPEVTARYI  349

Query  1314  RRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISE  1493
               TLKN+S+T++NMIGP+E+  LANHP +G+YF V G+P+S+ +++LSY GK+R+ + +E
Sbjct  350   HGTLKNSSMTISNMIGPMEQLALANHPCRGIYFMVLGSPESMTISILSYMGKVRIAVGTE  409

Query  1494  KDFIDVKKLKSCIESAFDEIFRLTLKSSPP  1583
             K FID +K  +CIE+AF  +F   + + PP
Sbjct  410   KGFIDPRKFNACIENAFQRVFEAAVGTPPP  439



>ref|XP_007214098.1| hypothetical protein PRUPE_ppa015879mg [Prunus persica]
 gb|EMJ15297.1| hypothetical protein PRUPE_ppa015879mg [Prunus persica]
Length=468

 Score =   481 bits (1237),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 247/486 (51%), Positives = 333/486 (69%), Gaps = 21/486 (4%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
             ME   EG+ E    P SP  QY NSS+LS +I+AVLE  +PI  +DS  LS ++DVFLPI
Sbjct  1     MEFREEGEVE----PVSPTGQYFNSSILSVAILAVLEFELPI--NDSQALSLLQDVFLPI  54

Query  318   NPRFSSIMVTGK-NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPF  494
             NPRFSSIMV+   + +K WK V+V LEDH+ VPIFP     E YD    +Y++ I+ + F
Sbjct  55    NPRFSSIMVSDNVDQKKQWKRVEVKLEDHVHVPIFPSKMSPESYDEYFDDYISNIAAEKF  114

Query  495   PQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRR  674
             PQ +PLWEIHI +YPTS+A G  IFKLH +LGDGYSLMGALLSCLQ A NP++PLTFP  
Sbjct  115   PQNRPLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQSAQNPSVPLTFPSL  174

Query  675   QGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVE  854
             + SG +    +  V++ F       S V  TV+DFSW+ LKS+ ++DD+T I S +DGVE
Sbjct  175   KSSGPQTTHKTKIVSQFF-------SSVFQTVSDFSWSILKSNFVEDDRTPIRSGEDGVE  227

Query  855   FRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVL  1034
             FRPI+++T+TFS+  +K IK+ L VT NDVISGI+  GTR+YMQE  +++ N  CTALVL
Sbjct  228   FRPITLSTLTFSIDEIKLIKNKLGVTTNDVISGIIFLGTRIYMQEVTQKSSNERCTALVL  287

Query  1035  FNTRAMGGGYKSVSEMIKPNA-EMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHR  1211
              NTR +  GY  + EMI+PN  EM WGN+  FL  ++PK       + SNPL F++ A +
Sbjct  288   LNTRNI-EGYMPIKEMIEPNHDEMSWGNQFGFLHVSVPK-----STEISNPLDFVWEAQK  341

Query  1212  MVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANH  1391
             ++K++R SA+ YLT   L+  +K RG E  A+++  TLKN+S+T++NMIGPVE+  LAN 
Sbjct  342   IIKKKRSSAAGYLTSWLLDVLKKFRGPEGAARYIHGTLKNSSMTISNMIGPVEQMALANQ  401

Query  1392  PVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             P+ G Y+ V G PQ L +T LSY GKLR+   +EK FID  KLK+ +++AF  I + + +
Sbjct  402   PICGFYYMVVGPPQCLTITALSYMGKLRVAFGAEKGFIDSHKLKASMQNAFGVILKASYQ  461

Query  1572  SSPPRA  1589
               P +A
Sbjct  462   IPPAKA  467



>ref|XP_008229085.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=463

 Score =   480 bits (1235),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 240/471 (51%), Positives = 324/471 (69%), Gaps = 22/471 (5%)
 Frame = +3

Query  147   HLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPR  326
             +LEG     L P SP  QY +S V++ S++AVLE  +PI D +S  +S +++VFLPI+PR
Sbjct  5     NLEG-----LEPVSPNGQYFSSDVITLSVLAVLEFEIPI-DIESQTMSLLKNVFLPISPR  58

Query  327   FSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQ  506
             FSSIMV   +G+K WK V+V LEDH+ +P FP     E YD  L EY++K+S + +PQ +
Sbjct  59    FSSIMVEN-DGKKEWKRVEVKLEDHVNIPSFPSNLSPESYDEYLEEYMSKLSTERYPQGK  117

Query  507   PLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG  686
             PLWE+HI +YPTSNA GN IFK H +LGDGYSLMGAL+S LQRADNP+LPLTFP RQ S 
Sbjct  118   PLWEVHIIKYPTSNAAGNIIFKFHHALGDGYSLMGALISTLQRADNPSLPLTFPSRQLSE  177

Query  687   KKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPI  866
              K+ EN          V ++ S   +T++D  W   K +L +DD T I S +D +EFRP 
Sbjct  178   SKKRENF--------FVTKIFSSACNTISDIWWGISK-TLKEDDLTPIKSSNDAIEFRPS  228

Query  867   SVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTR  1046
             ++ TMTFSL  LK IK+ L VT+NDV++G++ +GTRLYMQE ++ +   +CTA+VL NTR
Sbjct  229   TIATMTFSLDQLKSIKNKLGVTLNDVLTGMIFFGTRLYMQEIDQSSSTADCTAMVLLNTR  288

Query  1047  AMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQ  1226
              M G Y  + EMIKPN++MPWGNR TFL   IPKL    + D      FI N H+M+K++
Sbjct  289   IM-GDYMPIEEMIKPNSKMPWGNRFTFLQVPIPKLTELSNADD-----FIRNTHKMIKKK  342

Query  1227  RYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGM  1406
             R S ++Y T + LE   K    EA+++++ RTLKN+S+ ++NMIGPVE+ +LANHP+KG 
Sbjct  343   RNSLAVYFTSRLLEIVNKFGSHEASSRYIHRTLKNSSMVISNMIGPVEQMSLANHPIKGF  402

Query  1407  YFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             YF V G PQ   +T++SY GK+RL    EK  ID +KLKSC+E+A D I +
Sbjct  403   YFLVPGLPQGFDITIVSYMGKVRLAFKMEKGIIDPQKLKSCMENALDMIVK  453



>ref|XP_011001811.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Populus euphratica]
Length=473

 Score =   480 bits (1235),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 245/477 (51%), Positives = 329/477 (69%), Gaps = 11/477 (2%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             D+ +  P SP  Q+++SS+LS SIIAV+E   P   D+S  +  ++DVFLPINPRFSSIM
Sbjct  6     DQEISEPVSPSGQFLSSSILSLSIIAVMEFEAPF--DNSQAIPFLKDVFLPINPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  K+G K WK V+V L DH+  P+F  G   +FYD C  EYL+K++M+  PQ+QPLWE+
Sbjct  64    VADKDGVKRWKRVEVRLTDHVNFPVFTTGMSTQFYDECFDEYLSKMAMEQLPQSQPLWEV  123

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI  YPTS+A  N IFKLH SLGDG+SLMGALLSCLQRAD P LPLTFP  Q      G 
Sbjct  124   HIINYPTSHAASNIIFKLHHSLGDGFSLMGALLSCLQRADAPPLPLTFPSVQLHTNTSGR  183

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             N +     F+ VPR  S V +T +DF  + ++S L+ DDKT I S   GVEF P+++TTM
Sbjct  184   NCS----MFRKVPRFFSSVYNTASDFCSSIIQSCLVKDDKTPIRSGHSGVEFLPVAITTM  239

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             TFSL  +KQIK+ L VTINDVI+GI+  G R+YM+   + + +   T+LVL NTR M GG
Sbjct  240   TFSLDQIKQIKAKLGVTINDVITGIIFLGARMYMETVSQGSGSACSTSLVLLNTR-MHGG  298

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDS-SNPLRFIYNAHRMVKRQRYSA  1238
             YKS+ EM+KP+AE PWGN   FL   IPKLR   D ++ +NPL+FI NA +++K++R S 
Sbjct  299   YKSIQEMVKPDAESPWGNHFAFLNVRIPKLR---DAEAKNNPLKFILNARKIIKKKRTSF  355

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
              + LT ++L+   K RG    ++++  T++NTS+ ++N+ GP+E+  LAN+P+ G+YF V
Sbjct  356   GVNLTAKYLQLVAKFRGPNGASKYIYGTMENTSMGISNVRGPMEQMALANNPINGLYFVV  415

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSSPPRA  1589
             +GAPQSLV  + SY GKLR+ ++ EKDFID +KLKS  E AFD IF    + S  +A
Sbjct  416   TGAPQSLVAGVTSYVGKLRVALLVEKDFIDPRKLKSHTEKAFDMIFEAACRESTQQA  472



>ref|XP_007212723.1| hypothetical protein PRUPE_ppa018856mg [Prunus persica]
 gb|EMJ13922.1| hypothetical protein PRUPE_ppa018856mg [Prunus persica]
Length=469

 Score =   479 bits (1233),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 250/487 (51%), Positives = 330/487 (68%), Gaps = 22/487 (5%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
             ME   EG+ E    P SP  QY NSS+LS +I+AVLE  VP   +DS  LS ++DVFLPI
Sbjct  1     MEFREEGEGE----PVSPTGQYFNSSILSVAILAVLEFEVPF--NDSQALSLLQDVFLPI  54

Query  318   NPRFSSIMVTGK-NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPF  494
             NPRFSSIM++ K + +K WK V+V LEDH++VPIFP     E YD     Y++ I+ +  
Sbjct  55    NPRFSSIMISDKADQKKQWKRVEVKLEDHVRVPIFPSNMSPESYDEYFDNYISNIAAERL  114

Query  495   PQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPR-  671
             PQ +PLWEIHI +YPTS+A G  IFKLH +LGDGYSLMGALLSCLQ A NP++PLTFP  
Sbjct  115   PQNRPLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQTAQNPSVPLTFPSL  174

Query  672   RQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGV  851
             +  SG K    +  V++ F       S V  T++DFSW+ LKSS ++DD+T I S +DGV
Sbjct  175   KSSSGPKTTHMTKTVSQFF-------SSVFQTLSDFSWSILKSSFVEDDRTPIRSGEDGV  227

Query  852   EFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALV  1031
             EFRPI+++T+TFS+  +K IK+ L VTINDVI+GI+  GTR+YMQE  +++ N  CTALV
Sbjct  228   EFRPITLSTLTFSIDEIKLIKNKLRVTINDVIAGIIFLGTRIYMQEVTQKSSNERCTALV  287

Query  1032  LFNTRAMGGGYKSVSEMIKP-NAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAH  1208
             L  TR M  GY S  EMI+P NA M WGN+  FL   +PK       ++ NPL F++ A 
Sbjct  288   LLRTRNM-EGYLSTKEMIEPNNANMSWGNQFAFLHLPVPK-----SSETLNPLDFVWEAQ  341

Query  1209  RMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLAN  1388
             +M+K+++ SA+ YLT   L+  +K RG E  A+++  TLKN+S+T++NMIGPVEK  L N
Sbjct  342   KMIKKKKSSAASYLTSWLLDVLKKFRGPEGAARYIHGTLKNSSMTISNMIGPVEKMALDN  401

Query  1389  HPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTL  1568
              PV G+YF V G PQ L VT LSY GKLR+   +EK FID +KLK+ +++AF  I   + 
Sbjct  402   QPVGGLYFMVVGPPQCLTVTALSYMGKLRVAFGAEKGFIDSQKLKASMQNAFGIILEASN  461

Query  1569  KSSPPRA  1589
                P +A
Sbjct  462   PIPPAKA  468



>ref|XP_007198906.1| hypothetical protein PRUPE_ppa1027135mg [Prunus persica]
 gb|EMJ00105.1| hypothetical protein PRUPE_ppa1027135mg [Prunus persica]
Length=491

 Score =   479 bits (1234),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 242/476 (51%), Positives = 328/476 (69%), Gaps = 22/476 (5%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
             ME  + G++     P SP  Q +NSSVLS SI+ VLE  +PI  ++S ILS ++DVFL I
Sbjct  1     MEYEVHGNE-----PVSPIGQCLNSSVLSMSILGVLEFEIPI--NESKILSFLQDVFLNI  53

Query  318   NPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFP  497
             +PRFSSIMV   NGEK WK V+V L DH+ VPIFP G   + YD    +Y++ I ++ +P
Sbjct  54    SPRFSSIMVD-VNGEKQWKRVEVKLRDHVHVPIFPSGMSPKSYDDHFQDYISNIILEQYP  112

Query  498   QTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQ  677
             + +PLWE+HI +YPTS+A GN IFK H +LGDGYS M ALLSCLQRADNP LPLTFP R+
Sbjct  113   KDKPLWEVHIVKYPTSSAAGNLIFKFHHALGDGYSFMSALLSCLQRADNP-LPLTFPSRR  171

Query  678   GSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEF  857
             GS  K G +S ++ R    V    + V DTV DFSWN    SLL DD+T I S + GVEF
Sbjct  172   GS--KPGGDSESIFRW--DVSETFASVFDTVKDFSWN----SLLQDDRTPIRSGNYGVEF  223

Query  858   RPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLF  1037
              P++V+++TFSL  +K IK+ LN T+NDVISG + + TRLYMQE  +++    CTALVL 
Sbjct  224   LPMTVSSITFSLDEIKLIKTKLNATVNDVISGALFFATRLYMQEKSQKSSTASCTALVLV  283

Query  1038  NTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMV  1217
             NTR   G YK + EM KP++EMPWGNR+ F+P  +PKL      + SNPL F++ A +++
Sbjct  284   NTRITQGDYKPIKEMNKPDSEMPWGNRMAFMPVTMPKLT-----EFSNPLDFVFKAQKLI  338

Query  1218  KRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPV  1397
             KR+R S ++Y+  + LE  +K+RG E  ++++   LKN+S+ ++NMIGP E+  LA+HPV
Sbjct  339   KRKRSSFAVYINNKMLEIVKKIRGYEGASRYMHNRLKNSSLMISNMIGPAEQMALADHPV  398

Query  1398  KGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLT  1565
             +G+YF V G PQ L+VT++SY GKLR+ I ++   ID  K K+C+E+AF  I   T
Sbjct  399   RGVYFMVLGIPQDLIVTVVSYMGKLRIAIGTQNGLIDPDKFKACMENAFKMILEAT  454



>ref|XP_008227239.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=468

 Score =   477 bits (1227),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 246/486 (51%), Positives = 331/486 (68%), Gaps = 21/486 (4%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
             ME   EG+ E    P SP  QY NSS+LS +I+AVLE  +PI  +DS  LS ++DVFLPI
Sbjct  1     MEFREEGEVE----PVSPTGQYFNSSILSVAILAVLEFELPI--NDSQALSLLQDVFLPI  54

Query  318   NPRFSSIMVTGK-NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPF  494
             NPRFSSIMV+   + +K WK V+V LEDH+ VPIFP     E YD    +Y++ I+ +  
Sbjct  55    NPRFSSIMVSDNVDQKKQWKRVEVKLEDHVHVPIFPSKMSPESYDEYFDDYISNIAAEKL  114

Query  495   PQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRR  674
             PQ +PLWEIHI +YPTS+A G  IFKLH +LGDGYSLMGALLSCLQ A NP++PLTFP  
Sbjct  115   PQNRPLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQSAQNPSVPLTFPSL  174

Query  675   QGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVE  854
             + SG +    +  V++ F       S V  TV+DFSW+ LKS+ ++DD+T I S +DGVE
Sbjct  175   KSSGPQTTHKTKIVSQFF-------SSVFQTVSDFSWSILKSNFVEDDRTPIRSGEDGVE  227

Query  855   FRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVL  1034
             FRPI+++T+TFS+  +K IK+ L VT NDVI+GI+  GTR+YMQ   +++ N  CTALVL
Sbjct  228   FRPITLSTLTFSIDEIKLIKNKLGVTTNDVIAGIIFLGTRIYMQGVTKKSSNEHCTALVL  287

Query  1035  FNTRAMGGGYKSVSEMIKPNA-EMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHR  1211
              NTR +  GY  + EMI+PN  EM WGN+  FL  ++PK       + SNPL F++ AH+
Sbjct  288   LNTRNI-EGYMPIKEMIEPNNDEMSWGNQFGFLHVSMPK-----STEISNPLDFVWEAHK  341

Query  1212  MVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANH  1391
             ++K++R SA+ YLT   L+  +K RG E  A+++  TLKN+S+T++NMIGPVE+  LAN 
Sbjct  342   IIKKKRSSAAGYLTSWLLDVLKKFRGPEGAARYIHGTLKNSSMTISNMIGPVEQMALANQ  401

Query  1392  PVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             PV G Y+ V G PQ L +T LSY GKLR+   +EK FID  KLK+ +++AF  I   + +
Sbjct  402   PVCGFYYMVVGPPQCLTITALSYMGKLRVAFGAEKGFIDSHKLKASMQNAFRVILEASYQ  461

Query  1572  SSPPRA  1589
               P +A
Sbjct  462   IPPAKA  467



>ref|XP_002319796.2| hypothetical protein POPTR_0013s08300g [Populus trichocarpa]
 gb|EEE95719.2| hypothetical protein POPTR_0013s08300g [Populus trichocarpa]
Length=455

 Score =   475 bits (1222),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 240/467 (51%), Positives = 316/467 (68%), Gaps = 28/467 (6%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E  L P SP  QY NSS L+ S++ VLE+ VPI  DDS  +  + DVFLPINPRFSSIM
Sbjct  6     EEDALEPVSPTGQYFNSSALNVSVLGVLETEVPI--DDSKTIPFLMDVFLPINPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  +NGEK WK V+V  +DH+ VPIFP     +FYD                  QPLWEI
Sbjct  64    VIDENGEKRWKKVEVKFKDHVYVPIFPAEMSPQFYD-----------------NQPLWEI  106

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             H  +YPTSNA G  IFK+H S+GDGYSL+GALLSCLQRADNP+LPLT P  Q      G+
Sbjct  107   HFIKYPTSNAAGTVIFKIHHSIGDGYSLVGALLSCLQRADNPSLPLTLPSVQPRVDTSGD  166

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             +       FK VP++ S +  TV+DF  + +KSSL++DD + I S D G+EFRPI++ +M
Sbjct  167   HGTI----FKTVPKIFSLLFYTVSDFLGSLMKSSLVEDDLSPIRSGDIGIEFRPIALASM  222

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCN-GECTALVLFNTRAMGG  1058
             TFSL  +KQIK++L VTINDVI+G +  GTRLYMQE  + + N   CTALVL NTR M  
Sbjct  223   TFSLGQIKQIKATLGVTINDVITGAIFLGTRLYMQEMSKGSSNHSNCTALVLLNTR-MFR  281

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
              Y+S+ EM+KP AE PWGN   FL   +P+L +  +    NP+ F+  + +++KR+R S 
Sbjct  282   SYQSIKEMVKPKAESPWGNHFAFLHVQLPELVASTE---LNPIEFVRKSQQIIKRKRSSW  338

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
             +++LT  F+E  +KL+G E  AQ + +TL N S+ +TNMIGPVEK +LANHP+K M+F +
Sbjct  339   AVHLTAAFVETVKKLKGHEVAAQCIHKTLLNASVLITNMIGPVEKMSLANHPIKDMFFVL  398

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             +G PQSL +T+ SY   LR+T+ +EK F+DV+KLKSCIE AF  I +
Sbjct  399   AGNPQSLTITIASYMDNLRVTVGAEKGFVDVQKLKSCIEEAFQMILK  445



>ref|XP_008228990.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=473

 Score =   474 bits (1220),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 238/476 (50%), Positives = 329/476 (69%), Gaps = 23/476 (5%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
             ME  + G++     P SP  Q +NSSVLS SI+ VLE  +PI  ++S ILS ++DVFL I
Sbjct  1     MEYEVHGNE-----PVSPTGQCLNSSVLSMSILGVLEFEIPI--NESKILSFLQDVFLNI  53

Query  318   NPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFP  497
             +PRFSSIMV   NGEK WK V+V L DH+ VPIFP G   + YD    +Y++ I ++ +P
Sbjct  54    SPRFSSIMV-DINGEKQWKRVEVKLRDHVHVPIFPSGMSPKSYDDHFHDYISNIILEQYP  112

Query  498   QTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQ  677
             + +PLWE+HI +YPTS+A GN IFKLH +LGDGYS M ALLSCLQRADNP LPLT P RQ
Sbjct  113   KDKPLWEVHIIKYPTSSAAGNLIFKLHHALGDGYSFMSALLSCLQRADNP-LPLTLPSRQ  171

Query  678   GSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEF  857
             GS  ++G +S ++   F+ V    + V DT+ DFSWN    SL  DD+T I S + GVEF
Sbjct  172   GS--QRGGDSGSI---FRWVSETSASVFDTLKDFSWN----SLFQDDRTPIRSGNYGVEF  222

Query  858   RPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLF  1037
              P++V+++TFSL  +K IK+ LN T+NDVISG + + TRLYMQE  +++    CTALVL 
Sbjct  223   LPMTVSSITFSLDEIKLIKTKLNATVNDVISGALFFATRLYMQEKSQKSSTASCTALVLV  282

Query  1038  NTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMV  1217
             NTR   G YK + E+IKP++EMPWGNR+ F+P  +PKL      + SNPL F++ A +++
Sbjct  283   NTRITHGDYKPIKEIIKPDSEMPWGNRMAFMPVTMPKLT-----EFSNPLDFVFKAQKLI  337

Query  1218  KRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPV  1397
             KR+R S ++Y+  +  E  +K+RG E  ++++   LKN+S  ++NMIGP E+  LA+HPV
Sbjct  338   KRKRSSFAVYINSKMSEIVKKIRGYEGASRYMHSRLKNSSFMISNMIGPTEQMALADHPV  397

Query  1398  KGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLT  1565
             +G+YF V G PQ L++T++SY GKLR+   ++K  ID +K K+C+E+AF  I   T
Sbjct  398   RGVYFMVLGIPQDLIITVVSYMGKLRIAFGTQKGLIDPEKFKACMENAFKMILEAT  453



>ref|XP_007198851.1| hypothetical protein PRUPE_ppa016739mg [Prunus persica]
 gb|EMJ00050.1| hypothetical protein PRUPE_ppa016739mg [Prunus persica]
Length=464

 Score =   474 bits (1219),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 322/471 (68%), Gaps = 21/471 (4%)
 Frame = +3

Query  147   HLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPR  326
             +LEG     L P SP  QY +S V++ S++AVLE  +PI D +S  +S +++VFLPI+PR
Sbjct  5     NLEG-----LEPVSPNGQYFSSDVITLSVLAVLEFEIPIIDAESQTMSLLKNVFLPISPR  59

Query  327   FSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQ  506
             FSSIMV   +G+K W+ V+V LEDH+ +PIFP     E YD  L +YL+++S + +PQ +
Sbjct  60    FSSIMVEN-DGKKEWRRVEVKLEDHVMIPIFPSNLSPESYDQYLEDYLSRLSTERYPQGK  118

Query  507   PLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG  686
             PLWE+HI +YPTSNA GN +FK H +LGDGYSLMGAL+S LQRADNP+LPLTFP RQ S 
Sbjct  119   PLWEVHIIKYPTSNAAGNVVFKFHHALGDGYSLMGALISTLQRADNPSLPLTFPSRQRSE  178

Query  687   KKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPI  866
              K+ EN          V ++ S   +T++D  W   K +L +DD T I S +D +EFRP 
Sbjct  179   SKKRENF--------FVTKIFSSACNTISDILWGISK-TLKEDDLTPIKSSNDAIEFRPS  229

Query  867   SVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTR  1046
             ++ TMTFSL  LK IK+   VT+NDV++G++ +GTRLYMQE ++ +   +CTA+VL NTR
Sbjct  230   TIATMTFSLDQLKSIKNKFGVTLNDVLTGMIFFGTRLYMQEIDQSSSTADCTAMVLLNTR  289

Query  1047  AMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQ  1226
              M G Y  + EMIKPN++MPWGNR TFL   IP L      + SN   FI + H+M+KR+
Sbjct  290   LM-GDYMPIEEMIKPNSKMPWGNRFTFLQVPIPNL-----TELSNAEDFIRHTHKMIKRK  343

Query  1227  RYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGM  1406
             R S + + T + LE   K    EA+++++ RTLKN+S+ ++NMIGPVE+ +LANHP+KG 
Sbjct  344   RNSLAAHFTSRLLEIVNKFGSREASSRYIHRTLKNSSMVISNMIGPVEQMSLANHPIKGF  403

Query  1407  YFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             YF V G PQ   +T++SY G +RL    EK  ID +KLKSC+E+A D I +
Sbjct  404   YFLVPGLPQGFDITIVSYMGNVRLAFKMEKGIIDPQKLKSCMENALDMIVK  454



>ref|XP_007198876.1| hypothetical protein PRUPE_ppa022031mg [Prunus persica]
 gb|EMJ00075.1| hypothetical protein PRUPE_ppa022031mg [Prunus persica]
Length=464

 Score =   474 bits (1219),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 322/471 (68%), Gaps = 21/471 (4%)
 Frame = +3

Query  147   HLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPR  326
             +LEG     L P SP  QY +S V++ S++AVLE  +PI D +S  +S +++VFLPI+PR
Sbjct  5     NLEG-----LEPVSPNGQYFSSDVITLSVLAVLEFEIPIIDAESQTMSLLKNVFLPISPR  59

Query  327   FSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQ  506
             FSSIMV   +G+K W+ V+V LEDH+ +PIFP     E YD  L +YL+++S + +PQ +
Sbjct  60    FSSIMVEN-DGKKEWRRVEVKLEDHVMIPIFPSNLSPESYDQYLEDYLSRLSTERYPQGK  118

Query  507   PLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG  686
             PLWE+HI +YPTSNA GN +FK H +LGDGYSLMGAL+S LQRADNP+LPLTFP RQ S 
Sbjct  119   PLWEVHIIKYPTSNAAGNVVFKFHHALGDGYSLMGALISTLQRADNPSLPLTFPSRQRSE  178

Query  687   KKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPI  866
              K+ EN          V ++ S   +T++D  W   K +L +DD T I S +D +EFRP 
Sbjct  179   SKKRENF--------FVTKIFSSACNTISDIWWGISK-TLKEDDLTPIKSSNDAIEFRPS  229

Query  867   SVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTR  1046
             ++ TMTFSL  LK IK+   VT+NDV++G++ +GTRLYMQE ++ +   +CTA+VL NTR
Sbjct  230   TIATMTFSLDQLKSIKNKFGVTLNDVLTGMIFFGTRLYMQEIDQSSSTADCTAMVLLNTR  289

Query  1047  AMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQ  1226
              M G Y  + EMIKPN++MPWGNR TFL   IP L      + SN   FI + H+M+KR+
Sbjct  290   LM-GDYMPIEEMIKPNSKMPWGNRFTFLQVPIPNL-----TELSNAEDFIRHTHKMIKRK  343

Query  1227  RYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGM  1406
             R S + + T + LE   K    EA+++++ RTLKN+S+ ++NMIGPVE+ +LANHP+KG 
Sbjct  344   RNSLAAHFTSRLLEIVNKFGSREASSRYIHRTLKNSSMVISNMIGPVEQMSLANHPIKGF  403

Query  1407  YFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             YF V G PQ   +T++SY G +RL    EK  ID +KLKSC+E+A D I +
Sbjct  404   YFLVPGLPQGFDITIVSYMGNVRLAFKMEKGIIDPQKLKSCMENALDMIVK  454



>ref|XP_010260232.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=470

 Score =   473 bits (1218),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/465 (50%), Positives = 314/465 (68%), Gaps = 8/465 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP +QY+NSSVLS  ++AVLES VPI+D  + +L E   + LPINPRFSSIMV   +G
Sbjct  14    PVSPHAQYLNSSVLSICVLAVLESEVPIDDSQTTVLLE--KMLLPINPRFSSIMVLDDHG  71

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
               +WK V+V LEDH++V +FP G P   YD C  EY++KISM+  PQ++PLWEIH+F+YP
Sbjct  72    VGHWKKVEVKLEDHVRVAVFPDGLPATTYDECFQEYMSKISMEMLPQSRPLWEIHLFKYP  131

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TSNA G  + K H +LGDG+SLMGAL SC +RAD+P+LPLTFP  +         +  ++
Sbjct  132   TSNAAGTVVLKFHHALGDGFSLMGALFSCTRRADDPSLPLTFPSSRPKPIPNNHGAGGLS  191

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
                K     +S + ++ +DF+W+ LKSS L+D++  I S   GVEFRP +V+T+  SL  
Sbjct  192   -ILKKAHGFVSLLFNSASDFAWSLLKSSFLEDEQNPIRSGTAGVEFRPKTVSTVNLSLDR  250

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             + QIK  +  TINDV+ G++ YG RLYM  S R + +   TALVL NTR +    +S+ E
Sbjct  251   IGQIKEKIGGTINDVLCGVIFYGVRLYMYNSNRSSSHISSTALVLLNTRII-NNIQSIQE  309

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M+KP+ + PWGN   FL  +IP L    D D++ PL F+  A ++VKR+R S ++YL  +
Sbjct  310   MMKPDTKAPWGNYFAFLHVSIPIL----DADTTTPLDFVLKARQIVKRKRSSLAVYLNAK  365

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              LE TRK RG E  AQ +  TLKNTS+ +TNM+GP EK TLA HPV G+YF VSG PQSL
Sbjct  366   LLETTRKFRGPERAAQIIHSTLKNTSLAITNMVGPKEKVTLAGHPVSGLYFTVSGVPQSL  425

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKS  1574
              +T +SY G LRL + +EKDFID ++ KSCIE AF +IF   L +
Sbjct  426   TITAVSYMGTLRLGVEAEKDFIDNQQFKSCIEEAFRKIFEAALSA  470



>ref|XP_004489154.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=471

 Score =   472 bits (1214),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 234/465 (50%), Positives = 324/465 (70%), Gaps = 12/465 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY NSSV+   II VLE  VPI+D  +  L   +DVFLPI+PRFSSIMV  KN 
Sbjct  12    PVSPIGQYFNSSVICLHIIGVLEFEVPIDDLQAFAL--FKDVFLPISPRFSSIMVLDKNE  69

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             +K WK V+V L+DH+K+P F  GK +E+YD C   YL+ I+M+  PQ +PLWEIHI  YP
Sbjct  70    KKIWKQVEVDLKDHVKIPTFSEGKTIEYYDKCFHNYLSTIAMEKLPQEKPLWEIHIVNYP  129

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TS++ G  IFKLH +LGDGYSLMGALLSCLQRAD+ +LPL+FP       +  ++ ++  
Sbjct  130   TSDSLGTIIFKLHHALGDGYSLMGALLSCLQRADDSSLPLSFP-----SLRPSKSESSSK  184

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
               +    R +S V +T +DF W+ LKS ++DDDKT I   D G +F+PIS++TM FS+ H
Sbjct  185   SIWIRFSRTMSSVFNTASDFGWSVLKSRIIDDDKTPIRFGDKGADFQPISISTMEFSIDH  244

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +K IKS L VT+NDV++GIV YGTRLYM++ + ++     TALVL NTR +  GY+S+ +
Sbjct  245   IKDIKSRLGVTVNDVVTGIVFYGTRLYMKDKDSKSKTANSTALVLLNTRNI-EGYQSIDD  303

Query  1080  MI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTG  1256
             M+ K      WGN+I+FL   IPKL    +   SNPL FI + H+++KR++ S  + LTG
Sbjct  304   MLNKKKTNCRWGNKISFLHVPIPKL---NESIISNPLDFILHTHKIIKRKKQSLGVALTG  360

Query  1257  QFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQS  1436
               LE   KLRG E  A+ +RRT+  +S  +TN++GPVEK +L+NHPVKG+YF ++G  +S
Sbjct  361   TLLEIEGKLRGQEIIAKHIRRTITKSSTVLTNLVGPVEKMSLSNHPVKGLYFTLAGGAES  420

Query  1437  LVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             L ++++SY G LR+T+ +EKDFI+ ++LKS I+SAF+ IF+  +K
Sbjct  421   LTISIMSYMGVLRVTLKTEKDFIEEERLKSFIQSAFEIIFKEAMK  465



>ref|XP_004516682.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=470

 Score =   469 bits (1208),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 240/476 (50%), Positives = 321/476 (67%), Gaps = 14/476 (3%)
 Frame = +3

Query  159   DDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI  338
             ++E +  P SP  QY+NSS L   I+ VLE  +PI D  +  LS ++DVFLPIN RFSSI
Sbjct  5     EEEEITEPVSPTGQYLNSSALCIYILGVLEFEIPINDCQT--LSLLQDVFLPINTRFSSI  62

Query  339   MVTGK-NGEKNWKPVKVILEDHLKVPIFPVGKPLE-FYDYCLSEYLTKISMDPFPQTQPL  512
             M+  + NGEK WK V+V LE+H+K+PIFP  +     YD CL EY++KI+M+  PQ +PL
Sbjct  63    MIRDQINGEKKWKKVEVNLEEHIKIPIFPSNESSNSLYDECLDEYMSKIAMERLPQQRPL  122

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK  692
             WEIHI +YPT NA G  IFKLH +LGDGYSLMGALLSCL+RADNP+LP T P  Q    K
Sbjct  123   WEIHIIKYPTKNAAGTLIFKLHHALGDGYSLMGALLSCLERADNPSLPFTLPSSQRP--K  180

Query  693   QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
                N+ A+   FK  P + S V  ++ DF W+  KSSL++DD T I S+ D V+ R I++
Sbjct  181   SIFNTKAI---FKRFPSIFSSVFRSMFDFGWSIAKSSLIEDDLTPIRSRADDVKLRQITI  237

Query  873   TTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAM  1052
             + ++F + H+K+IKS L V+INDVI+G++ +G RLYM E  RE+     TALVL NTR++
Sbjct  238   SNVSFFMEHIKEIKSRLGVSINDVIAGLIFFGIRLYMLEVNRESRKANSTALVLLNTRSI  297

Query  1053  GGGYKSVSEMI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
              G YKSV EM+ K N    WGN+  FL   IP+L  P      NPL FI+ AH+ + R++
Sbjct  298   KG-YKSVKEMVSKNNNGAAWGNQFAFLHVPIPELNDP---KFENPLEFIWEAHKEINRKK  353

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
              S    LTG  L   + LRG EA A+++  TL+N+S T++N+IGPVE+  L NHPVKG+Y
Sbjct  354   NSLVTPLTGMLLNMVKTLRGPEAAARYVHSTLRNSSTTISNIIGPVEQMALDNHPVKGLY  413

Query  1410  FAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             F V G P+SL VT++SY GKLR+   SEKDFID +K+K C+E + + I + + K S
Sbjct  414   FMVVGPPESLTVTIMSYMGKLRIAFGSEKDFIDKQKIKCCMEKSLEMIIKASRKIS  469



>ref|XP_004489155.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=513

 Score =   469 bits (1207),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 237/465 (51%), Positives = 328/465 (71%), Gaps = 12/465 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY NSSVL   II VLE  VPI  DD    S ++DVFLPI+PRFSSIM+  KNG
Sbjct  54    PVSPIGQYFNSSVLCLYIIGVLEFEVPI--DDLQTFSLLQDVFLPISPRFSSIMIQDKNG  111

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             EK WK V V L+DH+K PIF  GK LEFY+ C  +YL+ I+M+  PQ +PLWE+HI  YP
Sbjct  112   EKRWKQVDVNLKDHVKTPIFSKGKTLEFYEKCFVDYLSTIAMEQLPQERPLWEVHIVNYP  171

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TS++ G  IFKLH +LGDGYSLMGALLSCLQRAD+ +LPL+FP       +  ++ ++  
Sbjct  172   TSDSLGTIIFKLHHALGDGYSLMGALLSCLQRADDSSLPLSFP-----SLRPSKSESSSK  226

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
               +    R +S V +T +DF W+ LKSS++DDDKT I   D+G +F+PIS++++ FS+ H
Sbjct  227   SIWIRFSRTMSSVFNTASDFGWSVLKSSIIDDDKTPIRFGDEGADFQPISISSIAFSIDH  286

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +K IKS L VT+NDV++GIV YGTRLYMQ  + ++     TALVL NTR +  GY+S+ E
Sbjct  287   IKDIKSRLGVTLNDVVTGIVFYGTRLYMQNLDSKSKTANSTALVLLNTRNI-EGYQSIDE  345

Query  1080  MIK-PNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTG  1256
             M+     + PWGN+I+FL   IPKL      + SNPL FI++ H ++KR++ S  + LTG
Sbjct  346   MLNTKKTKGPWGNKISFLHVPIPKLNG---SNISNPLEFIWDTHNIIKRKKQSLGVALTG  402

Query  1257  QFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQS  1436
               L+   K RG EA A+ +RRT+ N+S  +TN++GP++K +LANHPVKG YF ++G P+S
Sbjct  403   TLLDIEGKFRGQEAVAKHIRRTITNSSAVVTNLVGPIQKMSLANHPVKGFYFTLAGGPES  462

Query  1437  LVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             LV++++SY   +R+T+ +EK+FID ++LKSC++S+F+ IF+   K
Sbjct  463   LVISIMSYMEVVRVTLKTEKEFIDEQRLKSCMQSSFEMIFKAAKK  507



>ref|XP_008365935.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=478

 Score =   468 bits (1204),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 236/483 (49%), Positives = 325/483 (67%), Gaps = 19/483 (4%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
             ME   + D +    P SP  Q +N+SVLS S++ VLES VPI  D+S I+S ++DVFL I
Sbjct  1     MEFIKDDDGDYYNEPVSPTGQCLNTSVLSMSVLGVLESEVPI--DESKIMSFLQDVFLHI  58

Query  318   NPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGK-PLEFYDYCLSEYLTKISMDPF  494
             NPRF SIMV   +GEK WK V+V L DH+ VPIFP G  P E YD  L +Y++K+ ++ +
Sbjct  59    NPRFCSIMV-DVDGEKQWKKVEVKLTDHVHVPIFPSGVLPPESYDLYLGDYISKVVLEKY  117

Query  495   PQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRR  674
             P+ +PLWE+HI +YPTS A GN IFKLH +LGDGYS M A LSCLQRAD+P+LPLTFP R
Sbjct  118   PEDKPLWEVHIIKYPTSTAAGNLIFKLHHALGDGYSFMSAFLSCLQRADDPSLPLTFPSR  177

Query  675   QGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVE  854
             +GS +K  +N      A + V + L+     V D  W    S+ ++DD+T I S + GVE
Sbjct  178   RGSERKGLDN--YYKSALRWVSQKLTSAFYAVKDLGW----SAFVEDDRTPIRSGNSGVE  231

Query  855   FRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE----SERETCNGECT  1022
             F P+ ++++ FSL  +K IK+ LNVTINDV  GIV + TRLYMQE    +++ +    C 
Sbjct  232   FLPMDISSLIFSLDEIKLIKNKLNVTINDVTCGIVFFATRLYMQEIINNNQKSSSAASCR  291

Query  1023  ALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYN  1202
             ALVL NTR   G YK V +MI PN+EMPWGNRI F+P ++P L      + SNPL F++ 
Sbjct  292   ALVLVNTRITHGDYKPVKQMIGPNSEMPWGNRIAFMPVSMPNLT-----EISNPLDFVFE  346

Query  1203  AHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTL  1382
             A + +KR+R S S+Y   +  E   KLRG EA ++++   L  +S+ ++NMIGPVEK  L
Sbjct  347   AQKRIKRKRSSFSVYFYNKLFEIVSKLRGHEAASRYMHNRLMKSSLMISNMIGPVEKIAL  406

Query  1383  ANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRL  1562
             A+HP+KG+YF V G PQ +++T++SY G LR++  ++K FID +K KSC+++AF+ I  +
Sbjct  407   ADHPIKGVYFMVLGIPQDIIITIVSYMGDLRISFGTQKGFIDPQKFKSCLKNAFEMILEV  466

Query  1563  TLK  1571
             T K
Sbjct  467   TDK  469



>ref|XP_004292434.1| PREDICTED: O-acyltransferase WSD1-like [Fragaria vesca subsp. 
vesca]
Length=465

 Score =   464 bits (1194),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 233/467 (50%), Positives = 325/467 (70%), Gaps = 16/467 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E  L P SP  QY  + VLS S + VLE  VPI +    ++S I +VFLPI+PRFSS+M
Sbjct  4     EEEGLQPVSPLGQYFANRVLSVSNLGVLEIEVPIHELP--VMSLITNVFLPISPRFSSMM  61

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  + G+K WK V+V LEDH+ +PIFP G  L  YD  L +YL+K++++  P+ +PLWEI
Sbjct  62    VETR-GKKQWKRVEVELEDHVYIPIFPSGLSLASYDRYLDDYLSKLAVERLPEHRPLWEI  120

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI +YPT++A G  IFKLHQ+LGDG+SLMGALLSCLQRA+NP+LPLTFP R+ S + + +
Sbjct  121   HIIKYPTTSAAGTIIFKLHQALGDGFSLMGALLSCLQRAENPSLPLTFPSRKRSSQPRNK  180

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             N N V + F       S V +T++D     L S++ +DD+T I S +DG+EF+PI+V+TM
Sbjct  181   NGNFVTKVF-------SSVYNTISD----ILNSNMEEDDQTPIRSGNDGIEFKPIAVSTM  229

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             T SL  LK IKS L VTINDV++ ++  GTRLYMQE  + +     TA+VL NTR M G 
Sbjct  230   TISLDRLKLIKSRLGVTINDVLTAMIFLGTRLYMQEINKSSSEARGTAVVLLNTR-MLGN  288

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGD-SSNPLRFIYNAHRMVKRQRYSA  1238
             + SV EM KPN+++PWGN I+ L   IPKL +  +     N L F++ AH++++ +R+S 
Sbjct  289   FTSVEEMNKPNSKLPWGNHISLLHVPIPKLLTNSEEQFPDNALDFVWKAHKIIRSKRHSW  348

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
              +YLT  FLE   K  G EA A+++R++LKN+S+ ++NMIGPVE+ +LANHP+KG+YF V
Sbjct  349   GIYLTAGFLEILNKFGGHEAAAKYIRKSLKNSSMIISNMIGPVEQMSLANHPIKGLYFLV  408

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              G+P+ L VT++SY GK+R+    EK  ID  K KSC+E +F+ I +
Sbjct  409   FGSPEGLDVTIVSYMGKVRIAFKMEKGLIDPPKFKSCMEKSFEMILK  455



>ref|XP_011001809.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Populus euphratica]
Length=422

 Score =   461 bits (1187),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 223/418 (53%), Positives = 302/418 (72%), Gaps = 10/418 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY NSSVLS  I+AVLES VPI  DDS  ++ ++DVFLPINPRFSSIMV  KNG
Sbjct  13    PVSPTGQYFNSSVLSICILAVLESEVPI--DDSHTMTLLKDVFLPINPRFSSIMVNDKNG  70

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K WK V+V L++H+ +PIFP+G     YD   ++Y++++++  FPQ+QPLWEIH+ +YP
Sbjct  71    VKQWKRVEVQLQNHVSIPIFPIGLSTTSYDSYFNDYISRLALKQFPQSQPLWEIHVVKYP  130

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TS A GN IFKLH +LGDG+SLMGALLSCLQRADNP+L LTFP  Q           + +
Sbjct  131   TSKAAGNIIFKLHHALGDGFSLMGALLSCLQRADNPSLSLTFPSLQFPSYPDC----SFS  186

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             +    VP+ +S + +T++DF W+ LKSS ++D ++ I S D+ V+F+PI ++T+ FSL H
Sbjct  187   KLNITVPKCISSIFNTISDFGWSLLKSSFVEDSRSPIRSGDEEVQFKPIVISTIAFSLDH  246

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +KQIKS+L VTINDVI+GI+ YGTRLYMQ  + ++ N   TALVL NTR +  GY+SV E
Sbjct  247   IKQIKSTLGVTINDVITGIIFYGTRLYMQRVDDKSTNANSTALVLLNTRVI-SGYRSVKE  305

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M +P+AE PWGN+  FL  ++P+L    D   SNPL  +  A  +++R+R S ++ LTG+
Sbjct  306   MFEPDAESPWGNQFGFLHVSVPELT---DSRFSNPLECVTIAQEIIQRKRSSLAVNLTGR  362

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
              LE  RK RG EATA+ +++TL N+S+T++N+IGPV+K  LANHP+KG YF V G PQ
Sbjct  363   LLEVLRKFRGPEATAKHIKKTLFNSSMTISNIIGPVDKMALANHPIKGFYFMVVGVPQ  420



>ref|XP_009334893.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=478

 Score =   461 bits (1187),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 232/470 (49%), Positives = 320/470 (68%), Gaps = 21/470 (4%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  Q +N+SVLS S++ VLES VPI  D+S I+S ++DVFL INPRF SIMV   +G
Sbjct  15    PVSPTGQCLNTSVLSMSVLGVLESEVPI--DESKIMSFLQDVFLHINPRFCSIMVD-VDG  71

Query  360   EKNWKPVKVILEDHLKVPIFPVG--KPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             EK WK V+V L DH+ VPIFP G   P E YD  L +Y++K+ ++ +P+ +PLWE+HI +
Sbjct  72    EKQWKKVEVKLTDHVHVPIFPSGVLSP-ESYDLYLGDYISKVVLEKYPEDKPLWEVHIVK  130

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
             YPTS A GN IFKLH +LGDGYS M AL+SCLQRAD+P+ PLTFP RQGS +K  ++   
Sbjct  131   YPTSTAAGNLIFKLHHALGDGYSFMSALVSCLQRADDPSRPLTFPSRQGSERKGRDD--Y  188

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
                A + V + L+     V D  WN    + ++DD+T I S + GVEF P+ ++++ FSL
Sbjct  189   YKSALRWVSQNLASAFYAVKDLGWN----AFVEDDRTLIRSGNSGVEFLPMDISSLIFSL  244

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQE----SERETCNGECTALVLFNTRAMGGG  1061
               +K IK+ LNVTINDVI GIV + TRLYMQE    +++ +    C ALVL NTR   G 
Sbjct  245   DEIKLIKNKLNVTINDVICGIVFFATRLYMQEMINNNQKSSSAASCRALVLVNTRITHGD  304

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YK V +MI PN+EMPWGNRI F+P ++PKL      +  NPL F++ A + +KR+R S S
Sbjct  305   YKPVKQMIGPNSEMPWGNRIAFMPISMPKLT-----EILNPLDFVFEAQKRIKRKRSSFS  359

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             +    +  E   KLRG EA ++++   L  +S+ ++NMIGPVEK  LA+HP+KG+YF V 
Sbjct  360   VSFYNKLFEIVSKLRGHEAASRYMHNRLMKSSLMISNMIGPVEKAALADHPIKGVYFMVL  419

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             G PQ +++T++SY G LR++  ++K FID +K KSC+++AF+ I  +T K
Sbjct  420   GIPQDIIITIVSYMGDLRISFGTQKGFIDPQKFKSCLKNAFEMILEVTDK  469



>ref|XP_009336217.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=463

 Score =   461 bits (1186),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 316/471 (67%), Gaps = 19/471 (4%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E  L P SP   Y NSSVLS SI+A+LE  +PI  DDS  LS + +VFLPINPRFSSIM+
Sbjct  5     EEELEPVSPNGHYFNSSVLSVSILAILEYEIPI--DDSQFLSLLENVFLPINPRFSSIMI  62

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               KNG+K WK V+V LEDHLK PIFP     E YD    +Y++ I+   FPQ +PLWE+H
Sbjct  63    E-KNGKKQWKKVEVKLEDHLKTPIFPSNLSNESYDEYFDDYISSIATKRFPQDKPLWEVH  121

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             + +YP SNA GN IFKLH +LGDGYSLMGALLSCLQRADNP+LPLTFP    S  K  EN
Sbjct  122   VIKYPNSNAAGNLIFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSLLPSETK-SEN  180

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
                       + + +S ++ T++DF W   KS   +DD + I S  +G+EF PI+++ +T
Sbjct  181   ---------VMTKTISSLLSTISDFWWGISKSFRGEDDPSPIKSSKNGLEFAPITISMIT  231

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
              SL  ++ IKS L VTIND+++G+V  GTRLYMQE  + +     T+LVL NTR M   Y
Sbjct  232   ISLDRIRLIKSKLGVTINDILTGMVFLGTRLYMQEMNQGSREAHSTSLVLLNTRFM-TNY  290

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
              S+ EM+KPN + PWGNR  FL   IPKL      + SN L F++NAH+++K++R S+++
Sbjct  291   ASIEEMVKPNGKSPWGNRFAFLHVPIPKLT-----EFSNVLEFVWNAHKIIKQKRNSSAI  345

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             Y T   LE   K  G EA ++++  TLKN+S+ +TNMIGPVEK +LAN P+KG+YF ++G
Sbjct  346   YFTSGLLEMLNKFGGHEAASRYIHSTLKNSSLVITNMIGPVEKMSLANQPIKGLYFLLAG  405

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
              P+ L ++++SY GK++L    +K  ID +KLK C+E+A + I     K+S
Sbjct  406   TPKDLDISIVSYMGKVKLAFTVKKGIIDPQKLKLCMENALNMISNAADKNS  456



>ref|XP_009336220.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=463

 Score =   460 bits (1183),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 236/466 (51%), Positives = 311/466 (67%), Gaps = 19/466 (4%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP   Y N+SVLS S++AVLE  +PI  DDS  LS + +VFLPINPRF SI +  K
Sbjct  8     LEPVSPTGHYFNNSVLSISVLAVLEYEIPI--DDSQFLSLLENVFLPINPRFFSIRLK-K  64

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             NG+K WK V+V LEDH+K PIFP     E YD    +YL+ ++   FPQ +PLWE H+ +
Sbjct  65    NGKKQWKRVEVKLEDHVKTPIFPSNLSNESYDEYFDDYLSNLATKRFPQDKPLWEFHVIK  124

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
             YP SNA GN +FKLH +LGDGYSLMGALLSCLQRADNP+LPLTFP RQ S  K   N N 
Sbjct  125   YPNSNAAGNVVFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSRQSSKPK---NENV  181

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
             + R F       S +++T++D  W   KS   +DD + I S + G EF PI+V+T+T SL
Sbjct  182   MTRTF-------SSLLNTMSDIWWGISKSITGEDDGSPIKSSNIGFEFAPITVSTVTISL  234

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
              H+K IKS L VTINDV++G+V  GTRLYMQE  + +     TAL+L NTR M G Y SV
Sbjct  235   DHIKLIKSRLGVTINDVLTGMVFLGTRLYMQEMNQSSREAHSTALILLNTRVM-GNYTSV  293

Query  1074  SEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLT  1253
              EM+KP+++ PWGN ITFL   IP L      + SN L F++ A + +K +R S ++Y T
Sbjct  294   EEMVKPDSKSPWGNHITFLQIPIPNLT-----EFSNILDFVWKAQKCIKTKRNSLAIYFT  348

Query  1254  GQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
                L+   +  G EA ++F+ RTL N+S+  TN+IGPVE+ +LAN P+KG+YF + G+P 
Sbjct  349   SGLLKMLNRFGGHEAASRFIHRTLTNSSMAFTNLIGPVEQMSLANQPIKGLYFMIVGSPL  408

Query  1434  SLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
              L +++LSY GK+RLT+  +K  ID +KLK C+E+A D I   + K
Sbjct  409   DLDISVLSYMGKVRLTLTMKKGIIDPQKLKLCMENAHDMILNASDK  454



>ref|XP_002323911.2| hypothetical protein POPTR_0017s04310g [Populus trichocarpa]
 gb|EEF04044.2| hypothetical protein POPTR_0017s04310g [Populus trichocarpa]
Length=422

 Score =   457 bits (1177),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 223/409 (55%), Positives = 295/409 (72%), Gaps = 9/409 (2%)
 Frame = +3

Query  336   IMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLW  515
             I V  +NGEK WK V+V L+DH+ VPIFP     +FYD    +YL+K+SM   PQ+QPLW
Sbjct  12    IQVIDENGEKRWKKVEVELKDHVFVPIFPEEMSPQFYDEYFEDYLSKLSMLQLPQSQPLW  71

Query  516   EIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
             EIH+ +YPTSNA    IFK+H ++GDGYSLMGALLSCLQRADNP+LPLT P  Q      
Sbjct  72    EIHLIKYPTSNAASTIIFKIHHAIGDGYSLMGALLSCLQRADNPSLPLTLPSVQPRVDTS  131

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
             G++       FK VP++ S + +TV+DF  + +KSSL++DD + I S D G+EFRPI+ T
Sbjct  132   GDHRTI----FKTVPKIFSLLFNTVSDFLGSLMKSSLVEDDLSPIRSGDIGIEFRPIAPT  187

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAM  1052
             TMTFSL  +KQIK++L VTINDVI+G +  GTRLYMQE S+  + +  CTALV+ NTR M
Sbjct  188   TMTFSLGQIKQIKATLGVTINDVITGAILLGTRLYMQEMSKGSSDHSNCTALVMLNTR-M  246

Query  1053  GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
                Y+S++EM+KP AE PWGN   FL   +P+L +  +    NP+ FI  A +++KR+R 
Sbjct  247   FRSYQSITEMVKPKAESPWGNHFAFLHVQLPELVASTE---LNPIEFIRKAQQIIKRKRS  303

Query  1233  SASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             S ++YLT  F+E  +KL+G E  AQ++ +T+ N S+T+TNMIGPVEK +LANHP+KGMYF
Sbjct  304   SLAVYLTAAFIEIVKKLKGHEVAAQYIHKTMVNASMTVTNMIGPVEKMSLANHPIKGMYF  363

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             AV+G PQSL +T++SY  KLRLT+ +EK FID +KLKSCIE AF  I +
Sbjct  364   AVAGNPQSLNITIVSYVDKLRLTLGAEKGFIDAQKLKSCIEEAFQMILK  412



>ref|XP_009372230.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=478

 Score =   457 bits (1176),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 231/470 (49%), Positives = 318/470 (68%), Gaps = 21/470 (4%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  Q +N+SVLS S++ VLES VPI  D+S I+S ++DVFL INPRF SIMV   +G
Sbjct  15    PVSPTGQCLNTSVLSMSVLGVLESEVPI--DESKIMSFLQDVFLHINPRFCSIMVD-VDG  71

Query  360   EKNWKPVKVILEDHLKVPIFPVG--KPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             EK WK V+V L DH+ VPIFP G   P E YD  L +Y++K+ ++ +P+ +PLWE+HI +
Sbjct  72    EKQWKKVEVKLTDHVHVPIFPSGVLSP-ESYDLYLGDYISKVVLEKYPEDKPLWEVHIVK  130

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
             YPTS A GN IFKLH +LGDGYS M ALLSCLQRAD+P+ PLTFP RQGS +K  ++   
Sbjct  131   YPTSTAAGNLIFKLHHALGDGYSFMSALLSCLQRADDPSRPLTFPSRQGSERKGRDD--Y  188

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
                A + V + L+     V D  WN    + ++DD+T I S + GVEF P+ ++++ FSL
Sbjct  189   YKSALRWVSQNLASAFYAVKDLGWN----AFVEDDRTPIRSGNSGVEFLPMDISSLIFSL  244

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQE----SERETCNGECTALVLFNTRAMGGG  1061
               +K IK+ LNVTINDVI GIV + TRLYMQE    +++ +    C ALVL NTR   G 
Sbjct  245   DEIKLIKNKLNVTINDVICGIVFFATRLYMQEMINNNQKSSSAASCRALVLVNTRITHGD  304

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YK V + I PN+EMPWGNRI F+P ++PKL      +  NPL F++ A + +KR+R S S
Sbjct  305   YKPVKQTIGPNSEMPWGNRIAFMPISMPKLT-----EILNPLDFVFEAQKRIKRKRSSFS  359

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             +    +  E   KL G EA ++++   L  +S+ ++NMIGPVEK  LA+HP+KG+YF V 
Sbjct  360   VSFYNKLFEIVSKLSGHEAASRYMHNRLMKSSLMISNMIGPVEKAALADHPIKGVYFMVL  419

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             G PQ +++T++SY G LR++  ++K FID +K KSC+++AF+ I  +T K
Sbjct  420   GIPQDIIITIVSYMGDLRISFGTQKGFIDPQKFKSCLKNAFEMILEVTGK  469



>ref|XP_007203447.1| hypothetical protein PRUPE_ppa022053mg [Prunus persica]
 gb|EMJ04646.1| hypothetical protein PRUPE_ppa022053mg [Prunus persica]
Length=462

 Score =   456 bits (1174),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/469 (50%), Positives = 313/469 (67%), Gaps = 23/469 (5%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             LEG +     P SP  QY +S+V+S S++AV E  +PI+ +   I   I++VFLP++PRF
Sbjct  6     LEGQE-----PVSPNGQYFSSNVISLSVLAVWEFEIPIDPESQTIPLLIKNVFLPVSPRF  60

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIMV  K G+K WK V+V LEDH+  P FP G  LE YD    +Y++K+  + FPQ +P
Sbjct  61    SSIMVENK-GKKQWKRVEVKLEDHVYTPSFPSGLSLESYDKYFDDYISKLLTERFPQGKP  119

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LWEIHI  YPTSNA  N IFKLH +LGDGYSLMGAL+S LQRADNP+LPLTFP R+ S  
Sbjct  120   LWEIHIINYPTSNAAANVIFKLHHALGDGYSLMGALISSLQRADNPSLPLTFPSRKRSES  179

Query  690   KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPIS  869
             K+    N V + F       SG  +T++D  W+    ++  D  T I S +D +EFRP +
Sbjct  180   KR---ENFVTKTF-------SGFCNTISDL-WSGTLKTMNGDVVTPIRSGNDAIEFRPAT  228

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRA  1049
             V+TMTFSL  +K IK  L VT+NDV++G++ +GTRLYMQE  + +   +CTA+VL NTR 
Sbjct  229   VSTMTFSLDQIKSIKDKLGVTVNDVLTGMIFFGTRLYMQEMNQSSSKADCTAMVLLNTRI  288

Query  1050  MGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
             M G Y  + EMIKPN++ PWGNR TF+   IPKL      + SN L FI+NA + +KR+R
Sbjct  289   M-GDYLPIEEMIKPNSKAPWGNRFTFMHVPIPKLT-----ELSNALDFIWNACKTIKRKR  342

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
              S + Y   + LE   K  G EA  +++ RTLKN+S+ ++N+IGPVE+ +LANHP+KG+Y
Sbjct  343   NSFAAYFNSRLLEIVHKFGGHEACGKYIHRTLKNSSMLISNLIGPVEQMSLANHPIKGLY  402

Query  1410  FAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
             F V G P S  +T++SY GK+R+    EK  ID +KLKSC+E+A   I 
Sbjct  403   FVVGGGPLSFEITIVSYMGKVRVAFNMEKGVIDPQKLKSCMENALQMIL  451



>ref|XP_008229024.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=451

 Score =   456 bits (1172),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 229/471 (49%), Positives = 312/471 (66%), Gaps = 34/471 (7%)
 Frame = +3

Query  147   HLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPR  326
             +LEG     L P SP  QY +S V++ S++AVLE  +PI D +S  +S +++V       
Sbjct  5     NLEG-----LEPVSPNGQYFSSDVITLSVLAVLEFEIPIIDAESQTMSLLKNV-------  52

Query  327   FSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQ  506
                      +G+K WK V+V LEDH+ +PIFP     E YD  L +YL+K+S + +PQ +
Sbjct  53    -------ENDGKKEWKRVEVKLEDHVNIPIFPSNLSPESYDQYLEDYLSKLSTERYPQGK  105

Query  507   PLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG  686
             PLWE+HI +YPTSNA GN IFK H +LGDGYSLMGAL+S LQRADNP+LPLTFP RQ S 
Sbjct  106   PLWEVHIIKYPTSNAAGNVIFKFHHALGDGYSLMGALISTLQRADNPSLPLTFPSRQRSE  165

Query  687   KKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPI  866
              K+ EN          V ++ S   +T++D  W   K +L +D+ T I S +D +EFRP 
Sbjct  166   LKKRENF--------FVTKIFSSACNTISDIWWGISK-TLKEDELTPIKSSNDAIEFRPS  216

Query  867   SVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTR  1046
             ++ TMTFSL  LK IK+ L VT+NDV++G++ +GTRLYMQE ++ +   +CTA+VL NTR
Sbjct  217   TIATMTFSLGQLKSIKNKLGVTLNDVLTGMIFFGTRLYMQEIDQSSSTADCTAMVLLNTR  276

Query  1047  AMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQ  1226
              M G Y  + EMIKPN++MPWGNR TFL   IPKL    + D      FI N H+M+K++
Sbjct  277   IM-GDYMPIEEMIKPNSKMPWGNRFTFLQVPIPKLTELSNADD-----FIRNTHKMIKKK  330

Query  1227  RYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGM  1406
             R S ++Y T + LE   K    EA+++++ RTLKN+S+ ++NMIGPVE+ +LANHP+KG 
Sbjct  331   RNSLAVYFTSRLLEIVNKFGSHEASSRYIHRTLKNSSMVISNMIGPVEQMSLANHPIKGF  390

Query  1407  YFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             YF V G PQ   +T++SY GK+RL    EK  ID  KLKSC+E+AFD I +
Sbjct  391   YFLVPGLPQGFDITIVSYMGKVRLAFKMEKGIIDPHKLKSCMENAFDMIVK  441



>ref|XP_008241433.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=470

 Score =   456 bits (1173),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 312/469 (67%), Gaps = 23/469 (5%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             LEG +     P SP  QY +S+V+S S++AV E  +P + +   I   I++VFLP++PRF
Sbjct  6     LEGQE-----PVSPNGQYFSSNVISLSVLAVWEFEIPFDLESQTIPLLIKNVFLPVSPRF  60

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIMV   NG+K WK V+V LEDHL  P FP G  LE YD    +Y++K+  + FPQ +P
Sbjct  61    SSIMVEN-NGKKEWKRVEVKLEDHLYTPTFPSGLSLESYDKYFDDYISKLLTERFPQGKP  119

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LWEIHI  YPTSNA  N IFKLH +LGDGYSLMGAL+S +QRADNP+LPLTFP R+ S  
Sbjct  120   LWEIHIINYPTSNAAANVIFKLHHALGDGYSLMGALISSMQRADNPSLPLTFPSRKRSES  179

Query  690   KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPIS  869
             K+    N V + F       SG  +T++D  W+    ++  D  T I S +D +E+RP +
Sbjct  180   KR---ENFVTKTF-------SGFCNTISDL-WSGTLKTMNGDVLTPIRSGNDAIEYRPAT  228

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRA  1049
             V+TMTFSL  +K IK  L VT+NDV++G++ YGTRLYMQE  + +   +CTA+VL NTR 
Sbjct  229   VSTMTFSLDQIKSIKDKLGVTVNDVLTGMIFYGTRLYMQEMNQSSSKADCTAMVLLNTRI  288

Query  1050  MGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
             M G Y  + EMIKPN++ PWGNR TF+   IPKL      + SN L FI+N  +++KR+R
Sbjct  289   M-GDYVPIEEMIKPNSKAPWGNRFTFMHVPIPKLT-----ELSNALDFIWNTRKIIKRKR  342

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
              S + Y   + LE   K    EA  +++ RTLKN+S+ ++N+IGPVE+ +LANHP+KG Y
Sbjct  343   NSFAAYFNSRLLEIVHKFGSHEACGKYIHRTLKNSSMIISNLIGPVEQMSLANHPIKGFY  402

Query  1410  FAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
             F V G P SL +T++SY GK+R+    EKD ID +KLKSC+E+A   I 
Sbjct  403   FVVGGGPLSLEMTIVSYMGKVRVAFNMEKDVIDPQKLKSCMENALQMIL  451



>emb|CAN62907.1| hypothetical protein VITISV_043611 [Vitis vinifera]
Length=438

 Score =   454 bits (1167),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 224/418 (54%), Positives = 296/418 (71%), Gaps = 11/418 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY NSSVL  SI+++LES +PI  DDS  LS ++DVFLPINPRFSS+MV  KNG
Sbjct  14    PVSPTGQYFNSSVLQVSIMSILESDIPI--DDSPTLSLLKDVFLPINPRFSSLMVEDKNG  71

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K+WK V+V LEDH+ VPIFP G   E YD    + LTKI+M  FPQ++PLWEIHI +YP
Sbjct  72    VKHWKRVEVKLEDHVNVPIFPDGLSPESYDDYFDDCLTKIAMKEFPQSRPLWEIHIIKYP  131

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TSNA G  +FKLH +LGDG+SLMGALLSCLQRADNP LP+TFP       K   N ++  
Sbjct  132   TSNAAGTVVFKLHHALGDGFSLMGALLSCLQRADNPNLPITFP-----SFKVSSNLDSGR  186

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
                +AVPR LS   +TV+DF W  LKS+ ++DD+T I S D GVEFRP+S+ T++FSL +
Sbjct  187   SIIRAVPRALSAAFNTVSDFGWGLLKSTAVEDDRTPIRSGDPGVEFRPMSIATISFSLDN  246

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +++IK+ L VTINDV++GI+ +GTRLYMQ     + N   TALVL NTR +  GYKS+ E
Sbjct  247   IQKIKAKLGVTINDVLTGIIFFGTRLYMQSMNHASRNANSTALVLLNTRVI-SGYKSLKE  305

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M   ++   WGN+  FL   +P+L    D   ++PL F+  A + ++R+R S +++LTG+
Sbjct  306   MTASDSSSQWGNQFAFLHVTLPELV---DAKFTSPLDFVAKAQQTIQRKRNSLAVHLTGR  362

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
              LE  RK RG E TA+++  TLKN+S+T++NMIGP+E+  LANHP +GMYF   G+P+
Sbjct  363   LLETLRKYRGPEVTARYIHGTLKNSSMTISNMIGPMEQVALANHPCRGMYFMTLGSPE  420



>gb|KHN35245.1| O-acyltransferase WSD1 [Glycine soja]
Length=471

 Score =   452 bits (1163),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 227/465 (49%), Positives = 311/465 (67%), Gaps = 11/465 (2%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP   Y NSSV+   +   LE +VPI+D  ++ L E  DVFLPINPRFSSIM+
Sbjct  6     EEVQEPVSPHGHYFNSSVICSYVFGFLEMAVPIDDSQTIPLLE--DVFLPINPRFSSIMI  63

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               + G+  WK V+V  E+H+KVP FP     E YD+   EY+T+I  +  PQ +PLWE+H
Sbjct  64    RDQAGKMRWKRVQVNPEEHVKVPRFPECNSAELYDHYFDEYVTRILNERTPQNKPLWEVH  123

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             + +YPTSNA G  IFK H SLGDGYSLMGALLSCLQR D+P+LPLTFP R  S  +  + 
Sbjct  124   LIKYPTSNAAGTIIFKFHHSLGDGYSLMGALLSCLQRTDDPSLPLTFPSRVSSNPQHAKK  183

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
             +      FK +  ++S    ++ DF  + +K+ +++DDKT I S  +G + +  +++ ++
Sbjct  184   T-----MFKKLHSVISSFFSSMLDFGSSVIKAKMIEDDKTPIRSGYEGTKPQHFTLSNIS  238

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
              SL H+K IKS+L VTINDVI+GI+ YG RLYMQE +  T     TALV+ NTR +  GY
Sbjct  239   LSLDHIKAIKSNLGVTINDVITGIIFYGIRLYMQEIDYMTRKANSTALVVLNTRNI-RGY  297

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
             +SV EM KP  +  WGN+I+FL   IPKL  P     SNPL F++NA + +KR+++S S+
Sbjct  298   QSVKEMQKPKVKGLWGNKISFLQIPIPKLDQP---KISNPLEFVWNARKQIKRKKHSFSV  354

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             YL G  L+   KLRG E  ++    TL N S+ ++NM GP+E+  LANHPV+G+YFA+SG
Sbjct  355   YLIGLLLDLEMKLRGPEVASKTFYNTLGNCSVLISNMFGPLEQMALANHPVRGVYFAMSG  414

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              PQ++ V ++SY G+LR+T+ + K FID +K K CIE AFDEIF+
Sbjct  415   GPQNVNVAIMSYVGELRITLKTLKGFIDEQKFKFCIEKAFDEIFK  459



>ref|XP_010068985.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
 gb|KCW57194.1| hypothetical protein EUGRSUZ_H00010 [Eucalyptus grandis]
Length=473

 Score =   452 bits (1163),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 232/467 (50%), Positives = 312/467 (67%), Gaps = 14/467 (3%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP  +Y NS V+S SI+ +LES +PI+D  +  L  I+DVFLPINPRFSSIMV GK
Sbjct  10    LEPVSPTGEYFNSKVMSVSILGILESEIPIDDSQATAL--IKDVFLPINPRFSSIMVMGK  67

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGK----PLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
              G + WK V+V +E+H+ VP F   K    P E  D  L  Y+++I+M PFPQ QPLWEI
Sbjct  68    KGARKWKKVEVNVENHVHVPSFSFPKGSSSPSE-NDSFLKTYISQIAMQPFPQGQPLWEI  126

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI + PTS A G  IFKLH +LGDGYSL+GALLSCLQRADNP+LP+TFP          +
Sbjct  127   HIIKCPTSEAQGTLIFKLHHALGDGYSLVGALLSCLQRADNPSLPITFPSVSNFSSANKD  186

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             + N   R  K V R  S +V+TV DF W+  KS+ ++DD + I    +   F+P  V+T+
Sbjct  187   DRNIGLR--KVVSRCFSPLVNTVKDFGWSVFKSTCIEDDLSPIRCGSES--FQPFLVSTV  242

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGG  1058
             TFSL  +K+IKS L VT+NDVI G +   TR+YMQ  S     +   TALVL NTR +  
Sbjct  243   TFSLDRIKEIKSRLRVTVNDVIMGTIFLATRMYMQRASTNSNLSTNSTALVLLNTRNLRD  302

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
              YKSV +M++PN+E PWGN   FL   IPK++ P D   S+PL+F++ AH ++KR+R S 
Sbjct  303   -YKSVRDMVRPNSESPWGNNFAFLHVPIPKVK-PSDSQFSDPLKFVHEAHEVIKRKRSSF  360

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
              + LTG+ L   +K R  EA A+ + RTL+N+S+ ++N++GPVEK +LANHPVKGMY+ V
Sbjct  361   GVILTGKLLGIMKKCRNAEAVAKHISRTLRNSSMVISNVMGPVEKLSLANHPVKGMYYTV  420

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             +G P+SL +T+ SYAG LR+ + +E+ FID +     + +AFD I R
Sbjct  421   AGTPESLRITIFSYAGNLRVAVGAEQGFIDSELYTRSLVNAFDAILR  467



>gb|KHN47659.1| O-acyltransferase WSD1 [Glycine soja]
Length=467

 Score =   452 bits (1162),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/467 (49%), Positives = 321/467 (69%), Gaps = 15/467 (3%)
 Frame = +3

Query  159   DDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI  338
             D E +  P SP  QY+ SS LS  I+ VLE+ VPI+D  +V L  ++++FLPIN RFSSI
Sbjct  5     DGEEIEEPVSPTGQYLTSSSLSVYILGVLETEVPIDDSQTVPL--LQNLFLPINSRFSSI  62

Query  339   MVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEF-YDYCLSEYLTKISMDPFPQTQPLW  515
             M+  KNGEK WK V+V LEDH+KVP FP GK   F YD  L EYL+ I+++  P  +PLW
Sbjct  63    MIRDKNGEKRWKKVEVKLEDHIKVPTFPNGKSSNFLYDEYLDEYLSTIAVEYLPHNRPLW  122

Query  516   EIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
             E+HI +YPT+NA G  +FKLH +LGDG+SLMGALLSC+QRADN +LP T P    S + +
Sbjct  123   ELHIIKYPTNNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLP---SSLRPK  179

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
                SN     FK +P +      T+++F W+FLKS++++DD+T I S  +  + R I+++
Sbjct  180   ASISNTKG-VFKKLPSIF---FQTISEFGWSFLKSNMIEDDQTPIRSCAEDFKTRQITIS  235

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
              +TFSL  +K++KS L V+INDV++G++ +G RLYMQE   ++   + TALVL NTR + 
Sbjct  236   DVTFSLDLIKEVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNIE  295

Query  1056  GGYKSVSEMI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
             G YKSV EMI K N+   WGN+  FL   IP+L    D   +NPL FI  AH  + +++ 
Sbjct  296   G-YKSVKEMINKTNSRSSWGNQYAFLHVPIPEL---SDSKYANPLEFIREAHMDMTKKKN  351

Query  1233  SASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             S +  LTG  L+  RKLRG EA A++LR TL+N+S T++N+IGPVE+  +ANHP+KG YF
Sbjct  352   SLATPLTGMLLDMLRKLRGPEAAARYLRNTLRNSSTTISNIIGPVEQMAVANHPIKGFYF  411

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
              V+G+P+SL +T++SY GK+R+    EKDFID +  KSC+E++ + I
Sbjct  412   MVAGSPESLTMTIMSYMGKIRIAFGVEKDFIDKQLFKSCLENSLEMI  458



>ref|XP_003527429.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=471

 Score =   452 bits (1162),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 227/465 (49%), Positives = 311/465 (67%), Gaps = 11/465 (2%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP   Y NSSV+   +   LE +VPI+D  ++ L E  DVFLPINPRFSSIM+
Sbjct  6     EEVQEPVSPHGHYFNSSVICSYVFGFLEMAVPIDDSQTIPLLE--DVFLPINPRFSSIMI  63

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               + G+  WK V+V  E+H+KVP FP     E YD+   EY+T+I  +  PQ +PLWE+H
Sbjct  64    RDQAGKMRWKRVQVNPEEHVKVPRFPECNSAELYDHYFDEYVTRILNERTPQNKPLWEVH  123

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             + +YPTSNA G  IFK H SLGDGYSLMGALLSCLQR D+P+LPLTFP R  S  +  + 
Sbjct  124   LIKYPTSNAAGTIIFKFHHSLGDGYSLMGALLSCLQRTDDPSLPLTFPSRVSSNPQHAKK  183

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
             +      FK +  ++S    ++ DF  + +K+ +++DDKT I S  +G + +  +++ ++
Sbjct  184   T-----IFKKLHSVISSFFSSMLDFGSSVIKAKMIEDDKTPIRSGYEGTKPQHFTLSNIS  238

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
              SL H+K IKS+L VTINDVI+GI+ YG RLYMQE +  T     TALV+ NTR +  GY
Sbjct  239   LSLDHIKAIKSNLGVTINDVITGIIFYGIRLYMQEIDYMTRKANSTALVVLNTRNI-RGY  297

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
             +SV EM KP  +  WGN+I+FL   IPKL  P     SNPL F++NA + +KR+++S S+
Sbjct  298   QSVKEMQKPKVKGLWGNKISFLQIPIPKLDQP---KISNPLEFVWNARKQIKRKKHSFSV  354

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             YL G  L+   KLRG E  ++    TL N S+ ++NM GP+E+  LANHPV+G+YFA+SG
Sbjct  355   YLIGLLLDLEMKLRGPEVASKTFYNTLGNCSVLISNMFGPLEQMALANHPVRGVYFAMSG  414

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              PQ++ V ++SY G+LR+T+ + K FID +K K CIE AFDEIF+
Sbjct  415   GPQNVNVAIMSYVGELRITLKTLKGFIDEQKFKFCIEKAFDEIFK  459



>ref|XP_003541280.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=467

 Score =   451 bits (1160),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 229/467 (49%), Positives = 321/467 (69%), Gaps = 15/467 (3%)
 Frame = +3

Query  159   DDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI  338
             D E +  P SP  QY+ SS LS  I+ VLE+ VPI+D  +V L  ++++FLPIN RFSSI
Sbjct  5     DGEEIEEPVSPTGQYLTSSSLSVYILGVLETEVPIDDSQTVPL--LQNLFLPINSRFSSI  62

Query  339   MVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEF-YDYCLSEYLTKISMDPFPQTQPLW  515
             M+  KNGEK W+ V+V LEDH+KVP FP GK   F YD  L EYL+ I+++  P  +PLW
Sbjct  63    MIRDKNGEKKWEKVEVKLEDHIKVPTFPNGKSSNFLYDEYLDEYLSTIAVEHLPHNRPLW  122

Query  516   EIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
             E+HI +YPT+NA G  +FKLH +LGDG+SLMGALLSC+QRADN +LP T P    S + +
Sbjct  123   ELHIIKYPTNNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLP---SSLRPK  179

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
                SN     FK +P +      T+++F W+FLKS++++DD+T I S  +  + R I+++
Sbjct  180   ASISNTKG-VFKKLPSIF---FQTISEFGWSFLKSNMIEDDQTPIRSCAEDFKTRQITIS  235

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
              +TFSL  +K++KS L V+INDV++G++ +G RLYMQE   ++   + TALVL NTR + 
Sbjct  236   DVTFSLDLIKEVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNIE  295

Query  1056  GGYKSVSEMI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
             G YKSV EMI K N+   WGN+  FL   IP+L    D   +NPL FI  AH  + +++ 
Sbjct  296   G-YKSVKEMINKTNSRSSWGNQYAFLHVPIPEL---SDSKYANPLEFIREAHMDMTKKKN  351

Query  1233  SASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             S +  LTG  L+  RKLRG EA A++LR TL+N+S T++N+IGPVE+  +ANHP+KG YF
Sbjct  352   SLATPLTGMLLDMLRKLRGPEAAARYLRNTLRNSSTTISNIIGPVEQMAVANHPIKGFYF  411

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
              V+G+P+SL +T++SY GK+R+    EKDFID +  KSC+E++ + I
Sbjct  412   MVAGSPESLTMTIMSYMGKIRIAFGVEKDFIDKQLFKSCLENSLEMI  458



>ref|XP_008368650.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Malus domestica]
Length=467

 Score =   450 bits (1157),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 229/461 (50%), Positives = 309/461 (67%), Gaps = 19/461 (4%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP   Y NSSVLS SI+ VLE  +PI  DDS  LS + +VFLPIN RFSSI +   
Sbjct  8     LDPVSPTGHYFNSSVLSISILGVLEFEIPI--DDSQTLSLLENVFLPINSRFSSIXIEN-  64

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             NG+K WK V+V LEDH+K PIFP     E YD    +Y++ I+   FP+ +PLWEIH+ +
Sbjct  65    NGKKQWKKVEVKLEDHVKSPIFPSNLSNESYDKYFDDYISNIATTRFPEDKPLWEIHVIK  124

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
             YP SNA GN IFKLH +LGDGYSLMGAL+SCL+RADNP+LPLTFP R  S  K   + N 
Sbjct  125   YPNSNAAGNVIFKLHHALGDGYSLMGALISCLRRADNPSLPLTFPSRLPSKPK---SENV  181

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
             +   F       S +++T++D  W   KS + +DD++ I S ++G+EF PI+V+TMT SL
Sbjct  182   MTTTF-------SCLLNTISDSWWGISKSIMGEDDRSPIKSXNNGLEFAPITVSTMTISL  234

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
               ++ IKS L VTINDV++G+V  G RLYMQE  + +     T+LVL NTR M   Y S+
Sbjct  235   DLIRLIKSRLGVTINDVLTGVVFLGARLYMQEMNKSSREAHSTSLVLLNTRIM-ANYTSI  293

Query  1074  SEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLT  1253
              EMIKP+++ PWGNR TFL   IPKL      + SN L F++ A +++ ++R S ++Y  
Sbjct  294   EEMIKPDSKSPWGNRFTFLQVPIPKLT-----EFSNVLDFVWKAQKIINQKRNSFTIYFI  348

Query  1254  GQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
                LE   K  G EA ++++R T+KN+S+ +TNMIGP+E+ +LANHP+KG+YF V G PQ
Sbjct  349   SXLLEMLNKFGGHEAASRYIRSTIKNSSMVITNMIGPLEQMSLANHPIKGLYFLVVGTPQ  408

Query  1434  SLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
              L +++ SY GK++L    +K  ID +KLK C+E+A D IF
Sbjct  409   DLDISIXSYMGKVKLAFTMKKGIIDPQKLKLCMENALDMIF  449



>gb|KHN35242.1| O-acyltransferase WSD1 [Glycine soja]
Length=472

 Score =   449 bits (1154),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 221/471 (47%), Positives = 316/471 (67%), Gaps = 11/471 (2%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP  QY NSSV+   +   LE +VPI+D  ++ L  ++DVFLPINPRFSSIMV
Sbjct  7     EEVQEPVSPPGQYFNSSVICSYVFGFLEMAVPIDDSQTIPL--LKDVFLPINPRFSSIMV  64

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               ++G   WK V+V  E+H+KVP FP     E YD    +Y+T+I  +  PQ +PLWEIH
Sbjct  65    RDQDGRMKWKRVQVKPEEHVKVPKFPECNSPELYDQYFGDYVTRILTERTPQNKPLWEIH  124

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             I  YPTSNA G  IFKLH +LGDGYSLMGALLSCLQR+D+P+LPLTFP R  S  +Q + 
Sbjct  125   IINYPTSNAAGTLIFKLHHALGDGYSLMGALLSCLQRSDDPSLPLTFPSRTSSNSQQAKK  184

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
             S      FK +P  +S   ++++DF  + +K+ ++ DDKT I S  +G E  P +++ ++
Sbjct  185   S-----MFKKLPSFISSFFNSMSDFGSSLIKTRMIVDDKTPIRSGYEGTESMPFTLSNIS  239

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
              S+ ++K IKS L VTINDVI+G++ YG RLYMQE +R       T +V+ NTR +  GY
Sbjct  240   LSIDNIKAIKSKLGVTINDVITGLIFYGIRLYMQEIDRMARKANSTCVVMLNTRNV-RGY  298

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
             +SV EM K   +  WGN+I+FL   IPKL   G    SNPL FI+NA + +K++R S S+
Sbjct  299   QSVKEMQKSKVKGLWGNKISFLQVPIPKL---GQSKISNPLEFIWNARKQIKKKRRSFSV  355

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             YL G  L+   K+RG EA A+ + +TL+N+S+ ++N+ GP+E+ TLANHP+ G+YF ++G
Sbjct  356   YLIGLLLDLEMKIRGPEAVAKIIYKTLRNSSVVISNLFGPMEQMTLANHPISGLYFTMTG  415

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
              P+++ +T++SY   +R+T+ + K F+D +K K CIE A+D +F+  ++ S
Sbjct  416   GPENVDITIMSYVKVIRITLRTLKGFVDEQKFKFCIEKAYDVMFKAAMEIS  466



>ref|XP_008362473.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=645

 Score =   454 bits (1169),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 233/463 (50%), Positives = 313/463 (68%), Gaps = 19/463 (4%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E  L P SP   Y NSSVLS S++AVLE  +PI  DDS  LS + +VFLPI+PRFSSIM+
Sbjct  185   EEELEPVSPNGHYFNSSVLSVSVLAVLEYEIPI--DDSQTLSLLENVFLPISPRFSSIMI  242

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               KNG+K WK V+V LEDH+K PIFP     E YD    +Y++ I+   FPQ +PLWE+H
Sbjct  243   E-KNGKKQWKKVEVKLEDHVKTPIFPSNMSNESYDEYFDDYISSIATKRFPQDKPLWEVH  301

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             + +YP SNA GN IFKLH +LGDGYSLMGALLSCLQRADNP+LPLTFP R  S  K  EN
Sbjct  302   VIKYPNSNAAGNVIFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSRLPSETK-SEN  360

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
                       V + +S ++ T++DF W   KS   +DD + I S + G+EF PI+++T+T
Sbjct  361   ---------VVTKTISSLLSTISDFWWGISKSFRGEDDPSPIKSSNHGLEFAPITISTIT  411

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
              SL  +K IKS L VTIND+++G+V  G+RLYMQE  + +     TALVL NTR M   Y
Sbjct  412   ISLDRIKLIKSRLGVTINDILTGMVFLGSRLYMQEMNQSSREVHSTALVLLNTRFM-ANY  470

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
              S  EMIKPN++ PWGNR  FL   IPKL      + S+ L F++NA +++K++R S ++
Sbjct  471   ASTEEMIKPNSKSPWGNRFAFLHVPIPKLT-----EFSDVLDFVWNAQKIIKQKRXSLAI  525

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             Y T   LE   K  G EA ++++  TLKN+S+ +++MIGPV+K +LAN P+KG+YF V G
Sbjct  526   YFTSGLLEMLNKFGGHEAASRYVHSTLKNSSMMISSMIGPVQKMSLANQPIKGLYFLVVG  585

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
              P+ L ++++SY GK+RL   ++K  ID +KLK C+E+A + I
Sbjct  586   TPEELDISIVSYMGKVRLAXTAKKGIIDPQKLKLCMENALNMI  628


 Score =   221 bits (563),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 136/189 (72%), Gaps = 9/189 (5%)
 Frame = +3

Query  138  MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
            ME+  EG     L P SP     N+SVLS SI+AVLE  +PI  DDS  LS + +VFLPI
Sbjct  1    MENWEEG-----LEPVSPTGHXFNNSVLSISILAVLEYEIPI--DDSQFLSLLENVFLPI  53

Query  318  NPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFP  497
            NPRFSSIM+  KNG+K WK V+V LEDH+K PIFP     E YD    +YL+ ++   FP
Sbjct  54   NPRFSSIMIE-KNGKKQWKRVEVKLEDHVKTPIFPSNLSNESYDEYFDDYLSNVATKRFP  112

Query  498  QTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQ  677
            Q +PLWEIH+ +YPTSNA GN +FKLH +LGDGYSLMGALLSCLQRADNP+LPLTFP R+
Sbjct  113  QDKPLWEIHVIKYPTSNAVGNVVFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSRK  172

Query  678  GSGKKQGEN  704
             S K + EN
Sbjct  173  PS-KPKNEN  180



>ref|XP_007199626.1| hypothetical protein PRUPE_ppa016286mg [Prunus persica]
 gb|EMJ00825.1| hypothetical protein PRUPE_ppa016286mg [Prunus persica]
Length=466

 Score =   448 bits (1152),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 230/464 (50%), Positives = 312/464 (67%), Gaps = 19/464 (4%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP   Y  SSVLS S +AVLE+ +P ++  ++ L  +++VFLPI+PRFSSIMV   NG
Sbjct  11    PVSPTGHYFTSSVLSVSNLAVLETEIPFDESQTMYL--VQNVFLPISPRFSSIMVEN-NG  67

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             +K WK V+V LEDH+ +PIFP     E YD  L +Y++K++++     +PLWE HI +YP
Sbjct  68    KKRWKRVEVKLEDHVNIPIFPSSLSPEAYDKYLDDYISKLAVERLSPEKPLWEFHIIKYP  127

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TSNA GN I KLH +LGDG+SLM ALLSCLQRAD+P LPLTFP RQ S  K         
Sbjct  128   TSNAAGNVIIKLHHALGDGFSLMSALLSCLQRADDPRLPLTFPSRQRSQPKSES------  181

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
                  V ++ S V +T++DF W    S++ +DD T I S   G+EF+PI+V+TMTFSL  
Sbjct  182   ----LVTKVCSSVFNTLSDFWWGISNSTMDEDDLTPIRS-GKGIEFQPIAVSTMTFSLDQ  236

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +K IKS L VTINDV++G++  GTRLYMQE ++ +     TA+VL NTR M G Y S+ E
Sbjct  237   IKLIKSKLGVTINDVLTGMIFLGTRLYMQEIDKSSRKARGTAVVLLNTRMM-GDYTSIQE  295

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGD----SSNPLRFIYNAHRMVKRQRYSASLY  1247
             MIKPN++MPWGN  TFL   IP L  P D      S+  L F+  A +++  +R S ++Y
Sbjct  296   MIKPNSKMPWGNHFTFLHVPIPNLFLPEDDHPHEYSNIALEFVSKAQKIISTKRNSLAIY  355

Query  1248  LTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGA  1427
             LT +FLE   K  G EA A+++R TLKN+S+ ++N+IGPVE+  L NH +KG+YF V G+
Sbjct  356   LTSRFLEILNKFGGHEAAAKYIRSTLKNSSMVISNLIGPVEQMALGNHRIKGLYFLVLGS  415

Query  1428  PQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             P+ L VT++SY GK+R+    EK  ID +K KSC+E+AF+ I +
Sbjct  416   PEGLDVTIVSYMGKVRVAFKMEKGLIDPQKFKSCMENAFEMILK  459



>ref|XP_008791832.1| PREDICTED: O-acyltransferase WSD1-like [Phoenix dactylifera]
Length=478

 Score =   448 bits (1153),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 222/475 (47%), Positives = 321/475 (68%), Gaps = 16/475 (3%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             EG++     P SP  QY NSS LS  I+ V ES VPI  DDS  +S + ++FLPINPRFS
Sbjct  8     EGEEAAYNEPVSPTGQYFNSSALSICILVVFESDVPI--DDSPTMSTLENLFLPINPRFS  65

Query  333   SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
             SIMV  +NG + WK VKV L DH+ VP FP G  LE YD C+ +YL++I+++  PQ++PL
Sbjct  66    SIMVKDENGVQQWKRVKVKLGDHVNVPTFPTG--LESYDQCVQDYLSQIALEKLPQSRPL  123

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK  692
             W++HI +YPTSNA G  +FKLH +LGDG+SLMGAL SCL RAD+P+LPLTFP  +    K
Sbjct  124   WDLHIIKYPTSNAEGTMVFKLHHALGDGFSLMGALFSCLHRADDPSLPLTFPTPRDKAMK  183

Query  693   QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
             +    +        VPR+LS   +T+ D  W+  KS+L +DD T + S   G+EFRPI++
Sbjct  184   KSLWGSICG----VVPRVLSVCANTIRDVGWSLWKSTLAEDDTTPLRSGTPGLEFRPITI  239

Query  873   TTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQ---ESERETCNGECTALVLFNT  1043
             + + FSL  +++IK+++  T+NDVISGI+ YGT+LYMQ   E +R       TA+VL NT
Sbjct  240   SCVEFSLDDIRKIKAAVGGTVNDVISGIIFYGTKLYMQRVGEGQRRRA-ARVTAMVLLNT  298

Query  1044  RAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKR  1223
             R +   Y++V +M K NA+ PWGN+  FL  +IP  +   + + ++PL FI  A +++K 
Sbjct  299   RIVSR-YETVEKMTKTNAKSPWGNQFGFLHVSIPTSK---NAEKADPLYFIRKARKIIKA  354

Query  1224  QRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKG  1403
             +R S ++YLTG+ LE  RKL+G EA A ++  TL+ +S+T++N++GP+E+T +A HPV+ 
Sbjct  355   KRSSFAVYLTGRLLEMLRKLKGPEAAALYIHTTLRKSSMTVSNLVGPIEQTIIAGHPVRS  414

Query  1404  MYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTL  1568
              +F V G PQSL +T++SY GKL++ +  EK FID + L S ++ +F+ IF   +
Sbjct  415   FHFMVVGVPQSLTITVISYMGKLKVAMGVEKGFIDSELLISSLKKSFERIFEAAI  469



>gb|KEH17310.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=482

 Score =   447 bits (1151),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 315/469 (67%), Gaps = 11/469 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY+NSS LS  I+ VLES + I  DD+  LS + +VFLPI+ RFSSIM+   NG
Sbjct  11    PVSPTGQYLNSSSLSVCILGVLESEISISIDDNQTLSLLNNVFLPISTRFSSIMIKDHNG  70

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             EK WK V V +EDH+ +P+FP  K    YD  L +Y++KI+M+  PQ +PLWEIHI +YP
Sbjct  71    EKKWKKVDVKVEDHVYIPMFPTSKS-SLYDEYLDDYMSKIAMEHLPQDRPLWEIHIIKYP  129

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             T NA G  +FKLH +LGDGYSLMGALLSCL+RADNP LP T P  +   K          
Sbjct  130   TKNAAGTLVFKLHHALGDGYSLMGALLSCLERADNPFLPFTLPSSKIRPKSIFNTKAFFK  189

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             R+F   P + S V DT++DF W+ LKSSL++DD T I S +D ++ R I++++++FS+  
Sbjct  190   RSF---PSIFSKVFDTISDFGWSMLKSSLVEDDVTPIRSCEDDIKLRKINISSVSFSMDR  246

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +K++KS L V+ NDVI+G++ +G RLYM +  +++   + TALVL NTR +GG YKSV E
Sbjct  247   IKEVKSRLGVSTNDVIAGLIFFGIRLYMHQMNQDSSKNQSTALVLLNTRNIGG-YKSVKE  305

Query  1080  MI---KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYL  1250
             M+     N    WGN+  FL  +IPKL    D    NP+ FI+ AH+ + R++ S +  L
Sbjct  306   MVDIKNNNDGSAWGNQFAFLHVSIPKL---SDKKYENPIEFIWEAHKEINRKKNSLATPL  362

Query  1251  TGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAP  1430
             TG  L   +KLRG EA+A+F+  TL+N+S T++N+IGP+E+  LANHP+KG+YF V G P
Sbjct  363   TGMILNMVKKLRGPEASAKFVYNTLRNSSTTISNIIGPMEQMALANHPIKGLYFMVVGPP  422

Query  1431  QSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             +SL +T++SY GKLR+    EKDFID +K  SC+ES+ + I     K S
Sbjct  423   ESLTITIMSYMGKLRIAFGLEKDFIDKQKFISCMESSLEMIITAARKIS  471



>ref|XP_009396631.1| PREDICTED: O-acyltransferase WSD1-like [Musa acuminata subsp. 
malaccensis]
Length=497

 Score =   447 bits (1149),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 220/484 (45%), Positives = 322/484 (67%), Gaps = 10/484 (2%)
 Frame = +3

Query  102   RKKLSSIQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSV  281
             R  L S      +++ +E ++ VV  P SP  QY NSSVLS  I+A+ ES V I  DDS 
Sbjct  11    RGSLLSAMACDAVKTKVEVEETVVDDPVSPTGQYFNSSVLSIGILAIFESDVAI--DDSP  68

Query  282   ILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLS  461
              +S + ++FLPI+PRFSS+MV   +G + WK V + LEDH+ VP+FP G  LE YD  + 
Sbjct  69    TMSTLENLFLPIHPRFSSVMVKDDHGVRRWKRVALKLEDHVNVPVFPAG--LETYDDYIR  126

Query  462   EYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRAD  641
              Y++ I++  F Q++PLW++HI +YPT +A G  +F++H +LGDG+SLM AL SC +RAD
Sbjct  127   GYISDIAVAEFSQSRPLWDLHILKYPTKSAAGTMVFRIHHALGDGFSLMSALFSCFRRAD  186

Query  642   NPALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDK  821
             +P+LPLTFP  + +   QG  S A  RA++ VPR LS  ++TV DF W+ LK++ L DD 
Sbjct  187   DPSLPLTFPSSRATKPVQG--SGAWWRAWRNVPRALSVCMNTVRDFGWSLLKTNYLADDW  244

Query  822   TAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERE  1001
             T + S++ GVEFRP+ ++T+T SL  ++ +K+ L  T+NDVISG + YGT+LY Q +   
Sbjct  245   TPVRSEEAGVEFRPMEISTVTLSLDEVRHVKAKLGGTVNDVISGTIFYGTQLYFQATAPG  304

Query  1002  TCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSN  1181
             +     TALVL NTR M   Y+S+ EM  P+A  PWGNR  FL   +P     G+ D+S+
Sbjct  305   SKEARVTALVLLNTR-MIASYQSLKEMAGPDATNPWGNRFGFLHVPVP---VSGNPDASD  360

Query  1182  PLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIG  1361
             PL F+  A +++K ++ S +++L G+ LE  RKLRG E  A+++  TL+NTS+T++N+ G
Sbjct  361   PLSFVLKARQIIKAKKSSLAVHLNGRLLETIRKLRGAETAARYIHSTLRNTSMTISNLSG  420

Query  1362  PVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESA  1541
             P+E+  +A HP+   YF   G+PQSL V+++SY GKL++ + +EK FID   L SC+E +
Sbjct  421   PMEQMIIAGHPIGSFYFMTVGSPQSLTVSVVSYMGKLKVAMGTEKGFIDAGLLVSCMEQS  480

Query  1542  FDEI  1553
             F  I
Sbjct  481   FRRI  484



>ref|XP_007198908.1| hypothetical protein PRUPE_ppa025020mg [Prunus persica]
 gb|EMJ00107.1| hypothetical protein PRUPE_ppa025020mg [Prunus persica]
Length=458

 Score =   445 bits (1145),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 315/462 (68%), Gaps = 20/462 (4%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP  QY +S  LS S +AVLES +PI D +S  +  +++VFLPI+PRFSSIMV   
Sbjct  9     LEPVSPNGQYFSSDALSLSFLAVLESEIPI-DLESQSMFLLKNVFLPISPRFSSIMVEN-  66

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             NG+K WK V+V LEDHL +P FP     + YD  + +YL+K+S + FPQ +PLWE+HI  
Sbjct  67    NGKKEWKRVEVKLEDHLHIPTFPSNLSPKSYDKYIDDYLSKLSTERFPQGKPLWEVHIVN  126

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
             YPTSNA GN IFK H +LGDGYSLMGAL+S LQRAD+P+LPLTFP +Q S  K+    N 
Sbjct  127   YPTSNAAGNIIFKFHHALGDGYSLMGALISSLQRADDPSLPLTFPSQQRSESKE----NF  182

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
             V + F AV        +T++DF W+     + +DD T I S +D +EFRP +V+TMTFSL
Sbjct  183   VTKTFSAVG-------NTISDF-WSASLKIMKEDDLTPIKSGNDAIEFRPSTVSTMTFSL  234

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
               +K +K+ L +T+NDV++G++ +GTRLYMQE  + +   +CT+++L NTR + G Y  +
Sbjct  235   DQIKSMKNKLGMTVNDVLTGMIFFGTRLYMQEINQSSSKADCTSIMLINTRLI-GDYVPI  293

Query  1074  SEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLT  1253
              EM+KPN + PWGNR T++   +PKL        SN L FI+N  +++K++R S + Y +
Sbjct  294   EEMMKPNGKTPWGNRFTWVHIPVPKLT-----QLSNALDFIWNTQKIIKKKRSSLAAYFS  348

Query  1254  GQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
              + LE   K    EA+++++  T+KN+SI ++NMIGPVEK +LANHP+KG+YF + G PQ
Sbjct  349   SRLLEILDKFGSHEASSRYIHHTVKNSSIVISNMIGPVEKMSLANHPIKGLYFLMGGIPQ  408

Query  1434  SLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
                +T++SY GK+RL    EK  ID +K KSC+++A++ I +
Sbjct  409   GFQITIVSYMGKVRLGFKMEKGLIDPQKFKSCMQNAWEMILK  450



>ref|XP_009336219.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=467

 Score =   444 bits (1142),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 227/471 (48%), Positives = 312/471 (66%), Gaps = 19/471 (4%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E  L P SP   Y N+SVLS SI+A+LE  +PI  DDS  LS + +VFL INPRFSS+M+
Sbjct  5     EEELEPVSPNGHYFNNSVLSLSILAILEYEIPI--DDSQFLSLLENVFLRINPRFSSVMI  62

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               +NG+K WK V+V LEDHLK PIFP     E YD    +Y++ I+   FPQ +PLWE+H
Sbjct  63    E-QNGKKQWKKVEVKLEDHLKTPIFPSNLSNESYDEYFDDYISSIATKRFPQDKPLWEVH  121

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             + +YP SNA GN IFKLH +LGDGYSLMGALLSCLQRADNP+LPLTFP    S  K  EN
Sbjct  122   VIKYPNSNAAGNLIFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSLLPSETK-SEN  180

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
                       + + +S ++ T++D  W   KS   +DD + I S  +G+EF PI+++T+T
Sbjct  181   ---------VMTKTMSSLLSTISDVWWGISKSFRGEDDPSPIKSSKNGLEFAPITISTIT  231

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
              SL  ++ IKS L VT NDV++G++  G+RLYMQ   + +     T+LVL NTR M   Y
Sbjct  232   ISLDRIRLIKSKLGVTTNDVLTGMIFLGSRLYMQALNQSSREAHSTSLVLLNTRFM-ANY  290

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
              S+ EMIKPN++  WGN  TFL   IPKL      + SN L F++NAH+++K++R S+++
Sbjct  291   ASIEEMIKPNSKSSWGNHFTFLHVPIPKLT-----EFSNVLDFVWNAHKIIKQKRNSSAI  345

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             Y T   LE   K  G EA ++++  TLKN+S+ +T+MIGPVEK +LAN P+KG+YF V G
Sbjct  346   YFTSGLLEMLNKFGGHEAASRYIHSTLKNSSVVITSMIGPVEKMSLANQPIKGLYFFVVG  405

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
              P++L ++++SY G ++L    +K  ID +KLK C+E+A + I     K+S
Sbjct  406   TPEALDISIVSYMGNVKLAFTVKKGIIDPQKLKLCMENALNMISNAADKNS  456



>ref|XP_010260233.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=474

 Score =   444 bits (1142),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 221/472 (47%), Positives = 309/472 (65%), Gaps = 11/472 (2%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E  DE  LA  SP +QY+NSS LS  I+A LE  VPI+D  +V L  I+++FLPINPRFS
Sbjct  12    EISDEAELA--SPHAQYLNSSALSLCILAALEIEVPIDDSQTVAL--IKEMFLPINPRFS  67

Query  333   SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
             SI+V    G   W+ V V  EDH+ VP+FP G     YD    +Y++KIS +     +P 
Sbjct  68    SILVKDDQGIGQWRRVSVKPEDHVHVPVFPGGLSTAAYDGYFQDYMSKISTETLRPDRPP  127

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK  692
             WEIH+F+YPTS+A G  +FKLH +LGDG+SLMGAL SCLQRADNP+LPLTFP    S  K
Sbjct  128   WEIHLFKYPTSSAAGTVVFKLHHALGDGFSLMGALFSCLQRADNPSLPLTFP---ASLSK  184

Query  693   QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
               ++ +          R +S V ++ ++F+W+ L+S+  +DDKT I S D G+EFRP  V
Sbjct  185   PIQDDHGSCGILTRTLRYISMVFNSTSEFAWSLLRSNFWEDDKTPIRSGDAGIEFRPKIV  244

Query  873   TTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAM  1052
             +T+T S+  ++QIK  +  TINDV+ GI+ YGTRLYM  S +++ N   TALVL NTR +
Sbjct  245   STLTLSIDQIRQIKDKIGATINDVLCGIIFYGTRLYMHTSSKKSSNLCSTALVLLNTRII  304

Query  1053  GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
              G  + + EM+K   + PWGN   FL   IP L    D D++NPL F+  A ++++++R 
Sbjct  305   -GNIQPIKEMMKQGTKAPWGNHFAFLHVPIPTL---ADSDTANPLDFVLKAKQIIRKKRS  360

Query  1233  SASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             S ++YL G+ ++  R+LRG E TAQ++  T++ TS+ ++NM+GP EK  LA +P+ G+YF
Sbjct  361   SLAVYLNGKLIDTMRQLRGPEKTAQYIHSTIRKTSMGISNMVGPKEKMCLAGYPIGGLYF  420

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTL  1568
              V+GAPQ + VT +SY G LR+ +  EK FID +  KSC+E AF+ I    L
Sbjct  421   LVTGAPQCVSVTAVSYMGNLRIAVAVEKGFIDNQLFKSCMEKAFERISEAAL  472



>ref|XP_009335177.1| PREDICTED: O-acyltransferase WSD1-like [Pyrus x bretschneideri]
Length=483

 Score =   444 bits (1141),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 232/478 (49%), Positives = 323/478 (68%), Gaps = 27/478 (6%)
 Frame = +3

Query  147   HLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPR  326
             HLE D+ VVL P SP +QY  SSVLS S I V+E   P+ +  ++ L  ++ +FLPI+PR
Sbjct  3     HLEEDEVVVLEPVSPTAQYFTSSVLSVSNIGVMELENPLSESQAISL--LKTLFLPISPR  60

Query  327   FSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQ  506
             FSSI+V   NG+K WK V+V LE+H+ VP+ P     E Y+  L  Y++K++++   Q +
Sbjct  61    FSSIVVE-INGKKRWKRVEVKLEEHISVPVIPSNLSTESYEKYLDGYISKLALERLSQDK  119

Query  507   PLWEIHIFRYPT--SNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQG  680
             PLWE+HI  YPT  +NA  N IFKLH +LGDG+SLM A+LSCL+RADNP+LPLTFP RQ 
Sbjct  120   PLWELHILNYPTRNNNAACNLIFKLHHALGDGFSLMSAILSCLRRADNPSLPLTFPSRQR  179

Query  681   SGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFR  860
             S +   E+          + R +S V +T++D  W   +S++ +DD + I S  +G+EF+
Sbjct  180   SQQMSDES---------FLSRTISSVFNTLSDI-W---RSTVGEDDLSPIRS-GNGIEFQ  225

Query  861   PISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFN  1040
             PI+V TMTFSL  +K IKS L VT+NDV++G++  GTRLYMQE  R +     TA+VL N
Sbjct  226   PITVATMTFSLDQIKSIKSKLGVTVNDVLAGMIFLGTRLYMQEINRSSSKARGTAVVLLN  285

Query  1041  TRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDS-------SNPLRFIY  1199
             TR MG  Y S+ EM+KP+++MPWGN  TFL   IP L  P D D        SN L F++
Sbjct  286   TRMMGK-YTSIQEMMKPDSKMPWGNHFTFLHVPIPNLSLPEDHDHDFPADQHSNALDFVW  344

Query  1200  NAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTT  1379
              A +++ R+R S ++YLT +FLEF  K  G EA A+++  TLKNTS+ ++N+IGPVE+  
Sbjct  345   EAQKIITRKRSSLAIYLTCRFLEFLNKFGGHEAAARYIHSTLKNTSMMISNLIGPVEQMA  404

Query  1380  LANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             LAN+PVKGMYF V G+P+ L VT++SY GK+R+    EK  I+ +K KSC+++AF+ I
Sbjct  405   LANNPVKGMYFLVFGSPEGLDVTIVSYMGKVRVAFKMEKGLIEPQKFKSCMQNAFEMI  462



>ref|XP_008237425.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=466

 Score =   443 bits (1139),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 230/463 (50%), Positives = 309/463 (67%), Gaps = 20/463 (4%)
 Frame = +3

Query  186   SPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNGEK  365
             SP   Y  SSVLS S +AVLE+ +P   D+S  +S +++VFLPI+PRFSSIMV   NG+K
Sbjct  12    SPTGHYFTSSVLSVSNLAVLETEIPF--DESQTMSLVQNVFLPISPRFSSIMVEN-NGKK  68

Query  366   NWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTS  545
              WK V+V LEDH+ +PIFP     E YD  L +Y++K++++     +PLWE HI +YPTS
Sbjct  69    RWKRVEVKLEDHVTIPIFPPNLSPESYDKYLDDYISKLAVERLSPEKPLWEFHIIKYPTS  128

Query  546   NAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVARA  725
             NA GN I KLH +LGDG+SLM ALLSCLQRAD+P LPLTFP RQ S  K           
Sbjct  129   NAAGNVIIKLHHALGDGFSLMSALLSCLQRADDPRLPLTFPSRQRSQPKSES--------  180

Query  726   FKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLK  905
                V ++ S V +T++DF W    S++ +DD T I S   G+EF+PI+V+TMTFSL  +K
Sbjct  181   --LVTKVCSSVFNTLSDFWWGISNSTMDEDDLTPIRS-GKGIEFQPIAVSTMTFSLDQIK  237

Query  906   QIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMI  1085
              IK  L VTINDV++G++  GTRLYMQE ++ +     TA+VL NTR M G Y S+ EMI
Sbjct  238   LIKRKLGVTINDVLTGMIFLGTRLYMQEIDKSSRKARGTAVVLLNTRMM-GDYTSIQEMI  296

Query  1086  KPNAEMPWGNRITFLPFAIPKLRSPGDG-----DSSNPLRFIYNAHRMVKRQRYSASLYL  1250
             KPN++MPWGN  TFL   IP L  P D       S   L F+  A +++  +R S ++YL
Sbjct  297   KPNSKMPWGNHFTFLHVPIPNLFLPEDDHPHEYSSIIALEFVSKAQKIISTKRNSLAIYL  356

Query  1251  TGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAP  1430
             T +FLE   +  G EA A+++R TLKN+S+ ++NMIGPVE+  L NH +KG+YF V G+P
Sbjct  357   TSRFLEILNRFGGHEAAAKYIRSTLKNSSMVISNMIGPVEQMALGNHRIKGLYFLVLGSP  416

Query  1431  QSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             + L VT++SY GK+R+    EK  ID +K KSC+E+AF+ I +
Sbjct  417   EGLDVTIVSYMGKVRVAFKMEKGLIDPQKFKSCMENAFEMILK  459



>gb|KEH30692.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=471

 Score =   441 bits (1135),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 218/466 (47%), Positives = 315/466 (68%), Gaps = 17/466 (4%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E +  P SP  QY N+  L   +   LE  +PI+D  ++ L  I+ +FLPINPRFSSI+V
Sbjct  5     EDLTEPVSPSGQYFNTPPLCSYVFGFLELEIPIDDSQAMYL--IQHLFLPINPRFSSIIV  62

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               K+G   WK V+V  +DH KVP+FP  + +EFYD    +Y++KI ++  P+ +PLWEIH
Sbjct  63    RDKDGNMKWKKVEVNPKDHFKVPVFPKNESIEFYDQDFDDYVSKILIERTPKDKPLWEIH  122

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG---KKQ  695
             + +YPTSNA    IFKLH +LGDGYSLMGALLSCL RAD+P+LPL+FP R+ S     K+
Sbjct  123   VIKYPTSNAAYTIIFKLHHALGDGYSLMGALLSCLHRADDPSLPLSFPNRKSSQLLTPKR  182

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
             G         FK  P  +  + ++++DF W+ LKSS+++DDK+ I + ++G EF P +++
Sbjct  183   G--------FFKWFPSTIFSLFNSISDFGWSILKSSIIEDDKSPIWNGEEGSEFLPCALS  234

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
              ++FSL  +  IKS L VTINDVI+G++ YG RLYMQE + +      T LVL +TR + 
Sbjct  235   NLSFSLDEIITIKSKLGVTINDVITGVIFYGIRLYMQEIDNKATTSNSTGLVLLSTRNI-  293

Query  1056  GGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYS  1235
             G Y+S+ +M K +++ PWGN I+FL   IPKL  P     SNPL F++ A +++KR+R +
Sbjct  294   GSYQSIQDMTKADSKSPWGNHISFLHIPIPKLSQPS---LSNPLDFVWKAQKIIKRKRST  350

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFA  1415
              +++LT   L+   KLRG EA A+ L  TL+N+S+ M+N+IGPVE   LANHPVKG+YF 
Sbjct  351   FTVFLTEWLLDMQLKLRGHEAVAKHLYGTLRNSSVVMSNLIGPVEPMALANHPVKGLYFI  410

Query  1416  VSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             +SGAP+S+ + ++SYA  LR+T+ ++KD ID +K K C+  A++ I
Sbjct  411   MSGAPESIDIAVMSYARILRITLKTQKDLIDEQKFKLCMARAYEII  456



>ref|XP_010935670.1| PREDICTED: O-acyltransferase WSD1-like [Elaeis guineensis]
Length=475

 Score =   441 bits (1135),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 219/474 (46%), Positives = 314/474 (66%), Gaps = 19/474 (4%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +EG       P SP  QY +SS LS +I+A+ ES +PI  DDS  +  + ++FLPINPRF
Sbjct  3     VEGGQVAENQPVSPMGQYFSSSALSVNILAIFESEIPI--DDSQAMWTLENLFLPINPRF  60

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIMV  ++G   W+ VK+ LE+H+ +P+FP G  LEFYD  + EYL+KI  +  P  +P
Sbjct  61    SSIMVKNEHGILTWRKVKINLEEHVNIPVFPPG--LEFYDDYVQEYLSKIGTELLPHDRP  118

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LW IHI  YPT +A G  +FKLH +LGDG+SLMGAL SCLQRAD+P+LPL FP       
Sbjct  119   LWGIHIINYPTRDAPGTMVFKLHHALGDGFSLMGALFSCLQRADDPSLPLNFP-------  171

Query  690   KQGENSNAVA---RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFR  860
               GE+S   A   R  K++ R L    +T  DF  +FL S+ ++DD+T I S D G+E R
Sbjct  172   SSGESSRQFAKWIRIDKSIYRFLHMCFNTFWDFGRSFLMSNCMEDDRTPIRSGDSGIEIR  231

Query  861   PISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLF  1037
             PI+++T TFSL+ +KQIK+ L  T+NDV++GI+ YG +LYMQ  S+        TALV  
Sbjct  232   PITLSTATFSLHDIKQIKAKLKATVNDVVTGIIFYGIQLYMQAASQGNIKTSRVTALVTL  291

Query  1038  NTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMV  1217
             NTRA+   Y+S+ EM KPN++  WGN   FL  +IPK +   D ++++PL F++ A R++
Sbjct  292   NTRAIKS-YQSIQEMTKPNSKSRWGNHFAFLHVSIPKCK---DAENADPLEFVHKAKRII  347

Query  1218  KRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPV  1397
             + +R S ++YLT   LE  RKL+G EA A+++  T KNT++ ++NMIGP+E+  +A HP+
Sbjct  348   RSKRNSLAIYLTSGLLELLRKLKGPEAAARYIHATSKNTTLVISNMIGPMEQVQIAGHPI  407

Query  1398  KGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             K +YF +   PQSL VT++SY GK+++ +  EK FI+ +   SC+E +F  I++
Sbjct  408   KSLYFMMVHVPQSLTVTIISYMGKVKMAVGMEKGFINSEVFVSCMEKSFQRIYK  461



>ref|XP_008342897.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=467

 Score =   439 bits (1129),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 225/471 (48%), Positives = 309/471 (66%), Gaps = 19/471 (4%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E  L P SP   Y NSSVLS S++ VLE  +PIED  +  LS + +VFLPINPRFSSIM+
Sbjct  5     EEELEPVSPNGHYFNSSVLSISVLGVLEFEIPIEDSQT--LSLLENVFLPINPRFSSIMI  62

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
                NG+K WK V+V LEDH+K PIFP     E YD    +Y++ I+   FPQ +PLWE+H
Sbjct  63    EN-NGKKQWKRVEVKLEDHVKTPIFPSNLSNESYDEYFDDYVSSIATKRFPQDKPLWEVH  121

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             + +YP SNA GN IFKLH +LGDGYSLMGALLSCLQRADNP+LPLTFP    S  K  EN
Sbjct  122   VIKYPNSNAAGNVIFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSLLPSETK-SEN  180

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
                       + + +S ++ TV+DF W   KS   +DD + I S  +G+EF PI+++T+T
Sbjct  181   ---------IMTKTISSLLSTVSDFWWGISKSFKGEDDPSPIKSSKNGLEFAPITISTIT  231

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
              SL  ++ IKS L VTIN V++G+V  G+RLYMQE  + +     TALVL NTR M   Y
Sbjct  232   ISLDRIRLIKSKLGVTINGVLTGMVFLGSRLYMQEMNQSSREAHSTALVLLNTRIM-ANY  290

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
              S+ EM+KP+++ PWGN  TF+   IPKL      + SN L +++  H+++K++R S+++
Sbjct  291   TSIEEMVKPDSKSPWGNHFTFVHVPIPKLT-----EFSNVLDYVWKTHKIIKQKRNSSAI  345

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             Y T   L+   K  G EA ++++  TLKN+S+  T+MIGPVEK +LAN P+KG YF   G
Sbjct  346   YFTSGLLKMLNKFGGXEAASRYVCSTLKNSSVVXTSMIGPVEKMSLANQPIKGFYFLTVG  405

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
              P+ L ++++SY G+++L    +K  ID +KLK C+E+A + I     K+S
Sbjct  406   TPEELDISIVSYMGRVKLAFTVKKGIIDPQKLKLCMENALNMISNAADKNS  456



>gb|KHN07508.1| O-acyltransferase WSD1 [Glycine soja]
Length=469

 Score =   438 bits (1127),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 229/461 (50%), Positives = 316/461 (69%), Gaps = 15/461 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY+ SS LS  I+ VLES VPI+D  +V L  ++++FLPIN RFSSIM+  KNG
Sbjct  12    PVSPTGQYLTSSSLSVYILGVLESEVPIDDSQTVPL--LQNLFLPINSRFSSIMIRDKNG  69

Query  360   EKNWKPVKVILEDHLKVPIFPVGKP--LEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             EK WK V+V LEDH+KVP FP GK   L  YD  L EY++ I+++  PQ +PLWE+HI +
Sbjct  70    EKKWKKVEVKLEDHIKVPTFPNGKSSNLFLYDEYLDEYMSTIAVEHLPQNRPLWELHIIK  129

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
             YPTSNA G  +FKLH +LGDG+SLMGALLSC+QRADN +LP T P  Q        N+  
Sbjct  130   YPTSNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLPSSQRPKASSISNTKG  189

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
                 FK +P +      T+++F W+FLKS L++DD+T I S  +  + R ++++ +TFSL
Sbjct  190   F---FKKLPSIF---FQTISEFGWSFLKSKLIEDDQTPIRSCAEDFKTRQMTISDVTFSL  243

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
               +K +KS L V+INDV++G++ +G RLYMQE   ++   + TALVL NTR + G YKSV
Sbjct  244   DLIKDVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNIEG-YKSV  302

Query  1074  SEMI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYL  1250
              EMI K N+   WGN+  FL  +IP+L    D   +NPL FI  AH+ + +++ S +  L
Sbjct  303   KEMIEKTNSRSAWGNQYAFLHVSIPEL---SDSKYANPLEFIREAHKDMTKKKNSLATPL  359

Query  1251  TGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAP  1430
             TG  L+  RKLRG EA A +LR TL+N+S T++N+IGPVE+  +ANHP+KG YF V+G+P
Sbjct  360   TGMLLDMLRKLRGPEAAASYLRSTLRNSSTTISNIIGPVEQMAVANHPIKGFYFMVAGSP  419

Query  1431  QSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             +SL +T++SY GK+R+    EKDFID +  KSC+E++ + I
Sbjct  420   ESLTMTIMSYMGKIRIAFGVEKDFIDKQLFKSCLENSLEMI  460



>gb|KEH21614.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=421

 Score =   435 bits (1119),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 218/425 (51%), Positives = 295/425 (69%), Gaps = 12/425 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E +  P SP  QY NSS L   IIAVLE  V I+D  +  L  +RDVFLPI+PRFSSIM
Sbjct  6     EEQLQEPVSPIGQYFNSSSLCLYIIAVLEFEVSIDDLQAFTL--LRDVFLPISPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  KN +K WK V V L+DH+K PIF  GK +EFYD    +YL+ I+++P PQ +PLWE+
Sbjct  64    VQDKNEDKRWKQVDVNLKDHVKKPIFSKGKKVEFYDKSFQDYLSTIAIEPLPQGKPLWEV  123

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI  YPT N+ G  IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP  + S  K   
Sbjct  124   HIVNYPTKNSLGTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSLKPS--KLEP  181

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              + +  R F      +S V +T +DF W+ LKSS++ DDKT I S D+G +F+PIS++ +
Sbjct  182   YNKSFWRKFSWT---MSSVFNTASDFGWSVLKSSIIVDDKTPIRSGDEGADFQPISISNI  238

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
              FS+ H+K IKS L VT+NDV++GIV YGTRLYMQE + ++     TALVL NTR +  G
Sbjct  239   AFSIDHIKDIKSKLGVTMNDVVTGIVFYGTRLYMQEMDSKSKTSNSTALVLLNTRNV-EG  297

Query  1062  YKSVSEMIK-PNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
             Y+S+ +M+    ++ PWGN+++FL   IPKL    +   SNPL FIY+ H ++ R++ S 
Sbjct  298   YQSIDDMLNTKKSKGPWGNKLSFLHVPIPKL---NENRISNPLEFIYDTHNIINRKKQSL  354

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
             ++ LTG  L+   KLRG EA AQ +RRT+  +S  +TN++GPV++ +LANHPVKG+YF +
Sbjct  355   AVALTGTLLDIEGKLRGQEAVAQHIRRTITMSSTVVTNLVGPVQQMSLANHPVKGLYFTL  414

Query  1419  SGAPQ  1433
             +G P+
Sbjct  415   AGGPE  419



>ref|NP_001241558.1| uncharacterized protein LOC100777968 [Glycine max]
 gb|ACU18073.1| unknown [Glycine max]
Length=469

 Score =   436 bits (1122),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 228/461 (49%), Positives = 316/461 (69%), Gaps = 15/461 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY+ SS LS  I+ VLES VPI+D  +V L  ++++FLPIN RFSSIM+  KNG
Sbjct  12    PVSPTGQYLTSSSLSVYILGVLESEVPIDDSQTVPL--LQNLFLPINSRFSSIMIRDKNG  69

Query  360   EKNWKPVKVILEDHLKVPIFPVGKP--LEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             EK WK V+V LEDH+KVP FP GK   L  YD  L EY++ I+++  PQ +PLWE+HI +
Sbjct  70    EKKWKKVEVKLEDHIKVPTFPNGKSSNLFLYDEYLDEYMSTIAVEHLPQNRPLWELHIIK  129

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
             YPTSNA G  +FKLH +LGDG+SLMGALLSC+QRADN +LP T P  Q        N+  
Sbjct  130   YPTSNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLPSSQRPKASSISNTKG  189

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
                 FK +P +      T+++F W+FLKS L++DD+T I S  +  + R ++++ +TFSL
Sbjct  190   F---FKKLPSIF---FQTISEFGWSFLKSKLIEDDQTPIRSCAEDFKTRQMTISDVTFSL  243

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
               +K +KS L V+INDV++G++ +G RLYMQE   ++   + TALVL NTR + G YKSV
Sbjct  244   DLIKDVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNIEG-YKSV  302

Query  1074  SEMI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYL  1250
              EMI K N+   WGN+  FL  +IP+L    D   +NPL FI  AH+ + +++ S +  L
Sbjct  303   KEMIEKTNSRSAWGNQYAFLHVSIPEL---SDSKYANPLEFIREAHKDMTKKKNSLATPL  359

Query  1251  TGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAP  1430
             TG  L+  RKLRG EA A +LR TL+N+S T++N+IGPVE+  +ANHP+KG YF V+G+P
Sbjct  360   TGMLLDMLRKLRGPEAAASYLRSTLRNSSTTISNIIGPVEQMAVANHPIKGFYFMVAGSP  419

Query  1431  QSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             +SL +T++SY GK+R+    EK+FID +  KSC+E++ + I
Sbjct  420   ESLTMTIMSYMGKIRIAFGVEKNFIDKQLFKSCLENSLEMI  460



>ref|XP_003539933.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
 gb|KHN35218.1| O-acyltransferase WSD1 [Glycine soja]
Length=470

 Score =   435 bits (1119),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 308/464 (66%), Gaps = 10/464 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  ++ N++VL   +   LES VPIE   +  L E  DVFLP+NP FSSIMV  + G
Sbjct  10    PVSPSGRFFNTTVLCAYVFGFLESEVPIEFSQAKYLFE--DVFLPVNPHFSSIMVRDEEG  67

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             E  WK V+V  EDH+K+P FP  + LE YD    +Y+TKI M+  PQ +PLWEIH+ +YP
Sbjct  68    EMKWKRVEVKFEDHVKIPTFPENESLELYDQYFDDYVTKILMERTPQDKPLWEIHVIKYP  127

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TSNA G  IFKLH +LGDGYSL+GALLSCLQRAD+P+LPL+FP R+ S            
Sbjct  128   TSNAAGTLIFKLHHALGDGYSLVGALLSCLQRADDPSLPLSFPSRKSSASSSPSKKG---  184

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
               F+     L    ++++DF W+ +KSS+++DD+T I S ++GVE  P  ++ ++F L  
Sbjct  185   -FFRLFSSTLFSFFNSISDFGWSIVKSSIVEDDETPIRSGEEGVESLPCVISNISFDLDQ  243

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +K+IKS L VT+NDVI+G + YG RLYMQE + +      T LV+ +TR + G Y+S+ E
Sbjct  244   VKKIKSKLGVTVNDVITGAIFYGIRLYMQEIDNKAGKANSTGLVMLSTRNI-GSYQSIQE  302

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M+K +++ PWGN I+FL   IPKL        SNPL F++ A +++KR+R S +++L   
Sbjct  303   MMKADSKSPWGNHISFLHVPIPKL---SQASLSNPLEFVWKAQKIIKRKRKSFTVFLIEW  359

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              L+   KLRG EA A+ +  TL+N+S+ ++N+IGP+E   LANHPVKG+YF ++G P+S+
Sbjct  360   LLDMELKLRGHEAVAKHIYGTLRNSSVVVSNLIGPIEPMALANHPVKGLYFTMTGGPESI  419

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
              + ++SY   LR+T+ ++K FID KK K C+  AF+ I +  ++
Sbjct  420   NIAVISYTKTLRITLKTQKGFIDEKKFKFCVVKAFEVISKAAME  463



>ref|XP_007151640.1| hypothetical protein PHAVU_004G063900g [Phaseolus vulgaris]
 gb|ESW23634.1| hypothetical protein PHAVU_004G063900g [Phaseolus vulgaris]
Length=468

 Score =   432 bits (1112),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 222/475 (47%), Positives = 322/475 (68%), Gaps = 19/475 (4%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
             ME+  EG+   ++ P SP  QY+ SS LS  I+AV+E+ +PI+D  +V L  ++++FLPI
Sbjct  1     MEAFDEGE---IVEPVSPTGQYLTSSSLSIYILAVMETEIPIDDSQTVPL--LQNLFLPI  55

Query  318   NPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLE--FYDYCLSEYLTKISMDP  491
             N RFSSIM+  KNG+K WK V+V L DH+KVP F  G       YD  L EY++KI+++ 
Sbjct  56    NSRFSSIMIKDKNGDKKWKKVEVKLGDHIKVPKFQSGNESSNFLYDEYLDEYMSKIAVEH  115

Query  492   FPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPR  671
              PQ +PLWE+HI +YPTS A G  +FKLH +LGDG+SLMGALLSC++RAD  +LP T P 
Sbjct  116   LPQHRPLWELHIVKYPTSKAMGTLVFKLHHALGDGFSLMGALLSCMERADKASLPFTLPS  175

Query  672   RQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGV  851
              Q   K    N+  V   FK +P +    + T+++F W+ LKS+L++DD+T I S  +  
Sbjct  176   SQ-RPKSPISNTKVV---FKRLPSIF---LRTISEFGWSLLKSNLVEDDQTPIRSCSEDT  228

Query  852   EFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALV  1031
             + R I+++ ++FSL  +K++KS L V+INDV++G++ +G RLYMQE   ++  G+ TALV
Sbjct  229   KMRHINISDVSFSLDLVKEVKSKLGVSINDVLAGVIFFGIRLYMQEISLKSSQGQSTALV  288

Query  1032  LFNTRAMGGGYKSVSEMI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAH  1208
             L NTR + G YKS+ EM+ K N    WGN+  FL   IP+L    D   +NPL FI+ AH
Sbjct  289   LLNTRNIEG-YKSIKEMVEKTNTSSAWGNQYAFLHVPIPELT---DSKYANPLEFIWEAH  344

Query  1209  RMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLAN  1388
             + + +++ S +  LTG  L+  RKLRG EA A++L  TL+N+S T++NMIGPVE+  +AN
Sbjct  345   KEMIKKKNSLATPLTGMLLDMLRKLRGPEAAAKYLYSTLRNSSTTISNMIGPVEQMAVAN  404

Query  1389  HPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
              P+KG YF V+G+P+SL +T++SY GK+R+    EKDFID +  KS +E++ + I
Sbjct  405   IPIKGFYFMVAGSPESLTMTIMSYMGKIRIAFGVEKDFIDKQLFKSSLENSLEMI  459



>ref|XP_004136846.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis sativus]
Length=464

 Score =   431 bits (1109),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 222/478 (46%), Positives = 317/478 (66%), Gaps = 17/478 (4%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +E +DE  L P SP +Q +N+S LS S+IAVLE  +PI  D++ I+   +D F+P+N  F
Sbjct  1     MEEEDEF-LEPMSPTAQCLNTSSLSISVIAVLEFEIPI--DEAKIICYAKD-FIPLNSLF  56

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSI V   NGE+ WK V+V +E+ + V   P    +E  D   +EY+TK+S+    Q +P
Sbjct  57    SSITVNDINGERKWKKVEVKVEEQIVVATPPSDLSIELNDAFFNEYITKLSVQELDQNKP  116

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFP--RRQGS  683
             LWEIHI   PTS A  N I K H SLGDGYS+MG LLS ++RADNP+LPLTFP   +  +
Sbjct  117   LWEIHILNCPTSTAAANLILKFHHSLGDGYSVMGLLLSTMKRADNPSLPLTFPFNGKMIN  176

Query  684   GKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRP  863
              KK G+ S+ V+         L   +++V DF  + +KSS+L+D+ T I S  DGVEF+P
Sbjct  177   SKKLGQISSGVSH-------FLLSSINSVLDFGLSLIKSSVLEDELTPIRSGGDGVEFKP  229

Query  864   ISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNT  1043
               + T+TFSL+ +KQIKS L VT+NDV++G++  G RLYM+E+  ++     TALVL NT
Sbjct  230   TEIWTITFSLHQIKQIKSKLRVTVNDVVAGMLFLGIRLYMEETHPDSTKSNSTALVLLNT  289

Query  1044  RAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKR  1223
             R M G YK + +M+ PN+  PWGNR  FL   IPKL    D + SNPL+F+  A +++KR
Sbjct  290   R-MFGTYKCMEDMLNPNSNTPWGNRFGFLHIDIPKLT---DFNLSNPLQFVQAAQKLIKR  345

Query  1224  QRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKG  1403
             +R S++++L  + +E   K RG E  ++++ +T+KN+S+++TN+IGP EK TL  HPVKG
Sbjct  346   KRDSSAVFLVDKLMEIIHKFRGSEVASKYVYKTIKNSSLSITNLIGPKEKMTLTGHPVKG  405

Query  1404  MYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             MYF V G PQSL ++++SY   LR+   SEK+FID +KL SC++ AFD I + ++  S
Sbjct  406   MYFTVVGIPQSLKISVISYMENLRIAFGSEKEFIDQEKLTSCMKKAFDHIHKASIDVS  463



>ref|XP_003607481.1| O-acyltransferase WSD1 [Medicago truncatula]
 gb|AES89678.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=469

 Score =   431 bits (1108),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 216/466 (46%), Positives = 309/466 (66%), Gaps = 18/466 (4%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP  Q+ N+  L   +   LE  +P++D  ++ L +    FLPINPRFSSIMV
Sbjct  5     EDVTEPVSPSGQFFNTPPLCSYVFGFLELEIPMDDSQTMYLFQ---NFLPINPRFSSIMV  61

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               ++G+  WK ++   EDH+KVPIFP  + +E YD    +Y++KI M+  PQ +PLWE+H
Sbjct  62    RDQDGKMMWKKIEAKPEDHMKVPIFPKSESIELYDQYFDDYVSKIMMERTPQDKPLWEMH  121

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGS---GKKQ  695
             + +YPTSNA G  IFKLH +LGDGYSLMGALLSCLQR D+P+LPL+FP R+ S     K+
Sbjct  122   LIKYPTSNAKGTLIFKLHHALGDGYSLMGALLSCLQRVDDPSLPLSFPSRKPSQLLSPKK  181

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
             G         FK  P  +    ++ +DF W+  KSS+L DDKT I + ++GVE +P  ++
Sbjct  182   G--------FFKWFPSTIFPFFNSFSDFGWSIAKSSMLKDDKTPIWNGEEGVESQPCVLS  233

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
              ++FSL  +K IKS L VTINDVI+G++ YG RLYMQE + +      T LVL +TR + 
Sbjct  234   NLSFSLDEIKTIKSKLGVTINDVITGVIFYGIRLYMQEIDNKATTSNSTGLVLLSTRNI-  292

Query  1056  GGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYS  1235
             G Y+S+ +M K +++ PWGN I+FL   IPKL  P     SNPL F++ A +++KR+R +
Sbjct  293   GSYQSIQDMTKADSKSPWGNHISFLHIPIPKLCQPS---LSNPLDFVWKAQKIIKRKRST  349

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFA  1415
              +++LT   L+   KLRG EA A+ +  TL+N+S+ ++N+IGPVE   LANHPVKG+YF 
Sbjct  350   FTVFLTEWLLDMELKLRGHEAVAKHIYGTLRNSSVVISNLIGPVEPMALANHPVKGLYFT  409

Query  1416  VSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             ++G P+S+ + ++SY   LR+T+ ++K FID +K K CI  AF+ I
Sbjct  410   MTGGPESINIAIMSYTRILRITLKTQKGFIDEQKFKLCIVRAFEVI  455



>ref|XP_008455536.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis melo]
Length=456

 Score =   431 bits (1107),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 214/467 (46%), Positives = 304/467 (65%), Gaps = 20/467 (4%)
 Frame = +3

Query  159   DDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI  338
             D  ++  P SP ++Y++S +LS S++A+LE  VPI   D  +   +R++FLPINPRFSSI
Sbjct  2     DSSLLQQPLSPIAEYLSSPMLSLSVLAILEFQVPIHTLD--LAPNLRNLFLPINPRFSSI  59

Query  339   MVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWE  518
             +VT + GEK WK V V +E+H+K PIFP G  +E Y     EYLTKISM+ F   +PLWE
Sbjct  60    LVTNEQGEKKWKRVNVEVEEHVKDPIFPPGLTIESYKAHFDEYLTKISMEEFRPDKPLWE  119

Query  519   IHIFRYPTS-NAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
              H+F+YPTS    G  I KLH SLGDGYSLMG +LSCL  A +P +PLTFP R     +Q
Sbjct  120   THLFKYPTSPTVAGTMILKLHHSLGDGYSLMGVVLSCLHTASDPNVPLTFPSR-----RQ  174

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
                +N V ++   +   +S V  T +D  W+  K     D+KT I S  +G++F P++  
Sbjct  175   RRFNNGVVKSLTGI---VSAVCRTASDLGWSVFKGI---DEKTPIRSGREGLQFMPMNTF  228

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
             T++FSL  +K+IK+ L VT+NDVI+GI+  G RLYM+E E+ +     TAL + NTR +G
Sbjct  229   TVSFSLNDIKKIKTKLQVTVNDVITGIIFMGLRLYMEEIEKNSGEVAATALTIVNTRVIG  288

Query  1056  GGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYS  1235
               Y+S +EM KP ++  WGN++++L   IPK+      + +NPL F+  AHR +  +R S
Sbjct  289   N-YRSATEMAKPESKGLWGNQLSYLEIMIPKMT-----NVTNPLEFVMAAHRSINNKRTS  342

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFA  1415
              ++++    L   RKLRG +  A+FL   LKNT+  ++N+IGP+++  L NHP+ G+YF 
Sbjct  343   FTIHVVAHLLNLLRKLRGHQEVAKFLHNLLKNTTTVISNVIGPLQQMALDNHPISGLYFT  402

Query  1416  VSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
             + G PQS+ VTMLSY GKLR+   +EKDFID  KL  C+E AF++IF
Sbjct  403   IVGTPQSVTVTMLSYMGKLRVAFRTEKDFIDAHKLNCCMEDAFEKIF  449



>ref|XP_010035414.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW46794.1| hypothetical protein EUGRSUZ_K00600 [Eucalyptus grandis]
Length=473

 Score =   431 bits (1107),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 225/466 (48%), Positives = 308/466 (66%), Gaps = 12/466 (3%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP  QY+NS V+S SI+ +LE  +PI  DDS  +S  RD+FLPINPRFSSIMVTG+
Sbjct  10    LEPVSPSGQYLNSKVMSVSILGILELEIPI--DDSQAMSFFRDIFLPINPRFSSIMVTGE  67

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFY---DYCLSEYLTKISMDPFPQTQPLWEIH  524
              G + WK V V +E+H+ VP F   K        D  L  Y+++I+M PFPQ QPLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             I + PTS A    IFKLH +LGDGYSL+ ALLSCLQRAD+P+LP+T P  +       ++
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTSPSVKKFSSANKDD  187

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
              N   R  K V R  S +V+TV DF W+ LKS+ + DD + I S  + ++  P SV+T+T
Sbjct  188   RNIGLR--KVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PYSVSTIT  243

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGGG  1061
             FSL  +K+IKS L VT+NDVISG++   TRLYMQ  S     +   TALVL NTR +   
Sbjct  244   FSLDQIKEIKSRLRVTVNDVISGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNLRD-  302

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YK V +M++PN+E PWGN   FL   IPK++ P D   S+PL+F++  H ++KR+R S  
Sbjct  303   YKPVRDMVRPNSESPWGNHFAFLHVPIPKVK-PSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             + LTG+ LE  +K R  EA A+ + RT +N+S+ ++N+IGP+ K +LANHP++G+YF V+
Sbjct  362   VILTGKLLEIMQKCRNAEAVAKHISRTARNSSMGISNVIGPIHKLSLANHPLRGVYFTVA  421

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             G P +L++T+ SYAG LR+ + +E+ FID +     +  AFD I R
Sbjct  422   GIPWNLLITIFSYAGNLRVAVGAEQGFIDSELYNHSLLDAFDMILR  467



>gb|KEH30693.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=465

 Score =   430 bits (1106),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 218/459 (47%), Positives = 307/459 (67%), Gaps = 17/459 (4%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP  QY N+  L   +   LES +PI+D  ++ L   + VFLPINPRFSSIMV
Sbjct  5     EYVTEPVSPSGQYFNTPPLCSYVFGFLESQIPIDDSQTMYL--FQHVFLPINPRFSSIMV  62

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               K+G+  WK V+V  EDH+ VPIFP  + +E YD    +Y++KI M+  PQ +PLWEIH
Sbjct  63    RDKDGKMKWKKVEVKPEDHMHVPIFPKSESIELYDQYFDDYVSKIMMERTPQDKPLWEIH  122

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGS---GKKQ  695
             + +YPT NA G  IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP R+ S     K+
Sbjct  123   LIKYPTRNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSRKPSQLLSPKK  182

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
             G         FK  P  +    ++ +DF W+  KSS+L DDKT I + ++GVE +P  ++
Sbjct  183   G--------FFKWFPSTIFSFFNSFSDFGWSIAKSSMLKDDKTPIWNGEEGVESQPCVLS  234

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
              ++FSL  +K IKS L VTINDVI+G++ YG RLYMQE +++      T LVL +TR + 
Sbjct  235   NLSFSLDEIKTIKSKLGVTINDVITGVIFYGIRLYMQEMDKKARTSNSTGLVLLSTRNV-  293

Query  1056  GGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYS  1235
             G Y+S+ +M K +++ PWGN I+FL  +IPKL        SNPL FI+ A +++KR+R +
Sbjct  294   GSYQSIQDMTKADSKSPWGNHISFLHVSIPKL---SKASLSNPLEFIWKAQKIIKRKRNT  350

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFA  1415
              +++L    L+   KLRG EA A+ +  TL+N+S+ ++N+IGPVE   LANHPVKG+YF 
Sbjct  351   FTVFLIEWLLDMELKLRGHEAVAKHIYDTLRNSSVVISNLIGPVEPMALANHPVKGLYFT  410

Query  1416  VSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCI  1532
             ++G P+S+ + ++SY   LR+T+ ++K FID +K K C+
Sbjct  411   MTGGPESINIAVMSYTRILRITLKTQKGFIDEQKFKFCM  449



>gb|KGN43650.1| hypothetical protein Csa_7G051300 [Cucumis sativus]
Length=464

 Score =   430 bits (1105),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 221/478 (46%), Positives = 316/478 (66%), Gaps = 17/478 (4%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +E +DE  L P SP +Q +N+S LS S+IAVLE  +PI  D++ I+   +D F+P+N  F
Sbjct  1     MEEEDEF-LEPMSPTAQCLNTSSLSISVIAVLEFEIPI--DEAKIICYAKD-FIPLNSLF  56

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSI V   NGE+ WK V+V +E+ + V   P    +E  D   +EY+TK+S+    Q +P
Sbjct  57    SSITVNDINGERKWKKVEVKVEEQIVVATPPSDLSIELNDAFFNEYITKLSVQELDQNKP  116

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFP--RRQGS  683
             LWEIHI   PTS A  N I K H SLGDGYS+MG LLS ++RADNP+LPLTFP   +  +
Sbjct  117   LWEIHILNCPTSTAAANLILKFHHSLGDGYSVMGLLLSTMKRADNPSLPLTFPFNGKMIN  176

Query  684   GKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRP  863
              KK G+ S+ V+         L   +++V DF  + +KSS+L+D+ T I S  DGVEF+P
Sbjct  177   SKKLGQISSGVSH-------FLLSSINSVLDFGLSLIKSSVLEDELTPIRSGGDGVEFKP  229

Query  864   ISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNT  1043
               + T+TFSL+ +KQIKS L VT+NDV++G++  G RLYM+E+  ++     TALVL NT
Sbjct  230   TEIWTITFSLHQIKQIKSKLRVTVNDVVAGMLFLGIRLYMEETHPDSTKSNSTALVLLNT  289

Query  1044  RAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKR  1223
             R M G YK + +M+ PN+  PWGNR  FL   IPKL    D + SNPL+F+  A +++KR
Sbjct  290   R-MFGTYKCMEDMLNPNSNTPWGNRFGFLHIDIPKLT---DFNLSNPLQFVQAAQKLIKR  345

Query  1224  QRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKG  1403
             +R S++++L  + +E   K RG E  ++++ +T+KN+S+++TN+IGP EK TL  HPVKG
Sbjct  346   KRDSSAVFLVDKLMEIIHKFRGSEVASKYVYKTIKNSSLSITNLIGPKEKMTLTGHPVKG  405

Query  1404  MYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             MYF V G PQSL ++++SY   LR+    EK+FID +KL SC++ AFD I + ++  S
Sbjct  406   MYFTVVGIPQSLKISVISYMENLRIAFGGEKEFIDQEKLTSCMKKAFDHIHKASIDVS  463



>ref|XP_006603695.1| PREDICTED: uncharacterized protein LOC100777968 isoform X1 [Glycine 
max]
Length=478

 Score =   430 bits (1106),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 229/470 (49%), Positives = 316/470 (67%), Gaps = 24/470 (5%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY+ SS LS  I+ VLES VPI+D  +V L  ++++FLPIN RFSSIM+  KNG
Sbjct  12    PVSPTGQYLTSSSLSVYILGVLESEVPIDDSQTVPL--LQNLFLPINSRFSSIMIRDKNG  69

Query  360   EKNWKPVKVILEDHLKVPIFPVGKP--LEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
             EK WK V+V LEDH+KVP FP GK   L  YD  L EY++ I+++  PQ +PLWE+HI +
Sbjct  70    EKKWKKVEVKLEDHIKVPTFPNGKSSNLFLYDEYLDEYMSTIAVEHLPQNRPLWELHIIK  129

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
             YPTSNA G  +FKLH +LGDG+SLMGALLSC+QRADN +LP T P  Q        N+  
Sbjct  130   YPTSNAKGTLVFKLHHALGDGFSLMGALLSCMQRADNTSLPFTLPSSQRPKASSISNTKG  189

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
                 FK +P +      T+++F W+FLKS L++DD+T I S  +  + R ++++ +TFSL
Sbjct  190   F---FKKLPSIF---FQTISEFGWSFLKSKLIEDDQTPIRSCAEDFKTRQMTISDVTFSL  243

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
               +K +KS L V+INDV++G++ +G RLYMQE   ++   + TALVL NTR +  GYKSV
Sbjct  244   DLIKDVKSKLGVSINDVLAGVIFFGIRLYMQEINLKSSQTQSTALVLLNTRNI-EGYKSV  302

Query  1074  SEMI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYL  1250
              EMI K N+   WGN+  FL  +IP+L    D   +NPL FI  AH+ + +++ S +  L
Sbjct  303   KEMIEKTNSRSAWGNQYAFLHVSIPEL---SDSKYANPLEFIREAHKDMTKKKNSLATPL  359

Query  1251  TGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAP  1430
             TG  L+  RKLRG EA A +LR TL+N+S T++N+IGPVE+  +ANHP+KG YF V+G+P
Sbjct  360   TGMLLDMLRKLRGPEAAASYLRSTLRNSSTTISNIIGPVEQMAVANHPIKGFYFMVAGSP  419

Query  1431  ---------QSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
                      QSL +T++SY GK+R+    EK+FID +  KSC+E++ + I
Sbjct  420   EIINILTELQSLTMTIMSYMGKIRIAFGVEKNFIDKQLFKSCLENSLEMI  469



>ref|XP_010038538.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
 gb|KCW46800.1| hypothetical protein EUGRSUZ_K00605 [Eucalyptus grandis]
Length=476

 Score =   429 bits (1102),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 307/469 (65%), Gaps = 15/469 (3%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP  QY+NS V+S SI+ +LE  +PI  DDS  +S  RD FLPINPRFSSIMVTG 
Sbjct  10    LEPVSPSGQYLNSKVMSVSILGILELEIPI--DDSQAMSLFRDDFLPINPRFSSIMVTGD  67

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFY---DYCLSEYLTKISMDPFPQTQPLWEIH  524
              G + WK V V +E+H+ VP F   K        D  L  Y+++I+M PFPQ QPLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             I + PTS A    IFKLH +LGDGYSL+ ALLSCLQRAD+P+LP+TFP  +       ++
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTFPSVKKFSSANKDD  187

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
              N   R  K V R  S +V+TV DF W+ LKS+ + DD + I S  + ++  P SV+T+T
Sbjct  188   RNIGLR--KVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PFSVSTIT  243

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGGG  1061
             FSL  +K+IKS L VT+NDVI G++   TRLYMQ  S     +   TALVL NTR +   
Sbjct  244   FSLDQIKEIKSRLRVTVNDVILGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNL-RD  302

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YK V +M++PN+E PWGN   FL   IPK++ P D   S+PL+F++  H ++KR+R S  
Sbjct  303   YKPVKDMVRPNSESPWGNHFAFLHVPIPKVK-PSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1242  LYLTGQFLEFTRKLRG---LEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             + LTG+ LE  +K R    L+A A+ + RT +N+S+ ++N+IGPV+  +LANHP+KGMY+
Sbjct  362   VILTGKLLEIMQKCRNAEYLQAVAKHISRTARNSSMCISNLIGPVDNLSLANHPLKGMYY  421

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              ++G P+SL +T+ SYAG LR+ + +E+ FID +     +  AFD I R
Sbjct  422   TIAGTPESLRITIFSYAGNLRVAVGAEQGFIDSELYNHSLLDAFDMILR  470



>ref|XP_010035413.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW46795.1| hypothetical protein EUGRSUZ_K00600 [Eucalyptus grandis]
Length=476

 Score =   427 bits (1097),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/469 (48%), Positives = 309/469 (66%), Gaps = 15/469 (3%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP  QY+NS V+S SI+ +LE  +PI  DDS  +S  RD+FLPINPRFSSIMVTG+
Sbjct  10    LEPVSPSGQYLNSKVMSVSILGILELEIPI--DDSQAMSFFRDIFLPINPRFSSIMVTGE  67

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFY---DYCLSEYLTKISMDPFPQTQPLWEIH  524
              G + WK V V +E+H+ VP F   K        D  L  Y+++I+M PFPQ QPLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             I + PTS A    IFKLH +LGDGYSL+ ALLSCLQRAD+P+LP+T P  +       ++
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTSPSVKKFSSANKDD  187

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
              N   R  K V R  S +V+TV DF W+ LKS+ + DD + I S  + ++  P SV+T+T
Sbjct  188   RNIGLR--KVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PYSVSTIT  243

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGGG  1061
             FSL  +K+IKS L VT+NDVISG++   TRLYMQ  S     +   TALVL NTR +   
Sbjct  244   FSLDQIKEIKSRLRVTVNDVISGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNL-RD  302

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YK V +M++PN+E PWGN   FL   IPK++ P D   S+PL+F++  H ++KR+R S  
Sbjct  303   YKPVRDMVRPNSESPWGNHFAFLHVPIPKVK-PSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1242  LYLTGQFLEFTRKLRG---LEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             + LTG+ LE  +K R    L+A A+ + RT +N+S+ ++N+IGP+ K +LANHP++G+YF
Sbjct  362   VILTGKLLEIMQKCRNAEYLQAVAKHISRTARNSSMGISNVIGPIHKLSLANHPLRGVYF  421

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              V+G P +L++T+ SYAG LR+ + +E+ FID +     +  AFD I R
Sbjct  422   TVAGIPWNLLITIFSYAGNLRVAVGAEQGFIDSELYNHSLLDAFDMILR  470



>gb|KEH30682.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=467

 Score =   424 bits (1091),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 220/473 (47%), Positives = 314/473 (66%), Gaps = 13/473 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E V  P SP  QY NSSV+   + A LE ++P   D+S+ +  ++DVF+PINPRFSSIM
Sbjct  5     NEEVQEPVSPHGQYFNSSVICSYVFAFLELAIPF--DNSLAIPLLKDVFIPINPRFSSIM  62

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPV---GKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
             V  K GE  W+ V+V  E+HLK+PIFP        E YD  LS+Y+T I     PQ +PL
Sbjct  63    VKDKEGEMRWQKVEVKPEEHLKIPIFPETINSSSCELYDNYLSDYVTSILAKKTPQDKPL  122

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK  692
             WEIH+  YPT+NA    IFKLH  LGDGYSLMGALLSCLQRAD+P+LPL+FP    S + 
Sbjct  123   WEIHVINYPTTNAACTIIFKLHHGLGDGYSLMGALLSCLQRADDPSLPLSFP----SKRP  178

Query  693   QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
             Q ++  A    FK +   +S    +++DF  + LK+++++DDKT I S  +G E +P+++
Sbjct  179   QLDSKYAKKSLFKKLCIDISSFFSSISDFGSSILKTTMIEDDKTPIRSGYEGNESQPVTM  238

Query  873   TTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAM  1052
             +T++ SL  +K+IK+ L VTINDV+ G+V YG RLYM+E   +T     TA+V+ NTR +
Sbjct  239   STISLSLDQIKEIKTKLKVTINDVVCGMVFYGIRLYMKEMNEKTKRANSTAVVMLNTRNI  298

Query  1053  GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
             GG Y+S++EM KP  +  WGN+I+FL   IPK+        SNPL F++N+  ++KR+R 
Sbjct  299   GG-YQSLTEMQKPECKGLWGNQISFLQIPIPKV---SQSVISNPLEFVWNSRELIKRKRR  354

Query  1233  SASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             S S+YL    ++   +LRG EA A+ +  T+ N+S+ M+N++GPVEK TLANHPV G+YF
Sbjct  355   SFSVYLVAMLMDLEMRLRGPEAVAKIIYNTIGNSSVLMSNLVGPVEKMTLANHPVYGLYF  414

Query  1413  AVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
               +G P+ L +T++SY   LR+ + ++K FID  KLK  IE A + IF+  ++
Sbjct  415   TATGGPEDLTITIISYEKILRIAMKTQKGFIDEHKLKFYIEKASEIIFKAAME  467



>gb|KEH30680.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=475

 Score =   423 bits (1087),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 219/473 (46%), Positives = 314/473 (66%), Gaps = 13/473 (3%)
 Frame = +3

Query  126   VKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDV  305
             ++ T  + ++  +E V  P SP  QY NSSV+   + A LE ++P   D+S+ +  ++DV
Sbjct  1     MQHTHHTIMDKFNEEVQEPVSPHGQYFNSSVICSYVFAFLELAIPF--DNSLAIPLLKDV  58

Query  306   FLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPV---GKPLEFYDYCLSEYLTK  476
             F+PINPRFSSIMV  K GE  W+ V+V  E+HLK+PIFP        E YD  LS+Y+T 
Sbjct  59    FIPINPRFSSIMVKDKEGEMRWQKVEVKPEEHLKIPIFPETINSSSCELYDNYLSDYVTS  118

Query  477   ISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALP  656
             I     PQ +PLWEIH+  YPT+NA    IFKLH  LGDGYSLMGALLSCLQRAD+P+LP
Sbjct  119   ILAKKTPQDKPLWEIHVINYPTTNAACTIIFKLHHGLGDGYSLMGALLSCLQRADDPSLP  178

Query  657   LTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHS  836
             L+FP    S + Q ++  A    FK +   +S    +++DF  + LK+++++DDKT I S
Sbjct  179   LSFP----SKRPQLDSKYAKKSLFKKLCIDISSFFSSISDFGSSILKTTMIEDDKTPIRS  234

Query  837   QDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGE  1016
               +G E  P++++T++ SL  +K+IK+ L VTINDV+ G+V YG RLYM+E   +T    
Sbjct  235   GYEGNESHPVTLSTISLSLDQIKEIKTKLKVTINDVVCGMVFYGIRLYMKEMNEKTKRAN  294

Query  1017  CTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFI  1196
              TA+V+ NTR +GG Y+S++EM KP  +  WGN+I+FL   IPK+        SNPL F+
Sbjct  295   STAVVMLNTRNIGG-YQSLTEMQKPECKGLWGNQISFLQIPIPKV---SQSVISNPLEFV  350

Query  1197  YNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKT  1376
             +N+  ++KR+R S S+YL    ++   +LRG EA A+ +  T+ N+S+ M+N++GPVEK 
Sbjct  351   WNSRELIKRKRRSFSVYLVAMLMDLEMRLRGPEAVAKIIYNTIGNSSVLMSNLVGPVEKM  410

Query  1377  TLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIE  1535
             TLANHPV G+YF  +G P++L +T++SY   LR+ + ++K FID  KLK CIE
Sbjct  411   TLANHPVYGLYFTATGGPENLTITIISYEKILRIAMKTQKGFIDEYKLKFCIE  463



>ref|XP_004516681.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=469

 Score =   422 bits (1085),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 225/478 (47%), Positives = 314/478 (66%), Gaps = 12/478 (3%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +EG  E V  P SP  QY+NSS L   I+ VLE  VPI DD+   LS + +VFLPIN RF
Sbjct  1     MEGFVEEVEEPVSPTGQYLNSSSLCVYILGVLEFEVPI-DDNIQTLSLLHNVFLPINTRF  59

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIM+  KNGEK WK V+V LE+H+K P+FP  K    YD  + +Y++ I+M+  P+ +P
Sbjct  60    SSIMIKDKNGEKKWKKVEVKLEEHVKNPVFPSRKS-SLYDEYVDDYISTIAMEHLPEHRP  118

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LWEIH+ +YPT N     +FKLH +LGDGYSLMGALLSCLQR DNP+LP T P  Q    
Sbjct  119   LWEIHLIKYPTKNGASTLVFKLHHALGDGYSLMGALLSCLQRVDNPSLPFTLPSTQTP--  176

Query  690   KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPIS  869
             K   N+   ++  ++ P +   V +T++DF W+ LKSSL++DD T I S  D ++ R I+
Sbjct  177   KSIFNTKPFSK--RSFPSIFPKVFNTISDFGWSILKSSLVEDDLTPIRSCADDMKLRHIT  234

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRA  1049
             +++++FS+  +K++KS L V INDVI+G++ +G RLYMQ+   ++   + TALVL NTR 
Sbjct  235   ISSVSFSMNRIKEVKSRLGVGINDVIAGLIFFGIRLYMQQINEDSIKYKSTALVLMNTRN  294

Query  1050  MGGGYKSVSEMIKPNAE--MPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKR  1223
               G YKS+ EM+  N      WGN+  FL   IP+L    D    NPL FI+ AH+ + R
Sbjct  295   FKG-YKSIKEMVDKNNSNGSTWGNQFAFLHIPIPEL---SDTKFENPLEFIWEAHKEINR  350

Query  1224  QRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKG  1403
             ++ S +  L G  L   + LRG EA+A+++  TL+N+S T++N+IGPVE+  LANHPVKG
Sbjct  351   KKNSLATPLNGMLLNMVKILRGPEASARYIYNTLRNSSTTISNVIGPVEQMALANHPVKG  410

Query  1404  MYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             +YF V G P+SL +T++SY G+LR+    EKD+ID +K  SCIE++ + I     K S
Sbjct  411   LYFMVVGPPESLTITIMSYMGQLRIAFGLEKDYIDKQKFMSCIENSLEMIITAAQKIS  468



>gb|KCW57195.1| hypothetical protein EUGRSUZ_H00010 [Eucalyptus grandis]
Length=428

 Score =   419 bits (1077),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 214/428 (50%), Positives = 286/428 (67%), Gaps = 14/428 (3%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP  +Y NS V+S SI+ +LES +PI+D  +  L  I+DVFLPINPRFSSIMV GK
Sbjct  10    LEPVSPTGEYFNSKVMSVSILGILESEIPIDDSQATAL--IKDVFLPINPRFSSIMVMGK  67

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGK----PLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
              G + WK V+V +E+H+ VP F   K    P E  D  L  Y+++I+M PFPQ QPLWEI
Sbjct  68    KGARKWKKVEVNVENHVHVPSFSFPKGSSSPSE-NDSFLKTYISQIAMQPFPQGQPLWEI  126

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI + PTS A G  IFKLH +LGDGYSL+GALLSCLQRADNP+LP+TFP          +
Sbjct  127   HIIKCPTSEAQGTLIFKLHHALGDGYSLVGALLSCLQRADNPSLPITFPSVSNFSSANKD  186

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             + N   R  K V R  S +V+TV DF W+  KS+ ++DD + I    +   F+P  V+T+
Sbjct  187   DRNIGLR--KVVSRCFSPLVNTVKDFGWSVFKSTCIEDDLSPIRCGSES--FQPFLVSTV  242

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGG  1058
             TFSL  +K+IKS L VT+NDVI G +   TR+YMQ  S     +   TALVL NTR +  
Sbjct  243   TFSLDRIKEIKSRLRVTVNDVIMGTIFLATRMYMQRASTNSNLSTNSTALVLLNTRNL-R  301

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
              YKSV +M++PN+E PWGN   FL   IPK++ P D   S+PL+F++ AH ++KR+R S 
Sbjct  302   DYKSVRDMVRPNSESPWGNNFAFLHVPIPKVK-PSDSQFSDPLKFVHEAHEVIKRKRSSF  360

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
              + LTG+ L   +K R  EA A+ + RTL+N+S+ ++N++GPVEK +LANHPVKGMY+ V
Sbjct  361   GVILTGKLLGIMKKCRNAEAVAKHISRTLRNSSMVISNVMGPVEKLSLANHPVKGMYYTV  420

Query  1419  SGAPQSLV  1442
             +G P+  +
Sbjct  421   AGTPEVFI  428



>gb|AES89670.2| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=470

 Score =   418 bits (1074),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 216/474 (46%), Positives = 312/474 (66%), Gaps = 16/474 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E V  P SP  QY NSSV+   +   LE ++PI  DDS  +  ++DVFLPINPRFSSIM
Sbjct  5     NEEVQEPVSPHGQYFNSSVICSYVFGFLELAIPI--DDSQTMPLLKDVFLPINPRFSSIM  62

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFP--VGKPLEFYDYCLSEYLTKISMDPFPQTQPLW  515
             V  K+G+  W+ V+V LE+H+K+P FP         YD  LS+Y+T I     PQ +PLW
Sbjct  63    VRDKDGKMRWQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLW  122

Query  516   EIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
             EIH+ +YPTSNA G  IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP R      Q
Sbjct  123   EIHLIKYPTSNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSRP-----Q  177

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
               +  A    FK +   +S    +++DF  + +K+ +++DDKT I S  +G E +P +++
Sbjct  178   LNSKYAKKGLFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLS  237

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
              ++ SL  +K+IKS L VTINDV+SG++ YG RLYM+E   +T     TA+V+ NTR + 
Sbjct  238   NISLSLDQIKEIKSKLGVTINDVLSGVIFYGIRLYMEEMNEKTKKSNSTAVVMLNTRNIE  297

Query  1056  GGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYS  1235
             G Y+S+ EM KP ++  WGN+I+FL   IPKL        S+PL F++ A +++KR+R S
Sbjct  298   G-YQSLKEMQKPESKSLWGNQISFLQIPIPKL------SQSDPLEFVWKARKLIKRKRRS  350

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFA  1415
               +YL G  L    KL+G E+ A+ +  T+ N+S+ ++N++GPVEK  LANHP+ G YF 
Sbjct  351   FGVYLIGLLLNLEMKLKGSESVAKIIYNTMGNSSVVISNLVGPVEKMALANHPINGFYFT  410

Query  1416  VSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             ++G P+++ +T++SY   LR+T+ + K FID +K K C+E A + IF+  ++ S
Sbjct  411   MTGGPENVDITIMSYVKILRITLRTLKGFIDERKFKFCMEKAVEVIFKAAMEIS  464



>gb|KEH30678.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=467

 Score =   416 bits (1070),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 213/460 (46%), Positives = 309/460 (67%), Gaps = 13/460 (3%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP  QY NSSV+   +   LE ++P   D+S+++  ++DVF+PINPRFSSIMV
Sbjct  6     EEVQEPVSPHGQYFNSSVICSYVFGFLEFAIPF--DNSLVIPLLKDVFIPINPRFSSIMV  63

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPV---GKPLEFYDYCLSEYLTKISMDPFPQTQPLW  515
               K G+  W+ V+V  E+HLK+PIFP        E YD   ++Y+T I  +  PQ +PLW
Sbjct  64    KDKEGKMRWRKVEVKPEEHLKIPIFPETINSSSCELYDNYFNDYVTSILAERTPQDKPLW  123

Query  516   EIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
             EIHI  YPT+N     IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP    S + Q
Sbjct  124   EIHIINYPTTNEACTIIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFP----SQRPQ  179

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
              ++  A    FK +   +S    +++DF  + +K+ +++DDKT I S  +G E +P++++
Sbjct  180   LDSKYAKINLFKKLCFDISSFFSSISDFGSSIIKTRMIEDDKTPIRSGYEGNESQPVTLS  239

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
             T++ SL  +K+IKS L VTINDV+ G+V YG RLYM+E   +T     TA+V+ NTR +G
Sbjct  240   TISLSLDQIKEIKSKLKVTINDVVCGMVFYGIRLYMKEMNEKTKIANSTAVVMLNTRNIG  299

Query  1056  GGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYS  1235
             G Y+S+ EM KP ++  WGN+I+FL   IPK+        SNPL F++N+  ++KR+R+S
Sbjct  300   G-YRSLMEMQKPESKGLWGNQISFLQIPIPKV---SQSVISNPLEFVWNSRELIKRKRHS  355

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFA  1415
              S+YL    ++   +LRG EA A+ +  T++N+S+ M+N++GP+EK  LANHPV G+YF 
Sbjct  356   FSVYLIALLMDLEMRLRGPEAVAKIIYNTIRNSSVFMSNLVGPIEKMALANHPVNGLYFT  415

Query  1416  VSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIE  1535
             V+G P++L +T++SY   LR+ + ++K FID  KLK CIE
Sbjct  416   VAGGPENLTITIISYEKILRIAMKTQKGFIDEYKLKFCIE  455



>ref|XP_004137034.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis sativus]
 ref|XP_004170041.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis sativus]
Length=473

 Score =   416 bits (1070),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 214/462 (46%), Positives = 289/462 (63%), Gaps = 8/462 (2%)
 Frame = +3

Query  177   APASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKN  356
             AP SP SQY N+  +  S++ V+E   PI   +  I S + DV +P NPRF+SIMV  K 
Sbjct  9     APMSPLSQYFNTCEMCVSVLGVIELETPISSWED-ISSIVTDVLVPANPRFTSIMVKEKT  67

Query  357   GEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRY  536
              E+ WK  KV  +DH+ +P FP+      YD    EY TK +  PF Q  PLWEIH+F Y
Sbjct  68    EERKWKTTKVNPKDHIYIPNFPMELSSYEYDAYFDEYATKTATKPFSQAIPLWEIHVFNY  127

Query  537   PTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAV  716
             PT++A  + IFK+H S+ DG+ LM  LLSCL+RAD+P+LPLTFP RQ S  KQ  N    
Sbjct  128   PTTHATCSIIFKVHHSIADGFCLMNTLLSCLKRADDPSLPLTFPSRQRS--KQPGNEPKF  185

Query  717   ARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEF-RPISVTTMTFSL  893
              R      R  S + + V +F W+ +K++ ++DD T I  Q D ++  +PI+++TMTFSL
Sbjct  186   FRLSHFPARFFSSISNFVLNFGWSIMKNTFVEDDPTPIKPQKDSMQLVKPIAISTMTFSL  245

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
               +KQIK+ LN ++NDV++GI+  G RLYMQE   E+     +AL+L NTR     YKSV
Sbjct  246   DQIKQIKNKLNASVNDVLTGIIFLGIRLYMQEHNPESSGANSSALILLNTRK-AKAYKSV  304

Query  1074  SEMIKPNAEMPWGNRITFLPFAIPKL-RSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYL  1250
              EM+K +++ PWGN+I FLP  IPKL  SP    SS PL F+      +  QR   S++L
Sbjct  305   KEMVKKDSDAPWGNKIAFLPIPIPKLIDSP--VVSSTPLEFVEKVKEKIMLQRSPLSVFL  362

Query  1251  TGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAP  1430
               +  E  + + G E  A+  +R LKN+SI ++NMIGPVEK  L N PVKG+YF V G P
Sbjct  363   AAKVFEILKNVTGPEIGAKLFKRKLKNSSIMISNMIGPVEKMALVNLPVKGLYFTVPGMP  422

Query  1431  QSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
             QSL++T++SY G LR+    EK FI+ +KLK CIE AF  I 
Sbjct  423   QSLMITIVSYMGDLRIVFGGEKCFINQQKLKVCIEDAFQRIL  464



>ref|XP_008805672.1| PREDICTED: O-acyltransferase WSD1-like [Phoenix dactylifera]
Length=421

 Score =   413 bits (1061),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 291/430 (68%), Gaps = 13/430 (3%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +EG       P SP  QY +SSVLS +I+A+ ES +P+  DDS  +  + ++FLPINPRF
Sbjct  3     VEGGQMARNQPVSPMGQYFSSSVLSVNILAIFESEIPM--DDSKAMWALENLFLPINPRF  60

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIMV  ++G   W+ VKV LE+H+ +P+FP G  LEFYD  + EYL+K+  +  P  +P
Sbjct  61    SSIMVKNEHGILTWRKVKVKLEEHVNIPLFPPG--LEFYDDSMQEYLSKVGTELLPHDRP  118

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LW+IHI +YPT NA G   FKLH SLGDG+SLMGAL SCL+RAD+P+LPLTFP    S  
Sbjct  119   LWDIHIIKYPTRNAPGTMAFKLHHSLGDGFSLMGALFSCLRRADDPSLPLTFP----SSS  174

Query  690   KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPIS  869
             +   +     R  K++ RL +   +T  DF W+FL S+ ++DD+T + S D G+EFRPI+
Sbjct  175   ESSRHFAKWIRIDKSIYRLFNTCFNTFRDFGWSFLMSNCMEDDRTPMRSGDAGIEFRPIT  234

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQ-ESERETCNGECTALVLFNTR  1046
             ++T+TFSL  +KQIK+ L  T+NDVI+GI+ YG +LYMQ  S+ +T     TALV  NTR
Sbjct  235   LSTITFSLNDIKQIKAKLKATVNDVITGIIFYGIQLYMQAASQGKTKTSRVTALVTLNTR  294

Query  1047  AMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQ  1226
             A+   Y+S+ EM KPN++  WGN   FL  +IP+ +   D ++++PL F+  A R+++ +
Sbjct  295   AI-KSYQSIQEMTKPNSKSQWGNHFAFLHVSIPRYK---DVENADPLEFVLKAKRIIRSK  350

Query  1227  RYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGM  1406
             R S ++YLTG  LE  RKL+G EA A+++  T + T++ ++NMIGP+E+  +A HPV+ +
Sbjct  351   RNSLAIYLTGGLLELLRKLKGPEAAARYIYATAQKTTLVISNMIGPMEQVQIAGHPVQSL  410

Query  1407  YFAVSGAPQS  1436
             YF +   PQS
Sbjct  411   YFMMVHVPQS  420



>gb|KHN36647.1| O-acyltransferase WSD1 [Glycine soja]
Length=468

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 202/466 (43%), Positives = 299/466 (64%), Gaps = 12/466 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +EVV  P SP + Y++SS+++  ++ VLES +PI+D  +  L  +++ FLPI+ RFSSI+
Sbjct  5     EEVVPTPLSPMADYLSSSLINVFVLGVLESEIPIDDSRAEPL--LKNAFLPISTRFSSIL  62

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  K G K WK V V +++H+K+P F    PL+ YD CL EY++KI+M+  P  +PLWE+
Sbjct  63    VMDKKGNKGWKQVDVNVKEHIKIPTFTYAMPLKLYDECLDEYMSKIAMEQLPLDKPLWEM  122

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HIF+YPTSNA G +IFKLH +LGDGYS M  LLSC+Q A+NP++P+ FP  +        
Sbjct  123   HIFKYPTSNAAGTFIFKLHHALGDGYSFMTTLLSCVQNAENPSVPIKFPSSRSV------  176

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              S +     K +P+ +S V  +  DF W+ LK SL+ DD+T I S    V FRP+SVT +
Sbjct  177   ESKSTKIMPKLLPQTVSMVFKSAFDFGWSLLKDSLIPDDQTPIRSGHKDVGFRPMSVTDV  236

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             + SL ++K++K  L V++NDV+ G++  G +LYM     ++   E TALVL NTR +   
Sbjct  237   SLSLGNIKEVKDKLKVSVNDVLVGVIFLGIQLYMSAKNHKSSRAESTALVLLNTRKI-RA  295

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YKS   M   N+E PWGNR  F+   +P L    D +  NPL ++  A++ + R+R S +
Sbjct  296   YKSAEMMDHTNSEAPWGNRFHFMHVPMPML---SDTNYLNPLEYVLEANKNINRKRNSLA  352

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             + LTG  L    K+RG +A   ++ + L NTS+++++M+GP+EK  LANHP+KG+YF   
Sbjct  353   VPLTGVLLRLLNKIRGPQAATNYVYKILNNTSLSISHMVGPMEKVALANHPIKGLYFMTV  412

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             G  QS+ VT+ SY G LR+    E+ FID  +LKSC E++ + I +
Sbjct  413   GLSQSITVTITSYMGYLRVGFGVEEGFIDEYQLKSCFETSLEMILK  458



>ref|XP_003607478.1| O-acyltransferase WSD1 [Medicago truncatula]
 gb|AES89675.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=455

 Score =   413 bits (1062),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/452 (46%), Positives = 304/452 (67%), Gaps = 18/452 (4%)
 Frame = +3

Query  225   FSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHL  404
             F     LE  +P++D  ++ L +    FLPINPRFSSIMV  ++G+  WK ++   EDH+
Sbjct  2     FICFGFLELEIPMDDSQTMYLFQ---NFLPINPRFSSIMVRDQDGKMMWKKIEAKPEDHM  58

Query  405   KVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQS  584
             KVPIFP  + +E YD    +Y++KI M+  PQ +PLWE+H+ +YPTSNA G  IFKLH +
Sbjct  59    KVPIFPKSESIELYDQYFDDYVSKIMMERTPQDKPLWEMHLIKYPTSNAKGTLIFKLHHA  118

Query  585   LGDGYSLMGALLSCLQRADNPALPLTFPRRQGS---GKKQGENSNAVARAFKAVPRLLSG  755
             LGDGYSLMGALLSCLQRAD+P+LPL+FP R+ S     K+G         FK  P  +  
Sbjct  119   LGDGYSLMGALLSCLQRADDPSLPLSFPSRKPSQLLSPKKG--------FFKWFPSTIFS  170

Query  756   VVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTI  935
               ++ +DF W+  KSS+L DDKT I + ++GVE +P  ++ ++FSL  +K IKS L VTI
Sbjct  171   FFNSFSDFGWSIAKSSMLKDDKTPIWNGEEGVESQPCVLSNLSFSLDEIKTIKSKLGVTI  230

Query  936   NDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGN  1115
             NDVI+G++ YG RLYMQE +++      T LVL +TR + G Y+S+ +M K +++ PWGN
Sbjct  231   NDVITGVIFYGIRLYMQEMDKKARTSNSTGLVLLSTRNV-GSYQSIQDMTKADSKSPWGN  289

Query  1116  RITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLE  1295
              I+FL  +IPKL        SNPL FI+ A +++KR+R + +++L    L+   KLRG E
Sbjct  290   HISFLHVSIPKL---SKASLSNPLEFIWKAQKIIKRKRNTFTVFLIEWLLDMELKLRGHE  346

Query  1296  ATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLR  1475
             A A+ +  TL+N+S+ ++N+IGPVE   LANHPVKG+YF ++G P+S+ + ++SY   LR
Sbjct  347   AVAKHIYDTLRNSSVVISNLIGPVEPMALANHPVKGLYFTMTGGPESINIAVMSYTRILR  406

Query  1476  LTIISEKDFIDVKKLKSCIESAFDEIFRLTLK  1571
             +T+ ++K FID +K K C+  AF+ I + +++
Sbjct  407   ITLKTQKGFIDEQKFKFCMVRAFEVISKASME  438



>ref|XP_003541905.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=468

 Score =   412 bits (1058),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 201/466 (43%), Positives = 299/466 (64%), Gaps = 12/466 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +EVV  P SP + Y++SS+++  ++ VLES +PI+D  +  L  +++ FLPI+ RFSSI+
Sbjct  5     EEVVPTPLSPMADYLSSSLINVFVLGVLESEIPIDDSRAEPL--LKNAFLPISTRFSSIL  62

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  K G K WK V V +++H+K+P F    PL+ YD CL EY++KI+M+  P  +PLWE+
Sbjct  63    VMDKKGNKGWKQVDVNVKEHIKIPTFTYTMPLKLYDECLDEYMSKIAMEQLPLDKPLWEM  122

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HIF+YPTSNA G +IFKLH +LGDGYS M  LLSC+Q A+NP++P+ FP  +        
Sbjct  123   HIFKYPTSNAAGTFIFKLHHALGDGYSFMTTLLSCVQNAENPSVPIKFPSSRSV------  176

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              S +     K +P+ +S +  +  DF W+ LK SL+ DD+T I S    V FRP+SVT +
Sbjct  177   ESKSTKIMPKLLPQTVSMMFKSAFDFGWSLLKDSLIPDDQTPIRSGHKDVGFRPMSVTDV  236

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             + SL ++K++K  L V++NDV+ G++  G +LYM     ++   E TALVL NTR +   
Sbjct  237   SLSLGNIKEVKDKLKVSVNDVLVGVIFLGIQLYMSAKNHKSSRAESTALVLLNTRKI-RA  295

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YKS   M   N+E PWGNR  F+   +P L    D +  NPL ++  A++ + R+R S +
Sbjct  296   YKSAEMMDHTNSEAPWGNRFHFMHVPMPML---SDTNYLNPLEYVLEANKNINRKRNSLA  352

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             + LTG  L    K+RG +A   ++ + L NTS+++++M+GP+EK  LANHP+KG+YF   
Sbjct  353   VPLTGVLLRLLNKIRGPQAATNYVYKILNNTSLSISHMVGPMEKVALANHPIKGLYFMTV  412

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             G  QS+ VT+ SY G LR+    E+ FID  +LKSC E++ + I +
Sbjct  413   GLSQSITVTITSYMGYLRVGFGVEEGFIDEYQLKSCFETSLEMILK  458



>ref|XP_008241432.1| PREDICTED: O-acyltransferase WSD1-like [Prunus mume]
Length=425

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 206/421 (49%), Positives = 279/421 (66%), Gaps = 23/421 (5%)
 Frame = +3

Query  312   PINPR---FSSIMVT---GKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLT  473
             P++P    FSS +++     NG+K WK V+V LEDHL  P FP G  LE YD    +Y++
Sbjct  11    PVSPNGQYFSSNVISLSVENNGKKEWKRVEVKLEDHLYTPTFPSGLSLESYDKYFDDYIS  70

Query  474   KISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPAL  653
             K+  + FPQ +PLWEIHI  YPTSNA  N IFK H +LGDGYSLMGAL+S +QRADNP+L
Sbjct  71    KLLTERFPQGKPLWEIHIISYPTSNAAANVIFKFHHALGDGYSLMGALISSMQRADNPSL  130

Query  654   PLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIH  833
             PLTFP R+ S  K+    N V + F       SG  +T++D  W+    ++ +D  T I 
Sbjct  131   PLTFPSRKRSESKR---ENFVTKTF-------SGFCNTISDL-WSGTLKTMNEDVPTPIR  179

Query  834   SQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNG  1013
             S +D +EFRP +V+TMTFSL  +K IK  L VT+NDV++G++ +GTRLYMQE  + +   
Sbjct  180   SGNDAIEFRPATVSTMTFSLDQIKSIKDKLGVTVNDVLTGMIFFGTRLYMQEMNQSSSKA  239

Query  1014  ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRF  1193
             +CTA+VL NTR M G Y  + EMIKPN++ PWGNR TF+   IPKL      + SN L F
Sbjct  240   DCTAMVLLNTRIM-GDYVPIEEMIKPNSKAPWGNRFTFMHIPIPKLT-----ELSNALDF  293

Query  1194  IYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEK  1373
             I+NA +++KR+R S + Y   + LE   K    EA  +++ RTLKN+S+ ++N+IGPVE+
Sbjct  294   IWNARKIIKRKRNSFAAYFNSRLLEIVHKFGSHEACGKYIHRTLKNSSMLISNLIGPVEQ  353

Query  1374  TTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
              +LANHP+KG+YF V G P    +T++SY GK+R+    EKD ID +KLKSC+ESA   I
Sbjct  354   MSLANHPIKGLYFLVGGGPLGFEITIVSYMGKVRVAFKMEKDVIDPQKLKSCMESALQMI  413

Query  1554  F  1556
              
Sbjct  414   L  414



>ref|XP_007132726.1| hypothetical protein PHAVU_011G119700g [Phaseolus vulgaris]
 gb|ESW04720.1| hypothetical protein PHAVU_011G119700g [Phaseolus vulgaris]
Length=469

 Score =   411 bits (1057),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 213/471 (45%), Positives = 313/471 (66%), Gaps = 11/471 (2%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP  QY NSSV+   +   LE ++PI  DDS  +S I+DVFLPINPRFSSIM+
Sbjct  6     EEVEEPVSPPGQYFNSSVICSYVFGFLEIAIPI--DDSKTVSLIKDVFLPINPRFSSIMI  63

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               ++G++ W+ V+V  E+H+K+P FP G   E YD+   +Y+T I  +  PQ +PLWEIH
Sbjct  64    RDQDGKRRWRRVEVKPEEHVKIPKFPEGNSPELYDHYFDDYVTTILTERTPQNKPLWEIH  123

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             I +YPTSNA G  IFKLH +LGDGYSLMGALLSCLQR D+P+LPLTFP R  S  +  + 
Sbjct  124   IIKYPTSNAAGTIIFKLHHALGDGYSLMGALLSCLQRIDDPSLPLTFPSRTSSSSQGSKK  183

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
             +      F+ +P ++S    +++DF  + +K+++  D+KT + S  +G E  P +++ ++
Sbjct  184   N-----MFQKLPSVISSFFSSMSDFGSSLVKTTMDVDEKTPVRSGYEGTESMPFALSNIS  238

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
              SL H+K IK+ L VTINDVI+G+  YG RLYM E +      + TA+V+ NTR +  GY
Sbjct  239   LSLDHVKAIKTKLGVTINDVITGMFFYGIRLYMLEIDNMARKAKSTAVVMLNTRNV-KGY  297

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
             KS+ EM     +  WGN+I+FL   IPKL       S NPL F++NA +++ +++ S S+
Sbjct  298   KSLKEMQNSKVKGLWGNKISFLQIPIPKL---SQSRSHNPLEFVWNARKLINKKKRSFSV  354

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             YL G  L+   KL+G EA A+ + +TL N S+ ++N+ GP+E+  LAN+P+ G+YF ++G
Sbjct  355   YLIGLLLDLEMKLKGPEAVAKIIYKTLGNCSVVISNIFGPMEQMALANNPITGLYFTMTG  414

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
              P+++ +T++SY   LR+T+ + K FID +KLK C+E AFD IF+  ++ S
Sbjct  415   GPENIDITIMSYVKVLRITLRTLKGFIDEQKLKFCMEKAFDVIFKAAMEIS  465



>ref|XP_008381074.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=457

 Score =   410 bits (1055),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 217/448 (48%), Positives = 300/448 (67%), Gaps = 27/448 (6%)
 Frame = +3

Query  147   HLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPR  326
             HLE D+ VVL P SP +QY  SSVLS S I V+E   P+ +  ++ L  ++ +FLPI+PR
Sbjct  3     HLEEDEVVVLEPVSPTAQYFTSSVLSVSNIGVMELENPLSESQAISL--LKTLFLPISPR  60

Query  327   FSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQ  506
             FSSI+V   NG+K WK V+V  E+H+ VPI P     E Y+  L  Y++K++++   + +
Sbjct  61    FSSIVVV-INGKKRWKRVEVKPEEHISVPIIPSNLSTESYEKYLDGYISKLAVERLSEDK  119

Query  507   PLWEIHIFRYPT--SNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQG  680
             PLWE+HI  YPT  +NA  N IFKLH +LGDG+SLM A+LSCL+RADNP+LPLTFP RQ 
Sbjct  120   PLWELHILNYPTRNNNAACNLIFKLHHALGDGFSLMSAILSCLRRADNPSLPLTFPSRQR  179

Query  681   SGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFR  860
             S +   E+          V R +S V +T++D  W   +S++ +DD + I S  +G+EF+
Sbjct  180   SQQTSDES---------FVSRTISSVFNTLSDI-W---RSTVGEDDLSPIRS-GNGIEFQ  225

Query  861   PISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFN  1040
             PI++ TMTFSL  +K IKS L VT+NDV++G++  GTRLYMQE  R +     TA+VL N
Sbjct  226   PITLATMTFSLDQIKSIKSKLGVTVNDVLAGMIFLGTRLYMQEINRSSSKARGTAVVLLN  285

Query  1041  TRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDS-------SNPLRFIY  1199
             TR MG  Y S+ EM+KP+++MPWGN  TFL   IP L  P D D        SN L F++
Sbjct  286   TRMMGK-YTSIQEMMKPDSKMPWGNHFTFLHVPIPNLSLPDDHDHDFPADQYSNALDFVW  344

Query  1200  NAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTT  1379
              A +++ R+R S ++YLT +FLEF  K  G EA A+++  TLKNTS+ ++N+IGPVE+  
Sbjct  345   EAQKIITRKRSSLAIYLTCRFLEFLNKFGGHEAAARYIHSTLKNTSMMISNLIGPVEQMA  404

Query  1380  LANHPVKGMYFAVSGAPQSLVVTMLSYA  1463
             LAN+PV GMYF V G+P+ L VT++SY 
Sbjct  405   LANNPVNGMYFLVFGSPEGLDVTIVSYG  432



>gb|KEH17312.1| O-acyltransferase (WSD1-like) family protein [Medicago truncatula]
Length=407

 Score =   408 bits (1048),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 201/410 (49%), Positives = 280/410 (68%), Gaps = 10/410 (2%)
 Frame = +3

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLE-FYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
             +GEK WK V+V LE+H+KVP FP  K    FYD  L +Y++KI+M+  PQ +PLWEIHI 
Sbjct  5     DGEKKWKKVEVNLEEHIKVPEFPSDKSSNSFYDEHLDDYMSKIAMEHLPQDRPLWEIHII  64

Query  531   RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSN  710
             +YPT NA G  +FKLH +LGDGYSLMGALLSCL+RADNP+LP T P  +   K    N+ 
Sbjct  65    KYPTKNAAGTLVFKLHHALGDGYSLMGALLSCLERADNPSLPFTLPSSKIRPKSIF-NTK  123

Query  711   AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFS  890
             A+ + F   P + S  + ++ DF W+ LKSS+++DD T I S+ D V+ R I+++ ++F+
Sbjct  124   AIIKRF---PSIFSSTIWSMLDFGWSILKSSMIEDDLTPIRSRADDVKLRQITISNVSFT  180

Query  891   LYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKS  1070
             + H+K++K+ L V+INDVI+G++ +G RLYM E  +E+     TALVL NTR + G YKS
Sbjct  181   MEHIKEVKTRLGVSINDVIAGLIFFGIRLYMLEVNKESRKANSTALVLLNTRNIKG-YKS  239

Query  1071  VSEMI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLY  1247
             V EM+ K N    WGN+  FL   IP+L  P      NPL FI+ AH+ + R++ S    
Sbjct  240   VKEMVSKNNNGAAWGNQFAFLHVPIPELNDP---KFENPLEFIWEAHKEISRKKNSLVTP  296

Query  1248  LTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGA  1427
             LTG  L   + LRG EA A+++  TL+N+S T++N+IGPVE+  LANHPVKG+YF V G 
Sbjct  297   LTGMLLNMVKTLRGPEAAARYVHSTLRNSSTTISNIIGPVEQMALANHPVKGLYFMVVGP  356

Query  1428  PQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             P+SL VT++SY GKLR+   SEKDFID +K+K C+E + + I + + K+S
Sbjct  357   PESLTVTIMSYMGKLRIAFGSEKDFIDKQKIKCCMEKSLEMIIKASRKTS  406



>gb|KCW57197.1| hypothetical protein EUGRSUZ_H00012 [Eucalyptus grandis]
Length=439

 Score =   406 bits (1044),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 217/454 (48%), Positives = 292/454 (64%), Gaps = 28/454 (6%)
 Frame = +3

Query  219   LSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILED  398
             +S SI+ +LE  +PI+D  +  L  IRD+FLPINPRFSSIMV G+ G + WK V V +E+
Sbjct  1     MSVSILGILELEIPIDDSQATAL--IRDIFLPINPRFSSIMVMGEKGARKWKKVGVNMEN  58

Query  399   HLKVPIFPVGKPLEFY---DYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIF  569
             H+ VP F   K        D  L  Y+++I+M PFPQ QPLWEIHI   PTS A G  IF
Sbjct  59    HVHVPSFSSSKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIHIINCPTSEAQGTLIF  118

Query  570   KLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVARAF---KAVP  740
             KLH +LGDGYSL+GALLSCLQRAD+P+LP+TFP       K+  ++N V R     K V 
Sbjct  119   KLHHALGDGYSLVGALLSCLQRADDPSLPVTFP-----SVKKFSSANKVDRTIGLRKVVS  173

Query  741   RLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSS  920
             R  S +V+TV DF W+ LKS+ + DD + I    +   FRP SV+T+TFSL H+K+IKS 
Sbjct  174   RCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRYGSE--SFRPFSVSTVTFSLDHIKEIKSR  231

Query  921   LNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNA  1097
             L VT+NDVI G++   TRLYMQ  S     +   TALVL NTR +   YK+         
Sbjct  232   LRVTVNDVILGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNLRD-YKT---------  281

Query  1098  EMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTR  1277
               PWGN   FL   IPK++ P D   S+PL+F++  H ++KR+R S  + LTG+ LE  +
Sbjct  282   -SPWGNHFAFLHVPIPKVK-PSDSQFSDPLKFVHKTHEVIKRKRSSFGVILTGKLLEIMQ  339

Query  1278  KLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLS  1457
             K R  EA A+ +  TL+N+S+ ++N+IGP +K +LANHP+KGMY+ V+G P+SL +T+ S
Sbjct  340   KCRNAEAVAKHISGTLRNSSMAISNLIGPTDKLSLANHPLKGMYYTVAGTPESLRITIFS  399

Query  1458  YAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             YAG LR+ + +E+ FID +     +  AFD I R
Sbjct  400   YAGNLRVAVGAEQGFIDSELYNHSLLDAFDMILR  433



>ref|XP_004516688.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=482

 Score =   401 bits (1030),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 213/459 (46%), Positives = 304/459 (66%), Gaps = 12/459 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP +QY+NSS L   I++V+   VPI  DD   LS +++ F+P+N RFSSIM+  KNG
Sbjct  11    PVSPTAQYLNSSSLCVYILSVIAFEVPI--DDIPALSLLQEKFIPMNTRFSSIMIEDKNG  68

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             EK WK V+V LE+H+K PIFP  K    YD    EY++K++M+  P+ +PLWE+H+ +YP
Sbjct  69    EKKWKKVEVKLEEHVKTPIFPSSKS-SLYDEHFDEYMSKLAMERLPEDRPLWEVHLIKYP  127

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             T NA G+ I KLH +LGDGYSLMGALLSC  R DNP+LP T P  Q    K   N+  V 
Sbjct  128   TKNAAGSAILKLHHALGDGYSLMGALLSCFVRVDNPSLPFTLPSTQTP--KSIFNTKDVF  185

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             + +  +  + S V +T++DF W+ LKSSL+ DD T I S  +  +F  I+V++++ ++ H
Sbjct  186   KNY--IFSIFSNVFNTISDFGWSVLKSSLVKDDFTPIKSNANDTKFLQITVSSISITMDH  243

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +K+IKS L V+INDV+ GI+  G RLYMQE  +++   + TALVL NTR++ G YKS+ E
Sbjct  244   IKEIKSRLGVSINDVLVGIIFLGIRLYMQEMNKDSSKYKSTALVLMNTRSIKG-YKSIKE  302

Query  1080  MI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTG  1256
             M+ K N   PWGN+  FL   IP+L    D +  NPL FI  AH  + R++ S    LTG
Sbjct  303   MVDKNNKNGPWGNQFAFLHTPIPEL---NDTNIENPLDFILEAHEEINRKKNSLGAPLTG  359

Query  1257  QFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQS  1436
               L   +KLRG EA+A+++  T+ N+S+T++N++GP+E+ T+AN+ VK +Y  V+G P S
Sbjct  360   LLLNVMKKLRGPEASARYIYNTIGNSSLTISNLVGPMEQMTVANYRVKSIYHIVTGVPNS  419

Query  1437  LVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             + V+++SY G LR+T   EKDF D +K  SC+E +   I
Sbjct  420   IAVSIVSYMGMLRITFALEKDFFDKEKFMSCMEKSLQLI  458



>ref|XP_006446860.1| hypothetical protein CICLE_v10015616mg [Citrus clementina]
 gb|ESR60100.1| hypothetical protein CICLE_v10015616mg [Citrus clementina]
Length=379

 Score =   395 bits (1016),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 194/382 (51%), Positives = 259/382 (68%), Gaps = 12/382 (3%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E  DEVV  P SP  QY NS++LS SI+AVLE  VP   DDS+ +  ++D+FLPINPRFS
Sbjct  4     EKADEVVAEPVSPIGQYFNSTILSISILAVLELEVPF--DDSLAIPLLKDIFLPINPRFS  61

Query  333   SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
             SIMV  KNG K+WK V+V L++H+ VP FPVG   +FYD CL +YL+K+S +  PQ+QPL
Sbjct  62    SIMVVEKNGVKHWKSVEVKLKNHVYVPNFPVGMSQQFYDKCLQDYLSKLSAEQMPQSQPL  121

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK  692
             WE+HI +YPTSNA  + IFKLH +LGDG+SLMGALLSCLQRAD+P+ PLTFP  +     
Sbjct  122   WEVHIVKYPTSNAASSVIFKLHHALGDGFSLMGALLSCLQRADDPSRPLTFPSVRMRPDI  181

Query  693   QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
              G      +  FK VP+  + V +T +DF W+ +KSSL++DDKT I S      + PI++
Sbjct  182   NG------SSIFKNVPKFFNTVFNTASDFCWSMIKSSLIEDDKTPIRSGSAAAGWLPITI  235

Query  873   TTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAM  1052
             TTMTF L+ +KQIK +L  T+NDVI+G +  G RLYMQ   +E+ N   TA+VL NTR M
Sbjct  236   TTMTFPLHQIKQIKDNLGATLNDVITGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTR-M  294

Query  1053  GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
                  S+ EM+KP ++ PWGN  +FL  ++P+L    + +  NPL+FI  A  +++ +R 
Sbjct  295   FKSISSIKEMVKPGSKAPWGNHFSFLHISVPQLT---NAEVQNPLKFIQKAQEIIQSKRS  351

Query  1233  SASLYLTGQFLEFTRKLRGLEA  1298
             S   YLT + LE  +KLRG E 
Sbjct  352   SFGAYLTAKLLETVKKLRGHEV  373



>gb|AES89684.2| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=475

 Score =   398 bits (1023),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 211/464 (45%), Positives = 298/464 (64%), Gaps = 13/464 (3%)
 Frame = +3

Query  171   VLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTG  350
             V  P SP  QY NSSV+   +   LE ++P   D+S+ +  ++DVF+PINPRFSSIMV  
Sbjct  8     VQEPVSPHGQYFNSSVMCSYVFGFLELAIPF--DNSLAIPLLKDVFIPINPRFSSIMVKD  65

Query  351   KNGEKNWKPVKVILEDHLKVPIFPV---GKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
               G+  W+ V+V  E+HLK+PIFP        E YD  +S Y+T I     PQ +PLWEI
Sbjct  66    VEGKMRWQKVEVKPEEHLKIPIFPETINSSSCELYDKYVSNYVTSILNGRTPQNKPLWEI  125

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI  YPT+NA    IFKL+ +LGDGYSLM ALLSCLQRAD+P+LPL+FP    S + Q  
Sbjct  126   HIINYPTTNAACTIIFKLNHALGDGYSLMSALLSCLQRADDPSLPLSFP----SQRPQLN  181

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             +  A    F+ +  ++S    +++DF  + LK+ ++ DDKT I S  +G E +P  ++ +
Sbjct  182   SKYAKINLFEKLCFVISSFFSSISDFGSSILKTRMIKDDKTPIRSGYEGAESQPFILSNI  241

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             T SL  +K +K+ L VTINDV++G++ YG RLYM+E   +T     TA+V+ NTR +GG 
Sbjct  242   TLSLDQIKGVKTKLGVTINDVVTGMIFYGIRLYMEEKNEKTKTSNSTAVVMLNTRNIGG-  300

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             Y+SV EM KP ++  WGN+I+FL   IPK+        SNPL F++N   ++KR+R S S
Sbjct  301   YQSVKEMQKPESKGLWGNKISFLQIPIPKM---CQSKISNPLEFVWNTRELIKRKRRSFS  357

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             +YL    L+   KLRG E  A+ +  T  N+S+ M+N++GPVEK TLANHPV G+ F ++
Sbjct  358   VYLIALLLDLEMKLRGSEVVAKIIYNTTGNSSVLMSNIVGPVEKMTLANHPVNGLCFTMT  417

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
               P+++ +T++SY   LR+T+ + K FID +KLK CIE A   I
Sbjct  418   NGPENVNITIISYMNVLRITLKTLKGFIDEQKLKFCIEKAVKVI  461



>ref|XP_006446856.1| hypothetical protein CICLE_v10015143mg [Citrus clementina]
 gb|ESR60096.1| hypothetical protein CICLE_v10015143mg [Citrus clementina]
Length=373

 Score =   394 bits (1012),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/381 (51%), Positives = 258/381 (68%), Gaps = 12/381 (3%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E  DEVV  P SP  QY NSS+LS SI+AVLE  VP   DDS  +  ++D+FLPINPRFS
Sbjct  4     EKADEVVAEPVSPIGQYFNSSILSISILAVLELEVPF--DDSWAIPLLKDIFLPINPRFS  61

Query  333   SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
             SIMV  KNG K+WK V+V L++H+ VP FPVG   +FYD CL +YL+K+S +  PQ+QPL
Sbjct  62    SIMVVEKNGVKHWKSVEVKLKNHVYVPNFPVGMSQQFYDKCLQDYLSKLSAEQMPQSQPL  121

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK  692
             WE+HI +YPTSNA  + IFKLH +LGDG+SLMGALLSCLQRAD+P+ PLTFP  +     
Sbjct  122   WEVHIVKYPTSNAASSVIFKLHHALGDGFSLMGALLSCLQRADDPSRPLTFPSVRMRPDI  181

Query  693   QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
              G      +  FK VP+  + V +T +DF W+ +KSSL++DDKT I S      + PI++
Sbjct  182   NG------SSIFKNVPKFFNTVFNTASDFCWSMIKSSLIEDDKTPIRSGSAAAGWLPITI  235

Query  873   TTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAM  1052
             TTMTF L+ +KQIK +L  T+NDV++G +  G RLYMQ   +E+ N   TA+VL NTR M
Sbjct  236   TTMTFPLHQIKQIKDNLGATLNDVVTGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTR-M  294

Query  1053  GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRY  1232
                  S+ EM+KP ++ PWGN  +FL  ++P+L    + +  NPL+FI  A  +++ +R 
Sbjct  295   FKSISSIKEMVKPGSKAPWGNHFSFLHISVPQLT---NAEVQNPLKFIQKAQEIIQSKRG  351

Query  1233  SASLYLTGQFLEFTRKLRGLE  1295
             S   YLT + LE  +KLRG E
Sbjct  352   SFGAYLTAKLLETVKKLRGHE  372



>gb|KCW46801.1| hypothetical protein EUGRSUZ_K00605 [Eucalyptus grandis]
Length=446

 Score =   396 bits (1018),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 209/428 (49%), Positives = 282/428 (66%), Gaps = 15/428 (4%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP  QY+NS V+S SI+ +LE  +PI  DDS  +S  RD FLPINPRFSSIMVTG 
Sbjct  10    LEPVSPSGQYLNSKVMSVSILGILELEIPI--DDSQAMSLFRDDFLPINPRFSSIMVTGD  67

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFY---DYCLSEYLTKISMDPFPQTQPLWEIH  524
              G + WK V V +E+H+ VP F   K        D  L  Y+++I+M PFPQ QPLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             I + PTS A    IFKLH +LGDGYSL+ ALLSCLQRAD+P+LP+TFP  +       ++
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTFPSVKKFSSANKDD  187

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
              N   R  K V R  S +V+TV DF W+ LKS+ + DD + I S  + ++  P SV+T+T
Sbjct  188   RNIGLR--KVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PFSVSTIT  243

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGGG  1061
             FSL  +K+IKS L VT+NDVI G++   TRLYMQ  S     +   TALVL NTR +   
Sbjct  244   FSLDQIKEIKSRLRVTVNDVILGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNL-RD  302

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YK V +M++PN+E PWGN   FL   IPK++ P D   S+PL+F++  H ++KR+R S  
Sbjct  303   YKPVKDMVRPNSESPWGNHFAFLHVPIPKVK-PSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1242  LYLTGQFLEFTRKLRG---LEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYF  1412
             + LTG+ LE  +K R    L+A A+ + RT +N+S+ ++N+IGPV+  +LANHP+KGMY+
Sbjct  362   VILTGKLLEIMQKCRNAEYLQAVAKHISRTARNSSMCISNLIGPVDNLSLANHPLKGMYY  421

Query  1413  AVSGAPQS  1436
              ++G P+S
Sbjct  422   TIAGTPES  429



>ref|XP_004516680.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=473

 Score =   394 bits (1013),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 212/459 (46%), Positives = 298/459 (65%), Gaps = 12/459 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY+NSS L   I+ ++   VPI  DD   LS +++ F+P N RFSSIM+  KNG
Sbjct  11    PVSPTGQYLNSSSLCVYILGMINFEVPI--DDIPALSLLQEKFIPTNTRFSSIMIEDKNG  68

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             EK WK V+V LE+H+K PIFP  K    YD    EY++K++M+  P+ +PLWE+H+ +YP
Sbjct  69    EKKWKKVEVKLEEHVKTPIFPSSKS-SLYDEHFDEYMSKLAMERLPEDRPLWEVHLIKYP  127

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             T NA G+ I KLH +LGDGYSLMGALLSC  R DNP+LP T P  Q    K   N+  V 
Sbjct  128   TKNAAGSAILKLHHALGDGYSLMGALLSCFVRVDNPSLPFTLPSTQTP--KSIFNNKDVF  185

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             + +  +  + S V +T++DF W+ LKSSL+ DD T I S  +  +   I+V++++ ++ H
Sbjct  186   KNY--IFSIFSNVFNTISDFGWSVLKSSLVKDDFTPIKSNANDTKLLQITVSSISVTMDH  243

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +K+IKS L V+INDV+ GI+  G RLYMQE  +++   + TALVL NTR++ G YKS+ E
Sbjct  244   IKEIKSRLGVSINDVLVGIIFLGIRLYMQEMNKDSSKYKSTALVLMNTRSIKG-YKSIKE  302

Query  1080  MI-KPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTG  1256
             M+ K N   PWGN+  FL   IP+L    D    NPL FI  AH  + R++ S    LTG
Sbjct  303   MVDKNNKNGPWGNQFAFLHTPIPEL---NDTKIENPLEFILEAHEEINRKKNSLGAPLTG  359

Query  1257  QFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQS  1436
               L   +KLRG EA+A+++  T+ N+S+T++N++GP+E+ T+AN+ V  +Y  V+G P S
Sbjct  360   LLLNVMKKLRGPEASARYIYNTIGNSSLTISNLVGPMEQMTVANYRVNSIYHIVTGVPNS  419

Query  1437  LVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             + V++LSY G LR+T   EKDF D +K  SCIE +   I
Sbjct  420   ISVSILSYMGMLRITFALEKDFFDKEKFMSCIEKSLQLI  458



>ref|XP_004505568.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=471

 Score =   393 bits (1010),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 204/472 (43%), Positives = 299/472 (63%), Gaps = 13/472 (3%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP  QY N+S++S  ++A +E + P  +  S+++  I +VF   NPRFSSIMV
Sbjct  6     EEVEEPVSPTGQYFNNSIISSYVVAFMEFANPFHE--SLLIPFITNVFFHANPRFSSIMV  63

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
              G++G   W+ V+V  E+H+K+P  P  K    YD   +EY+T I     PQ +PLWEIH
Sbjct  64    RGEDGTMRWRKVEVYPEEHIKIPKLPEIKE-SLYDNYFNEYVTSILNARTPQDKPLWEIH  122

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             +F+YPTS A    IFKLH ++GDGYSLM ALLSCL RAD+P+LPL+FP RQ S  K  + 
Sbjct  123   LFKYPTSKAATTAIFKLHHAIGDGYSLMSALLSCLNRADDPSLPLSFPSRQQSHSKYAQK  182

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
             S      F+ +    S    ++ DF  + +++ + +DD T I S  +G E +P +++ + 
Sbjct  183   S-----LFQKICLTTSYFFGSILDFGSSIIQTRITEDDITPIRSGYEGTELQPFALSEIV  237

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
              SL  +K  KS L VTIND+++GI+ YG RLYM+E + +T      +++L NTR + G Y
Sbjct  238   LSLDQIKATKSKLGVTINDLVTGIIFYGIRLYMEEKDEKTKCSNSKSVILLNTRNISG-Y  296

Query  1065  KSVSEMIKPNAEMP-WGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             KS+ EM KP +E   WGN+ + L  +IPKL        SNPL F++ + +++K++RYS  
Sbjct  297   KSLKEMQKPKSEGGLWGNQFSMLQISIPKLT---QSRISNPLEFVWESSKLIKKKRYSFG  353

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS  1421
             +YL    ++F RKLRG EA A+ L ++  N+S  +TNMIGP+EKT + N PV G+YF V 
Sbjct  354   VYLMALLMDFERKLRGPEAVAKVLFKSAFNSSTLITNMIGPIEKTAVENIPVNGIYFTVM  413

Query  1422  GAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             G P++L ++++SY   LR+T+ + K FID +KLK CIE A + IF+  +  S
Sbjct  414   GGPENLFISLISYVNILRITLRTLKGFIDEQKLKLCIEKAAEVIFKAAMDIS  465



>gb|KDO53892.1| hypothetical protein CISIN_1g036070mg [Citrus sinensis]
Length=426

 Score =   391 bits (1005),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 208/465 (45%), Positives = 288/465 (62%), Gaps = 55/465 (12%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP +QY++SS LS  I+A+LE    +  DDS+++  ++DVFL I+PRFSS+MV  +NG
Sbjct  11    PVSPTAQYLSSSTLSLCILAILEFEQVL--DDSLLMQLVKDVFLSISPRFSSVMVRDENG  68

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K  K V+V L +H+K P  P G   E YD  L +Y+++I M   PQ+QPLWEIH+ R P
Sbjct  69    AKQRKRVEVKLINHVKFPFCPSGLSPESYDKYLGDYISEIGMQQLPQSQPLWEIHLIRSP  128

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TS+A    IFKLH SLGDG+SLMGALLSCLQRAD+P+LPLT P      K + E++ ++ 
Sbjct  129   TSHAACTLIFKLHHSLGDGFSLMGALLSCLQRADDPSLPLTLPSVFLPSKAKDESNGSI-  187

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
               F  V ++ S V DTV DF WNF+KS+  +DD+T I S DD VEFRP+ V TMTFSL H
Sbjct  188   --FTRVLKIFSTVSDTVLDFCWNFVKSTTAEDDQTPIRSGDDRVEFRPVRVATMTFSLDH  245

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +KQIK+ +  TINDV++GI+  GTRLYMQE   ++ N + TAL+L NTR     Y+SV +
Sbjct  246   VKQIKTKVVATINDVVTGIIFLGTRLYMQELRHDSSNAKSTALILLNTRVF-RSYESVKD  304

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M+K +A  PWGN   FL  +IP+L    D  SSNPL F+  A +++  ++ S ++YLTG+
Sbjct  305   MLKHDANAPWGNYFAFLHMSIPEL---TDDWSSNPLDFVVKARQIMNFKKNSLAVYLTGR  361

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
              LE  +  R                                               P+SL
Sbjct  362   VLEILKNFR----------------------------------------------VPESL  375

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKS  1574
              VT++SY  KLR+++++E  FID +KLKSC+E AF+ +   T+++
Sbjct  376   SVTIISYMEKLRVSVVAEDGFIDSQKLKSCVEHAFEVMLNATVET  420



>gb|EYU24923.1| hypothetical protein MIMGU_mgv1a007879mg [Erythranthe guttata]
Length=392

 Score =   386 bits (992),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 192/392 (49%), Positives = 268/392 (68%), Gaps = 19/392 (5%)
 Frame = +3

Query  147   HLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPR  326
             +++ +++V L P SP +QY+ SS LS +I+AVLE   P+ED  S+ +  +++VFLPINPR
Sbjct  10    YVDMEEQVPLEPMSPSAQYLKSSALSLTILAVLELQHPMED--SIAIKLVKEVFLPINPR  67

Query  327   FSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQ  506
             FSSIMV G NGEK WK V+V ++DH+ VP+FP  +   ++D    EY ++++ +  P  +
Sbjct  68    FSSIMVAGGNGEKKWKRVEVNVDDHIHVPVFPATE-TGYHDEFFGEYFSRMAAEELPPDR  126

Query  507   PLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG  686
             PLWEIH+ ++ T  A  + +FKLH SLGDGYSLMGALLSCLQR D+P++PLTFP    +G
Sbjct  127   PLWEIHMVKHRTRTAAESVVFKLHHSLGDGYSLMGALLSCLQRLDDPSIPLTFP----AG  182

Query  687   K-------KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDD  845
             K         G          + V     G+V+T +DF W+ LKSSL++DD++ I S +D
Sbjct  183   KFCVGGGGGGGGGGGGGCSVLRRVRGFFKGMVNTASDFGWSVLKSSLIEDDESPIRSGED  242

Query  846   GVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTA  1025
             GVEFRPI  +T TFS+  +K+IK+ LNVTINDV++GI+  GTRLYMQ++ + +   + TA
Sbjct  243   GVEFRPIVTSTTTFSIDQIKEIKTKLNVTINDVVTGIIMLGTRLYMQKASQISSEAKSTA  302

Query  1026  LVLFNTRAM--GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIY  1199
             LVL NTRA   G GYKSVSEM++P ++MPWGNR  FL   IPKL    D +  +PL F+ 
Sbjct  303   LVLLNTRAAARGAGYKSVSEMVEPGSKMPWGNRFAFLHVPIPKL---SDVELQDPLIFVK  359

Query  1200  NAHRMVKRQRYSASLYLTGQFLEFTRKLRGLE  1295
               HR +K++R SA +YLTGQ L+  RK++G E
Sbjct  360   KVHRTIKKRRNSAGIYLTGQLLDLIRKIKGPE  391



>ref|XP_008455537.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis melo]
Length=627

 Score =   392 bits (1006),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 200/441 (45%), Positives = 290/441 (66%), Gaps = 15/441 (3%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +E +DE+ L P SP +Q  N+S LS S+IAV+E  +PI  D++ I+   +D F+P+NP F
Sbjct  1     MEEEDEL-LEPVSPTAQCFNTSALSISVIAVVEFEIPI--DEAKIMCYAKD-FIPLNPLF  56

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSIMV   NGE+ WK V+V +E+ + V   P    +E  +   +EY+TK+S+  F Q +P
Sbjct  57    SSIMVNDINGERKWKKVEVKVEEQIVVATPPSNLSIELNNVYFNEYITKLSVKEFAQNKP  116

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGK  689
             LWEIHI   PTS+A  N + K H SLGDGYS+MG LLS ++RADNP+LPLTFP    +GK
Sbjct  117   LWEIHILNCPTSDAAANLVLKFHHSLGDGYSVMGLLLSSMKRADNPSLPLTFPF---TGK  173

Query  690   KQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPIS  869
                 NSN   +    V   L   ++TV DF  + +KSS+L+D+ T I S  DGVEF+P  
Sbjct  174   II--NSNKFGQISSGVSHFLLSSINTVLDFGLSLIKSSVLEDELTPIRSGGDGVEFKPTE  231

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRA  1049
             + T+TFSL+H+KQIKS L +T+NDV+ G++  G RLYM+E+  E+     TALVL NTR 
Sbjct  232   IWTITFSLHHIKQIKSKLRMTVNDVVVGMLFLGIRLYMEETRPESTKSNSTALVLLNTR-  290

Query  1050  MGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
             M   YK + +M+ PN+  PWGNR  FL   IPKL    D + SNPL+ +  A +++KR+R
Sbjct  291   MFRTYKCMEDMLNPNSNTPWGNRFAFLHIDIPKLT---DFNLSNPLQLVEAAQKLIKRKR  347

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
              S++++L  + ++   K RG E  ++++ +T+KN+S++++N+IGP EK  L  HP KGMY
Sbjct  348   DSSAVFLVDKLMQMIHKFRGSEVASKYVYKTIKNSSLSISNLIGPKEKMALTGHPAKGMY  407

Query  1410  FAVSGAPQSL--VVTMLSYAG  1466
             F V G PQ++  V++ + + G
Sbjct  408   FTVVGIPQTINDVISGIVFMG  428


 Score =   191 bits (486),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 132/193 (68%), Gaps = 4/193 (2%)
 Frame = +3

Query  930   TINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPW  1109
             TINDVISGIV  G RLYM E+  ++     T +VL NTR M G YKS+ +M+KPN+   W
Sbjct  416   TINDVISGIVFMGIRLYMHETCPDSTQSNVTTIVLLNTR-MFGDYKSIEDMLKPNSNASW  474

Query  1110  GNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRG  1289
             GNRI  L   IPKL    D + SNP++FI  A +++KR+RYS +++L  + +E  +KL+G
Sbjct  475   GNRIALLLIDIPKLT---DYELSNPIQFIKAAQKLIKRKRYSYAIFLLDKLMEMVQKLKG  531

Query  1290  LEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGK  1469
              EA A+ + +  +N+S++++NMIGP EK  L  HP KG+YF + G PQSL++T++SY   
Sbjct  532   PEAAAKCVYKMARNSSLSISNMIGPKEKMALLGHPAKGIYFTIFGIPQSLMITVVSYMED  591

Query  1470  LRLTIISEKDFID  1508
             LR+   SEK+FID
Sbjct  592   LRIAFGSEKEFID  604



>ref|XP_004492761.1| PREDICTED: O-acyltransferase WSD1-like [Cicer arietinum]
Length=476

 Score =   386 bits (992),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 204/462 (44%), Positives = 301/462 (65%), Gaps = 15/462 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  Q +N++ L   I+A LE  VPI D    I+S + D FL I P F+SIMV  + G
Sbjct  12    PVSPMGQCLNNTSLCSYILAFLEFEVPIHDLP--IVSLVEDAFLSI-PHFTSIMVNDERG  68

Query  360   EKNWKPVKVILEDHLKVP-IFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRY  536
              K WK V+V LE+H+  P +   G  ++ YD   ++Y+++++++  P T+PLW++H+F+Y
Sbjct  69    VKRWKQVEVKLEEHIIEPKLIDDGISVDLYDKHFADYISRMALEKLPPTKPLWQVHVFKY  128

Query  537   PTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAV  716
             PTSNA G  +FKLH ++GDGYSLM  +LS LQRAD+P+LPL+FP  + S K      N  
Sbjct  129   PTSNAAGTLVFKLHHAIGDGYSLMSVILSSLQRADDPSLPLSFPSSRKSSK-----PNKF  183

Query  717   ARAF-KAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
             +R F   +P+ LS   ++V++F  + LKS+LL+DDKT I S  + VEFRP  ++ +TFS+
Sbjct  184   SRLFLNKMPQFLSIPFNSVSEFGSSLLKSTLLEDDKTPIRSGVEAVEFRPTKLSNVTFSI  243

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
              H+KQIKS+L VTINDVI+GI+ YG RLYMQ+ +  +     TALV+ +TR +   Y+ V
Sbjct  244   DHIKQIKSNLGVTINDVITGIIFYGIRLYMQDVDYRSRTLNSTALVIASTRHI-KDYQRV  302

Query  1074  SEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLT  1253
              +M+   A+  WGNRIT+   +IPKL    D   SNPL+F+  AH  +KR+  S +  L 
Sbjct  303   QDMMLKTAKSAWGNRITYYHVSIPKLE---DIPISNPLQFVMKAHTSIKRKNNSFAPLLV  359

Query  1254  GQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
              + L+   K  G E  A+++  TL+ +S+ ++N++GP+E+   ANHP+ G  F ++G PQ
Sbjct  360   TKLLQMKVKFEGPEVVAKYVHNTLRKSSLIISNVVGPIEQMAWANHPIGGFSFTLAGFPQ  419

Query  1434  SLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             SLV+T++SY G LR+T  +E+ FID +KL   +  AF EI R
Sbjct  420   SLVITIMSYMGVLRVTSSTEEGFIDEQKLMQYMNKAF-EIIR  460



>ref|XP_011001812.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Populus euphratica]
Length=395

 Score =   382 bits (980),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 198/377 (53%), Positives = 259/377 (69%), Gaps = 11/377 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             D+ +  P SP  Q+++SS+LS SIIAV+E   P   D+S  +  ++DVFLPINPRFSSIM
Sbjct  6     DQEISEPVSPSGQFLSSSILSLSIIAVMEFEAPF--DNSQAIPFLKDVFLPINPRFSSIM  63

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
             V  K+G K WK V+V L DH+  P+F  G   +FYD C  EYL+K++M+  PQ+QPLWE+
Sbjct  64    VADKDGVKRWKRVEVRLTDHVNFPVFTTGMSTQFYDECFDEYLSKMAMEQLPQSQPLWEV  123

Query  522   HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
             HI  YPTS+A  N IFKLH SLGDG+SLMGALLSCLQRAD P LPLTFP  Q      G 
Sbjct  124   HIINYPTSHAASNIIFKLHHSLGDGFSLMGALLSCLQRADAPPLPLTFPSVQLHTNTSGR  183

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
             N +     F+ VPR  S V +T +DF  + ++S L+ DDKT I S   GVEF P+++TTM
Sbjct  184   NCS----MFRKVPRFFSSVYNTASDFCSSIIQSCLVKDDKTPIRSGHSGVEFLPVAITTM  239

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGG  1061
             TFSL  +KQIK+ L VTINDVI+GI+  G R+YM+   + + +   T+LVL NTR M GG
Sbjct  240   TFSLDQIKQIKAKLGVTINDVITGIIFLGARMYMETVSQGSGSACSTSLVLLNTR-MHGG  298

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDS-SNPLRFIYNAHRMVKRQRYSA  1238
             YKS+ EM+KP+AE PWGN   FL   IPKLR   D ++ +NPL+FI NA +++K++R S 
Sbjct  299   YKSIQEMVKPDAESPWGNHFAFLNVRIPKLR---DAEAKNNPLKFILNARKIIKKKRTSF  355

Query  1239  SLYLTGQFLEFTRKLRG  1289
              + LT ++L+   K RG
Sbjct  356   GVNLTAKYLQLVAKFRG  372



>ref|XP_007149837.1| hypothetical protein PHAVU_005G102500g [Phaseolus vulgaris]
 gb|ESW21831.1| hypothetical protein PHAVU_005G102500g [Phaseolus vulgaris]
Length=461

 Score =   384 bits (985),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 194/467 (42%), Positives = 289/467 (62%), Gaps = 14/467 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E V  P SP + Y +SS+++  ++ V+ES +PI  D+S     +++  LPI  RFSSIM
Sbjct  5     EEDVPMPLSPMADYFSSSLINVFVLCVVESEIPI--DESKFQPLLKNKLLPICSRFSSIM  62

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFP-VGKPLEFYDYCLSEYLTKISMDPFPQTQPLWE  518
             VT KNG+K WK V V  EDH+K+P F      L+ YD CL EY++KI+M+   + +PLWE
Sbjct  63    VTDKNGKKVWKQVDVNPEDHIKIPKFASTNGTLKLYDECLDEYMSKIAMEQLREDKPLWE  122

Query  519   IHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQG  698
             +HIF YPT+ A G  + KLH +LGDGYS M   LS  Q ADNP+LP+  P  +       
Sbjct  123   VHIFNYPTTKAAGTIVVKLHHALGDGYSFMATFLSITQSADNPSLPIKLPSSKSV-----  177

Query  699   ENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTT  878
               S +     K + +  S V  +  DF W+F+KSS++ D++T + S  + V FRP+S+T 
Sbjct  178   -ESTSTKGIGKRLSQTASVVFKSAFDFGWSFMKSSVMPDEQTPLRSGHEDVGFRPMSITN  236

Query  879   MTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGG  1058
             ++ SL  +K++K+ L V++NDV+ G + +G +LYM+   +++   E TALVL NTR +  
Sbjct  237   VSLSLDTIKEVKNKLKVSVNDVLVGAIFFGIQLYMKAKNQKSGTSESTALVLLNTRKIRA  296

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
              YKS  EM   ++E PWGNR  F+   IP L    D +  NPL F++ A + + RQR S 
Sbjct  297   -YKSAKEM-HNDSEAPWGNRFHFMHVPIPMLT---DKNELNPLEFVFEAKKKISRQRTSL  351

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
             ++ +TG  L    +++G +A   +L +T+ N S+++++M+GP EK TLANHP+KG YF  
Sbjct  352   AVPMTGVLLHLLNQIKGPQAATNYLYKTMNNASLSISHMVGPAEKVTLANHPIKGFYFMT  411

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              G  QS+ VT+ SY G LR+    E+ FID  +LKSC E++  +I  
Sbjct  412   VGLSQSITVTITSYMGHLRVGFGVEEGFIDEYQLKSCFETSLQQILE  458



>ref|XP_006582315.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=431

 Score =   382 bits (982),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 199/471 (42%), Positives = 285/471 (61%), Gaps = 52/471 (11%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP  QY NSSV+   +   LE +VPI+D  ++ L  ++DVFLPINPRFSSIMV
Sbjct  7     EEVQEPVSPPGQYFNSSVICSYVFGFLEMAVPIDDSQTIPL--LKDVFLPINPRFSSIMV  64

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               ++G   WK V+V  E+H+KVP FP     E YD    +Y+T+I  +  PQ +PLWEIH
Sbjct  65    RDQDGRMKWKRVQVKPEEHVKVPKFPECNSPELYDQYFGDYVTRILTERTPQNKPLWEIH  124

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             I   PT NA G  IFKLH +LGDGYSLMGALLSCLQR                       
Sbjct  125   IINNPTRNAAGTLIFKLHHALGDGYSLMGALLSCLQR-----------------------  161

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
                                    +F  + +K+ ++ DDKT + S  +G    P +++ ++
Sbjct  162   -----------------------NFGSSLIKTRMIVDDKTPLRSGYEGTVSMPFTLSHIS  198

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGY  1064
               + ++K IKS L VTINDVI+G++ YG RLYMQE +R       T +V+ NTR + G Y
Sbjct  199   LYIDNIKAIKSKLGVTINDVITGLIFYGIRLYMQEIDRMARKANSTCVVMLNTRNVRG-Y  257

Query  1065  KSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASL  1244
             +SV EM K   +  WGN+I+FL   IPKL   G    SNPL FI+NA + +K++R S S+
Sbjct  258   QSVKEMQKSKVKGLWGNKISFLQVPIPKL---GQSKISNPLEFIWNARKQIKKKRRSFSV  314

Query  1245  YLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSG  1424
             YL G  L+   K+RG EA A+ + +TL+N+S+ ++N+ GP+E+ TLANHP+ G+YF ++G
Sbjct  315   YLIGLLLDLEMKIRGPEAVAKIIYKTLRNSSVVISNLFGPMEQMTLANHPISGLYFTMTG  374

Query  1425  APQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
              P+++ +T++SY   +R+T+ + K F+D +K K CIE A+D +F+  ++ S
Sbjct  375   GPENVDITIMSYVKVIRITLRTLKGFVDEQKFKFCIEKAYDVMFKAAMEIS  425



>ref|XP_010268803.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=483

 Score =   378 bits (970),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 189/460 (41%), Positives = 294/460 (64%), Gaps = 13/460 (3%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP SQ +NSS LS  II V E   P+    +     ++D+F+PIN RFSS+++T K
Sbjct  18    LPPLSPLSQCINSSSLSIPIIGVYELGAPLNRSQTATF--LQDIFIPINDRFSSVIITDK  75

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
              G + WK V+V +++H+ +P FP G   E YD   +EYL+KI+MDP P+ +PLW +H+  
Sbjct  76    KGMQRWKKVEVDIDEHILIPTFPSGLSREDYDDYTNEYLSKITMDPLPENRPLWNVHVIP  135

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
             YP++NA    +FK++ ++GDGYSL+GAL SCL+RAD+P+LPLTFP    S   QG     
Sbjct  136   YPSTNAEATLVFKINHAIGDGYSLIGALFSCLKRADDPSLPLTFP-SMSSRMMQGTGG--  192

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
                 +  +   L+  V+T+TD + + L  + L+DDKTAI S    VE+ PIS++++TFSL
Sbjct  193   -LSKWSRLCSFLTVCVNTLTDSARSVLFGTFLEDDKTAIRSGLPEVEYEPISISSITFSL  251

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
               L +I+S    T+N+ ++GI++Y  +LYM+   + +     T+LV+ N R M  G+K+V
Sbjct  252   DDLGRIQSKFGGTVNEAVTGIISYAIQLYMKRVGKVSKKARITSLVVLNAR-MLKGFKTV  310

Query  1074  SEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLT  1253
              +M+K N    WGNR + L  ++P   S  D +  +P+ F+  A + ++R+R S +L+  
Sbjct  311   GDMLKANI---WGNRFSLLHVSVP---SNVDVNKVDPMDFVVQAKKEMRRRRNSMALFFN  364

Query  1254  GQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
              + L   R +RG EA ++++  T KN SITMT+++GP +K  +A+ P+   YF ++G PQ
Sbjct  365   NRLLHVLRSIRGPEAASRYIYSTWKNASITMTSLVGPTQKMVIADLPINSFYFTLAGVPQ  424

Query  1434  SLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             SLV T++SY GKLR+ + +EKDFID +   SC+  A+++I
Sbjct  425   SLVFTIVSYMGKLRVAVRTEKDFIDSQLFVSCMNEAYEKI  464



>ref|XP_006469878.1| PREDICTED: O-acyltransferase WSD1-like [Citrus sinensis]
Length=380

 Score =   374 bits (960),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/372 (51%), Positives = 254/372 (68%), Gaps = 9/372 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP +QY++SS LS  I+A+LE    +  DDS+++  ++DVFL I+PRFSS+MV  +NG
Sbjct  11    PVSPTAQYLSSSTLSLCILAILEFEQVL--DDSLLMQLVKDVFLSISPRFSSVMVRDENG  68

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K WK V+V L +H+K P  P G   E YD  L +Y+++I M   PQ+QPLWEIH+ R P
Sbjct  69    AKQWKRVEVKLINHVKFPFCPSGLSPESYDKYLGDYISEIGMQQLPQSQPLWEIHLIRSP  128

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TS+A    IFKLH SLGDG+SLMGALLSCLQRAD+P+LPLT P      K + E++ ++ 
Sbjct  129   TSHAACTLIFKLHHSLGDGFSLMGALLSCLQRADDPSLPLTLPSVFLPSKAKDESNGSI-  187

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
               F  V ++ S V DTV DF WNF+K +  +DD+T I S DDGVEFRP+ V TMTFSL H
Sbjct  188   --FTRVLKIFSTVSDTVLDFCWNFVKITTAEDDQTPIRSGDDGVEFRPVRVATMTFSLDH  245

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +KQIK+ ++ TINDV++GI+  GTRLYMQE   ++ N   TAL+L NTR     Y+SV +
Sbjct  246   VKQIKTKVDATINDVVTGIIFLGTRLYMQELRHDSSNAISTALILLNTRVF-RSYESVKD  304

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M+K +A  PWGN   FL  +IP+L    D  SSNPL F+  A +++  ++ S ++YLTG+
Sbjct  305   MLKHDANAPWGNYFAFLHVSIPEL---TDDWSSNPLEFVVKARQIMNFKKNSLAVYLTGR  361

Query  1260  FLEFTRKLRGLE  1295
              LE  +K RG E
Sbjct  362   VLEILKKFRGPE  373



>ref|XP_007149838.1| hypothetical protein PHAVU_005G102600g [Phaseolus vulgaris]
 gb|ESW21832.1| hypothetical protein PHAVU_005G102600g [Phaseolus vulgaris]
Length=470

 Score =   375 bits (962),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 191/467 (41%), Positives = 284/467 (61%), Gaps = 14/467 (3%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E V  P SP + Y++SS+++  ++  +ES +PI  DDS     + +  LPI  RFS IM
Sbjct  5     EEDVPMPLSPMADYLSSSLINVFVLCAVESEIPI--DDSKFQPLLENKLLPICSRFSCIM  62

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFP-VGKPLEFYDYCLSEYLTKISMDPFPQTQPLWE  518
             VT KNG+K WK V V  EDH+K+P F    +  + YD CL  Y++KI+ +   + QPLWE
Sbjct  63    VTDKNGKKVWKQVDVNPEDHIKIPKFASTNRTHKLYDECLDGYMSKIANEQLREDQPLWE  122

Query  519   IHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQG  698
             +HIF YPT+ A G  +FKLH +LGD YS M   LS  Q ADNP+LP+  P  +       
Sbjct  123   VHIFNYPTTKAAGTILFKLHHALGDDYSFMATFLSITQSADNPSLPIKLPSSKLV-----  177

Query  699   ENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTT  878
               S +     K + +  S ++ +  DF W+F+KSSL+ D++T + S  + V FRP+S+  
Sbjct  178   -ESTSTKGMVKRLSQTASVLLKSAFDFGWSFMKSSLMPDEQTPLRSGHEDVGFRPMSIIN  236

Query  879   MTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGG  1058
             ++ SL  +K++K+ L V+INDV+ G + +G +LYM+   +++   E TALVL NTR +  
Sbjct  237   VSLSLDSIKEVKNELKVSINDVLVGAIFFGIQLYMKAKNQKSGTSESTALVLLNTRKIRA  296

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
              YKS  EM   ++E PWGNR  F+   IP L    D +  NPL F+  A + + RQR S 
Sbjct  297   -YKSAKEM-HTDSEAPWGNRFHFMHVPIPML---SDNNELNPLEFVLEAKKKINRQRTSL  351

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
             ++ + G  L    +++G +A   FL +T+ N S+++++M+GP EK TLANHP+KG+YF  
Sbjct  352   AVPMAGVLLRLLNQIKGPQAATNFLYKTMNNASLSISHMVGPAEKVTLANHPIKGLYFMT  411

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              G  QS+ VT+ SY G LR+    E+ FID  +LKSC E++  +I  
Sbjct  412   VGLSQSITVTITSYMGHLRVGFGVEEGFIDEYQLKSCFETSLQKILE  458



>gb|KGN43653.1| hypothetical protein Csa_7G051330 [Cucumis sativus]
Length=413

 Score =   371 bits (953),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/409 (46%), Positives = 256/409 (63%), Gaps = 7/409 (2%)
 Frame = +3

Query  336   IMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLW  515
             + V  K  E+ WK  KV  +DH+ +P FP+      YD    EY TK +  PF Q  PLW
Sbjct  1     MQVKEKTEERKWKTTKVNPKDHIYIPNFPMELSSYEYDAYFDEYATKTATKPFSQAIPLW  60

Query  516   EIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
             EIH+F YPT++A  + IFK+H S+ DG+ LM  LLSCL+RAD+P+LPLTFP RQ S  KQ
Sbjct  61    EIHVFNYPTTHATCSIIFKVHHSIADGFCLMNTLLSCLKRADDPSLPLTFPSRQRS--KQ  118

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEF-RPISV  872
               N     R      R  S + + V +F W+ +K++ ++DD T I  Q D ++  +PI++
Sbjct  119   PGNEPKFFRLSHFPARFFSSISNFVLNFGWSIMKNTFVEDDPTPIKPQKDSMQLVKPIAI  178

Query  873   TTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAM  1052
             +TMTFSL  +KQIK+ LN ++NDV++GI+  G RLYMQE   E+     +AL+L NTR  
Sbjct  179   STMTFSLDQIKQIKNKLNASVNDVLTGIIFLGIRLYMQEHNPESSGANSSALILLNTRK-  237

Query  1053  GGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKL-RSPGDGDSSNPLRFIYNAHRMVKRQR  1229
                YKSV EM+K +++ PWGN+I FLP  IPKL  SP    SS PL F+      +  QR
Sbjct  238   AKAYKSVKEMVKKDSDAPWGNKIAFLPIPIPKLIDSP--VVSSTPLEFVEKVKEKIMLQR  295

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
                S++L  +  E  + + G E  A+  +R LKN+SI ++NMIGPVEK  L N PVKG+Y
Sbjct  296   SPLSVFLAAKVFEILKNVTGPEIGAKLFKRKLKNSSIMISNMIGPVEKMALVNLPVKGLY  355

Query  1410  FAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
             F V G PQSL++T++SY G LR+    EK FI+ +KLK CIE AF  I 
Sbjct  356   FTVPGMPQSLMITIVSYMGDLRIVFGGEKCFINQQKLKVCIEDAFQRIL  404



>gb|KDO41203.1| hypothetical protein CISIN_1g017622mg [Citrus sinensis]
Length=368

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 230/319 (72%), Gaps = 9/319 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  QY+NSS LS S++ VLES +PI  DDS   S ++D+FLPINPRFSSIMV  +NG
Sbjct  11    PVSPSGQYLNSSALSLSVLGVLESEIPI--DDSQCFSLLKDIFLPINPRFSSIMVVDENG  68

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             EK WK V+V L +H+KVPIFP G   E YD    +Y+++I M+ FPQ+QPLWE+HI +YP
Sbjct  69    EKQWKRVEVKLRNHVKVPIFPSGLSPEAYDKYFDDYISEIGMELFPQSQPLWEVHIIKYP  128

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFP--RRQGSGKKQGENSNA  713
             TS+A G  IFKLH SLGDG+SLMGALLSCLQRAD+P++PLTFP   R  S KK G NSN 
Sbjct  129   TSHAAGFLIFKLHHSLGDGFSLMGALLSCLQRADDPSVPLTFPSVNRFPSNKKDGNNSNI  188

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
              +  +K        V +TV+DF W+F+KS+ L DD+T I+S DDG+EFRP+SV T  FSL
Sbjct  189   FSNMYKT----FCVVSETVSDFCWSFVKSAWLQDDRTPIYSGDDGIEFRPVSVATTAFSL  244

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
               +KQIK+ ++ T+NDVI+GI+  GTRLYMQE  + +     T LVL NTRA    Y+SV
Sbjct  245   DQIKQIKTKVDATVNDVIAGIIFLGTRLYMQEMRQGSGEANSTTLVLLNTRAF-RSYESV  303

Query  1074  SEMIKPNAEMPWGNRITFL  1130
              +M+KP+A+ PWGN   FL
Sbjct  304   KDMVKPDAKSPWGNYFAFL  322



>ref|XP_003623995.1| O-acyltransferase WSD1 [Medicago truncatula]
 gb|AES80213.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=478

 Score =   364 bits (934),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 196/460 (43%), Positives = 293/460 (64%), Gaps = 16/460 (3%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP  Q ++++ L   I+A LE  VPI D    I S + D FL I PRF+SIMV    G
Sbjct  12    PVSPMGQCLDNTSLCLHILAFLEFQVPIHD--LPIFSLVEDAFLYI-PRFTSIMVHDGRG  68

Query  360   EKNWKPVKVILEDHLKVPIF-PVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRY  536
              K WK ++V LE+H+  P F   G  ++  D   ++Y++K++M+  P+T+PLW++H+ +Y
Sbjct  69    VKRWKQIEVKLEEHIIEPKFIDDGMSVDSNDKHFADYISKMAMEDLPRTRPLWQVHVIKY  128

Query  537   PTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAV  716
             PTSNA G  +FK H ++GDGY+LMG +LS LQRAD+P+L L+FP  +    K      ++
Sbjct  129   PTSNAAGTLVFKFHHAIGDGYNLMGVILSSLQRADDPSLRLSFPSLKSPRPK------SI  182

Query  717   AR-AFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
             +R     + + LS    +V++F W+ LKS+L++DDKT I S  + VEFR   ++ +TFS 
Sbjct  183   SRFIMNKMSQYLSMPFTSVSEFGWSLLKSTLVEDDKTPIRSGVEAVEFRRTKLSNVTFSK  242

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSV  1073
              H+K+IKS+L VTINDVI+GI+ YG RLYMQ  +  +     TALV+ NTR +   Y+ V
Sbjct  243   DHIKEIKSNLGVTINDVITGIIFYGIRLYMQNIDYRSRAFSSTALVIANTRHIKD-YQIV  301

Query  1074  SEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLT  1253
              +M+K   +  WGN IT+   ++PKL+   D   SNPL+F+  AH  +KR + S +  L 
Sbjct  302   QDMLK-TEKGAWGNHITYYHVSVPKLQ---DIPISNPLQFVRKAHTSIKRNKNSFANPLI  357

Query  1254  GQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
              + L    KL G EA A+ +  T++ +S+ ++N+ GP+E+   ANHP+ G +F +SG PQ
Sbjct  358   TKLLRMKNKLEGPEALAKHIHGTMRKSSLLISNVAGPIEQMAWANHPIGGFFFTLSGIPQ  417

Query  1434  SLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEI  1553
             SLV+T++SY G LR+T  +E++FID +KL   +  AFD I
Sbjct  418   SLVITVMSYMGMLRVTTTTEEEFIDEQKLTWYLNKAFDII  457



>gb|KEH30688.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=401

 Score =   355 bits (912),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 181/405 (45%), Positives = 267/405 (66%), Gaps = 14/405 (3%)
 Frame = +3

Query  369   WKPVKVILEDHLKVPIFP--VGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPT  542
             W+ V+V LE+H+K+P FP         YD  LS+Y+T I     PQ +PLWEIH+ +YPT
Sbjct  3     WQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLWEIHLIKYPT  62

Query  543   SNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVAR  722
             SNA G  IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP R      Q  +  A   
Sbjct  63    SNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSRP-----QLNSKYAKKG  117

Query  723   AFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHL  902
              FK +   +S    +++DF  + +K+ +++DDKT I S  +G E +P +++ ++ SL  +
Sbjct  118   LFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLSNISLSLDQI  177

Query  903   KQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEM  1082
             K+IKS L VTINDV+SG++ YG RLYM+E   +T     TA+V+ NTR + G Y+S+ EM
Sbjct  178   KEIKSKLGVTINDVLSGVIFYGIRLYMEEMNEKTKKSNSTAVVMLNTRNIEG-YQSLKEM  236

Query  1083  IKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQF  1262
              KP ++  WGN+I+FL   IPKL        S+PL F++ A +++KR+R S  +YL G  
Sbjct  237   QKPESKSLWGNQISFLQIPIPKL------SQSDPLEFVWKARKLIKRKRRSFGVYLIGLL  290

Query  1263  LEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLV  1442
             L    KL+G E+ A+ +  T+ N+S+ ++N++GPVEK  LANHP+ G YF ++G P+++ 
Sbjct  291   LNLEMKLKGSESVAKIIYNTMGNSSVVISNLVGPVEKMALANHPINGFYFTMTGGPENVD  350

Query  1443  VTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKSS  1577
             +T++SY   LR+T+ + K FID +K K C+E A + IF+  ++ S
Sbjct  351   ITIMSYVKILRITLRTLKGFIDERKFKFCMEKAVEVIFKAAMEIS  395



>gb|KCW46796.1| hypothetical protein EUGRSUZ_K00600 [Eucalyptus grandis]
Length=409

 Score =   350 bits (897),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 190/398 (48%), Positives = 253/398 (64%), Gaps = 12/398 (3%)
 Frame = +3

Query  174   LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
             L P SP  QY+NS V+S SI+ +LE  +PI  DDS  +S  RD+FLPINPRFSSIMVTG+
Sbjct  10    LEPVSPSGQYLNSKVMSVSILGILELEIPI--DDSQAMSFFRDIFLPINPRFSSIMVTGE  67

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFY---DYCLSEYLTKISMDPFPQTQPLWEIH  524
              G + WK V V +E+H+ VP F   K        D  L  Y+++I+M PFPQ QPLWEIH
Sbjct  68    KGARKWKKVGVNMENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAMQPFPQGQPLWEIH  127

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
             I + PTS A    IFKLH +LGDGYSL+ ALLSCLQRAD+P+LP+T P  +       ++
Sbjct  128   IIKCPTSEAQETLIFKLHHALGDGYSLVAALLSCLQRADDPSLPVTSPSVKKFSSANKDD  187

Query  705   SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
              N   R  K V R  S +V+TV DF W+ LKS+ + DD + I S  + ++  P SV+T+T
Sbjct  188   RNIGLR--KVVSRCFSPLVNTVRDFGWSLLKSTCVKDDLSPIRSGSESLQ--PYSVSTIT  243

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGGG  1061
             FSL  +K+IKS L VT+NDVISG++   TRLYMQ  S     +   TALVL NTR +   
Sbjct  244   FSLDQIKEIKSRLRVTVNDVISGVIFLATRLYMQRVSTNSNLSTNSTALVLLNTRNL-RD  302

Query  1062  YKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSAS  1241
             YK V +M++PN+E PWGN   FL   IPK++ P D   S+PL+F++  H ++KR+R S  
Sbjct  303   YKPVRDMVRPNSESPWGNHFAFLHVPIPKVK-PSDSQFSDPLKFVHKTHEVIKRKRSSFG  361

Query  1242  LYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNM  1355
             + LTG+ LE  +K R  E  A+   R  KN     +++
Sbjct  362   VILTGKLLEIMQKCRNAEVCARRDDRLSKNAKYAKSDL  399



>ref|XP_010690153.1| PREDICTED: O-acyltransferase WSD1-like [Beta vulgaris subsp. 
vulgaris]
Length=495

 Score =   351 bits (901),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 198/496 (40%), Positives = 300/496 (60%), Gaps = 22/496 (4%)
 Frame = +3

Query  120   IQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIR  299
             +  KT +E  LE  DE  L P SP S+ + S V++  ++A LE ++P+  D   +L+ ++
Sbjct  7     VNTKTKVERSLELIDEK-LEPMSPTSECLTSEVVTLYVLAFLELAIPV--DFQSVLTFLK  63

Query  300   DVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKI  479
             + F+ I+PRFSSI++    G+K WK V+V +EDHLKVP FP     E Y     +Y+TKI
Sbjct  64    NDFINIHPRFSSIVIENMKGKKMWKQVQVNVEDHLKVPTFPKNLSSESYSKHFDDYITKI  123

Query  480   SMDPFPQTQPLWEIHIFRYPT-SNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALP  656
             +    PQ +PLWE+HI  YP  +N    +IFK+H ++ DG SLMG +LSC +R D+P+LP
Sbjct  124   ATSQLPQHKPLWELHIINYPKDNNVASTFIFKIHHAIADGTSLMGGVLSCFKRVDDPSLP  183

Query  657   LTFP---RRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTA  827
             LTFP   RR  + +++   S ++++ FK VP  +S ++ ++ DF  + LK  + +DD+T 
Sbjct  184   LTFPSKTRRLSNSREKRNISQSLSKIFKIVPNFMSSIIYSLYDFGQS-LKLIVDEDDQTP  242

Query  828   IHSQDDGVEFRPIS--VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE---S  992
             I S    +   P S  V ++T  L  +K+IK+ L VT+ND+I GI+   TRLY+Q+    
Sbjct  243   IRSGVTDMTL-PCSTRVCSVTLHLNEVKRIKTLLGVTVNDIIVGIIFLATRLYIQDITDD  301

Query  993   ERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGD  1172
             E++  N   TA +  N R + G   S+ EM K N    WGNRI+ +   +P L    D  
Sbjct  302   EQQKINKRSTASIFVNIRRVKGNL-SLEEMRKGNT---WGNRISNIEIPLPNLE---DDY  354

Query  1173  SSNPLRFIYNAHRMVKRQRY-SASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMT  1349
              SNPL FI  AH+++KR+R  +  L+L     +  R + G++A A+ L R  KN S  +T
Sbjct  355   LSNPLEFIMRAHKIIKRKRSGTLGLFLMDGLFQAIRTVGGIQAAARTLGRRWKNCSFAIT  414

Query  1350  NMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSC  1529
             NMIGP E+ +LANHP+KG YF  +G   S+ V++LSY   LR+ +  E  FID +KL +C
Sbjct  415   NMIGPSEQVSLANHPIKGFYFVPTGINLSVTVSVLSYMDDLRIGLALENGFIDHQKLMTC  474

Query  1530  IESAFDEIFRLTLKSS  1577
             +E++F  IF+ ++  S
Sbjct  475   VENSFQMIFQASMAMS  490



>ref|XP_006447284.1| hypothetical protein CICLE_v10015554mg [Citrus clementina]
 gb|ESR60524.1| hypothetical protein CICLE_v10015554mg [Citrus clementina]
Length=388

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 167/317 (53%), Positives = 220/317 (69%), Gaps = 6/317 (2%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP +QY++SS LS  I+A+LE    +  DDS+++  ++DVFL I+PRFSS+MV  +NG
Sbjct  24    PVSPTAQYLSSSTLSLCILAILEFEQVL--DDSLLMQLVKDVFLSISPRFSSVMVRDENG  81

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              K WK V+V L +H+K P  P G   E YD  L +Y+++I M   PQ+QPLWEIH+ R P
Sbjct  82    AKQWKRVEVKLINHVKFPFCPSGLSPESYDKYLGDYISEIGMQQLPQSQPLWEIHLIRSP  141

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             TS+A    IFKLH SLGDG+SLMGALLSCLQRAD+P+LPLT P      K + E++ ++ 
Sbjct  142   TSHAACTLIFKLHHSLGDGFSLMGALLSCLQRADDPSLPLTLPSVFLPSKAKDESNGSI-  200

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
               F  V ++ S V DTV DF WNF+K +  +DD+T I S DDGVEFRP+ V TMTFSL H
Sbjct  201   --FTRVLKIFSTVSDTVLDFCWNFVKITTAEDDQTPIRSGDDGVEFRPVRVATMTFSLDH  258

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +KQIK+ ++ TINDV++GI+  GTRLYMQE   ++ N   TAL+L NTR     Y+SV +
Sbjct  259   VKQIKTKVDATINDVVTGIIFLGTRLYMQELRHDSSNAISTALILLNTRVF-RSYESVKD  317

Query  1080  MIKPNAEMPWGNRITFL  1130
             M+K +A  PWGN   FL
Sbjct  318   MLKHDANAPWGNYFAFL  334


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 4/64 (6%)
 Frame = +3

Query  1383  ANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRL  1562
             AN P  G YFA      SL VT++SY  KLR+++++E  FID +KLKSC+E AF+ +   
Sbjct  323   ANAP-WGNYFAF---LHSLSVTIISYMEKLRVSVVAEDGFIDSQKLKSCVEHAFEVMLNA  378

Query  1563  TLKS  1574
             T+++
Sbjct  379   TVET  382



>ref|XP_003607474.1| O-acyltransferase WSD1, partial [Medicago truncatula]
Length=351

 Score =   334 bits (856),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 174/358 (49%), Positives = 236/358 (66%), Gaps = 17/358 (5%)
 Frame = +3

Query  165   EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
             E V  P SP  QY N+  L   +   LES +PI+D  ++ L   + VFLPINPRFSSIMV
Sbjct  5     EDVTEPVSPSGQYFNTPPLCSYVFGFLESQIPIDDSQTMYL--FQHVFLPINPRFSSIMV  62

Query  345   TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
               K+G+  WK V+V  EDH+ VPIFP  + +E YD    +Y++KI M+  PQ +PLWEIH
Sbjct  63    RDKDGKMKWKKVEVKPEDHMHVPIFPKSESIELYDQYFDDYVSKIMMERTPQDKPLWEIH  122

Query  525   IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGS---GKKQ  695
             + +YPTSNA G  IFKLH +LGDGYSLMGALLSCLQR D+P+LPL+FP R+ S     K+
Sbjct  123   LIKYPTSNAEGTLIFKLHHALGDGYSLMGALLSCLQRVDDPSLPLSFPSRKPSQLLSPKK  182

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
             G         FK  P  +    ++ +DF W+  KSS+L DDKT I + ++GVE +P  ++
Sbjct  183   G--------FFKWFPSTIFSFFNSFSDFGWSIAKSSMLKDDKTPIWNGEEGVESQPCVLS  234

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
              ++FSL  +K IKS L VTINDVI+G++ YG RLYMQE +++      T LVL +TR + 
Sbjct  235   NLSFSLDEIKTIKSKLGVTINDVITGVIFYGIRLYMQEMDKKARTSNSTGLVLLSTRNV-  293

Query  1056  GGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
             G Y+S+ +M K +++ PWGN I+FL  +IPKL        SNPL FI+ A +++KR+R
Sbjct  294   GSYQSIQDMTKADSKSPWGNHISFLHVSIPKL---SKASLSNPLEFIWKAQKIIKRKR  348



>gb|KEH30689.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=392

 Score =   334 bits (856),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/401 (45%), Positives = 254/401 (63%), Gaps = 16/401 (4%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
             +E V  P SP  QY NSSV+   +   LE ++PI  DDS  +  ++DVFLPINPRFSSIM
Sbjct  5     NEEVQEPVSPHGQYFNSSVICSYVFGFLELAIPI--DDSQTMPLLKDVFLPINPRFSSIM  62

Query  342   VTGKNGEKNWKPVKVILEDHLKVPIFP--VGKPLEFYDYCLSEYLTKISMDPFPQTQPLW  515
             V  K+G+  W+ V+V LE+H+K+P FP         YD  LS+Y+T I     PQ +PLW
Sbjct  63    VRDKDGKMRWQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLW  122

Query  516   EIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
             EIH+ +YPTSNA G  IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP R      Q
Sbjct  123   EIHLIKYPTSNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSR-----PQ  177

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
               +  A    FK +   +S    +++DF  + +K+ +++DDKT I S  +G E +P +++
Sbjct  178   LNSKYAKKGLFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLS  237

Query  876   TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMG  1055
              ++ SL  +K+IKS L VTINDV+SG++ YG RLYM+E   +T     TA+V+ NTR + 
Sbjct  238   NISLSLDQIKEIKSKLGVTINDVLSGVIFYGIRLYMEEMNEKTKKSNSTAVVMLNTRNI-  296

Query  1056  GGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYS  1235
              GY+S+ EM KP ++  WGN+I+FL   IPKL        S+PL F++ A +++KR+R S
Sbjct  297   EGYQSLKEMQKPESKSLWGNQISFLQIPIPKL------SQSDPLEFVWKARKLIKRKRRS  350

Query  1236  ASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMI  1358
               +YL G  L    KL+G E        + KN  + + ++I
Sbjct  351   FGVYLIGLLLNLEMKLKGSEVCHTLFNHSSKNLMLYLFSLI  391



>ref|XP_004173488.1| PREDICTED: O-acyltransferase WSD1-like, partial [Cucumis sativus]
Length=369

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 176/384 (46%), Positives = 248/384 (65%), Gaps = 17/384 (4%)
 Frame = +3

Query  150   LEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRF  329
             +E +DE  L P SP +Q +N+S LS S+IAVLE  +PI  D++ I+   +D F+P+N  F
Sbjct  1     MEEEDEF-LEPMSPTAQCLNTSSLSISVIAVLEFEIPI--DEAKIICYAKD-FIPLNSLF  56

Query  330   SSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             SSI V   NGE+ WK V+V +E+ + V   P    +E  D   +EY+TK+S+    Q +P
Sbjct  57    SSITVNDINGERKWKKVEVKVEEQIVVATPPSDLSIELNDAFFNEYITKLSVQELDQNKP  116

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFP--RRQGS  683
             LWEIHI   PTS A  N I K H SLGDGYS+MG LLS ++RADNP+LPLTFP   +  +
Sbjct  117   LWEIHILNCPTSTAAANLILKFHHSLGDGYSVMGLLLSTMKRADNPSLPLTFPFNGKMIN  176

Query  684   GKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRP  863
              KK G+ S+ V+         L   +++V DF  + +KSS+L+D+ T I S  DGVEF+P
Sbjct  177   SKKLGQISSGVS-------HFLLSSINSVLDFGLSLIKSSVLEDELTPIRSGGDGVEFKP  229

Query  864   ISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNT  1043
               + T+TFSL+ +KQIKS L VT+NDV++G++  G RLYM+E+  ++     TALVL NT
Sbjct  230   TEIWTITFSLHQIKQIKSKLRVTVNDVVAGMLFLGIRLYMEETHPDSTKSNSTALVLLNT  289

Query  1044  RAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKR  1223
             R M G YK + +M+ PN+  PWGNR  FL   IPKL    D + SNPL+F+  A +++KR
Sbjct  290   R-MFGTYKCMEDMLNPNSNTPWGNRFGFLHIDIPKLT---DFNLSNPLQFVQAAQKLIKR  345

Query  1224  QRYSASLYLTGQFLEFTRKLRGLE  1295
             +R S++++L  + +E   K RG E
Sbjct  346   KRDSSAVFLVDKLMEIIHKFRGSE  369



>gb|KEH23372.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=386

 Score =   313 bits (803),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 159/370 (43%), Positives = 243/370 (66%), Gaps = 12/370 (3%)
 Frame = +3

Query  447   DYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSC  626
             D   ++Y++K++M+  P+T+PLW++H+ +YPTSNA G  +FK H ++GDGY+LMG +LS 
Sbjct  7     DKHFADYISKMAMEDLPRTRPLWQVHVIKYPTSNAAGTLVFKFHHAIGDGYNLMGVILSS  66

Query  627   LQRADNPALPLTFPRRQGSGKKQGENSNAVAR-AFKAVPRLLSGVVDTVTDFSWNFLKSS  803
             LQRAD+P+L L+FP  +    K      +++R     + + LS    +V++F W+ LKS+
Sbjct  67    LQRADDPSLRLSFPSLKSPRPK------SISRFIMNKMSQYLSMPFTSVSEFGWSLLKST  120

Query  804   LLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYM  983
             L++DDKT I S  + VEFR   ++ +TFS  H+K+IKS+L VTINDVI+GI+ YG RLYM
Sbjct  121   LVEDDKTPIRSGVEAVEFRRTKLSNVTFSKDHIKEIKSNLGVTINDVITGIIFYGIRLYM  180

Query  984   QESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPG  1163
             Q  +  +     TALV+ NTR +   Y+ V +M+K   +  WGN IT+   ++PKL+   
Sbjct  181   QNIDYRSRAFSSTALVIANTRHIKD-YQIVQDMLK-TEKGAWGNHITYYHVSVPKLQ---  235

Query  1164  DGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSIT  1343
             D   SNPL+F+  AH  +KR + S +  L  + L    KL G EA A+ +  T++ +S+ 
Sbjct  236   DIPISNPLQFVRKAHTSIKRNKNSFANPLITKLLRMKNKLEGPEALAKHIHGTMRKSSLL  295

Query  1344  MTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLK  1523
             ++N+ GP+E+   ANHP+ G +F +SG PQSLV+T++SY G LR+T  +E++FID +KL 
Sbjct  296   ISNVAGPIEQMAWANHPIGGFFFTLSGIPQSLVITVMSYMGMLRVTTTTEEEFIDEQKLT  355

Query  1524  SCIESAFDEI  1553
               +  AFD I
Sbjct  356   WYLNKAFDII  365



>emb|CDP20976.1| unnamed protein product [Coffea canephora]
Length=296

 Score =   310 bits (793),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/251 (58%), Positives = 191/251 (76%), Gaps = 3/251 (1%)
 Frame = +3

Query  180  PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
            P SP  QY NSSVLS  II VLE  +PI++DDS+ +  ++DVFLPINPRFSSIMV  + G
Sbjct  11   PVSPTGQYFNSSVLSICIIGVLEFEIPIQEDDSLTVKLVQDVFLPINPRFSSIMVQDEKG  70

Query  360  EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             K WK V+V  +DH++VP FP GK +EFYD C ++YLTK++M+  PQ+QPLWEIHI +YP
Sbjct  71   VKYWKKVEVKPKDHIRVPNFPEGKSIEFYDECFNDYLTKLAMETLPQSQPLWEIHIIKYP  130

Query  540  TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
            T NA GN +FKLH +LGDGYS+MGALLSCLQRAD+P+LP+TFP  + + +      +++ 
Sbjct  131  TKNAAGNVVFKLHHALGDGYSIMGALLSCLQRADDPSLPITFPAFRTNPQVISIEDSSIC  190

Query  720  RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
               K VPR+LSG+ +T++DF W  LKS++L+DD+T I S DDGVEFRPIS+TT +FS+  
Sbjct  191  ---KKVPRILSGIGNTISDFVWGVLKSTVLEDDRTPIRSGDDGVEFRPISITTFSFSMDQ  247

Query  900  LKQIKSSLNVT  932
            +KQIK +L V 
Sbjct  248  IKQIKVNLEVV  258



>gb|KDP24113.1| hypothetical protein JCGZ_25770 [Jatropha curcas]
Length=272

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 199/264 (75%), Gaps = 4/264 (2%)
 Frame = +3

Query  768   VTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVI  947
             ++DF W+ LKSSL++D K+ I S DDGV+F+PIS++T+TFSL  +KQIK+ L VTINDVI
Sbjct  1     MSDFGWSLLKSSLVEDVKSPIRSGDDGVQFKPISLSTVTFSLDRIKQIKARLGVTINDVI  60

Query  948   SGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF  1127
             +GI+ YG RLYM E      N   TALVL NTRA+GG YKSV EM+KPNAE  WGNR  F
Sbjct  61    TGIIFYGIRLYMVEVNDRFSNAHSTALVLLNTRAIGG-YKSVKEMVKPNAESAWGNRFGF  119

Query  1128  LPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQ  1307
             L  ++P+L        SNPL+F+ NA++++KR+R S ++ LTG+ L+  RKLRG E TA+
Sbjct  120   LHVSMPELTKSA---ISNPLQFVENANQIIKRKRSSLAVDLTGRLLDALRKLRGPETTAK  176

Query  1308  FLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTII  1487
             ++  TLKN+S+T++N+IGPVE   LANHPVKG+YF V G PQSL +TM+SY G+LR+ + 
Sbjct  177   YIHSTLKNSSMTISNVIGPVESMALANHPVKGLYFMVVGVPQSLTITMVSYTGQLRVAVG  236

Query  1488  SEKDFIDVKKLKSCIESAFDEIFR  1559
             +EK FID +K  SCIE+AF+ IF+
Sbjct  237   AEKGFIDTQKFNSCIENAFEMIFK  260



>emb|CDP14803.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   306 bits (784),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 194/278 (70%), Gaps = 8/278 (3%)
 Frame = +3

Query  324   RFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQT  503
             + S   + G++G+K WK V+V + +H+  P FP G   ++YD C+S YL+K+ M+ FP  
Sbjct  33    QISGKQIAGEDGQKKWKRVEVNVNEHVNFPKFPQGMSPDYYDDCVSNYLSKLGMEDFPPE  92

Query  504   QPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGS  683
             +PLWEIH+  YPT+NA  N +FKLH +LGDGYSL+GALLSCL+R+DNP+LPLTFP    S
Sbjct  93    RPLWEIHVMNYPTTNAASNIVFKLHHALGDGYSLVGALLSCLKRSDNPSLPLTFP----S  148

Query  684   GKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRP  863
             G+ + +  NA   +   +P +LS   +T+  F +  LK  LL DD T I S D+GV FRP
Sbjct  149   GQSKTKFKNA---STTFLPDVLSRAFNTIYYFGYGVLKGFLLRDDHTPIPSDDEGVLFRP  205

Query  864   ISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNT  1043
             +++TTM FSL   KQIK+ L VTINDVI GI+ +GTR+YM+E   E+    CTA+VL NT
Sbjct  206   LTMTTMEFSLDQFKQIKAKLQVTINDVIMGIIMFGTRIYMREMNHESSEANCTAVVLLNT  265

Query  1044  RAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRS  1157
             R    GYKSVSEMIKPNAEMPWGNR  FLP  IPKL +
Sbjct  266   R-YAAGYKSVSEMIKPNAEMPWGNRFAFLPLPIPKLTA  302



>ref|XP_010242035.1| PREDICTED: O-acyltransferase WSD1-like [Nelumbo nucifera]
Length=472

 Score =   309 bits (792),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 168/461 (36%), Positives = 268/461 (58%), Gaps = 21/461 (5%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP SQ M+S     +II V    VP +   +V L  ++ +    +PR  S++VT + G
Sbjct  21    PLSPLSQIMHS----LTIIVVAGFDVPFDKSQTVEL--LKAMHTTSDPRLFSVIVTDRKG  74

Query  360   EKNWKPV-KVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRY  536
                WK V +V  EDH+ V  FP G  +E YD    +YLTK+S+ PF    P WE+H   Y
Sbjct  75    VHRWKKVTQVAYEDHIFVASFPEGLSMEDYDKHFKDYLTKVSVTPFSDNLPPWEVHAIMY  134

Query  537   PTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAV  716
             PTSN  G+ +FK   +LGDGYS +G++++  +R D+P+LP+TFP    S   +    N+ 
Sbjct  135   PTSNGAGSLVFKFSHALGDGYSSLGSIMTLCRREDDPSLPITFP----SSTSKAGRKNSW  190

Query  717   ARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLY  896
             +R+      L+S  ++TV D + + L+ + L DDKT I S    V  +P+ ++ ++FSL 
Sbjct  191   SRSASV---LISWFINTVRDSAVSTLQGTFLRDDKTPIRSGTPPVGLQPMEISPVSFSLD  247

Query  897   HLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVS  1076
              +K+I+S L  T+NDV+ GI++Y  +LY+Q  +  +     TAL+  N R M  GY+ + 
Sbjct  248   CIKRIRSKLGATVNDVVIGILSYAIQLYIQRMDFISSGARVTALIPLNMR-MLNGYQDIG  306

Query  1077  EMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTG  1256
             +M+K N    WGNR   L  ++P      D +  +PL FI ++   +++++ SA+++ + 
Sbjct  307   DMLKANL---WGNRFGLLSISLPSF---SDEEKVDPLHFITSSRDNIRKKKNSAAVHFSS  360

Query  1257  QFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQS  1436
               L     + G +A A F++ + +NTS T++ ++GP  K +L NHPVK  YF V GAPQ 
Sbjct  361   GLLTMLNNVLGPKALAGFIKSSFRNTSTTISTVVGPTHKISLENHPVKRCYFTVVGAPQD  420

Query  1437  LVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             +V T+ SY  +L +   +EK FID   L SC++ AF++I++
Sbjct  421   VVFTIASYMEELCIVATAEKSFIDSNVLISCVKKAFEDIYQ  461



>ref|XP_010672070.1| PREDICTED: O-acyltransferase WSD1-like [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   307 bits (787),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 175/492 (36%), Positives = 278/492 (57%), Gaps = 26/492 (5%)
 Frame = +3

Query  117   SIQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEI  296
             +++VKT   + L  +    L P SP S+Y  + V +  ++ + E  +PI  D S I +  
Sbjct  2     ALRVKTKANNKLNEN----LEPTSPTSEYFLTEVATLYVLCIFELEIPI--DSSSIYAFF  55

Query  297   RDVFLPINPRFSSIMVTGKNGEKN-WKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLT  473
              DVFL   PRFS I +  K   +N WK V+V +EDH+K   FP     E Y     +Y++
Sbjct  56    NDVFLESYPRFSCIPIEDKQRRRNVWKKVEVNVEDHIKFSKFPEHLSPENYSDHFDDYMS  115

Query  474   KISMDPFPQTQPLWEIHIFRYPT-SNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPA  650
             KI+    P+ +PLWE+H F YPT +N     I K H ++GDG SLMG + SC +R D+P 
Sbjct  116   KIATSQLPKDKPLWEVHTFNYPTKNNVAATLIVKFHHAVGDGTSLMGVVFSCFKRVDDPT  175

Query  651   LPLTFPRRQGSGKKQGENSN----AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDD  818
             LPLTFP    +   +G   +     + +    VP+ L  ++  + DF    L+  L++DD
Sbjct  176   LPLTFPSTTRTSSSKGHQLHDFKATLMKVINIVPKFLCSMLYNIYDFGQT-LRVLLVEDD  234

Query  819   KTAIHSQDDGVEFRPIS--VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQES  992
             +T I S    +   P S  + ++T SL  +++IKS L VT+NDV+ GI+++ TRLY+Q++
Sbjct  235   RTPIRSGITNMAL-PYSAKICSVTLSLTDVRRIKSLLKVTVNDVVIGIISFATRLYIQDA  293

Query  993   ER--ETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGD  1166
             ++     N   TA +  N R++   + S  EM K N    WGN+ + +   +P L   G 
Sbjct  294   DQGGRLNNARLTASMAVNMRSIKR-FASPEEMRKENT---WGNKFSIIEMPLPTL---GK  346

Query  1167  GDSSNPLRFIYNAHRMVKRQ-RYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSIT  1343
              D  NPL F+ N ++++ R+ R   ++YLT   L+  R   G +A  +   ++ KN+++ 
Sbjct  347   DDIRNPLNFVINTNKILNRKKRNVGAIYLTALTLDAIRIFGGFKAATRTFEKSWKNSTVA  406

Query  1344  MTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLK  1523
             +TNMIGPV+  ++ NHP+KG YF  +G   SL V++LSY   LRL ++ E  FID ++L 
Sbjct  407   ITNMIGPVDHISVGNHPIKGFYFVPTGLNLSLTVSVLSYMENLRLGLVVENGFIDHQRLV  466

Query  1524  SCIESAFDEIFR  1559
             +C+E+A+ +I +
Sbjct  467   TCVETAYQKILQ  478



>ref|XP_008455535.1| PREDICTED: uncharacterized protein LOC103495687 [Cucumis melo]
Length=321

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 204/318 (64%), Gaps = 7/318 (2%)
 Frame = +3

Query  606   MGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSW  785
             M  LLSCL+RAD+P+LPLTFP RQ S  KQ +N     R      R  S V + V +F W
Sbjct  1     MNTLLSCLKRADDPSLPLTFPSRQRS--KQPKNKLDFCRLSHFPARFFSSVSNFVLNFGW  58

Query  786   NFLKSSLLDDDKTAIHSQDDGVEF-RPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVT  962
             + +K++ ++DD T I  Q+D ++  +PI+++TMTFSL  +KQIK+ LN ++NDV++GI+ 
Sbjct  59    SIMKNTFVEDDPTPIKPQEDSMQLVKPIAISTMTFSLDQIKQIKNKLNASVNDVLTGIIF  118

Query  963   YGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAI  1142
              G RLYMQE   E+     +AL+L NTR     YKSV EM+K +++ PWGN+I FLP  I
Sbjct  119   LGVRLYMQEHNPESSEANSSALILLNTRK-AKAYKSVKEMVKKDSDAPWGNKIAFLPVPI  177

Query  1143  PKL-RSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRR  1319
             PKL  SP    SS PL F+      +  QR   S++L  +  E  + + G E  A+  +R
Sbjct  178   PKLIDSPVV--SSTPLEFVEKVKEKITLQRSPLSVFLAAKVFEILKNVTGPEIGAKLFKR  235

Query  1320  TLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKD  1499
              LKN+SI ++N+IGPVEK  L N PVKG+YF V G PQSL++T++SY G LR+    EK 
Sbjct  236   KLKNSSIMISNLIGPVEKMALVNRPVKGLYFTVPGMPQSLMITIVSYMGDLRIVFGGEKC  295

Query  1500  FIDVKKLKSCIESAFDEI  1553
             FI+ +KLK CIE AF  I
Sbjct  296   FINQQKLKVCIEDAFQRI  313



>ref|XP_004293155.1| PREDICTED: O-acyltransferase WSD1-like [Fragaria vesca subsp. 
vesca]
Length=258

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 192/260 (74%), Gaps = 7/260 (3%)
 Frame = +3

Query  156  GDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSS  335
            G++ ++  P SP SQ++NSSVLS SI+AVLE  VPI+D  ++ L  +++VFLPINPRFSS
Sbjct  4    GEEGLLQEPVSPGSQFINSSVLSLSILAVLEFQVPIDDLQTISL--LKNVFLPINPRFSS  61

Query  336  IMVTGKNGE-KNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
            IMV G + + K WK V V LEDH++ PIFP G  LE YD C +EY+T+I+ + FPQ++PL
Sbjct  62   IMVEGVDKQNKQWKRVTVKLEDHVRAPIFPAGMSLESYDTCFNEYMTQIASETFPQSKPL  121

Query  513  WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKK  692
            WE+H+F+YPTS+A G  IFK+H +LGDGYSLMGALLS LQ A NP+LPLTFP  +G+  +
Sbjct  122  WELHLFQYPTSHAAGQIIFKIHHALGDGYSLMGALLSRLQNAQNPSLPLTFPSLKGANNE  181

Query  693  QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
                + + +R F+ VP++ S V ++  DFSW  LKS+ ++DD+T I S  DGVEFRP+SV
Sbjct  182  ----ATSRSRVFEFVPKIFSAVFNSAWDFSWGILKSTWVEDDRTPIRSGVDGVEFRPLSV  237

Query  873  TTMTFSLYHLKQIKSSLNVT  932
            +T+  S+  +K +KS+L V 
Sbjct  238  STLILSIEEIKLVKSNLGVA  257



>ref|XP_008244954.1| PREDICTED: O-acyltransferase WSD1-like, partial [Prunus mume]
Length=253

 Score =   270 bits (689),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 183/266 (69%), Gaps = 15/266 (6%)
 Frame = +3

Query  138  MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
            ME   EG+ E    P SP  QY NSS+LS +I+AVLE  VPI  +DS  LS ++DVFLPI
Sbjct  1    MEFREEGEGE----PVSPTGQYFNSSILSVAILAVLEFEVPI--NDSQTLSLLQDVFLPI  54

Query  318  NPRFSSIMVTGK-NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPF  494
            NPRFSSIMV    + +K WK V+V LEDH+ VPIFP     E YD    +Y++ I+ +  
Sbjct  55   NPRFSSIMVRDNPDQKKQWKRVEVKLEDHVHVPIFPSKMSQESYDEYFDDYISNIAAEKL  114

Query  495  PQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPR-  671
            PQ +PLWEIHI +YPTS+A G  IFKLH +LGDGYSLMGALLSCLQ A NP++PLTFP  
Sbjct  115  PQNRPLWEIHILKYPTSHAAGTLIFKLHHALGDGYSLMGALLSCLQTAQNPSVPLTFPSL  174

Query  672  RQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGV  851
            +  SG K    +  V++ F       S V  TV+DFSW+ LKS+ ++DD+T I S +DGV
Sbjct  175  KSSSGPKTTHMTKTVSQFF-------SSVFQTVSDFSWSILKSNFVEDDRTPIRSGEDGV  227

Query  852  EFRPISVTTMTFSLYHLKQIKSSLNV  929
            EFRPI+++T+TFS+  +K IK+ L V
Sbjct  228  EFRPITLSTLTFSIDEIKLIKNKLGV  253



>gb|KDP24070.1| hypothetical protein JCGZ_25727 [Jatropha curcas]
Length=293

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/280 (47%), Positives = 190/280 (68%), Gaps = 4/280 (1%)
 Frame = +3

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYH  899
             R  K    + S +++T++DF  + +  S ++DDK+ I S   GVEF P+S+ TM+FSL  
Sbjct  7     RIRKCFLGIFSSILNTLSDFCSSIMIGSFVEDDKSPIRSGHSGVEFLPVSLVTMSFSLDQ  66

Query  900   LKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSE  1079
             +KQI++ L VTINDVISG +  GTR+YM+   + +     T+LVL NTR M GGYKSV E
Sbjct  67    IKQIRTKLGVTINDVISGTIFLGTRMYMEAISKGSGKARTTSLVLLNTR-MFGGYKSVQE  125

Query  1080  MIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQ  1259
             M KPNAE+PWGN   FL  +IPKL      +  +PL+F++ A ++++R+R S ++YLT +
Sbjct  126   MTKPNAELPWGNHFAFLSVSIPKLSG---SEPKDPLQFVWKARKIIQRKRASFAVYLTAK  182

Query  1260  FLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSL  1439
             +L+   K RG EA +++L  TLKNTSI +TN++GP E+  LANHP+ G YF V+ +PQSL
Sbjct  183   YLQLVNKFRGPEAVSKYLHNTLKNTSIGITNVMGPGEQMALANHPINGFYFVVTNSPQSL  242

Query  1440  VVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             +  ++SY GKLR+  + EKDFID +K    +E+AF  I +
Sbjct  243   MTGVVSYMGKLRVAALVEKDFIDPQKYTLYVENAFQMILK  282



>gb|KEH30690.1| O-acyltransferase WSD1-like protein [Medicago truncatula]
Length=323

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/332 (44%), Positives = 209/332 (63%), Gaps = 14/332 (4%)
 Frame = +3

Query  369   WKPVKVILEDHLKVPIFP--VGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPT  542
             W+ V+V LE+H+K+P FP         YD  LS+Y+T I     PQ +PLWEIH+ +YPT
Sbjct  3     WQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLWEIHLIKYPT  62

Query  543   SNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVAR  722
             SNA G  IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP R      Q  +  A   
Sbjct  63    SNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSRP-----QLNSKYAKKG  117

Query  723   AFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHL  902
              FK +   +S    +++DF  + +K+ +++DDKT I S  +G E +P +++ ++ SL  +
Sbjct  118   LFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLSNISLSLDQI  177

Query  903   KQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEM  1082
             K+IKS L VTINDV+SG++ YG RLYM+E   +T     TA+V+ NTR +  GY+S+ EM
Sbjct  178   KEIKSKLGVTINDVLSGVIFYGIRLYMEEMNEKTKKSNSTAVVMLNTRNI-EGYQSLKEM  236

Query  1083  IKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQF  1262
              KP ++  WGN+I+FL   IPKL        S+PL F++ A +++KR+R S  +YL G  
Sbjct  237   QKPESKSLWGNQISFLQIPIPKL------SQSDPLEFVWKARKLIKRKRRSFGVYLIGLL  290

Query  1263  LEFTRKLRGLEATAQFLRRTLKNTSITMTNMI  1358
             L    KL+G E        + KN  + + ++I
Sbjct  291   LNLEMKLKGSEVCHTLFNHSSKNLMLYLFSLI  322



>gb|ADE77834.1| unknown [Picea sitchensis]
Length=501

 Score =   275 bits (702),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 159/487 (33%), Positives = 253/487 (52%), Gaps = 35/487 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P +P SQ + SS+LS S+  V E    I D      S I D  LP NP FS IM     G
Sbjct  22    PVNPISQAICSSLLSLSVNVVFEFEEAITDISRCTKS-IVDAALPRNPLFSCIMKEDDQG  80

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
                W+   V + DH  +  FP G+  E YD C+ +Y++K+++ PF  ++PL E H   Y 
Sbjct  81    VLRWEKTAVNINDHTFIAEFPPGQ--ESYDACVDDYISKLALAPFDHSRPLCEFHFLNYK  138

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             T+ A    +F+ H +LGDG S M  L    +R DNP LP TFP  + S +     +  + 
Sbjct  139   TNKAKATMVFRFHHALGDGISFMSTLFCIARRVDNPDLPPTFPTAKPSIQSSHSGNTLLT  198

Query  720   RAFKAVPRLLSGVVDTVTDFSWNFLK-SSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLY  896
             +  + +  ++  +  T+ D   + L+ +  + D +  I     GV+  P+++++ TF L 
Sbjct  199   KFIQRLWYMMLVLWYTLVDVISSLLRMTGWIGDSQMPIRGPP-GVKTMPVALSSATFLLE  257

Query  897   HLKQIKSSLNVTINDVISGIVTYGTRLYMQ------------------------ESERET  1004
              LKQIK+S+  T+NDVI+GI+ YG + Y+Q                           ++ 
Sbjct  258   DLKQIKNSVGGTVNDVITGIIFYGMQRYLQIRFSAITEHGLQDAYEKRFEMPEDAVIKQM  317

Query  1005  CNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNP  1184
                + TAL L N R + G  +S+ EM+KP A+ PWGN   FLP  +P L     G   NP
Sbjct  318   EKSKLTALCLINMRGLAG-LQSIDEMVKPKAQAPWGNHFGFLPVRVPML-----GKLENP  371

Query  1185  LRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGP  1364
             ++F+      + R + S    + G+ + +   L+G +A +++L  TL N++  M+N+IGP
Sbjct  372   IQFVRRTKSKIDRHKISLGTSINGKIMAYLGWLKGPQAVSRYLYNTLANSTFGMSNLIGP  431

Query  1365  VEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAF  1544
              EK  +  +P+K   F VSGAPQSL ++++SY G + + + ++K ++D   L  C   A 
Sbjct  432   TEKVAIDGNPIKSFSFFVSGAPQSLELSIVSYTGVVVVQVYAQKAYVDANMLCKCFIEAC  491

Query  1545  DEIFRLT  1565
             +EI + T
Sbjct  492   EEIKKAT  498



>gb|ADE76190.1| unknown [Picea sitchensis]
Length=504

 Score =   272 bits (696),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 160/489 (33%), Positives = 255/489 (52%), Gaps = 35/489 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P +P SQ M+SS+LS  +  V E    I D  S     I D  LP NP  S IM     G
Sbjct  24    PVNPISQAMSSSLLSLCVNVVFEFEEAITDI-SRCTKVITDAALPRNPLLSCIMKEDDLG  82

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
                W+   V  ++H  +  FP+G+  + YD C+ EY++K++  P   ++PLWE+H   Y 
Sbjct  83    VLRWQKTTVNTKNHTFIVEFPIGQ--DSYDACVDEYISKLAHRPLDHSRPLWELHFLNYK  140

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVA  719
             T+ A    +F+ H +LGDG S M  L    +R DNP LP TFP  + S +     S  +A
Sbjct  141   TNKAKATMVFRFHHALGDGISFMSTLFCVARRVDNPDLPPTFPTAKTSIQSSHSGSTLLA  200

Query  720   RAFKAVPRLLSGVVDTVTD-FSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLY  896
             R F+ +  ++  +  T+ D  S +   +  + D +  I     GV+  P+++++ TF L 
Sbjct  201   RFFQRLWYMMLVLWYTLVDVISSSLRMTGWIGDSQMPIRGHP-GVKNMPVALSSATFLLE  259

Query  897   HLKQIKSSLNVTINDVISGIVTYGTRLYMQ-----ESE-------------------RET  1004
              +KQIK+S+  T+ND I+GI+ +G + Y+Q     ++E                   ++ 
Sbjct  260   DIKQIKNSVGGTVNDAITGIIFHGIQRYLQIRLSADAEHSLRDAYEKRFEMPEEAVIKQM  319

Query  1005  CNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNP  1184
              N   TAL L N R + G  +++ EM KP AE PWGN     P  +P L     G   +P
Sbjct  320   KNLRLTALCLINMRGLAG-VQNIDEMFKPKAEAPWGNHFGIFPVRVPIL-----GMLESP  373

Query  1185  LRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGP  1364
             L F+  A   + R + S   ++  + + +   L+G +A +++L  T+ N++I ++NMIGP
Sbjct  374   LEFVRRAKSKMDRHKISLGAFVDAKIMTYLGWLKGPQAVSRYLYSTIANSTIAISNMIGP  433

Query  1365  VEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAF  1544
             +E   +  +P+K   F VSGAPQSL + ++SY G + L + ++K ++D   L  C   A 
Sbjct  434   MEMVAIDGNPIKSFSFFVSGAPQSLDLFIVSYTGVVVLQVYAQKAYVDANMLSKCFMEAC  493

Query  1545  DEIFRLTLK  1571
             +EI + TLK
Sbjct  494   EEIKKATLK  502



>gb|KCW57203.1| hypothetical protein EUGRSUZ_H00018 [Eucalyptus grandis]
Length=345

 Score =   266 bits (680),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 161/361 (45%), Positives = 217/361 (60%), Gaps = 34/361 (9%)
 Frame = +3

Query  234   IAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVP  413
             + + ES +PI+D  + +L  IRDVFLPINPRF SIMV            +V +E+ L VP
Sbjct  1     MGISESEIPIDDSQATLL--IRDVFLPINPRFYSIMV------------EVKVENQLHVP  46

Query  414   IFPVGKPLEF---YDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQS  584
              F   K L      D  L  Y+++I+  PFPQ QPLWEIH  + PTS   G  IFKL  +
Sbjct  47    SFSSPKGLSSPSENDSFLKSYISQIAKQPFPQGQPLWEIHTIKGPTSEVQGTLIFKLRHA  106

Query  585   LGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGV--  758
             LGDGYSL+GALLSCLQRAD+P+L +TFP    + K    N++     F+   R L+ V  
Sbjct  107   LGDGYSLVGALLSCLQRADDPSLLVTFP---SANKLSSANNDDRTLDFR---RWLADVFL  160

Query  759   --VDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVE-FRPISVTTMTFSLYHLKQIKSSLNV  929
               V+TV +F    LKS+   DD   I     G+E FRP S++T++FSL  +K+IKS L V
Sbjct  161   PLVNTVRNFDGRVLKSTCFKDDLPPIRC---GLESFRPFSLSTISFSLDCIKEIKSRLRV  217

Query  930   TINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMP  1106
             TIN++I G++   TRLYMQ  S     +   TALVL N R +   YKSV +M++PN+E  
Sbjct  218   TINNIIMGVIFLATRLYMQRGSPNLNLSTNSTALVLLNMRNL-RDYKSVRDMVRPNSESL  276

Query  1107  WGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLR  1286
             WGN   FL   IPK++ P D + S PL+F++ AH  +K +R S  + LTG+ L+ T+K R
Sbjct  277   WGNNFAFLHVPIPKVK-PSDSEFSIPLKFVHKAHEAIKGKRSSFGVVLTGKLLKMTKKCR  335

Query  1287  G  1289
              
Sbjct  336   N  336



>ref|XP_008345468.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=253

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/253 (53%), Positives = 170/253 (67%), Gaps = 13/253 (5%)
 Frame = +3

Query  174  LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
            L P SP   Y N+SVLS SI+AVLE  +PI  DDS  LS + +VFLPINPRFSSIM+  K
Sbjct  8    LEPVSPTGHYFNNSVLSISILAVLEYEIPI--DDSQFLSLLENVFLPINPRFSSIMIE-K  64

Query  354  NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
            NG+K WK V+V LEDH+K PIFP     E YD    +YL+ ++   FPQ +PLWEIH+ +
Sbjct  65   NGKKQWKRVEVKLEDHVKTPIFPSNLSNESYDEYFXDYLSNVATKRFPQDKPLWEIHVIK  124

Query  534  YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
            YP  NA  N +FKLH +LGDGYSLMGALLSCLQRADNP+LPLTFP R+ S  K   N N 
Sbjct  125  YPNXNAAXNVVFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPSRKPSKPK---NENV  181

Query  714  VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
            + + F       S +++T++D  W   KS   +DD + I S ++ +EF PI V+T+T SL
Sbjct  182  MTKTF-------SSLLNTISDIWWGISKSITGEDDLSPIKSSNNELEFTPIIVSTVTISL  234

Query  894  YHLKQIKSSLNVT  932
             H++ IK+ L V 
Sbjct  235  DHIRLIKNRLEVV  247



>gb|EYU28203.1| hypothetical protein MIMGU_mgv1a013012mg [Erythranthe guttata]
Length=233

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/229 (55%), Positives = 158/229 (69%), Gaps = 13/229 (6%)
 Frame = +3

Query  171  VLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTG  350
            +L P SP  QY  SSV+S SIIA+LE   PI  D S + + ++ VFLPINPRFSS+MV  
Sbjct  5    ILEPVSPTGQYFTSSVMSVSIIAILELEFPI--DQSRLDTLLKTVFLPINPRFSSLMVKD  62

Query  351  KNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
            KNG+K+WK V+V +++H+K+P FP GK  EFY+ CLS YL+KIS++ FP+ + LWE HI 
Sbjct  63   KNGKKHWKKVEVDIQEHIKIPNFPHGKSPEFYEDCLSGYLSKISLEQFPENKALWEFHII  122

Query  531  RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSN  710
             YPT NA  N +FKLH SLGDGYSLMGALLSCLQRADNP LPLTFP      +     +N
Sbjct  123  NYPTKNAAQNLVFKLHHSLGDGYSLMGALLSCLQRADNPQLPLTFPLLNQKIQTNDNKNN  182

Query  711  AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEF  857
             ++ AF           D+V DF W+ LKS +L+DDKT I S DDGV+ 
Sbjct  183  ILSMAF-----------DSVCDFGWSVLKSIVLEDDKTPIRSGDDGVQL  220



>gb|KDP24069.1| hypothetical protein JCGZ_25726 [Jatropha curcas]
Length=262

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 173/253 (68%), Gaps = 4/253 (2%)
 Frame = +3

Query  801   SLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLY  980
             S ++DDK+ I S   GVE  P+S+ TM+FSL  +KQI++ L VTI DVI+G +  G R+Y
Sbjct  4     SFVEDDKSPIRSGHSGVECLPVSLVTMSFSLDQIKQIRTKLGVTIKDVITGTIFLGNRMY  63

Query  981   MQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSP  1160
             M+   + +     T+LVL NTR M  GYKSV EM KPNAE PWGN ITFL   IPKL   
Sbjct  64    MEAMSKGSGQARTTSLVLLNTR-MFEGYKSVQEMTKPNAEFPWGNHITFLSVPIPKLSGT  122

Query  1161  GDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSI  1340
                D  +PL+F++ A ++++R+R S ++YLT ++L+   K RG EA +++LR TLKN+S+
Sbjct  123   ---DPKDPLQFVWKARQIIQRKRASFAVYLTAKYLQLVNKFRGPEALSKYLRNTLKNSSM  179

Query  1341  TMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKL  1520
              +TN++GPVE+  LANHP+ G YF V+ +P SL   ++SY GKLR+  + EKDFID +K 
Sbjct  180   GITNLMGPVEQMALANHPINGFYFVVTNSPHSLGTGVVSYMGKLRVAALVEKDFIDPQKY  239

Query  1521  KSCIESAFDEIFR  1559
                +E+AF+ I +
Sbjct  240   TLHVENAFEMILK  252



>ref|XP_008368651.1| PREDICTED: uncharacterized protein LOC103432247 isoform X2 [Malus 
domestica]
Length=351

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 131/252 (52%), Positives = 169/252 (67%), Gaps = 13/252 (5%)
 Frame = +3

Query  174  LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
            L P SP   Y NSSVLS SI+ VLE  +PI  DDS  LS + +VFLPIN RFSSI +   
Sbjct  8    LDPVSPTGHYFNSSVLSISILGVLEFEIPI--DDSQTLSLLENVFLPINSRFSSIXIEN-  64

Query  354  NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
            NG+K WK V+V LEDH+K PIFP     E YD    +Y++ I+   FP+ +PLWEIH+ +
Sbjct  65   NGKKQWKKVEVKLEDHVKSPIFPSNLSNESYDKYFDDYISNIATTRFPEDKPLWEIHVIK  124

Query  534  YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
            YP SNA GN IFKLH +LGDGYSLMGAL+SCL+RADNP+LPLTFP R  S  K   + N 
Sbjct  125  YPNSNAAGNVIFKLHHALGDGYSLMGALISCLRRADNPSLPLTFPSRLPSKPK---SENV  181

Query  714  VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
            +   F       S +++T++D  W   KS + +DD++ I S ++G+EF PI+V+TMT SL
Sbjct  182  MTTTF-------SCLLNTISDSWWGISKSIMGEDDRSPIKSXNNGLEFAPITVSTMTISL  234

Query  894  YHLKQIKSSLNV  929
              ++ IKS L V
Sbjct  235  DLIRLIKSRLGV  246


 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = +3

Query  1296  ATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLR  1475
             A ++++R T+KN+S+ +TNMIGP+E+ +LANHP+KG+YF V G PQ L +++ SY GK++
Sbjct  247   AASRYIRSTIKNSSMVITNMIGPLEQMSLANHPIKGLYFLVVGTPQDLDISIXSYMGKVK  306

Query  1476  LTIISEKDFIDVKKLKSCIESAFDEIF  1556
             L    +K  ID +KLK C+E+A D IF
Sbjct  307   LAFTMKKGIIDPQKLKLCMENALDMIF  333



>ref|XP_004136847.1| PREDICTED: O-acyltransferase WSD1-like [Cucumis sativus]
Length=265

 Score =   245 bits (625),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/260 (49%), Positives = 172/260 (66%), Gaps = 12/260 (5%)
 Frame = +3

Query  180  PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
            P SP +Q  NSS LS S+IAVLE  +PI  D+  I+   +D+ +P+NP FSSIMV   NG
Sbjct  15   PVSPTAQCFNSSALSISVIAVLEFEIPI--DEVQIMCYAKDL-IPLNPLFSSIMVDDING  71

Query  360  EKNWKPVKVILEDHLKVPIFPVGKPLE---FYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
            E+ WK V+V LE+H+ VP FP    +     YD   ++Y+T +      + +PLWEIHI 
Sbjct  72   ERKWKKVEVNLEEHILVPTFPSNLSVVDDINYDAYFNKYITNLGAQELAKNKPLWEIHII  131

Query  531  RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSN  710
            +YPTSNA  N I K H SLGDGYS+MG L+S ++RADNP+LPLTFP R+ +      N+ 
Sbjct  132  KYPTSNAAANLILKFHHSLGDGYSVMGLLISSMKRADNPSLPLTFPSRKINS--DDHNNK  189

Query  711  AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFS  890
             +      VP  ++ V+    DF W+ +KSS+L+DD T I S  DGVEFRP+++ T++FS
Sbjct  190  NLRHVLNYVPSFMNSVL----DFGWSIIKSSVLEDDLTPIRSGGDGVEFRPVAICTISFS  245

Query  891  LYHLKQIKSSLNVTINDVIS  950
            L+ +KQIKS L VTINDVI+
Sbjct  246  LHQIKQIKSKLRVTINDVIT  265



>ref|XP_002517895.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44413.1| conserved hypothetical protein [Ricinus communis]
Length=316

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 174/257 (68%), Gaps = 14/257 (5%)
 Frame = +3

Query  168  VVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM--  341
            V+  P SP  QY++SS++S +I+AVLE  VPI  DDS  +S + DVFLPINPRFSSIM  
Sbjct  14   VISEPVSPMGQYLSSSIVSLTIVAVLELEVPI--DDSQAMSLLEDVFLPINPRFSSIMNE  71

Query  342  ---VTG--KNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQ  506
                +G  +   K  + V+V LE+H+KVP FP G      D  L +YL+KI M+  P+ Q
Sbjct  72   CNLASGYEQQRRKALEEVEVKLENHVKVPFFPTGMSSNSNDDYLDDYLSKIPMEELPKHQ  131

Query  507  PLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG  686
            PLWE+HI +Y T+ A  N IFKLH SLGDG++LMGALLSCLQRADNP++PL+FP  Q   
Sbjct  132  PLWEVHIVKYQTTIAACNVIFKLHHSLGDGFTLMGALLSCLQRADNPSIPLSFPSAQLHT  191

Query  687  KKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPI  866
            + QG  +N + R    V ++LS V + ++DF    L+S L+ DDK+ I S   GVEF P+
Sbjct  192  QTQGNTNNNIGR--NIVTKILSSVCNILSDFC---LRSGLIKDDKSPIKSGHPGVEFLPV  246

Query  867  SVTTMTFSLYHLKQIKS  917
            S+ TM+FSL ++KQIK+
Sbjct  247  SIVTMSFSLDYIKQIKT  263



>ref|XP_011012031.1| PREDICTED: O-acyltransferase WSD1-like, partial [Populus euphratica]
Length=281

 Score =   244 bits (623),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 131/282 (46%), Positives = 171/282 (61%), Gaps = 32/282 (11%)
 Frame = +3

Query  162  DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS---  332
            +E  + P SP  QY NSS L+ S++ V E+ VPI  DDS  +S + DVFLPINPRFS   
Sbjct  6    EEDAIEPVSPTGQYCNSSALNVSVLGVFETEVPI--DDSKTISFLTDVFLPINPRFSPSQ  63

Query  333  -----------------------SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEF  443
                                    I V  +NGEK WK V+V L+DH+ VPIFP     +F
Sbjct  64   YYMSASKSKLFIMLPGSPHLCQVKIQVIDENGEKRWKKVEVKLKDHVYVPIFPAEMSPQF  123

Query  444  YDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLS  623
            YD  + +Y +K+ +   PQ+QPLWEIH  +YPTSN  G  IFK+H S+GDGYSLMGALLS
Sbjct  124  YDKYVEDYFSKLLLSQLPQSQPLWEIHFIKYPTSNEAGTVIFKIHHSIGDGYSLMGALLS  183

Query  624  CLQRADNPALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSS  803
            CLQRADNP+LPLT P  +      G++       FK VP++LS +   V+ FS + +KSS
Sbjct  184  CLQRADNPSLPLTLPSVEPRVDTSGDHDT----IFKTVPKILSLMFYIVSGFSRSLIKSS  239

Query  804  LLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNV  929
            L++DD + I S D  +EF PI++T M FS   +KQIK+   V
Sbjct  240  LVEDDLSPIRSGDIRIEFHPITLTLMIFSRGQIKQIKTIFGV  281



>gb|KCW57201.1| hypothetical protein EUGRSUZ_H00016 [Eucalyptus grandis]
Length=272

 Score =   243 bits (621),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 178/274 (65%), Gaps = 19/274 (7%)
 Frame = +3

Query  174  LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
            L P SP  QY NS V+S S++ +LES +PI+D  +  L  I+DVFLPINPRFSSIMV GK
Sbjct  10   LEPVSPTGQYFNSKVMSVSVLGILESEIPIDDSQATAL--IKDVFLPINPRFSSIMVIGK  67

Query  354  NGEKNWKPVKVILEDHLKVPIFPVGKPLEFY---DYCLSEYLTKISMDPFPQTQPLWEIH  524
             G + WK V+V +E+H+ VP F   K        D  L  Y+++I+  PFPQ QPLWE+H
Sbjct  68   KGARKWKKVEVEVENHVHVPSFSSPKGSSSPSENDSFLKSYISQIAKQPFPQGQPLWEVH  127

Query  525  IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
            I + PTS A G  IFKLH +LGDGYSL+GALLSCLQRAD+P+LP+TFP          ++
Sbjct  128  IIKCPTSEAQGTVIFKLHHALGDGYSLVGALLSCLQRADDPSLPVTFPSVNKFSSANNDD  187

Query  705  SNAVARAFKAVPRLLSG----VVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVE-FRPIS  869
             N        +P+++SG    +V+TV DF  + LKS+   DD + I     G+E FRP S
Sbjct  188  RNI------GLPKVVSGCFLPLVNTVRDFGGSVLKSTCFKDDLSPIRC---GLESFRPFS  238

Query  870  VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGT  971
            ++ ++FSL  +K+IKS L VTINDVI G++   T
Sbjct  239  LSAISFSLDRIKEIKSRLRVTINDVIMGVIFLAT  272



>gb|KDO38197.1| hypothetical protein CISIN_1g044955mg [Citrus sinensis]
Length=244

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 111/226 (49%), Positives = 158/226 (70%), Gaps = 4/226 (2%)
 Frame = +3

Query  879   MTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGG  1058
             MTF L+ +KQIK +L  T+NDVI+G +  G RLYMQ   +E+ N   TA+VL NTR M  
Sbjct  1     MTFPLHQIKQIKDNLGATLNDVITGTIFLGIRLYMQAVNQESTNLHSTAVVLLNTR-MFK  59

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
                S+ EM+KP+++ PWGN   FL  ++P+L    + +  NPL+FI  A  +++ +R S 
Sbjct  60    SISSIKEMVKPDSKAPWGNHFAFLHISVPQLT---NAEVQNPLKFIQKAQEIIQSKRSSF  116

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
               YLT + LE  +KLRG E  A+F+  +L N+S+ +TNM+GPVEK  LANHP+KG+YF V
Sbjct  117   GAYLTAKLLETVKKLRGHETAAKFIHGSLNNSSLAITNMMGPVEKMALANHPIKGLYFMV  176

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
             +G+PQSLVVT+++Y G LR+++ +E+ FID  KLKSCIE+AF+ I 
Sbjct  177   AGSPQSLVVTIVTYMGNLRVSLGAEEGFIDSPKLKSCIENAFEMIL  222



>gb|KGN43651.1| hypothetical protein Csa_7G051310 [Cucumis sativus]
Length=265

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 166/254 (65%), Gaps = 12/254 (5%)
 Frame = +3

Query  180  PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
            P SP +Q  NSS LS S+IAVLE  +PI  D+  I+   +D+ +P+NP FSSIMV   NG
Sbjct  15   PVSPTAQCFNSSALSISVIAVLEFEIPI--DEVQIMCYAKDL-IPLNPLFSSIMVDDING  71

Query  360  EKNWKPVKVILEDHLKVPIFPVGKPLE---FYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
            E+ WK V+V LE+H+ VP FP    +     YD   ++Y+T +      + +PLWEIHI 
Sbjct  72   ERKWKKVEVNLEEHILVPTFPSNLSVVDDINYDAYFNKYITNLGAQELAKNKPLWEIHII  131

Query  531  RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSN  710
            +YPTSNA  N I K H SLGDGYS+MG L+S ++RADNP+LPLTFP R+ +      N+ 
Sbjct  132  KYPTSNAAANLILKFHHSLGDGYSVMGLLISSMKRADNPSLPLTFPSRKINS--DDHNNK  189

Query  711  AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFS  890
             +      VP  ++ V+    DF W+ +KSS+L+DD T I S  DGVEFRP+++ T++FS
Sbjct  190  NLRHVLNYVPSFMNSVL----DFGWSIIKSSVLEDDLTPIRSGGDGVEFRPVAICTISFS  245

Query  891  LYHLKQIKSSLNVT  932
            L+ +KQIKS L V+
Sbjct  246  LHQIKQIKSKLRVS  259



>emb|CDP21807.1| unnamed protein product, partial [Coffea canephora]
Length=242

 Score =   224 bits (571),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 149/215 (69%), Gaps = 4/215 (2%)
 Frame = +3

Query  930   TINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPW  1109
             +INDVI G++  G RLYMQ   +E  N   TALVL NTR + G YKS+ EM++PN E  W
Sbjct  21    SINDVICGVIFLGARLYMQAMNQEKTNASSTALVLLNTRNIAG-YKSIEEMVEPNTESTW  79

Query  1110  GNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRG  1289
             GN+  FL  ++P+       DSSNPL F++ A + +K +R SA++YLTGQ LE  R+ RG
Sbjct  80    GNQFGFLHVSVPRFTKK---DSSNPLNFVFKAQKTIKSKRDSAAVYLTGQLLETLRRHRG  136

Query  1290  LEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGK  1469
              E TA+++R TLKN+S+T++N+ GPV++  LANHP KGMYF V G PQSL +TM+SY  +
Sbjct  137   PEGTAKYVRGTLKNSSMTISNISGPVDQLALANHPAKGMYFMVVGVPQSLTITMISYMRE  196

Query  1470  LRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLKS  1574
             LR+ + +EK  I  +K +SCIE AF+ +F+   +S
Sbjct  197   LRVAVGTEKGLIHPQKFQSCIEDAFNIMFKAAAES  231



>gb|KEH30694.1| DNA repair and recombination RAD26-like protein, putative [Medicago 
truncatula]
Length=834

 Score =   238 bits (608),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 175/278 (63%), Gaps = 13/278 (5%)
 Frame = +3

Query  165  EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
            E +  P SP  QY N+  L   +   LE  +PI+D  ++ L  I+ +FLPINPRFSSI+V
Sbjct  5    EDLTEPVSPSGQYFNTPPLCSYVFGFLELEIPIDDSQAMYL--IQHLFLPINPRFSSIIV  62

Query  345  TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
              K+G   WK V+V  +DH KVP+FP  + +EFYD    +Y++KI ++  P+ +PLWEIH
Sbjct  63   RDKDGNMKWKKVEVNPKDHFKVPVFPKNESIEFYDQDFDDYVSKILIERTPKDKPLWEIH  122

Query  525  IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG---KKQ  695
            + +YPTSNA    IFKLH +LGDGYSLMGALLSCL RAD+P+LPL+FP R+ S     K+
Sbjct  123  VIKYPTSNAAYTIIFKLHHALGDGYSLMGALLSCLHRADDPSLPLSFPNRKSSQLLTPKR  182

Query  696  GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
            G         FK  P  +  + ++++DF W+ LKSS+++DDK+ I + ++G EF P +++
Sbjct  183  G--------FFKWFPSTIFSLFNSISDFGWSILKSSIIEDDKSPIWNGEEGSEFLPCALS  234

Query  876  TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE  989
             ++FSL  +  IKS L V+         T G     Q+
Sbjct  235  NLSFSLDEIITIKSKLGVSRGHFAHKYKTSGANFAKQD  272



>gb|AES89677.2| DNA repair and recombination RAD26-like protein, putative [Medicago 
truncatula]
Length=1158

 Score =   239 bits (611),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/278 (44%), Positives = 175/278 (63%), Gaps = 13/278 (5%)
 Frame = +3

Query  165  EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
            E +  P SP  QY N+  L   +   LE  +PI+D  ++ L  I+ +FLPINPRFSSI+V
Sbjct  5    EDLTEPVSPSGQYFNTPPLCSYVFGFLELEIPIDDSQAMYL--IQHLFLPINPRFSSIIV  62

Query  345  TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
              K+G   WK V+V  +DH KVP+FP  + +EFYD    +Y++KI ++  P+ +PLWEIH
Sbjct  63   RDKDGNMKWKKVEVNPKDHFKVPVFPKNESIEFYDQDFDDYVSKILIERTPKDKPLWEIH  122

Query  525  IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG---KKQ  695
            + +YPTSNA    IFKLH +LGDGYSLMGALLSCL RAD+P+LPL+FP R+ S     K+
Sbjct  123  VIKYPTSNAAYTIIFKLHHALGDGYSLMGALLSCLHRADDPSLPLSFPNRKSSQLLTPKR  182

Query  696  GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
            G         FK  P  +  + ++++DF W+ LKSS+++DDK+ I + ++G EF P +++
Sbjct  183  G--------FFKWFPSTIFSLFNSISDFGWSILKSSIIEDDKSPIWNGEEGSEFLPCALS  234

Query  876  TMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE  989
             ++FSL  +  IKS L V+         T G     Q+
Sbjct  235  NLSFSLDEIITIKSKLGVSRGHFAHKYKTSGANFAKQD  272



>ref|XP_006593082.1| PREDICTED: O-acyltransferase WSD1-like [Glycine max]
Length=259

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/254 (46%), Positives = 160/254 (63%), Gaps = 12/254 (5%)
 Frame = +3

Query  171  VLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTG  350
            V  P SP   Y NSSV+   +   LE +VPI+D  ++ L E  DVFLPINPRFSSIMV  
Sbjct  8    VQEPVSPHGHYFNSSVICSYVFGFLEMAVPIDDSQTIPLLE--DVFLPINPRFSSIMVRD  65

Query  351  KNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
            + G+  WK V+V  E+H+KVP FP     E Y+    +Y+T+I  +  PQ +PLWEIH+ 
Sbjct  66   QAGKMRWKRVQVNPEEHVKVPRFPECNSAELYEQYFDDYVTRILNERTPQNKPLWEIHLI  125

Query  531  RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSN  710
            +YPTS+A G  IFK H SLGDGYSLMGALLSCLQR D+P+LPLTFP      KK     +
Sbjct  126  KYPTSSAAGTIIFKFHHSLGDGYSLMGALLSCLQRTDDPSLPLTFPSNSQHAKKNMFKLH  185

Query  711  AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFS  890
            +V          +S +  ++ DF  + +K+ +++DDKT I S  +G + +  +++ ++ S
Sbjct  186  SV----------ISSLFSSMLDFGSSIIKTRMIEDDKTPIRSGYEGTKPKYFTLSNISLS  235

Query  891  LYHLKQIKSSLNVT  932
            L H+K IKS+L V 
Sbjct  236  LDHIKAIKSNLGVV  249



>ref|XP_003607480.1| Chromodomain-helicase-DNA-binding protein [Medicago truncatula]
Length=1283

 Score =   238 bits (608),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/261 (46%), Positives = 171/261 (66%), Gaps = 13/261 (5%)
 Frame = +3

Query  165  EVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV  344
            E +  P SP  QY N+  L   +   LE  +PI+D  ++ L  I+ +FLPINPRFSSI+V
Sbjct  5    EDLTEPVSPSGQYFNTPPLCSYVFGFLELEIPIDDSQAMYL--IQHLFLPINPRFSSIIV  62

Query  345  TGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIH  524
              K+G   WK V+V  +DH KVP+FP  + +EFYD    +Y++KI ++  P+ +PLWEIH
Sbjct  63   RDKDGNMKWKKVEVNPKDHFKVPVFPKNESIEFYDQDFDDYVSKILIERTPKDKPLWEIH  122

Query  525  IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSG---KKQ  695
            + +YPTSNA    IFKLH +LGDGYSLMGALLSCL RAD+P+LPL+FP R+ S     K+
Sbjct  123  VIKYPTSNAAYTIIFKLHHALGDGYSLMGALLSCLHRADDPSLPLSFPNRKSSQLLTPKR  182

Query  696  GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
            G         FK  P  +  + ++++DF W+ LKSS+++DDK+ I + ++G EF P +++
Sbjct  183  G--------FFKWFPSTIFSLFNSISDFGWSILKSSIIEDDKSPIWNGEEGSEFLPCALS  234

Query  876  TMTFSLYHLKQIKSSLNVTIN  938
             ++FSL  +  IKS L V  +
Sbjct  235  NLSFSLDEIITIKSKLGVVTH  255



>gb|KHN35224.1| O-acyltransferase WSD1 [Glycine soja]
Length=360

 Score =   223 bits (568),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 117/254 (46%), Positives = 161/254 (63%), Gaps = 12/254 (5%)
 Frame = +3

Query  171  VLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTG  350
            V  P SP   Y NSSV+   +   LE +VPI+D  ++ L E  DVFLPINPRFSSIMV  
Sbjct  8    VQEPVSPHGHYFNSSVICSYVFGFLEMAVPIDDSQTIPLLE--DVFLPINPRFSSIMVRD  65

Query  351  KNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
            + G+  WK V+V  E+H+KVP FP     E Y+    +Y+T+I  +  PQ +PLWEIH+ 
Sbjct  66   QAGKMRWKRVQVNPEEHVKVPRFPECNSAELYEQYFDDYVTRILNERTPQNKPLWEIHLI  125

Query  531  RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSN  710
            +YPTS+A G  IFK H SLGDGYSLMGALLSCLQR D+P+LPLTFP      KK      
Sbjct  126  KYPTSSAAGTIIFKFHHSLGDGYSLMGALLSCLQRTDDPSLPLTFPSNSQHAKKN-----  180

Query  711  AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFS  890
                 FK +  ++S +  ++ DF  + +K+ +++DDKT I S  +G + +  +++ ++ S
Sbjct  181  ----MFK-LHSVISSLFSSMLDFGSSIIKTRMIEDDKTPIRSGYEGTKPKYFTLSNISLS  235

Query  891  LYHLKQIKSSLNVT  932
            L H+K IKS+L V 
Sbjct  236  LDHIKAIKSNLGVV  249


 Score =   102 bits (254),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  1287  GLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAG  1466
             G+ A+  F   TL N S+ ++NM GP+E+  LANHPV G+YFA+SG PQ++ V ++SY G
Sbjct  247   GVVASKTFYN-TLGNCSVLISNMFGPMEQMALANHPVSGVYFAMSGGPQNVNVEIMSYVG  305

Query  1467  KLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTLK-SSPPRA*IYIHI  1607
             +LR+T  + K FID +K K CIE AFDEIF+  ++    P+  IY+ I
Sbjct  306   ELRITSKTLKGFIDEQKFKFCIEKAFDEIFKDAMEIYEIPKWDIYMEI  353



>ref|XP_003607473.1| O-acyltransferase WSD1, partial [Medicago truncatula]
Length=251

 Score =   219 bits (559),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 166/254 (65%), Gaps = 9/254 (4%)
 Frame = +3

Query  162  DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIM  341
            +E V  P SP  QY NSSV+   +   LE ++PI  DDS  +  ++DVFLPINPRFSSIM
Sbjct  5    NEEVQEPVSPHGQYFNSSVICSYVFGFLELAIPI--DDSQTMPLLKDVFLPINPRFSSIM  62

Query  342  VTGKNGEKNWKPVKVILEDHLKVPIFP--VGKPLEFYDYCLSEYLTKISMDPFPQTQPLW  515
            V  K+G+  W+ V+V LE+H+K+P FP         YD  LS+Y+T I     PQ +PLW
Sbjct  63   VRDKDGKMRWQRVEVKLEEHIKIPKFPETTNSSSILYDNYLSDYVTSILTSRTPQDKPLW  122

Query  516  EIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
            EIH+ +YPTSNA G  IFKLH +LGDGYSLMGALLSCLQRAD+P+LPL+FP R      Q
Sbjct  123  EIHLIKYPTSNAKGTLIFKLHHALGDGYSLMGALLSCLQRADDPSLPLSFPSR-----PQ  177

Query  696  GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVT  875
              +  A    FK +   +S    +++DF  + +K+ +++DDKT I S  +G E +P +++
Sbjct  178  LNSKYAKKGLFKKLCLDISSFFSSISDFGSSLIKTRMIEDDKTPIRSGYEGTESQPFTLS  237

Query  876  TMTFSLYHLKQIKS  917
             ++ SL  +K+IKS
Sbjct  238  NISLSLDQIKEIKS  251



>ref|XP_008362450.1| PREDICTED: O-acyltransferase WSD1-like [Malus domestica]
Length=238

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 151/226 (67%), Gaps = 6/226 (3%)
 Frame = +3

Query  879   MTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGG  1058
             MT SL  ++ IKS L VTINDV++G+V  G RLYMQE  + +     T+LVL NTR M  
Sbjct  1     MTISLDLIRLIKSRLGVTINDVLTGVVFLGARLYMQEMNKSSREAHSTSLVLLNTRIMAN  60

Query  1059  GYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSA  1238
              Y S+ EMIKP+++ PWGNR TFL   IPKL      + SN L F++ A +++ ++R S 
Sbjct  61    -YTSIEEMIKPDSKSPWGNRFTFLQVPIPKL-----TEFSNVLDFVWKAQKIINQKRNSF  114

Query  1239  SLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAV  1418
             ++Y     LE   K  G EA ++++R T+KN+S+ +TNMIGP+E+ +LANHP+KG+YF V
Sbjct  115   TIYFISXLLEMLNKFGGHEAASRYIRSTIKNSSMVITNMIGPLEQMSLANHPIKGLYFLV  174

Query  1419  SGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
              G PQ L +++ SY GK++L    +K  ID +KLK C+E+A D IF
Sbjct  175   VGTPQDLDISIXSYMGKVKLAFTMKKGIIDPQKLKLCMENALDMIF  220



>gb|KDO38023.1| hypothetical protein CISIN_1g047091mg [Citrus sinensis]
Length=229

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 144/206 (70%), Gaps = 4/206 (2%)
 Frame = +3

Query  930   TINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPW  1109
             T+NDVI+G +  GTRLYMQ   +E+ N   TA+VL NTR M     SV EM+KP+++ PW
Sbjct  3     TLNDVITGTIFLGTRLYMQAVNQESTNLHSTAVVLLNTR-MLKSISSVKEMVKPDSKAPW  61

Query  1110  GNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRG  1289
             GN   FL  ++P+L    + +  NPL+FI  A  +++ +R S   YLT + LE  +K RG
Sbjct  62    GNHFAFLHVSVPQLT---NAEIQNPLKFIRKAQEIIQSKRSSFGAYLTAKLLETVKKFRG  118

Query  1290  LEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGK  1469
              E  A+F+  +L N+SI +TNM+GPVEK TLANH +KG+YF V G+PQSLVVT++SY G 
Sbjct  119   HETAAKFIHGSLNNSSIAITNMMGPVEKMTLANHAIKGLYFMVVGSPQSLVVTIVSYMGN  178

Query  1470  LRLTIISEKDFIDVKKLKSCIESAFD  1547
             LR+++ +E+ FID  KLKSCIE+AF+
Sbjct  179   LRVSLGAEEGFIDSPKLKSCIENAFE  204



>gb|KCW57200.1| hypothetical protein EUGRSUZ_H00015 [Eucalyptus grandis]
Length=284

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 171/269 (64%), Gaps = 9/269 (3%)
 Frame = +3

Query  174  LAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGK  353
            L P SP  QY NS V+S SI+ +LES +PI  D S   S I+DVFLPINPRFSSIMV GK
Sbjct  10   LEPVSPLGQYFNSKVMSVSILGILESEIPI--DGSQAKSLIKDVFLPINPRFSSIMVMGK  67

Query  354  NGEKNWKPVKVILEDHLKVPIFPVGKPLEFY---DYCLSEYLTKISMDPFPQTQPLWEIH  524
             G K WK V+V +E+H+ VP F   K        D  L  Y+ +++M PF   QPLWEIH
Sbjct  68   KGGKKWKKVEVKVENHVHVPSFSSPKGSSSSSENDSFLKSYIAEVAMQPFQLGQPLWEIH  127

Query  525  IFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGEN  704
            I   P S A G  IFKLH +LGDGYSL+GALLSCLQRAD+P+LP+TFP          ++
Sbjct  128  IINCPASEAQGTVIFKLHHALGDGYSLVGALLSCLQRADDPSLPVTFPSVNNFSSANKDD  187

Query  705  SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
               V R  K V R    +V+T+ DF  + LKS+ ++DD + I  + +   FRP S++T+T
Sbjct  188  GKIVLR--KVVSRCFLPLVNTIRDFGRSVLKSTCVEDDLSPIRCRSES--FRPFSLSTIT  243

Query  885  FSLYHLKQIKSSLNVTINDVISGIVTYGT  971
            FSL+H+K+IKS L V  N ++  I++  +
Sbjct  244  FSLHHIKEIKSRLRVVTNIILKTILSLAS  272



>gb|EPS63572.1| hypothetical protein M569_11213 [Genlisea aurea]
Length=198

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 127/183 (69%), Gaps = 2/183 (1%)
 Frame = +3

Query  138  MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
            ME    G++E      SP  +Y+ SS L  +I+ VLE   PI+D  +++L  I  VFLPI
Sbjct  1    MEFPAAGEEEEEEEAVSPSGEYLKSSKLDLTILGVLEFQNPIDDSPTLLL--IDRVFLPI  58

Query  318  NPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFP  497
            NPRFSSIMV  + G K WK V+V L+DH+KVP+FP     E+YD C  EYLT I+ +P P
Sbjct  59   NPRFSSIMVADETGAKKWKRVRVNLQDHVKVPVFPADMRAEYYDGCFREYLTSIAAEPLP  118

Query  498  QTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQ  677
            Q +PLWEIH+ +YPT  A GN +FK+H SLGDGYSLMGALLSCLQR D+P +PLTFP R+
Sbjct  119  QDRPLWEIHVVKYPTKVAAGNLVFKIHHSLGDGYSLMGALLSCLQRLDDPLMPLTFPSRK  178

Query  678  GSG  686
             + 
Sbjct  179  STA  181



>ref|XP_007198862.1| hypothetical protein PRUPE_ppa018325mg, partial [Prunus persica]
 gb|EMJ00061.1| hypothetical protein PRUPE_ppa018325mg, partial [Prunus persica]
Length=238

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 126/287 (44%), Positives = 166/287 (58%), Gaps = 49/287 (17%)
 Frame = +3

Query  138  MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
            ME  + G++     P S   Q +NSSVLS SI+ VLE  +PI  ++S  LS ++DVF  I
Sbjct  1    MEYGVHGNE-----PVSSTGQCLNSSVLSMSILCVLEFEIPI--NESKNLSFLQDVFPHI  53

Query  318  NPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFP  497
            +PRFSSIMV   NGEK  K V+V L DH+ VPIFP G   + YD    +Y++ I ++ +P
Sbjct  54   SPRFSSIMV-DVNGEKQCKRVEVKLRDHVHVPIFPSGLSPKSYDDHFHDYISNIILEQYP  112

Query  498  QTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQ  677
            + +PLWE+HI +YPTS+A GN IFKLH +LGDGYS M ALLSCLQRADNP LPLT     
Sbjct  113  KDKPLWEVHIIKYPTSSAAGNLIFKLHHALGDGYSFMSALLSCLQRADNP-LPLT-----  166

Query  678  GSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEF  857
                           +F   P + +G         WN    SL  DD T I S + GVEF
Sbjct  167  --------------SSF--TPGIATGC--------WN----SLFQDDLTPIRSGNYGVEF  198

Query  858  RPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESER  998
             P++ +++TFSL  +K IK+ LN       +GI+      Y +   R
Sbjct  199  LPMTASSITFSLDEIKLIKTKLN-------AGIIFTNIHCYKKAKRR  238



>ref|XP_003607477.1| O-acyltransferase WSD1 [Medicago truncatula]
Length=481

 Score =   202 bits (513),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 116/259 (45%), Positives = 161/259 (62%), Gaps = 9/259 (3%)
 Frame = +3

Query  171  VLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTG  350
            V  P SP  QY NSSV+   +   LE ++P   D+S+ +  ++DVF+PINPRFSSIMV  
Sbjct  8    VQEPVSPHGQYFNSSVMCSYVFGFLELAIPF--DNSLAIPLLKDVFIPINPRFSSIMVKD  65

Query  351  KNGEKNWKPVKVILEDHLKVPIFPV---GKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
              G+  W+ V+V  E+HLK+PIFP        E YD  +S Y+T I     PQ +PLWEI
Sbjct  66   VEGKMRWQKVEVKPEEHLKIPIFPETINSSSCELYDKYVSNYVTSILNGRTPQNKPLWEI  125

Query  522  HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
            HI  YPT+NA    IFKL+ +LGDGYSLM ALLSCLQRAD+P+LPL+FP    S + Q  
Sbjct  126  HIINYPTTNAACTIIFKLNHALGDGYSLMSALLSCLQRADDPSLPLSFP----SQRPQLN  181

Query  702  NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
            +  A    F+ +  ++S    +++DF  + LK+ ++ DDKT I S  +G E +P  ++ +
Sbjct  182  SKYAKINLFEKLCFVISSFFSSISDFGSSILKTRMIKDDKTPIRSGYEGAESQPFILSNI  241

Query  882  TFSLYHLKQIKSSLNVTIN  938
            T SL  +K +K+ L V  N
Sbjct  242  TLSLDQIKGVKTKLGVLSN  260



>ref|XP_010911763.1| PREDICTED: O-acyltransferase WSD1-like, partial [Elaeis guineensis]
Length=190

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 130/195 (67%), Gaps = 6/195 (3%)
 Frame = +3

Query  342  VTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEI  521
            V  ++G + WK VKV LEDH+ VP FP G  LE YD  + +YL++I+++  PQ+QPLW++
Sbjct  1    VEDEHGVQQWKRVKVKLEDHVNVPTFPPG--LESYDQFVQDYLSEIAVEKLPQSQPLWDL  58

Query  522  HIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGE  701
            HI +YPTS A G  +FKLH +LGDG+SLMGAL SCLQRAD+P+LPLTFP    + +++  
Sbjct  59   HIIKYPTSTAEGTMVFKLHHALGDGFSLMGALFSCLQRADDPSLPLTFP----TSREKAM  114

Query  702  NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
              +        VPR LS   +TV D  W+  KS+L +DD T + S    VEFRPI+++ +
Sbjct  115  KKSLWGSIRWKVPRFLSMCANTVQDVGWSLWKSNLAEDDVTPLRSGAPAVEFRPITISCI  174

Query  882  TFSLYHLKQIKSSLN  926
             FSL  +++IK  + 
Sbjct  175  EFSLDDIRKIKDKVG  189



>ref|XP_008353775.1| PREDICTED: uncharacterized protein LOC103417361 [Malus domestica]
Length=209

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/201 (46%), Positives = 134/201 (67%), Gaps = 6/201 (3%)
 Frame = +3

Query  954   IVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLP  1133
             +V  G+RLYMQE  + +     TALVL +TR MG  Y S+ EM+KP+++ PWGN   FL 
Sbjct  1     MVFLGSRLYMQEMNQSSREAHSTALVLLSTRIMGN-YTSIEEMVKPDSKSPWGNHFAFLQ  59

Query  1134  FAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFL  1313
               IPKL      + SN L F++ A + +K +R S ++Y T   L+      G EA ++++
Sbjct  60    VPIPKLT-----EFSNALDFVWEAQKFIKMKRNSLAIYFTSGLLKMLNMFEGHEAASRYI  114

Query  1314  RRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISE  1493
             RRTLKN+S+  TNMIGPVE+ +LAN P+KG+YF + G+PQ L +++LSY G++RLT+  +
Sbjct  115   RRTLKNSSMAFTNMIGPVEQMSLANQPIKGLYFMLVGSPQDLDISVLSYMGEVRLTLTMK  174

Query  1494  KDFIDVKKLKSCIESAFDEIF  1556
             K  ID +KLK C+E+A D IF
Sbjct  175   KGTIDPQKLKLCMENAHDMIF  195



>ref|XP_007042465.1| O-acyltransferase family protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007042466.1| O-acyltransferase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98296.1| O-acyltransferase family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOX98297.1| O-acyltransferase family protein, putative isoform 1 [Theobroma 
cacao]
Length=485

 Score =   198 bits (504),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 144/486 (30%), Positives = 237/486 (49%), Gaps = 49/486 (10%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P +P  +    S  +  I  +L    PI+ D   + S +R   +  +PRF S++V  KNG
Sbjct  11    PLTPAGRLFLQSQTNIIIHCILRGKNPIDID--AVKSTLRSSLMVRHPRFCSLLVRDKNG  68

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYD-----------------YCLSEYLTKISMD  488
              ++W+  +V ++ H+ V    + K   F D                   +++Y+  +S+ 
Sbjct  69    FEHWRKAQVDIDQHVIVIDKRLDKSDNFLDESRRFSSEEGEGDDDDEAAVNQYVADLSVS  128

Query  489   -PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLT  662
              P    +PLWEIHI   P   A    +F++H +LGDG SLM  L++  +RAD+  ALP  
Sbjct  129   SPLSTDKPLWEIHIL-VPHKCA----VFRIHHALGDGISLMSMLMASCRRADDADALPRM  183

Query  663   FPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVT---DFSWNFLKSSLLDDDKTAIH  833
              P      +K  E  +   R +  +  +L G +  V     F   F+ SSLL  D+  + 
Sbjct  184   VP------EKSAEFKDGKGRDWFWLFGILWGFLKMVCFTVMFVMEFVVSSLLVCDRKTVI  237

Query  834   SQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTINDVISGIVTYGTRLYMQESERETCN  1010
             S  +GVE  P  + T  F L  ++ +K ++ N TINDV+ G+V+ G   Y+        +
Sbjct  238   SGGEGVELWPRKLATARFLLEDMRVVKKAIPNTTINDVLFGVVSSGLSRYLDHRTPNALH  297

Query  1011  G--ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNR--ITFLPFAIPKLRSPGDGDSS  1178
                  T + + N R   G ++ +S+++K  AE  WGN+  +  LP    K         +
Sbjct  298   EGLRMTGVAMVNLRPQTG-FQDLSQLMKGAAEARWGNKFGLILLPVYFKKA-------GN  349

Query  1179  NPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMI  1358
             NPL ++  A RMV R+++S   Y + +  +    L G +       R L NT+ T++N+I
Sbjct  350   NPLEYVKRAKRMVDRKKHSLEAYFSYRIGDLVMSLLGSKYACLLNYRLLCNTTFTISNII  409

Query  1359  GPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIE  1535
             GP+E+ TLA +P+  +    S  PQ++ + MLSYAG+  + I+  KD + D + L  C E
Sbjct  410   GPLEEITLAGNPISSIKVNTSSLPQAITMHMLSYAGRAEMQILVAKDIVPDPEFLAKCFE  469

Query  1536  SAFDEI  1553
              A  E+
Sbjct  470   DALLEM  475



>ref|XP_010025798.1| PREDICTED: uncharacterized protein LOC104416056 [Eucalyptus grandis]
Length=366

 Score =   194 bits (493),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 137/211 (65%), Gaps = 3/211 (1%)
 Frame = +3

Query  930   TINDVISGIVTYGTRLYMQE-SERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMP  1106
             T+NDV++GI+   TRLYMQ  S     +   TALVL NTR +   YKSV EMI+PN++ P
Sbjct  152   TVNDVVTGIIFLATRLYMQRVSPNSNGSTNSTALVLLNTRNLRD-YKSVGEMIQPNSKSP  210

Query  1107  WGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLR  1286
             WGN   FL   IPK++ PG+   S+P +F+   H ++KR+R S  + LTG  LE  +K R
Sbjct  211   WGNYFAFLHVPIPKVK-PGNSQFSDPSKFVRKTHEVIKRKRSSFGVVLTGMLLEMMKKCR  269

Query  1287  GLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAG  1466
               EA A+ + RT  N+S+ ++N++GP+EK +LANHP+KGMYF + G P+SL VTM+SYA 
Sbjct  270   NPEAVARHIYRTTTNSSMVISNVMGPMEKLSLANHPIKGMYFTIVGTPESLQVTMISYAE  329

Query  1467  KLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
              LRL + +E+ FID +     +  A D I  
Sbjct  330   NLRLVVRAEQGFIDSELYTRSLHDALDMILH  360



>ref|XP_007203282.1| hypothetical protein PRUPE_ppa025603mg, partial [Prunus persica]
 gb|EMJ04481.1| hypothetical protein PRUPE_ppa025603mg, partial [Prunus persica]
Length=205

 Score =   189 bits (479),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 133/210 (63%), Gaps = 12/210 (6%)
 Frame = +3

Query  354  NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
            NG+K WK V+V LEDH+  P FP G  LE YD    +Y++K+  + FPQ +PLWEIHI  
Sbjct  4    NGKKQWKRVEVKLEDHVYTPPFPSGLSLESYDKYFDDYISKLLTERFPQGKPLWEIHIIN  63

Query  534  YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
            YPTSNA  N IFKLH +LGDGYSLMGAL+S +QRADNP+LPLT P R+ S  K+    N 
Sbjct  64   YPTSNAAANVIFKLHHALGDGYSLMGALISSMQRADNPSLPLTLPSRKRSESKR---ENF  120

Query  714  VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
            V + F       SG  +T++D     LK ++  D  T I S +D +EFRP +V+TMTFSL
Sbjct  121  VTKTF-------SGFCNTISDLWLGTLK-TMNGDVVTPIRSGNDAIEFRPATVSTMTFSL  172

Query  894  YHLKQIKSSLNVTINDVISGIVTYGTRLYM  983
              +K IK  L V  + V S ++ Y   L +
Sbjct  173  DQIKSIKDKLGV-WSRVNSALIFYCRSLRL  201



>gb|KGN43654.1| hypothetical protein Csa_7G051340 [Cucumis sativus]
Length=283

 Score =   191 bits (484),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 120/320 (38%), Positives = 176/320 (55%), Gaps = 41/320 (13%)
 Frame = +3

Query  159   DDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI  338
             D  ++  P SP ++Y++S +LS SI+A+LE  VPI   D  +   +R +FLPINPRF   
Sbjct  2     DSSLLQQPPSPIAEYLSSPMLSLSILAILEFQVPIHTLD--LTFNLRSLFLPINPRFPPY  59

Query  339   MVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWE  518
              +  +   ++ K          +  +      +E Y     EYLTKISM+ F   +PLWE
Sbjct  60    WLQMRKERRSGKGKHRSGRTCERSNLSTWFNYIESYKAYCDEYLTKISMEEFRPDKPLWE  119

Query  519   IHIFRYPTS-NAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQ  695
              H+F+YPTS    G  + K+H SLGDGYSLMG +LSCL  A +    LTF          
Sbjct  120   AHLFKYPTSPTVAGTMVLKVHHSLGDGYSLMGVVLSCLHTASD----LTF----------  165

Query  696   GENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLD--DDKTAIHSQDDGVEFRPIS  869
                              LS  +  V D S    ++S+L   D+KT+I S  +G++F P++
Sbjct  166   -----------------LSLFLPDVNDDS----RTSVLKGIDEKTSIRSGREGLQFMPMN  204

Query  870   VTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTALVLFNTRA  1049
               T++FSL ++K+IK+ L+VT+NDVI+GI   G RLYM+E E+ +     TAL + NTR 
Sbjct  205   TFTVSFSLNYIKKIKTKLDVTVNDVITGITFMGLRLYMEEMEKNSGEVAATALTIVNTRV  264

Query  1050  MGGGYKSVSEMIKPNAEMPW  1109
             + G Y+  +EM KP ++  W
Sbjct  265   I-GTYRPATEMAKPESKGLW  283



>ref|XP_011088231.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Sesamum indicum]
Length=465

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 140/473 (30%), Positives = 231/473 (49%), Gaps = 47/473 (10%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P +P  +     +++  I   L +  PI+ D   + ++I++  +  +PRF S+MV   +G
Sbjct  10    PLTPSGRLFLQPLMNQVINCALGADYPIDLD--CVKTQIQNSIMLKHPRFCSLMVRDSSG  67

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDY-CLSEYLTKISMD-PFPQTQPLWEIHIFR  533
              ++W+  +V ++ HL +    +       D   ++ Y+  +S   P P  +PLWE+H+  
Sbjct  68    REHWRKTQVDVDRHLIIRHHSLSNDPSVSDEDAINNYMADLSFSSPLPTDKPLWELHVL-  126

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNA  713
                  A    +F++H +LGDG SLM  LLSC ++ D+PA     P   G G         
Sbjct  127   ----AAHNAVVFRVHHALGDGISLMSMLLSCCRKVDDPA---QLPTIGGVG---------  170

Query  714   VARAFKAVPRLLSGVVDTVTDFSW-------NFLKSSLLDDDKTAIHSQDDGVEFRPISV  872
                A   VPR  S  V T+    W        F+   L   DKT + S   G+E  P  +
Sbjct  171   ---AASLVPRRWS--VWTLMKVVWFTLVSILEFVLRLLWLRDKTTVLSGGSGLELWPRQL  225

Query  873   TTMTFSLYHLKQIKSSL-NVTINDVISGIVTYGTRLYM--QESERETCNGECTALVLFNT  1043
              T  F L  +K +K +L + TINDV+ G+++ G   Y+  + S       + T L + N 
Sbjct  226   ATARFRLDDMKTVKRALADSTINDVLFGVISIGFSRYLDIRSSTAPQEGDQITGLAMVNL  285

Query  1044  RAMGGGYKSVSEMIKPNAEMPWGNR--ITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMV  1217
             R   G  + +S+++  ++  PWGN+  I  LP    +       +SS+PL+F+  A  M+
Sbjct  286   RPQSG-LQDLSKLMDSDSGTPWGNKFGIILLPVHYHR-------ESSDPLQFVRRAKAMI  337

Query  1218  KRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPV  1397
              R++ S     +   L++   L G + T+    R + NT+ T++N++GP E+ TLA HPV
Sbjct  338   HRKKLSLEAPFSHTLLDWITSLFGAKLTSILNYRIVCNTTFTISNIVGPREQVTLAGHPV  397

Query  1398  KGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIESAFDEI  1553
             K +    S  P ++ + MLSYAG   + I+  K+ I D K L  C E A  E+
Sbjct  398   KYIRVTSSSLPHAITMHMLSYAGVADMQILVAKEVIPDPKVLAKCFEDALLEM  450



>gb|KHG19380.1| O-acyltransferase WSD1 [Gossypium arboreum]
Length=464

 Score =   191 bits (486),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 129/418 (31%), Positives = 215/418 (51%), Gaps = 24/418 (6%)
 Frame = +3

Query  318   NPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMD-PF  494
             +PRF S++V   NG ++W+  ++ ++ H+ V    V +  E  +  ++ Y+  +S+  P 
Sbjct  55    HPRFCSLLVRDDNGFEHWRKTRLDVDRHVIVVKHRVNEDEEDDEVAVNLYVADLSVSSPL  114

Query  495   PQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALL-SCLQRADNPALPLTFPR  671
                +PLWE+H+       A  + +F++H SLGDG SLM  L+ SC + +D  ALP+  P 
Sbjct  115   STDKPLWEVHLL-----TAHKHVVFRIHHSLGDGISLMSMLMASCRKVSDPDALPMMVPE  169

Query  672   RQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGV  851
             +    K+    S      F  +  L       V +F    L+S  + D KTA+ S  DGV
Sbjct  170   KTTEKKRDSPWSFGSMWGFLKMAWL---TFVFVLEF---LLRSLFVSDRKTAV-SGGDGV  222

Query  852   EFRPISVTTMTFSLYHLKQIKSSL-NVTINDVISGIVTYGTRLYMQESERETCNG--ECT  1022
             E  P  + T  F L  +K++K ++ + TINDV+ GIV+ G   Y+        +     T
Sbjct  223   ELWPRKLATAKFLLDDMKEVKKAIPDTTINDVLFGIVSCGLSRYLDHRTPNALHEGLRMT  282

Query  1023  ALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYN  1202
              + + N RA   G + +S+++K N+E  WGN+   +   +   +S  D     PL ++  
Sbjct  283   GVAMVNLRA-KPGLQEISKLMKDNSETRWGNKFGVILLPVFYHKSGND-----PLEYLKR  336

Query  1203  AHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTL  1382
             A  MV R++ S   Y + +  +    L G++  +    R L NT+ T++N+IGP+E  TL
Sbjct  337   AKVMVDRKKQSLEAYFSYRIGDLIVSLLGIKYASLINYRLLCNTTFTISNLIGPLEDITL  396

Query  1383  ANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIESAFDEI  1553
             + +P+  +  + S  PQ+L + M+SYAGK  + I+  KD I D + L  C E A  E+
Sbjct  397   SGNPISSIKVSTSSLPQALTMHMVSYAGKAEMQILVAKDIIPDPEFLAKCFEDALLEM  454



>gb|EPS67964.1| hypothetical protein M569_06810, partial [Genlisea aurea]
Length=207

 Score =   183 bits (464),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 139/216 (64%), Gaps = 12/216 (6%)
 Frame = +3

Query  930   TINDVISGIVTYGTRLYMQESERETCNG---ECTALVLFNTRAMGGGYKSVSEMIKPNAE  1100
             +INDV+ G+V  G RLYM+   ++       + TALVL NTR + G YKSVSEM+  +  
Sbjct  1     SINDVVCGVVFLGIRLYMKSKNQDVDKKRGTKSTALVLLNTRNING-YKSVSEMVDKDPA  59

Query  1101  MPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRK  1280
               WGN+  FL  ++P   +P D +  NPL ++  A ++V+R R SA++ LTG+ LE  RK
Sbjct  60    ASWGNQFAFLHVSVP---TPPDPE--NPLSYVMKARKLVRRTRNSAAVILTGKLLERLRK  114

Query  1281  LRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSY  1460
             LRG E TA+++  TLKNTS+T++NM+GP E   L +HPV G YF V G   +L +T++SY
Sbjct  115   LRGPEVTAKYIHSTLKNTSLTISNMVGPSEAMALNSHPVSGFYFMVVG---NLTITVVSY  171

Query  1461  AGKLRLTIISEKDFIDVKKLKSCIESAFDEIFRLTL  1568
             A  +R+ + +E   ID  K K+C+++AFD I +  L
Sbjct  172   ADHVRMAVGTENGLIDAPKFKACLQNAFDSIHKSAL  207



>ref|XP_010035244.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
 gb|KCW46541.1| hypothetical protein EUGRSUZ_K00371 [Eucalyptus grandis]
Length=505

 Score =   190 bits (482),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 137/477 (29%), Positives = 238/477 (50%), Gaps = 40/477 (8%)
 Frame = +3

Query  186   SPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV--TGKNG  359
             SP ++  ++   +  I+A++     I  +  V+ + + +  L  +PRFSS MV    ++G
Sbjct  32    SPAARLFHAPRFNCYILAIMGCKTRI--NPGVVKAGLEETLLK-HPRFSSKMVGDIKRSG  88

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             +  W   K+ L++H+ VP   V   ++  D  + +Y++ ++  P   ++PLWE+H+    
Sbjct  89    KMKWVQTKMNLDEHVIVP--DVDPDMDTPDRFVEDYISYLTKTPLDMSRPLWELHLLNVK  146

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGENSNAV  716
             TS+A    IF++H S+GDG SLM  LL+C ++  +P ALP T P ++ +G    +NS   
Sbjct  147   TSDAEAVAIFRIHHSMGDGASLMSLLLACTRKTADPEALP-TIPGKKSAGT---QNSGGF  202

Query  717   ARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLY  896
                  A+  +   + +T+ DFS  F+ +     D  ++     GV          T SL 
Sbjct  203   WWFILALWSMFRLIWNTIVDFS-VFVATYCFLKDTESLVKGGPGVAKTTKRFVHRTVSLD  261

Query  897   HLKQIKSSLNVTINDVISGIVTYGTRLYM-----------QESERETCN----GECTALV  1031
              +K IKS+LN+TINDV+ G+   G   Y+           Q S+++  N        A V
Sbjct  262   DIKLIKSALNMTINDVVLGVTQAGLSRYLNRRYEGESGKDQNSKKKKSNIPKNMRLRATV  321

Query  1032  LFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFL--PFAIPKLRSPGDGDSSNPLRFIYNA  1205
             L N R   G  +++S+M+  N++  WGN I ++  PF+I        G   +PL +++ A
Sbjct  322   LINLRPTAG-IQALSDMMIKNSKCKWGNWIGYILIPFSI--------GSEDDPLEYVHKA  372

Query  1206  HRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLA  1385
                + R++ S    +T    E   KL G++  +    R L NT++  +N+IGPVE+ +  
Sbjct  373   KATIDRKKLSLEAIITFVCAELVLKLFGVKVASAIAHRFLSNTTVAFSNVIGPVEEISFY  432

Query  1386  NHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIESAFDEI  1553
              HP+  +  +V G P +L +   SY  K+ + +  + D I D  +L   IE +   I
Sbjct  433   GHPIAFLAPSVYGHPHALTIHFQSYVNKMTIAVAVDPDVIPDPHQLCDDIEESLKTI  489



>ref|XP_004309135.1| PREDICTED: O-acyltransferase WSD1-like [Fragaria vesca subsp. 
vesca]
Length=502

 Score =   189 bits (479),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 133/438 (30%), Positives = 219/438 (50%), Gaps = 39/438 (9%)
 Frame = +3

Query  309   LPINPRFSSIMVTGKN--GEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKIS  482
             LP++PRFSSIMV  +N  G+K W  V V +EDH+ VP   +   +E  D  + +Y++ ++
Sbjct  61    LPMHPRFSSIMVKDRNLCGKKRWIQVSVNMEDHVIVP--NMDSDMEDADKFVRDYISHLT  118

Query  483   MDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPL  659
               P   ++PLWE+HI    TS+A    + ++H S+GDG SLM  LL+C ++  +P ALP 
Sbjct  119   TSPLDLSKPLWEVHIVNVKTSDAEAVVVIRIHHSMGDGASLMSLLLACTRKTSDPDALP-  177

Query  660   TFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVV---DTVTDFSWNFLKSSLLDDDKTAI  830
             + P ++   K QG +S+ ++  +  +  + S V    +T  D          L D KT I
Sbjct  178   SVPNQR---KHQGSSSSDLSVFWWLLLAIWSAVTLIGNTFVDLVLFVATILFLKDTKTPI  234

Query  831   HSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYM--QESERET  1004
                  GVE         T SL H+KQ+K+++N+TINDV+ G+   G   Y+  +  E E 
Sbjct  235   KGP-PGVELTAKRFLHRTVSLDHIKQVKNAMNMTINDVVLGVTQAGLSQYLNYKYGENEK  293

Query  1005  CNG------------ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAI  1142
               G               A +L N R+   G + +++M+   ++  WGNRI +  +PF I
Sbjct  294   DEGAKKKGNNLPKSIRLRANILVNLRS-AAGIQDLADMMAKKSKTKWGNRIGYVLVPFII  352

Query  1143  PKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRT  1322
                         +PL ++  A   + R+++S   + T        KL G +       R 
Sbjct  353   --------ALQDDPLDYVRGAKSHLDRKKHSLEAFCTYLCANVLTKLIGAKGAGAVAHRV  404

Query  1323  LKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDF  1502
             L N+++  TN+IGP+E+ +   HPV  +   V G P +L +   SY  K+ +++  + + 
Sbjct  405   LCNSTLAFTNLIGPLEEISYYGHPVTYIAPNVYGHPHALHIHFQSYVDKMTISLAVDPNV  464

Query  1503  I-DVKKLKSCIESAFDEI  1553
             I D +KL   +E +   I
Sbjct  465   IPDPEKLLDDLEESLQLI  482



>ref|XP_010482729.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=491

 Score =   186 bits (471),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 134/473 (28%), Positives = 238/473 (50%), Gaps = 36/473 (8%)
 Frame = +3

Query  132   TTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFL  311
             T ME+ +E +      P SP S+  NS   + +II  +   V  + +   I+  ++   +
Sbjct  9     TVMETVVEEE------PLSPCSRLFNSPDFNCAIIVTMGCRV--KGNTPAIIDGLKRTLV  60

Query  312   PINPRFSSI--MVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISM  485
               +PRFSSI  M  GK G+  W   KV +EDH+ VP   +   +E  D  L +Y++K++ 
Sbjct  61    N-HPRFSSILEMNNGKKGKPCWVRTKVKVEDHVIVP--EIDPKIENPDQYLEDYISKLTT  117

Query  486   DPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLT  662
              P   ++PLWEIHI    TSNA    + K+H SLGDG SLM   L+C ++  NP ALP  
Sbjct  118   IPMDLSKPLWEIHIIHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNPEALPTV  177

Query  663   FPRRQGSGKKQGEN-SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQ  839
               +++  G        N +   F  +  ++  + +T  D     L   L+ D +T + ++
Sbjct  178   AVQKKRFGPICNSGFFNKIWWLFVGLWFIIRLLFNTFVDILMFALTIFLVRDTETPLLAK  237

Query  840   DDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQESE---  995
               G EF P        S   +K +K++L +T+NDV+ G+   G     +R Y QE+    
Sbjct  238   -PGSEFNPKRFVHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATPKL  296

Query  996   RETCNG-ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGD  1166
             +E+       + ++ N R    G +++++M+   ++  WGN   +  LPF++        
Sbjct  297   KESMRRIRLRSAIMINLRP-NAGIEALADMMAKKSKCRWGNLFGYILLPFSV--------  347

Query  1167  GDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITM  1346
             G  ++PL ++  A   + R+++S     +  F +   K+ GL+A+   +R+ + +T++T 
Sbjct  348   GLETDPLEYVRRAKSTIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLTF  407

Query  1347  TNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             +N++GP E+ T   HP+  +   V G P +L +   SYA K+ +++ ++   I
Sbjct  408   SNVVGPKEEITFHGHPLSYIAPCVFGHPYALTIHFQSYANKVIISVTADPTVI  460



>ref|XP_010095758.1| O-acyltransferase WSD1 [Morus notabilis]
 gb|EXB62178.1| O-acyltransferase WSD1 [Morus notabilis]
Length=508

 Score =   185 bits (470),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 142/510 (28%), Positives = 244/510 (48%), Gaps = 38/510 (7%)
 Frame = +3

Query  87    KGTTIRK-KLSSIQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPI  263
             +G   RK  L +I+ K      +   +  +  P SP  +  +    +  +IA++ S   I
Sbjct  5     EGIRWRKPALKAIETKVKKSKGIIDHEGELEEPVSPAGRMFHEPNFNVHVIAIMGSKYKI  64

Query  264   EDDDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEF  443
             + D  V  +      L  +PRFSS++V    G+  W   +V L+ H+ VP   +   +E 
Sbjct  65    QPD--VAKANAPKTLLK-HPRFSSLLVVDDEGKMKWVRTEVDLDKHVIVPDIDIPN-IES  120

Query  444   YDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLS  623
              D  + +Y+  ++     +++PLWEIHI    TS+A G  IF++H SLGDG SLM  LL+
Sbjct  121   PDKFVEDYIYNLTKTSLDKSKPLWEIHILNLKTSDAEGVGIFRIHHSLGDGTSLMSLLLA  180

Query  624   CLQRADNP-ALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKS  800
             C ++  NP ALP T P+ +   +K G    + ++ F  V  LL    +T+ D  + F+ +
Sbjct  181   CTRQVANPDALP-TLPKHKKKDEKGG-FIRSFSQCFFGVWWLLGLFWNTMVDV-FMFMAT  237

Query  801   SL-LDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRL  977
             SL L D  T I +  D V   P  +   T SL  +K +K+++N+TINDV  GI   G   
Sbjct  238   SLFLKDTATPITAPPDSVR-NPRRIVHKTVSLDDMKLVKNAMNMTINDVAVGITQAGLSK  296

Query  978   YMQESERETCNGECTA---------------LVLFNTRAMGGGYKSVSEMIKPNAEMPWG  1112
             Y+     E  N +  A               ++L N R    G + +++M++ NAE  WG
Sbjct  297   YLNRRYGEKNNNDKGATESKNNLPKNIRLRSVLLINIRP-SAGIQELADMMEKNAEAKWG  355

Query  1113  NRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLR  1286
             N + +  LPF I        G   +PL +I  A   + R+++S  +  T        ++ 
Sbjct  356   NWVGYILLPFDI--------GLRDDPLEYIRRAKNTIDRKKHSLEVLATSAIANLLLRVL  407

Query  1287  GLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAG  1466
             G++  +    R   NT+   +N+ GP+E+  +  H ++ +     G P +L++   SY  
Sbjct  408   GIKRASAQSHRIFSNTTFVFSNLTGPLEEIGIYGHELEYLAPTSYGQPHALMINFQSYVN  467

Query  1467  KLRLTI-ISEKDFIDVKKLKSCIESAFDEI  1553
             ++ + + + E+ + D  KL   I  +  ++
Sbjct  468   RMTIVLSVDERVYPDPYKLCDDIAESLKQV  497



>ref|XP_006852653.1| hypothetical protein AMTR_s00021p00243800 [Amborella trichopoda]
 gb|ERN14120.1| hypothetical protein AMTR_s00021p00243800 [Amborella trichopoda]
Length=473

 Score =   184 bits (468),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 129/458 (28%), Positives = 227/458 (50%), Gaps = 31/458 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP ++     + + SI+ +L     + D ++V+    R   +  +PRFSSI+    +G
Sbjct  8     PLSPAARLFKQPLFNCSILCMLGLGKKVTDIEAVMAGLERT--MARHPRFSSIVKEDSSG  65

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             ++ W    V++EDH+    F   +     D  + +Y+TK+S  P   ++PLWE+HI    
Sbjct  66    KQQWVRTNVVMEDHIITQPFDEDQEANGAD-LIDQYITKLSTTPLDMSKPLWELHILNLK  124

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGENSNAV  716
             T  A    IF++H SLGDG SLM  L++C ++  +P +LP + P+R+   +K  EN + +
Sbjct  125   TDEAEATAIFRIHHSLGDGISLMSLLMACTRKTSDPDSLP-SVPQRK---EKPLENRSGL  180

Query  717   ARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLY  896
                   +  +   +  T+ D       +  L D  T I     GVE  P  V  +T SL 
Sbjct  181   LSILSRIWVIFLTIWYTLMDLLLFIPNTLFLKDTDTPIKGL-PGVEKSPKKVVHLTLSLD  239

Query  897   HLKQIKSSLNVTINDVISGIVTYGTRLYMQ---ESERETCNGECT-----------ALVL  1034
              +K++K  +N T+NDV+ GI + G   Y+    E  +E  NG+             + +L
Sbjct  240   DMKKMKYHVNGTLNDVMLGITSAGLVKYLARRYELSKENHNGKTEKPSFPQNIHIRSSLL  299

Query  1035  FNTRAMGGGYKSVSEMIKPNAEMP-WGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHR  1211
              N R+   G   ++EM+K  ++   WGNR+ +L F +P LR       ++PL +   A  
Sbjct  300   VNLRS-APGLHELAEMMKDKSKKARWGNRMGYLVFKMPMLR------HTDPLEYFREAKA  352

Query  1212  MVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANH  1391
             ++ R++ S   ++T    +   +L G+++ A+ +   L NT+ + +N++GP E+      
Sbjct  353   IIDRKKMSFEPFITYFIGKLVVRLFGIKSAARMMHTALSNTTFSFSNVMGPTEEVEFLGL  412

Query  1392  PVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             P+  +   V G P +L +   SY  K++L I   ++ I
Sbjct  413   PIVFIAPTVYGHPHALTIHYQSYTNKVKLVICVAEETI  450



>gb|KGN43652.1| hypothetical protein Csa_7G051320 [Cucumis sativus]
Length=175

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 120/170 (71%), Gaps = 3/170 (2%)
 Frame = +3

Query  1050  MGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQR  1229
             M G YKSV +M+KPN+  PWGNR+  L   IPKL    D + SNP++FI  A +++KR+R
Sbjct  1     MFGNYKSVEDMLKPNSNAPWGNRLALLLIDIPKLT---DYELSNPIQFIKAAQKLIKRKR  57

Query  1230  YSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMY  1409
             YS + +L  + +E   KL+G E  A+++ + ++N+S++++NMIGP EK  L  HP KG+Y
Sbjct  58    YSYATFLLDKLMEMVHKLKGPEVAAKYMYKMVRNSSLSISNMIGPKEKMALLGHPAKGVY  117

Query  1410  FAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIFR  1559
             F + G PQSL++TM+SY   LR+   SEK+FID +KL SC+++AF+ +++
Sbjct  118   FILFGIPQSLIITMVSYMENLRIAFGSEKEFIDQEKLTSCMKTAFEHMYK  167



>ref|XP_008246217.1| PREDICTED: uncharacterized protein LOC103344399, partial [Prunus 
mume]
Length=154

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 111/160 (69%), Gaps = 6/160 (4%)
 Frame = +3

Query  954   IVTYGTRLYMQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLP  1133
             ++ +GTRLYMQE ++ +   +CTA+VL NTR MG  Y  + EMIKPN++MPWGNR TFL 
Sbjct  1     MIFFGTRLYMQEIDQSSSTADCTAMVLLNTRIMGD-YMPIEEMIKPNSKMPWGNRFTFLQ  59

Query  1134  FAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFL  1313
               IPKL    + D      FI N H+M+K++R S ++Y T + LE   K    EA+++++
Sbjct  60    VPIPKLTELSNADD-----FIRNTHKMIKKKRNSLAVYFTSRLLEIVNKFGSHEASSRYI  114

Query  1314  RRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQ  1433
              RTLKN+S+ ++NMIGPVE+ +LANHP+KG YF V G PQ
Sbjct  115   HRTLKNSSMVISNMIGPVEQMSLANHPIKGFYFLVPGLPQ  154



>ref|XP_010426423.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=523

 Score =   185 bits (469),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 146/510 (29%), Positives = 252/510 (49%), Gaps = 40/510 (8%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E +DE    P SP ++  ++   + +II+V+ S   I+ D  VI+   +  F+  +PRFS
Sbjct  13    EKEDE---QPLSPAARLFHAPEFNCNIISVIGSKSKIDPD--VIIRGFQQTFIR-HPRFS  66

Query  333   SIMVT-GKNGE-KNWKPVKVILEDHLKVP-IFPVGKPLEFYDYCLSEYLTKISMDPFPQT  503
             S +V+ G NG+ + W    V++EDH+ VP I P  + +E  D  L +Y++ +   P   +
Sbjct  67    SKLVSDGDNGQNQRWVRTNVVVEDHVIVPEIKP--QNIENTDAFLEDYVSDLMKIPLDTS  124

Query  504   QPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP----ALPLTFPR  671
             +PLWE+HI    TS+A    +FK+H S+GDG S+M  +L+C+++  NP    +LP     
Sbjct  125   KPLWEVHILDLKTSDAENVAVFKVHHSVGDGMSMMSLVLACMRKTSNPDELPSLPYQKRS  184

Query  672   RQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDF--SWNFLKSSL-LDDDKTAIHSQD  842
                        S   +R    V  L   V+  +  F  S + L + L + D +T I    
Sbjct  185   SSSGSSLLTTGSRGDSRLLWLVKLLWMAVILGLNTFCDSLDILLTMLFVKDTETPIKGDF  244

Query  843   DGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE--SERETCNGE  1016
                + + + +   T SL  +K IK+++++T+NDV+ G+       Y++    E+ET    
Sbjct  245   RSSKSKQLRLVHRTVSLDDIKLIKNAMDMTVNDVVLGVTQASLSRYLERRYGEKETKRKP  304

Query  1017  CTAL--------VLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFL--PFAIPKLRSPGD  1166
                L        +L N R   G  + +++M++  ++  WGNR  ++  PF+I  LR+   
Sbjct  305   KNLLKRIRLRSALLVNLRPTTG-IQDLADMMEKGSKCWWGNRFGYVVFPFSIA-LRN---  359

Query  1167  GDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITM  1346
                 +PL  +  AH+ + R++ S    LT  F     K  G+E  A  + R + NT++T 
Sbjct  360   ----DPLEHLKTAHKTINRKKNSFGAMLTYVFCRIIVKSLGIEVAATIINRLMSNTTMTF  415

Query  1347  TNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLK  1523
             +NM+GPVE+ +   HP+  +  +  G P +L +   SY  K+ +T++ +   I D  +L 
Sbjct  416   SNMVGPVEEVSFYGHPITYIASSAYGHPHALTIHCQSYMNKMTITLLVDPTVISDPHQLC  475

Query  1524  SCIESAFDEIFRLTLKSSPPRA*IYIHIYS  1613
                E +   I     K   PR   Y+ + S
Sbjct  476   DDWEESLRSIKAAVHKRGSPRLWDYLRLLS  505



>ref|XP_002877655.1| condensation domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53914.1| condensation domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=521

 Score =   184 bits (468),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 136/485 (28%), Positives = 251/485 (52%), Gaps = 42/485 (9%)
 Frame = +3

Query  120   IQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIR  299
             +++KT  + H+  +++    P SP ++  +S   + +II+V+   +  + D  VI+   +
Sbjct  1     MEIKT--QRHISENEKEEEQPLSPAARLFHSPEFNCNIISVI--GLKSKLDPCVIIRGFK  56

Query  300   DVFLPINPRFSSIMVTGKNGE-KNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTK  476
             + F+  +PRFSS +VT +NG+ + W    V++EDH+ VP   + + +E  D  L +Y++ 
Sbjct  57    ETFIR-HPRFSSKLVTDENGQNQRWVRTNVVVEDHVIVPEIKL-QNIENTDSFLEDYVSD  114

Query  477   ISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP---  647
             +   P   ++PLWE+H+    TS+A    + K+H S+GDG S+M  +L+C+++  NP   
Sbjct  115   LMKIPLDISRPLWELHLLDLKTSDAENVAVLKIHHSVGDGMSIMSLVLACMRKTSNPDEL  174

Query  648   -ALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVV---DTVTDFSWNFLKSSL-LD  812
              +LP  + R           S + +R    V  L + V+   +T+ D +  F+ ++L + 
Sbjct  175   PSLPYQY-RSSSGSSLLTTGSRSDSRLLWLVKVLWTAVILGLNTICD-TLEFIVTTLFVK  232

Query  813   DDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE-  989
             D +T I       + + + +   T SL  +K IK+++N+T+NDV+ G+       Y++  
Sbjct  233   DTETPIKGDFRSTKSKRLRLVHRTVSLDDIKLIKNAMNMTVNDVVLGVTQASLSQYLERR  292

Query  990   -SERETCNGE--------CTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFL--PF  1136
               ERET              + +L N R    G + +++M++  ++  WGN   ++  PF
Sbjct  293   YGERETKRKRKNLPKRIRLRSALLVNLRP-TTGIQDIADMMENGSKCRWGNWFGYIVFPF  351

Query  1137  AIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLR  1316
             +I  LR        +PL  +  A +++ R++ S    LT  F     K  G++  A  + 
Sbjct  352   SIA-LRD-------DPLEHLKRAQKIITRKKNSFGAMLTYIFCRIIVKFLGIQLAATIIN  403

Query  1317  RTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS--GAPQSLVVTMLSYAGKLRLTIIS  1490
             R + NT++T +NM+GPVE+ +   HP+   YFA S  G P +L +   SY  K+ +T+I 
Sbjct  404   RMVSNTTMTFSNMVGPVEQVSFYGHPIT--YFASSGYGHPHALTINCQSYMNKMTITLIV  461

Query  1491  EKDFI  1505
             +   I
Sbjct  462   DSTVI  466



>ref|XP_010445768.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=491

 Score =   184 bits (466),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 133/473 (28%), Positives = 237/473 (50%), Gaps = 36/473 (8%)
 Frame = +3

Query  132   TTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFL  311
             T ME+ +E +      P SP S+  NS   + +II  +   V  + +   I+  ++   +
Sbjct  9     TVMETVVEEE------PLSPCSRLFNSPDFNCAIIVTMGCRV--KGNTPAIIDGLKRTLV  60

Query  312   PINPRFSSI--MVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISM  485
               +PRFSSI  M  GK G+  W   KV +EDH+ VP   +   +E  D  L +Y++K++ 
Sbjct  61    N-HPRFSSILEMNNGKKGKPCWVRTKVKVEDHVIVP--EIDPKIENPDQYLEDYISKLTT  117

Query  486   DPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADN-PALPLT  662
              P   ++PLWEIHI    TSNA    + K+H SLGDG SLM   L+C ++  N  ALP  
Sbjct  118   IPMDLSKPLWEIHIIHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNLEALPTV  177

Query  663   FPRRQGSGKKQGEN-SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQ  839
               +++  G        N +   F  +  ++  + +T  D     L   L+ D +T + ++
Sbjct  178   AVQKKRFGPSCNSGFFNKIWWLFVGLWFIIRLLFNTFVDILMFALTIFLVRDTETPLLAK  237

Query  840   DDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQESE---  995
               G EF P        S   +K +K++L +T+NDV+ G+   G     +R Y QE+    
Sbjct  238   -PGSEFNPKRFVHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATPKL  296

Query  996   RETCNG-ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGD  1166
             +E+       + ++ N R    G +++++M+   ++  WGN   +  LPF++        
Sbjct  297   KESMRRIRLRSAIMINLRP-NAGIEALADMMAKKSKCRWGNLFGYILLPFSV--------  347

Query  1167  GDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITM  1346
             G  ++PL ++  A   + R+++S     +  F +   K+ GL+A+   +R+ + +T++T 
Sbjct  348   GLETDPLEYVRRAKATIDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLTF  407

Query  1347  TNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             +N++GP E+ T   HP+  +   V G P +L +   SYA K+ +++ ++   I
Sbjct  408   SNVVGPKEEITFHGHPLSYIAPCVFGHPHALTIHFQSYANKVIISVTADPTVI  460



>emb|CDY47071.1| BnaA03g12270D [Brassica napus]
Length=490

 Score =   184 bits (466),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 129/459 (28%), Positives = 230/459 (50%), Gaps = 32/459 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV----T  347
             P SP S+  NS   + +II ++   V  + +   I+  ++   +  +PRFSSI++     
Sbjct  16    PLSPCSRLFNSPDFNCAIIVIMGCKV--KGNPPAIIDGLKHTLVN-HPRFSSILIQEMKN  72

Query  348   GKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHI  527
             GK G+ +W   +V +EDH+ VP   +   +E  D  L  Y++K++  P   ++PLWEIH+
Sbjct  73    GKKGKPSWVRTEVRVEDHVIVP--DIDPNIENPDQYLEHYISKLTTVPMDFSKPLWEIHL  130

Query  528   FRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALP-LTFPRRQGSGKKQGE  701
                 TSNA    + K+H SLGDG SLM   L+C ++  +P ALP ++  R+Q        
Sbjct  131   LCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKTSDPEALPTVSVQRKQFGPSSYNG  190

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
               N +   F  +  +L  V +T  D     L    L D +T + ++  G E  P      
Sbjct  191   FFNKIWWLFVGLRFILRLVFNTFVDVLMFALTICFLRDTETPLLAKP-GTELVPKRFVHR  249

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQE----SERETCNGECTALVL  1034
               S   +K +K+++ +T+NDV+ G+   G     +R Y QE    S+         + ++
Sbjct  250   IISFDDVKLVKNAMKLTVNDVLLGVTQAGLSRYLSRRYDQEATPKSKESMRKFRLRSAIM  309

Query  1035  FNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAH  1208
              N R    G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A 
Sbjct  310   INLRP-NTGIEALADMMAKKSKCRWGNLFGYILLPFSV--------GLETDPLEYVRRAK  360

Query  1209  RMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLAN  1388
               V R+++S     +  F +   K+ GL+A+   +R+ + NT++T +N++GP E+ T   
Sbjct  361   VTVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHNTTLTFSNVVGPKEEITFHG  420

Query  1389  HPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             HP+  +  +V G P +L V   SY  K+ +++ ++   I
Sbjct  421   HPLSYIAPSVFGHPHALTVHFQSYEKKVIISVTADPTVI  459



>ref|XP_010503567.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=520

 Score =   184 bits (467),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 141/514 (27%), Positives = 256/514 (50%), Gaps = 35/514 (7%)
 Frame = +3

Query  132   TTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFL  311
             TT  + LEG+ E    P SP ++  ++   + +II+V+   +  + D  VI+   +  F+
Sbjct  4     TTRRNILEGEKEDE-QPLSPAARLFHAPEFNCNIISVI--GIKSKMDPDVIMRGFKQTFI  60

Query  312   PINPRFSSIMVTGKNGE---KNWKPVKVILEDHLKVP-IFPVGKPLEFYDYCLSEYLTKI  479
               +PRFSS +V+ +  +   + W    V++E+H+ VP I P  + +E  D  L +Y++ +
Sbjct  61    R-HPRFSSKLVSERWRQWTNQRWVRTDVVVEEHVIVPEIKP--QNIENTDAFLEDYVSDL  117

Query  480   SMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPL  659
                P   ++PLWE+HI    TS+A    +FK+H S+GDG S+M  +L+C+++  NP    
Sbjct  118   MKIPLDTSRPLWELHILDLKTSDAENVAVFKIHHSVGDGMSIMSLVLACMRKTSNPDELP  177

Query  660   TFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVV---DTVTDFSWNFLKSSLLDDDKTAI  830
             + P ++ S       + + +R    V  L + V+   +TV D     + +  + D +T I
Sbjct  178   SLPYQKRSSSLLTTATRSDSRLLWLVKLLWTAVILGLNTVCDVLEFLVTTLFVKDTETPI  237

Query  831   HSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQ------ES  992
                    +   + +   T SL  +K IK+++N+TIN V+ G+       Y++      E+
Sbjct  238   KGDFRSKKSEQLRLVHRTVSLDDIKLIKNAMNMTINGVVLGVTQASLSRYLERRYGEDET  297

Query  993   ERETCNG----ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFL--PFAIPKLR  1154
             +R+  N        + +L N R    G + +++M++  ++  WGNR  +L  PF+I  LR
Sbjct  298   KRKPKNLLKRIRLRSALLVNLRP-TTGIQDLADMMEKGSKCWWGNRFGYLVFPFSIA-LR  355

Query  1155  SPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNT  1334
             +       +PL  +  AH+ + R++ S    LT  F     K  G+E  A  + R + NT
Sbjct  356   N-------DPLEHLKTAHKTINRKKNSFGAMLTYVFCRIIVKSLGIEVAATIINRLMSNT  408

Query  1335  SITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DV  1511
             ++T +NM+GPVE+ +   HP+  +  +  G P +L +   SY  K+ +T++ +   I D 
Sbjct  409   TMTFSNMVGPVEEVSFYGHPITCIASSAYGHPHALTIHCQSYMNKMTITLLVDPTVISDP  468

Query  1512  KKLKSCIESAFDEIFRLTLKSSPPRA*IYIHIYS  1613
             ++L    E +   I     K   P    Y+ + S
Sbjct  469   QRLCEDWEESLRSIKAAVHKRGSPLLWDYLRLLS  502



>ref|XP_009766774.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana sylvestris]
Length=514

 Score =   184 bits (466),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 139/456 (30%), Positives = 224/456 (49%), Gaps = 44/456 (10%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI-MVTGKN  356
             PASP ++  ++  LS  IIA+L  +  I  D  +I   +    L  +PRF+SI +V  K 
Sbjct  46    PASPATRLFHTKSLSCHIIAILGCTTKINVD--LIKKGLESTLLN-HPRFTSIPVVDEKK  102

Query  357   GEKNWKPVKVILEDHLKVPIFP--VGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
             G + WK   V + +H+  P     +  P EF    +  Y + ++  P   T+PLWE+HI 
Sbjct  103   GVRKWKQTTVNVGNHMVCPDLDPDMDSPDEF----IENYTSSLTTIPMDMTKPLWEVHIL  158

Query  531   RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRA-DNPALPLTFPRRQGSGKKQGENS  707
                TS A    I KLH S+GDG S++  +L+C ++A D+ ALP T P    S KK+  + 
Sbjct  159   NVKTSEAEATGILKLHHSIGDGMSIISLILACTRKASDSEALP-TIPT---SSKKECSDE  214

Query  708   NAVARAFK-AVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMT  884
                 R F  +V  LL    +T+ D    F     L D  T I     GVE  P  +   T
Sbjct  215   AGFCRRFCFSVWFLLMVFWNTLVDAIMFFATVLFLKDTNTPIKG-GAGVEHNPKRLVHRT  273

Query  885   FSLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQESERETC-------NGECTAL  1028
              SL  +K +K++LN+TINDV+ GI   G      R Y  ++ R +        N      
Sbjct  274   ISLDDMKIVKNALNLTINDVVMGIAQAGISRYLNRRYGNKNGRGSSKTNNLPKNIRLRGS  333

Query  1029  VLFNTRAMGGGYKSVSEMIKPNAEMPWGNRI----TFLPFAIPKLRSPGDGDSSNPLRFI  1196
             ++FN R    G K ++EM++  ++  WGN+I    T LP ++P+          NPL +I
Sbjct  334   IVFNIRP-SAGIKVLAEMMEKKSKAKWGNKIGYVLTSLPISLPE----------NPLDYI  382

Query  1197  YNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKT  1376
             + A  ++ +++ S    L+    + T+ + G    A+   R L +T+I ++N++GP E+ 
Sbjct  383   HQAKAIIDKKKLSLESRLSFAAAKLTQDIFGSNVAAKLTNRVLSHTTILLSNVVGPQEEI  442

Query  1377  TLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTI  1484
             T   H +      + G P +L++   SY  K+ +++
Sbjct  443   TFFGHKLAYAAPTICGLPHALIMHFQSYCNKMTISM  478



>ref|XP_009132482.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=490

 Score =   183 bits (465),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 129/459 (28%), Positives = 230/459 (50%), Gaps = 32/459 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMV----T  347
             P SP S+  NS   + +II ++   V  + +   I+  ++   +  +PRFSSI++     
Sbjct  16    PLSPCSRLFNSPDFNCAIIVIMGCKV--KGNPPAIIDGLKHTLVN-HPRFSSILIQEMKN  72

Query  348   GKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHI  527
             GK G+ +W   +V +EDH+ VP   +   +E  D  L  Y++K++  P   ++PLWEIH+
Sbjct  73    GKKGKPSWVRTEVRVEDHVIVP--DIDPNIENPDQYLEHYISKLTTVPMDFSKPLWEIHL  130

Query  528   FRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALP-LTFPRRQGSGKKQGE  701
                 TSNA    + K+H SLGDG SLM   L+C ++  +P ALP ++  R+Q        
Sbjct  131   LCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKTSDPEALPTVSVQRKQFGPSSYNG  190

Query  702   NSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTM  881
               N +   F  +  +L  V +T  D     L    L D +T + ++  G E  P      
Sbjct  191   FFNKIWWLFVGLWFILRLVFNTFVDVLMFALTICFLRDTETPLLAKP-GTELVPKRFVHR  249

Query  882   TFSLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQE----SERETCNGECTALVL  1034
               S   +K +K+++ +T+NDV+ G+   G     +R Y QE    S+         + ++
Sbjct  250   IISFDDVKLVKNAMKLTVNDVLLGVTQAGLSRYLSRRYDQEATPKSKESMRKFRLRSAIM  309

Query  1035  FNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAH  1208
              N R    G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A 
Sbjct  310   INLRP-NTGIEALADMMAKKSKCRWGNLFGYILLPFSV--------GLETDPLEYVRRAK  360

Query  1209  RMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLAN  1388
               V R+++S     +  F +   K+ GL+A+   +R+ + NT++T +N++GP E+ T   
Sbjct  361   VTVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHNTTLTFSNVVGPKEEITFHG  420

Query  1389  HPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             HP+  +  +V G P +L V   SY  K+ +++ ++   I
Sbjct  421   HPLSYIAPSVFGHPHALTVHFQSYEKKVIISVTADPTVI  459



>ref|XP_010048502.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
Length=468

 Score =   182 bits (462),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 144/486 (30%), Positives = 234/486 (48%), Gaps = 44/486 (9%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPI  317
             M S   G DE    P +P  + +    ++  I + +    P++ D   + S I+   +  
Sbjct  1     MGSPENGSDE----PLTPTGRLVLQKEMNLVIYSAIGMKQPLDVD--ALKSMIQSSPMFT  54

Query  318   NPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIF-PVGKPLEFYDYCLSEYLTKISMDP-  491
             +PRF S++V    G ++W+   + ++ H+ +P++ P+ + L   +  ++EYL  +S D  
Sbjct  55    HPRFCSLLVQDSAGREHWRRTCLDIDRHV-IPVYGPIAEGLS-DEAAVNEYLVDLSTDLP  112

Query  492   --FPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLT  662
                   +PLW++H+       A    +F++H +LGDG SLM   L   +R D+P ALP  
Sbjct  113   GFLGDDKPLWDVHLLM-----AQRCMVFRIHHALGDGISLMSMFLVLCRRVDDPEALPTI  167

Query  663   FP-----RRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTA  827
              P     RR+G G   GE   AV R    V   L  VV+ +       L+S  + D KT 
Sbjct  168   RPPSSAKRRRGGG---GEWWKAVMRVLGVVWFTLVFVVEFM-------LRSMWVSDRKTP  217

Query  828   IHSQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTINDVISGIVTYGTRLYM-QESERE  1001
             + S   GVE  P  + T  F L  ++ +KS++ N TINDV+ GI++ G   Y+   S   
Sbjct  218   V-SSGAGVELWPRKLATARFWLEDMRAVKSAVANATINDVLFGIISAGLVKYLDHRSPNA  276

Query  1002  TCNG-ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSS  1178
                G + T + + N R   G  + +S ++K N  + WGN++  L   +   RS GD    
Sbjct  277   VREGTQITGMAMVNLREQPG-LQELSTLMKDNPGLQWGNKVGILLLPVHYHRSCGD----  331

Query  1179  NPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMI  1358
              PL ++  A  M+ R++ S   + + +  E      G  A      R   NT+ T++NM 
Sbjct  332   -PLEYLRKAKSMIDRKKKSLEAHFSYKICEMVMSYPGARAATLLNYRIFCNTTFTISNMF  390

Query  1359  GPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIE  1535
             GP E+     +P+  +   VSG P +L + M+SYAG+  + I   KD I D + L  C E
Sbjct  391   GPHEEIAAVGNPITYIRVNVSGLPHALTLHMVSYAGRADMQIQVAKDIIPDPEFLAECFE  450

Query  1536  SAFDEI  1553
              A  E+
Sbjct  451   DALLEM  456



>ref|XP_010442900.1| PREDICTED: O-acyltransferase WSD1-like [Camelina sativa]
Length=491

 Score =   181 bits (460),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 132/473 (28%), Positives = 236/473 (50%), Gaps = 36/473 (8%)
 Frame = +3

Query  132   TTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFL  311
             T ME+ +E +      P SP S+  NS   + +II  +   V  + +   I+  ++   +
Sbjct  9     TVMETVVEEE------PLSPCSRLFNSPDFNCAIIVTMGCRV--KGNTPAIIDGLKRTLV  60

Query  312   PINPRFSSI--MVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISM  485
               +PRFSSI  M  GK G+  W   KV +EDH+ VP   +   +E  D  L +Y++K++ 
Sbjct  61    N-HPRFSSILEMNNGKKGKPCWVRTKVKVEDHVIVP--EIDPKIENPDQYLEDYISKLTT  117

Query  486   DPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLT  662
              P   ++PLWEIHI    TSNA    + K+H SLGDG SLM   L+C ++  NP ALP  
Sbjct  118   IPMDLSKPLWEIHIIHLKTSNAESIALLKIHHSLGDGMSLMSLFLACTRKTSNPEALPTV  177

Query  663   FPRRQGSGKKQGEN-SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQ  839
               +++  G        N +      +  ++  + +T  D     L   L+ D +T + ++
Sbjct  178   AVQKKRFGPSCNSGFFNKIWWLCVGLWFIIRLLFNTFVDILMFALTIFLVRDTETPLLAK  237

Query  840   DDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQESE---  995
               G E  P        S   +K +K++L +T+NDV+ G+   G     +R Y QE+    
Sbjct  238   -PGSELNPKRFVHRIISFDDVKLVKNALKMTVNDVLLGVTEAGLSRYLSRRYDQEATPKL  296

Query  996   RETCNG-ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGD  1166
             +E+       + ++ N R    G +++++M+   ++  WGN   +  LPF++        
Sbjct  297   KESMRRIRLRSAIMINLRP-NAGIEALADMMAKKSKCRWGNLFGYILLPFSV--------  347

Query  1167  GDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITM  1346
             G  ++PL ++  A   + R+++S     +  F +   K+ GL+A+   +R+ + +T++T 
Sbjct  348   GLETDPLEYVRRAKATIDRKKHSLEAVFSMAFFKLILKVLGLKASVILVRKVIHSTTLTF  407

Query  1347  TNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             +N++GP E+ T   HP+  +   V G P +L +   SYA K+ +++ ++   I
Sbjct  408   SNVVGPKEEITFHGHPLSYIAPCVFGHPHALTIHFQSYANKVIISVTADPTVI  460



>gb|KCW57198.1| hypothetical protein EUGRSUZ_H00013 [Eucalyptus grandis]
Length=198

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 119/179 (66%), Gaps = 2/179 (1%)
 Frame = +3

Query  1020  TALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIY  1199
             TALVL NTR +   YKSV EMI+PN++ PWGN   FL   IPK++ PG+   S+P +F+ 
Sbjct  15    TALVLLNTRNLRD-YKSVGEMIQPNSKSPWGNYFAFLHVPIPKVK-PGNSQFSDPSKFVR  72

Query  1200  NAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTT  1379
               H ++KR+R S  + LTG  LE  +K R  EA A+ + RT  N+S+ ++N++GP+EK +
Sbjct  73    KTHEVIKRKRSSFGVVLTGMLLEMMKKCRNPEAVARHIYRTTTNSSMVISNVMGPMEKLS  132

Query  1380  LANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKKLKSCIESAFDEIF  1556
             LANHP+KGMYF + G P+SL VTM+SYA  LRL + +E+ FID +     +  A D I 
Sbjct  133   LANHPIKGMYFTIVGTPESLQVTMISYAENLRLVVRAEQGFIDSELYTRSLHDALDMIL  191



>ref|XP_009396534.1| PREDICTED: O-acyltransferase WSD1-like [Musa acuminata subsp. 
malaccensis]
Length=515

 Score =   182 bits (461),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 137/512 (27%), Positives = 236/512 (46%), Gaps = 53/512 (10%)
 Frame = +3

Query  90    GTTIRKKLSSIQVKTTMESHLEGDDEVVLA-----------PASPFSQYMNSSVLSFSII  236
             G T RK+   I++     +    ++E V             P SP +Q  +       I+
Sbjct  3     GATPRKRPLPIRIGRRSAASGAAEEETVAGKARAVEEEEEEPLSPAAQLFHQPGFDCCIV  62

Query  237   AVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG--EKNWKPVKVILEDHLKV  410
             A++    P + D  VI S +    +  +PRFSS+ V  ++G  E  W   KV++E+H+ +
Sbjct  63    AIMGLGKPADVD--VIRSGLAATLVR-HPRFSSVPVLEESGGAEPRWVRTKVVVENHIVI  119

Query  411   PIFP-VGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSL  587
             P      +     D  + +Y+  ++  P  +++PLW++H+  +PTS A    + ++H SL
Sbjct  120   PALEDQRRAAASPDQVVEDYVASLTSAPLDRSRPLWDLHVLNFPTSEAAAVAVLRVHHSL  179

Query  588   GDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDT  767
             GDG SLM  LL+C ++A +P    T P +  S +           AF  +  L + ++  
Sbjct  180   GDGTSLMSLLLACTRKASDPHSLPTIPHQ--SRRPLVSRKLHAGGAFTLLLWLWAFLI--  235

Query  768   VTDFSWN-------FLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLN  926
                 +WN       F  +S    D T   +   GVE+ P  +   T SL  +K +K++++
Sbjct  236   ---LAWNTLLDVLRFTATSAFSKDTTTPLTGPKGVEYHPKRIVHRTVSLDDIKDVKNAMH  292

Query  927   VTINDVISGIVTYGTRLYMQESERETCN--GECTAL---------VLFNTRAMGGGYKSV  1073
              T+NDV+ G+ + G   Y+     +  +  G+ T L         +L N R   G +   
Sbjct  293   CTVNDVLVGVTSAGLSRYLSRRYGQNVDEHGKKTQLPSNIRLQSTLLVNIRPSPGVHALA  352

Query  1074  SEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLY  1247
               M   ++   WGN I +  LPF+I K + P D        +I     +  R++ S    
Sbjct  353   ELMEGRHSGTKWGNYIGYIILPFSIFKYKDPMD--------YIRKGKEIAGRKKNSLEAI  404

Query  1248  LTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGA  1427
              T +  E   K  G++A A    R L NT+++ +NMIGPVE+    +HP+  +  +V G 
Sbjct  405   FTYKSGELIVKCLGIKAGAALCHRVLSNTTLSFSNMIGPVEEVAFYDHPIVYLAPSVYGH  464

Query  1428  PQSLVVTMLSYAGKLRLTI-ISEKDFIDVKKL  1520
             PQ+L V   SY   +++ + + +K   D  +L
Sbjct  465   PQALTVHFQSYMNMMKMVVTVDDKVIPDAHQL  496



>ref|XP_004230765.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum]
Length=462

 Score =   180 bits (457),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 129/446 (29%), Positives = 217/446 (49%), Gaps = 26/446 (6%)
 Frame = +3

Query  240   VLESSVPIED--DDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVP  413
             ++  +V ++D  D   +  EI +  L  +PRFSSIM+    G + W+  +V ++DH  + 
Sbjct  25    IINCAVSVDDPIDVDAVKLEISNSILVKHPRFSSIMLKDTCGRERWRKTEVNVDDHFIIR  84

Query  414   IFPVGKPLEFYDY-CLSEYLTKISMD-PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSL  587
               P+       D   +++YL  + +  P   T+PLWE H+       A    + +LH +L
Sbjct  85    HEPLTDDPSIADEDAVNDYLADLCVSTPLSLTKPLWEFHLLL-----AHNWAVLRLHHAL  139

Query  588   GDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDT  767
             GDG SLM   +SC +RAD+P      P   G G     N+  V    K +  ++   +  
Sbjct  140   GDGISLMSMFMSCCRRADDPN---QRPTTHGIGTSSSSNNLNVWSLLKKLVMVIWYTLVY  196

Query  768   VTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTINDV  944
             VT+F    L+S  L D KTAI S   GVE  P  + T  F +  +K +K ++ N TINDV
Sbjct  197   VTEFG---LRSLWLKDKKTAI-SGGAGVELWPRKLATAKFKIDDMKTVKKAIDNATINDV  252

Query  945   ISGIVTYGTRLYMQ-ESERETCNG-ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNR  1118
             + G++++G   Y+   S + T  G + T + + N R   G  +  SE++K  +   WGN+
Sbjct  253   LFGVISFGLSRYLDLRSPKATKEGLQMTGVAMINLRKQSG-LQDFSELMKSKSGARWGNK  311

Query  1119  ITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEA  1298
                L   +P     G    S+PL+F+  A  M+ +++ S     + +  +    + G + 
Sbjct  312   FGML--LLPVYYHKG---GSDPLQFVKRAKAMIDKKKLSLEGPCSYKIGDLIMSIFGAKL  366

Query  1299  TAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRL  1478
                   R + NT+ T++N+IGP E  T   + +  +    +    ++ + M+SYAG+  +
Sbjct  367   ATLLNYRIISNTTFTISNVIGPAEDITFGGNRISSVRVTSTALSHAITMHMVSYAGRAGM  426

Query  1479  TIISEKDFI-DVKKLKSCIESAFDEI  1553
              I+  KD I D K L  C + A  E+
Sbjct  427   QILVAKDIIPDPKVLAKCFQDALLEM  452



>ref|XP_009601405.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=514

 Score =   181 bits (460),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 143/472 (30%), Positives = 227/472 (48%), Gaps = 58/472 (12%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E   +V L PASP ++  ++  LS  IIA+L  +  I  D  +I   +    L  +PRF+
Sbjct  37    EQKKQVQLEPASPATRLFHTKSLSCHIIAILGCTTKINVD--LIKKGLESTLLN-HPRFT  93

Query  333   SI-MVTGKNGEKNWKPVKVILEDHLKVPIFP--VGKPLEFYDYCLSEYLTKISMDPFPQT  503
             SI +V  K G + WK   V + +H+  P     +  P EF +     Y + ++  P   T
Sbjct  94    SIPVVDEKKGVRKWKQTTVNVGNHMVCPDLDPDMDSPDEFVE----NYTSSLTTIPMDMT  149

Query  504   QPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQG  680
             +PLWE+HI    TS A    I KLH S+GDG S++  +L+C ++A +P ALP T P   G
Sbjct  150   KPLWEVHILNVKTSEAEATGILKLHHSIGDGMSIISLILACTRKASDPEALP-TIP--TG  206

Query  681   SGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWN-------FLKSSL-LDDDKTAIHS  836
             S KK+  +     R F     +LS V        WN       FL + L L D +T I  
Sbjct  207   S-KKESSDEAGFCRRFCFSVWVLSMVF-------WNTFVDAILFLATILFLKDTETPIKG  258

Query  837   QDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQESERE  1001
                GVE  P  +   T SL  +K +K++LN+TINDV+ GI   G      R Y  +  R 
Sbjct  259   -GAGVEHNPKRLVHRTISLDDMKIVKNALNLTINDVVMGIAQAGISRYLNRRYGNKKGRG  317

Query  1002  TC-------NGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF----LPFAIPK  1148
             +        N      ++FN R    G K ++EM++  ++  WGN+I +    LP ++P 
Sbjct  318   SSKTNNLPKNIRLRGSIVFNIRP-SAGIKVLAEMMEKKSKAKWGNKIGYVLTPLPISLP-  375

Query  1149  LRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLK  1328
                       NPL +I+ A  ++ ++  S     +    + T+ + G    A+   R L 
Sbjct  376   ---------DNPLDYIHQAKAIIDKKNLSLESRFSFAAAKLTQDIFGSNVAAKLTNRVLS  426

Query  1329  NTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTI  1484
             +T+I ++N++GP E+ T   H +      + G P +L++   SY  K+ +++
Sbjct  427   HTTILLSNVVGPQEEITFFGHKLAYAAPTICGLPHALIMHFQSYCNKMTISM  478



>gb|EMS49019.1| O-acyltransferase WSD1 [Triticum urartu]
Length=498

 Score =   180 bits (457),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 145/506 (29%), Positives = 237/506 (47%), Gaps = 40/506 (8%)
 Frame = +3

Query  87    KGTTIRKKLSSIQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIE  266
             + TT+RK+  SI+     E     + E+   P SP ++     V  F II ++ +S P+ 
Sbjct  2     EATTLRKRPLSIKTAAGREGRTAAEAELG-EPVSPSARL----VEDFYIIVLMGASTPLN  56

Query  267   DDDSVILSEIR---DVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPL  437
                   L  +R   +  L   P F SI VT K+GE  W P  V +E+HL  P        
Sbjct  57    ------LPALRAGIEAQLARYPHFRSIQVTDKDGELRWAPTTVNVENHLIRPTLDPAAVA  110

Query  438   EFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGAL  617
                D  + +Y+  +S  P  ++QPLWE H+F +PTS A      ++H SLGDG SL+  L
Sbjct  111   ANPDKAVEDYVASLSTLPMDRSQPLWEFHLFDFPTSEATSTAAIRVHHSLGDGMSLLTLL  170

Query  618   LSCLQRADN----PALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSW  785
             ++C + A +    PA+P   P R G+  ++   S  V      V   +     TV D + 
Sbjct  171   MACTRSAADPTRLPAIP-PLPSRTGAIYQRPRPSAGVLAYLLWVWSFVVLAWHTVVDVA-  228

Query  786   NFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTY  965
              F  + L   D   +  + +  E +   +     SL  +K +K+++  T+NDV+ G VTY
Sbjct  229   GFFATILFLKDPHTLFKRVNHAETQRKRIVHRRLSLDDVKFVKNAMKCTVNDVLIG-VTY  287

Query  966   G--TRLYMQESERETCNGE---CTALVLFNTRAMGGGYKSVSEMIKPNAE--MPWGNRIT  1124
                +R + ++S  ET   +     +++L N R     +  V +MIK   E  + WGN + 
Sbjct  288   AALSRYHFRKSGGETDTRKEIRVRSMLLVNLRPTTSLHACV-DMIKSGKESHVKWGNELG  346

Query  1125  F--LPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEA  1298
             F  LPF I        G  S+PL ++    ++V R++ S  +  T    E   K+ GL+A
Sbjct  347   FIILPFFI--------GMHSDPLDYVRKGKKVVDRKKSSLEVVFTHVAAEVIFKVFGLKA  398

Query  1299  TAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRL  1478
              +    R + +T+I+  NM GPVE+     HP+  +  +  G P++L V   SY   + +
Sbjct  399   ASAIFHRMISHTTISFANMTGPVEQVEFCGHPIVFIAPSGYGPPEALTVNYQSYVNTIMI  458

Query  1479  TI-ISEKDFIDVKKLKSCIESAFDEI  1553
              + + E  F D  +L      + ++I
Sbjct  459   NLALDEGHFPDYDELLDDFVESLEDI  484



>ref|XP_010537088.1| PREDICTED: O-acyltransferase WSD1 isoform X1 [Tarenaya hassleriana]
Length=477

 Score =   180 bits (456),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 133/473 (28%), Positives = 230/473 (49%), Gaps = 31/473 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI--MVTGK  353
             P SP S+  NS   + SII  L        + + I+  +++  +  +PRFSS   M  G 
Sbjct  7     PLSPGSRLFNSPEFNCSIIVTLGCKT--RGNPNAIIDGLKNTLIN-HPRFSSKLEMNRGN  63

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
              G+  W   KV +EDH+ VP   +   +E  D  L +Y++ ++  P   ++PLWEIH+F 
Sbjct  64    GGKPTWVRTKVRVEDHVVVP--DIDPDMEEPDKFLEDYISNLTTLPMDMSKPLWEIHLFN  121

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGENSN  710
               TS+A    + K+H SLGDG SLM   L+C ++  NP ALP    +++  G     NS 
Sbjct  122   LKTSDAESVGVLKIHHSLGDGMSLMSLFLACTRKTSNPEALPTIASKKKRIGPSPSLNS-  180

Query  711   AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFS  890
              + R F  V  ++  + +T  D          L D +T I S+   +   P        S
Sbjct  181   -IFRFFVRVWFMIRLIFNTFVDVYKFAATLFFLRDTETPIMSKPAAMAPNPRRCVHRIIS  239

Query  891   LYHLKQIKSSLNVTINDVI-----SGIVTYGTRLYMQE----SERETCNGECTALVLFNT  1043
                +K +K+++ +TINDV+     +GI  Y +R Y QE    S++        + ++ N 
Sbjct  240   FEDVKLVKNAMKMTINDVLLGVTQAGISRYLSRRYDQEGTPKSKKFMGRIRLHSAIMINL  299

Query  1044  RAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRMV  1217
             R    G +++++M+   ++  WGN I +  LPF++        G  ++PL ++  A   +
Sbjct  300   RP-NTGIEALADMMAKGSKCRWGNLIGYVLLPFSV--------GLENDPLEYVRRAKSTI  350

Query  1218  KRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPV  1397
              R++ S    L+    +FT  + G +A    ++R   NT++T +N++GP E+ +   HP+
Sbjct  351   DRKKLSLEAVLSYAIFKFTINVLGFKAGEALVKRVFGNTTMTFSNLVGPKEEISFYGHPI  410

Query  1398  KGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIESAFDEI  1553
               +  +  G P +L +   SYA K+ + +  +   I D  +L      +F+ I
Sbjct  411   SYIASSAFGHPHALSLHFQSYADKIIIAMAVDPTVIPDPHRLCDDFSESFETI  463



>gb|KCW78187.1| hypothetical protein EUGRSUZ_D02376, partial [Eucalyptus grandis]
Length=505

 Score =   180 bits (456),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 137/462 (30%), Positives = 219/462 (47%), Gaps = 40/462 (9%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKN-  356
             P SP +Q  +    +  I+AV+    PI  D  VI S +    L  +PRFSS+ V  +  
Sbjct  33    PLSPSAQMFHEPNFNVYIVAVMGCKTPI--DLPVIKSNLVHTLLK-HPRFSSLQVEDEKE  89

Query  357   -GEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
              G+  W P  V LE H+ VP    G  ++  +  + +Y++ +S     +TQPLW+IHI  
Sbjct  90    KGKFRWIPTNVDLEKHIIVPKIKPG--MDSPERFIEDYVSNLSKTTICKTQPLWDIHILN  147

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQ-GENS  707
               TS+A    +F++H SLGDG SLM  LL+C ++  +P ALP T P ++   K+  G   
Sbjct  148   VKTSDAEAVGVFRIHHSLGDGTSLMSLLLACTRKISDPEALP-TIPVKKSKEKRDYGRIW  206

Query  708   NAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTF  887
               +      +  L +  VDT+  F    L    L D ++ I     GVE  P      T 
Sbjct  207   GWLLGVCWFLVLLWNTAVDTIM-FGATVL---FLKDSESPIKGP-PGVELMPRRFVYRTV  261

Query  888   SLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERET--------------CNGECTA  1025
             SL  +K +K++LN T+NDV  G+   G   Y+     ET               N    +
Sbjct  262   SLEDIKMVKNALNATVNDVALGVTQAGLSQYLHLRYAETKKRHGATKIRNDLPKNLRLRS  321

Query  1026  LVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIY  1199
              +L N R    G + ++ M++ + E+ WGNRI +  +P  I           SNPL ++ 
Sbjct  322   TLLINLRP-SIGIQGLAAMMEKDTEVKWGNRIGYVLVPITI--------ALHSNPLDYVR  372

Query  1200  NAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTT  1379
              A   + R+++S     T    E   KL G++A +    R + +T++  +N++GP+E+  
Sbjct  373   EAKATINRKKHSLEAIFTHSIAEAVLKLFGIKAASALSHRVITHTTMCFSNLVGPLEEIG  432

Query  1380  LANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
                HP+  +     G P  L+V   SYA K+   + +++  I
Sbjct  433   FYGHPLAYLAPGCYGQPHGLMVNFQSYANKMTFVVSADEGTI  474



>ref|XP_006282349.1| hypothetical protein CARUB_v10028646mg [Capsella rubella]
 gb|EOA15247.1| hypothetical protein CARUB_v10028646mg [Capsella rubella]
Length=496

 Score =   180 bits (456),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 128/457 (28%), Positives = 228/457 (50%), Gaps = 30/457 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI--MVTGK  353
             P SP S+  NS   + +II  +   V  + +   I+  ++   +  +PRFSSI  M  GK
Sbjct  24    PLSPCSRLFNSPDFNCAIIVTMGCRV--KANPPAIVDGLKHTLVN-HPRFSSILEMNNGK  80

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
              G+  W   KV +EDH+ VP   +   +E  D  L +Y++K++  P   ++PLWE+HI  
Sbjct  81    KGKPCWVRTKVRVEDHVIVP--DIDPKIENPDKYLEDYISKLTTIPMDLSKPLWEMHILN  138

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALP-LTFPRRQGSGKKQGENS  707
               TSNA    I K+H SLGDG SLM   L+C ++  NP ALP +   +++          
Sbjct  139   LKTSNAESIAILKIHHSLGDGMSLMSLFLACTRKTSNPEALPTVAVQKKRLVPSCNSGFF  198

Query  708   NAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTF  887
             N +   F  +  +L  + +T  D     L    + D +T + ++  G E  P        
Sbjct  199   NKIWWLFVVLWFILRLLFNTFVDILMFALTILFVRDTETPLLAK-PGSELIPKRFVHRII  257

Query  888   SLYHLKQIKSSLNVTINDVI-----SGIVTYGTRLYMQE----SERETCNGECTALVLFN  1040
             S   +K +K++L +T+NDV+     +G+  Y +R Y QE    S+         + ++ N
Sbjct  258   SFDDVKLVKNALKMTVNDVLLGVTEAGLTRYLSRRYDQEATPKSKESMRKIRLRSAIMIN  317

Query  1041  TRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRM  1214
              R    G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A   
Sbjct  318   LRP-NAGIEALADMMAKKSKCRWGNLFGYILLPFSV--------GQETDPLEYVRRAKAT  368

Query  1215  VKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHP  1394
             V R+++S     +  F +   K+ GL+A+   +R+ + +T+++ +N++GP E+ T   HP
Sbjct  369   VDRKKHSLEAVFSMAFFKVILKVFGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGHP  428

Query  1395  VKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             +  +   V G P +L +   SYA K+ +++ ++   I
Sbjct  429   LSYIAPCVFGHPHALTLHFQSYANKVIISVTADPTII  465



>ref|XP_011092557.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Sesamum indicum]
Length=463

 Score =   179 bits (453),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 142/486 (29%), Positives = 236/486 (49%), Gaps = 47/486 (10%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASP-FSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLP  314
             ME  +E D    L PA   F Q + + V++ +++       P  DD     +E+R   L 
Sbjct  1     MEEAMERDQP--LTPAGRLFLQPLMNQVINCAVVV----EFPF-DDVEAFKAELRSSILL  53

Query  315   INPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDY-CLSEYLTKISMD-  488
              +PRF S+MVT   G ++W+  +V ++ H+ V   P+   +   D   +++++  +S+  
Sbjct  54    QHPRFCSLMVTDSFGREHWRKTQVDVDRHVIVRHQPLSDDIHISDDDAVNDFVADLSVSS  113

Query  489   PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFP  668
             P P  +PLWEIH+       A    +F++H +LGDG SLM  LLSC +R D+P+ P   P
Sbjct  114   PLPTDKPLWEIHLLL-----AHKTVLFRVHHALGDGISLMSMLLSCCRRVDDPSQP---P  165

Query  669   RRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSW-------NFLKSSLLDDDKTA  827
                G G            A  + PR  +  V T+    W        F   +L   DKT 
Sbjct  166   TIGGVG------------AASSSPRRRAWSVSTLVKVVWYTLIYILEFSLRALCLRDKTT  213

Query  828   IHSQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTINDVISGIVTYGTRLYMQ-ESERE  1001
               S  DGVE  P  + +  F L  +K +K ++ + TINDV+ G+++ G   Y+  +S + 
Sbjct  214   AVSGGDGVELWPRRLASARFRLDDMKIVKRAVADATINDVLFGVISCGLSRYLDIKSPKA  273

Query  1002  TCNG-ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSS  1178
                G   T + + N R   G  + + ++I   +   WGN+   L   +P     G    S
Sbjct  274   MPEGLRITGVAMVNLRPQAG-LQEIWKLINSKSGSRWGNKFGML--LLPVYYHSG---GS  327

Query  1179  NPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMI  1358
             +PL+F+  A  M+ +++ S     + +  +    L G +  +    R + NT+ T++N++
Sbjct  328   DPLQFVKRAKTMIDKKKLSLEAPFSYKVGDLVMSLFGPKLASILNYRIVCNTTFTISNVV  387

Query  1359  GPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIE  1535
             GP E+ ++A +PVK +    S  P +L + M+SYAG   L I+  KD I D K L  C +
Sbjct  388   GPREEISMAGNPVKNIRTTSSSLPHALTMHMVSYAGVADLQILVAKDIIPDPKVLADCFQ  447

Query  1536  SAFDEI  1553
             +A  E+
Sbjct  448   NALLEM  453



>ref|NP_190488.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
 emb|CAB66398.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42239.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63856.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78509.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=522

 Score =   180 bits (456),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 136/477 (29%), Positives = 240/477 (50%), Gaps = 41/477 (9%)
 Frame = +3

Query  147   HLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPR  326
             H+ GD++    P SP ++  ++   + +II+V+     +  D  V +   ++ F+  +PR
Sbjct  8     HISGDEKEEEQPLSPAARLFHAPEFNCNIISVIGFKSKL--DPCVFIRGFKESFIR-HPR  64

Query  327   FSSIMVTGKNGE-KNWKPVKVILEDHLKVP-IFPVGKPLEFYDYCLSEYLTKISMDPFPQ  500
             FSS +VT +NG+ + W    V++EDH  VP I P  + +E  +  L +Y++ +   P   
Sbjct  65    FSSKLVTDENGQNQRWVRTNVVVEDHFIVPKIKP--QNIENSNAFLEDYVSDLMKIPLDT  122

Query  501   TQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP----ALPLTFP  668
             ++PLWE+H+    TS+A    + K+H S+GDG S+M  +L+C+++  NP    +LP  + 
Sbjct  123   SRPLWELHLLDLKTSDAENVAVLKIHHSVGDGMSIMSLVLACMRKTSNPDELPSLPYQY-  181

Query  669   RRQGSGKKQGENSNAVARAFKAVPRLLSGVV---DTVTDFSWNFLKSSLLDDDKTAIHSQ  839
             R           S + +R    V  + + V+   +TV D     + +  + D +T I   
Sbjct  182   RSSSRSSLLTTGSRSDSRLLWLVKVIWTAVILGLNTVCDALEFIVTTLFVKDTETPIKGD  241

Query  840   DDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE--SERETCNG  1013
                 + + + +   T SL  +K  K+++N+TINDV+ G+   G   Y+     E ET N 
Sbjct  242   FLSTKSKQLRLVHRTVSLDDIKLTKNAMNMTINDVVLGVTQAGLSRYLARRYGEEETKNR  301

Query  1014  ECTAL---------VLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFL--PFAIPKLRSP  1160
             +   L         +L N R   G  + +++M++  ++  WGN   ++  PF+I  LR  
Sbjct  302   KQKKLPKRIRLRSALLVNLRPTTG-IQDLADMMEKGSKCRWGNWFGYVVFPFSIA-LRD-  358

Query  1161  GDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSI  1340
                   +PL  +  A + + R++ S    LT  F     KL G++  A  + R + NT++
Sbjct  359   ------DPLEHLEIAQKTISRKKNSYGAMLTYIFCRIIVKLLGIKVAASIINRMVSNTTM  412

Query  1341  TMTNMIGPVEKTTLANHPVKGMYFAVS--GAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             T +NM+GPVE+ +   HP+   YFA S  G P +L +   SY  K+ +T+I +   I
Sbjct  413   TFSNMVGPVEEVSFYGHPIT--YFASSAYGHPHALTIHCQSYMNKMTITLIVDPTVI  467



>emb|CDY54346.1| BnaC03g14900D [Brassica napus]
Length=489

 Score =   179 bits (455),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 128/457 (28%), Positives = 229/457 (50%), Gaps = 30/457 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI--MVTGK  353
             P SP S+  NS   + +II ++   V  + +   I+  ++   +  +PRFSSI  M  GK
Sbjct  16    PLSPCSRLFNSPDFNCAIIVIMGCKV--KGNPPAIIDGLKHTLVN-HPRFSSILEMNNGK  72

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
              G+ +W   +V +EDH+ VP   +   +E  D  L +Y++K++  P   ++PLWEIH+  
Sbjct  73    KGKPSWVRTEVRVEDHVIVP--DIDPNIESPDQYLEDYISKLTTVPMDFSKPLWEIHLLC  130

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALP-LTFPRRQGSGKKQGENS  707
               TSNA    + K+H SLGDG SLM   L+C ++  +P ALP ++  ++Q          
Sbjct  131   LKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKTSDPEALPTVSVQKKQFGPSSNTGFF  190

Query  708   NAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTF  887
             N +   F  +  +L  V +T  D     L    L D +T + ++    E  P        
Sbjct  191   NKIWWLFVGLWFILRLVFNTFVDVLIFALTICFLRDTETPLLAKPR-TELVPKRFVHRII  249

Query  888   SLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQE----SERETCNGECTALVLFN  1040
             S   +K +K+++ +T+NDV+ G+   G     +R Y QE    S+         + ++ N
Sbjct  250   SFDDVKLVKNAMKLTVNDVLLGVTQAGLSRYLSRRYDQEATPKSKESMGKFRLRSAIMIN  309

Query  1041  TRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRM  1214
              R    G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A   
Sbjct  310   LRP-NTGIEALADMMAKKSKCRWGNLFGYILLPFSV--------GLETDPLEYVRQAKVT  360

Query  1215  VKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHP  1394
             V R+++S     +  F +   K+ GL+A+   +R+ + NT++T +N++GP E+ T   HP
Sbjct  361   VDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHNTTLTFSNVVGPKEEITFHGHP  420

Query  1395  VKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             +  +  +V G P +L V   SY  K+ +++ ++   I
Sbjct  421   LSYIAPSVFGHPHALTVHFQSYEKKVIISVTADPTVI  457



>gb|EYU42683.1| hypothetical protein MIMGU_mgv1a006065mg [Erythranthe guttata]
Length=459

 Score =   179 bits (453),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 135/448 (30%), Positives = 212/448 (47%), Gaps = 31/448 (7%)
 Frame = +3

Query  258   PIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGK-P  434
             P   D + + +E+R   +   PRF S+MV    G + W+  +V ++ H+ V   P+   P
Sbjct  32    PFAVDVAAVKAEVRSSVMLKLPRFCSLMVRDSCGREYWRRTEVDVDRHVIVRHHPLSDDP  91

Query  435   LEFYDYCLSEYLTKISMD-PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMG  611
             L   +  +++++  +++  P P  +PLWEIHI       A    +F+LH +LGDG SLM 
Sbjct  92    LVSDEDAVNDFIADLAVSSPLPADKPLWEIHIL-----VAHATAVFRLHHALGDGISLMS  146

Query  612   ALLSCLQRADNPA-LPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWN  788
              LLSC ++AD+P+ LP             G  + A  R + A    L  +V     ++  
Sbjct  147   MLLSCCRKADDPSQLPTI-----------GAAAAAPPRGWSAWA--LVKLVWYTLVYALE  193

Query  789   FLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLN-VTINDVISGIVTY  965
             F   +L   D+T   S   GVE  P  + T  F L  +K +K ++N  TINDV+ GI++ 
Sbjct  194   FTVRALWLRDRTTAVSGGAGVELWPRKLATARFRLDDMKIVKRAVNESTINDVLFGIISC  253

Query  966   GTRLYMQESERETCNGE---CTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPF  1136
             G   Y+     +    E    T + + N RA  G       M   N+   WGN+  F   
Sbjct  254   GLSRYLDIKSPKALPPEGLRMTGVAMVNLRAQPGLQDISKLMSSSNSSTSWGNK--FGMI  311

Query  1137  AIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLR  1316
              +P     GD   SNP+ F+  A  M+ +++ S     + +         G +  A    
Sbjct  312   ILPVYYHKGD---SNPIEFVKRAKSMIDKKKLSLEALFSYKVGHLVTSFLGAKFAAILSY  368

Query  1317  RTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEK  1496
             R L NTS T++N+IGP EK T+  H VK +    S  P ++ + M+SY G   + I++ K
Sbjct  369   RILSNTSFTISNIIGPREKITIVGHTVKHIRVTSSSLPHAITMHMVSYGGVAEMQILTAK  428

Query  1497  DFI-DVKKLKSCIESAFDEIFRLTLKSS  1577
             + I D K L  C E A  E+  + L S+
Sbjct  429   EIIPDPKILAKCFEDALLEMKEVALGSN  456



>ref|XP_004979822.1| PREDICTED: O-acyltransferase WSD1-like [Setaria italica]
Length=508

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 141/479 (29%), Positives = 234/479 (49%), Gaps = 47/479 (10%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E DDE    P SP +Q        F I+AV+  + PI   D  +     +V L  +PRF 
Sbjct  29    EADDE----PLSPTAQLYGD----FCIVAVVGLAAPI---DIELARAGLEVTLVRHPRFC  77

Query  333   SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
             SI VT    E  W    V L+DH+ VP           D  L +Y++ +S  P  +++PL
Sbjct  78    SIHVT-DGPEHRWVRTPVNLDDHIIVPDLDPAAIAADPDKVLEDYVSSLSTLPMDKSRPL  136

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADN----PALPLTFP----  668
             WE+HI  +PTS A    +F+++ +LGDG SL+  LL+C + A +    P +P   P    
Sbjct  137   WELHILDFPTSEAASAAVFRINHALGDGTSLISLLLACTRSATDPKTLPVMPSAMPPPAR  196

Query  669   ---RRQGSGKKQGENSNAVARAFKAVPRLLSGVV---DTVTD-FSWNFLKSSLLDDDKTA  827
                RR+  G       +A A AF  V  +LS V+    T+ D  S+  L   L+ D +T 
Sbjct  197   LKGRRRVYGASPPPARSAGAMAF--VAWVLSCVLLAWHTIVDVVSFAALALDLVRDPRT-  253

Query  828   IHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYG-TRLYMQESERET  1004
             + +   GVEFR   + +   SL  +K +K+ L  T+NDV+ G+ +   +R Y ++S  + 
Sbjct  254   VFTAVKGVEFRRKRLVSRGLSLDDVKHVKNVLGCTVNDVLVGVTSAALSRYYFRKSGDDA  313

Query  1005  CNGECT--ALVLFNTRAMGGGYKSVSEMIKPNAE--MPWGNRI--TFLPFAIPKLRSPGD  1166
                +    +L++ N R+   G + +++M++P+    + WGN +    LPF I        
Sbjct  314   TKKDVCLRSLLMVNVRST-PGIQELAQMMEPSKHNGVKWGNPVGQIILPFYIAMY-----  367

Query  1167  GDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITM  1346
                 +PL ++  A ++V R+++S  + +T    +   +L G + +     R + NT++  
Sbjct  368   ---DDPLEYVRKAKKVVDRKKHSLEVIVTHGIGKRGTELFGTKVSGAIFHRMVSNTTVAF  424

Query  1347  TNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTI-ISEKDFIDVKKL  1520
             +NMIGPVE+     H V  +  +V G   +L +   SYA  +R+ + + +  F D   L
Sbjct  425   SNMIGPVEQVEFYGHRVVYIAPSVCGNTSALTIHWQSYADTIRVVLAVDDSQFPDCHHL  483



>emb|CBH32551.1| conserved hypothetical protein, expressed [Triticum aestivum]
 emb|CDM83948.1| unnamed protein product [Triticum aestivum]
Length=515

 Score =   179 bits (455),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 140/505 (28%), Positives = 237/505 (47%), Gaps = 44/505 (9%)
 Frame = +3

Query  87    KGTTIRKKLSSIQVKTTMESHLEGDDEVVLA--PASPFSQYMNSSVLSFSIIAVLESSVP  260
             +G+ +RK+ S+I  +   E+   G  +      P SP  +       S  I++V      
Sbjct  5     RGSALRKRPSAIDARYARETERGGGGKTGEGEEPVSPTGRLFREPHFSCYIVSVFGLGAR  64

Query  261   IEDDDSVILSEIR---DVFLPINPRFSSIMVTGK---NGEKNWKPVKVILEDHLKVPIFP  422
             ++      L+ +R   +  L  +PRF S+ V  +   +    W    V L+DH+ VP   
Sbjct  65    VD------LAGVRAGLEATLARHPRFCSVQVVDELEEDARPKWVRTTVNLDDHVIVPDLD  118

Query  423   VGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYS  602
                     D  L  Y++ +S  P   ++PLWE+H+F +PTS+A    + ++H S+GDG S
Sbjct  119   PTATSADPDRALEHYVSSLSTLPMDHSRPLWELHVFDFPTSDAAAAVVLRVHHSVGDGVS  178

Query  603   LMGALLSCLQRADN----PALPLT-FPRRQGSG-----KKQGENSNAVARAFKAVPRLLS  752
             L+   ++C +RA +    P LP T  PRR G       +    +  A+A     V  LL 
Sbjct  179   LLSLFIACTRRAADPDALPELPTTGAPRRAGPAYALRSRHSPSSWGALAVLAAWVVSLLV  238

Query  753   GVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVT  932
                 TV D       ++ +  D   +    +GVEFRP      T SL  +K +K+++N T
Sbjct  239   LAWHTVVDVLCFSATATWMLRDPPTLFKGAEGVEFRPKRFVNRTLSLDDVKYVKNTMNCT  298

Query  933   INDVISGIVTYG-TRLYMQ---ESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAE  1100
             +NDV+ G+ +   +R Y +   ES R++     T LV  N R    G  +++ M+K   +
Sbjct  299   VNDVLLGVTSAALSRFYFRKTGESGRKSIKVRSTLLV--NLRKT-PGLHALATMMKSGKD  355

Query  1101  --MPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLE  1268
                 WGNR+ +  LPF I      GD    +PL ++  A ++ +R++ S     T     
Sbjct  356   NWAEWGNRLGYMILPFHIVH----GD----DPLEYVRKATKVARRKKSSMESIFTYWSAS  407

Query  1269  FTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVT  1448
                K  G++A A      ++NT+++ +NM GP E+     HP+  +  +V G P +L + 
Sbjct  408   MIMKFFGIKAAASLCYGMMRNTTLSFSNMAGPTEQVVFYGHPIVYIAPSVYGHPHALTMH  467

Query  1449  MLSYAGKLRLTIISEKD-FIDVKKL  1520
               SY   ++L + +E++ F D  +L
Sbjct  468   YQSYMNIIKLVLATEEEQFPDAHEL  492



>ref|XP_006346395.1| PREDICTED: O-acyltransferase WSD1-like [Solanum tuberosum]
Length=462

 Score =   178 bits (452),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/446 (29%), Positives = 218/446 (49%), Gaps = 26/446 (6%)
 Frame = +3

Query  240   VLESSVPIED--DDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVP  413
             ++  +V ++D  D   +  EI +  L  +PRFSSIM+    G + W+  +V ++DH  + 
Sbjct  25    IINCAVSVDDPIDVEAVKLEISNSILVKHPRFSSIMLKDSCGRERWRKTEVNVDDHFIIR  84

Query  414   IFPVGKPLEFYDY-CLSEYLTKISMD-PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSL  587
               P+       D   +++YL  +S+  P   T+PLWE H+       A  + + +LH +L
Sbjct  85    HQPLTDDPSISDEDAVNDYLADLSVSTPLSLTKPLWEFHLLL-----AHNSAVLRLHHAL  139

Query  588   GDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDT  767
             GDG SLM   +SC +RAD+P      P  QG G     N+  V R  K +  ++   V  
Sbjct  140   GDGISLMSMFMSCCRRADDPN---QRPTTQGVGTSSSSNNRNVWRLLKKLVMVIWYTVVY  196

Query  768   VTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTINDV  944
             VT+F    L+S  L D KTAI S   GVE  P  + T  F +  ++ +K ++ N TINDV
Sbjct  197   VTEFG---LRSLWLKDKKTAI-SGGAGVELWPRKLATAKFKIDDMRTVKKAIDNATINDV  252

Query  945   ISGIVTYGTRLYMQ-ESERETCNG-ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNR  1118
             + G+++ G   Y+   S +    G + T + + N R   G  +  SE++K  +   WGN+
Sbjct  253   LFGVISCGLSRYLDLRSPKAPKEGLQMTGVAMINLRKQSG-LQDFSELMKSKSGARWGNK  311

Query  1119  ITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEA  1298
                L   +P     G    S+PL+F+  A  M+ +++ S     + +  +    + G + 
Sbjct  312   FGML--LLPVYYYNG---GSDPLQFVKRAKAMIDKKKLSLEGPCSYKTGDLIMSIFGPKL  366

Query  1299  TAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRL  1478
                   R + NT+ T++N+IGP E  T   + +  +    +    ++ + M+SYAG+  +
Sbjct  367   ATLLNYRIVSNTTFTISNVIGPPEDITFGGNHISSVRVTSTALSHAITMHMVSYAGRADM  426

Query  1479  TIISEKDFI-DVKKLKSCIESAFDEI  1553
              I+  K  I D K L  C + A  E+
Sbjct  427   QILVAKAIIPDPKVLAKCFQDALLEM  452



>ref|XP_011000126.1| PREDICTED: O-acyltransferase WSD1-like [Populus euphratica]
Length=466

 Score =   178 bits (451),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 133/433 (31%), Positives = 212/433 (49%), Gaps = 30/433 (7%)
 Frame = +3

Query  288   SEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEY  467
             S I++  +  +PRF SI+V  KNG ++WK   + ++ H  +         +  D  ++EY
Sbjct  45    SAIKNSLMLKHPRFCSILVRDKNGREHWKKTDIDIDQHFIIVNKKTCTDDDDVDKVVNEY  104

Query  468   LTKISMD-PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALL-SCLQRAD  641
             +  +S+  P    +PLWE+H+            I ++H +LGDG SLM  LL SC   +D
Sbjct  105   IADLSVSTPLDMNKPLWEVHVMLEQKCA-----IMRIHHALGDGISLMSMLLASCRTASD  159

Query  642   NPALP-LTFPRRQGSGKK--QGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLD  812
               A+P L   RR   GKK  Q +    + R  K V   ++  ++ V  F W       + 
Sbjct  160   PEAIPTLVTMRRPDYGKKGKQQDWRGVILRVLKMVWFSMAFSLEFVLRFLW-------VS  212

Query  813   DDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTINDVISGIVTYGTRLYM-Q  986
             D KT I S  DGVE  P  + T  F +  +K +K ++ N TINDV+ G+++YG   Y+  
Sbjct  213   DKKTVI-SGGDGVELWPRKLATAKFLIEDMKTVKGAVANATINDVLFGVISYGLSRYLDH  271

Query  987   ESERETCNGE-CTALVLFNTRAMGGGYKSVSEMIKPNA--EMPWGNRITFLPFAIPKLRS  1157
              S +    G+  T + + N R      + +SEM+K N+  +  WGNR  F+   +P    
Sbjct  272   RSPKALKEGQQITGMAMVNLREQLS-MQDLSEMLKNNSGSQSRWGNRFGFI--LLPVFYH  328

Query  1158  PGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTS  1337
               D D   PL+ +  A  M+ R++ ++  + T           G +A      R L NT+
Sbjct  329   KSDVD---PLQHVGRAKTMIDRKKKTSEAHFTYHIGHLAMSFLGPKAAHVLNYRVLCNTT  385

Query  1338  ITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVK  1514
              T +N++GP E  T++ +PV  +    S  P +L + M+SYAG+  + I+  KD I D +
Sbjct  386   FTFSNVVGPQELVTMSGNPVTFIRVNTSSIPHALTMHMVSYAGRADMQIMVAKDIIPDPE  445

Query  1515  KLKSCIESAFDEI  1553
              L  C E A  E+
Sbjct  446   FLAKCFEDALFEM  458



>ref|XP_010515263.1| PREDICTED: O-acyltransferase WSD1 [Camelina sativa]
Length=523

 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 136/472 (29%), Positives = 238/472 (50%), Gaps = 36/472 (8%)
 Frame = +3

Query  159   DDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI  338
             DD+    P SP ++  +S   + +II+V+   +  + D  VI+   +  F+  +PRFSS 
Sbjct  12    DDKEDEQPLSPAARLFHSPEFNCNIISVI--GIKSKMDPDVIMRGFKQTFIR-HPRFSSK  68

Query  339   MVT-GKNG-EKNWKPVKVILEDHLKVP-IFPVGKPLEFYDYCLSEYLTKISMDPFPQTQP  509
             +V+ G NG  + W    V++EDH+ VP I P  + +E  D  L +Y++ +   P   ++P
Sbjct  69    LVSDGDNGLNQRWVRTNVVVEDHVIVPEIKP--QNIENTDAFLEDYVSDLMKIPLDTSRP  126

Query  510   LWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP----ALPLTFPRRQ  677
             LWE+HI    TS+A    +FK+H S+GDG S+M  +L+C+++  NP    +LP       
Sbjct  127   LWELHILDLKTSDAENVAVFKIHHSVGDGMSIMSLVLACMRKTSNPDELPSLPYQKRSSS  186

Query  678   GSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDF--SWNFLKSSL-LDDDKTAIHSQDDG  848
                      S   +R    V  L   V+  +  F  + +FL + L + D +T I      
Sbjct  187   SGSSLLTTGSRGDSRLLWLVKLLWMAVILGLNTFCDALDFLLTMLFVKDTETPIKGDFRS  246

Query  849   VEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE--SERETCNGECT  1022
              + + + +   T SL  +K IK+++++TINDV+ G+       Y++    E+ET      
Sbjct  247   SKSKQLRLVHRTVSLDDIKLIKNAMDMTINDVVLGVTQASFSRYLERRYGEKETKRKPKN  306

Query  1023  AL--------VLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFL--PFAIPKLRSPGDGD  1172
              L        +L N R    G + +++M++  ++  WGNR  ++  PF+I  LR+     
Sbjct  307   LLKRIRLRSALLVNLRP-TTGIQDLADMMETGSKCWWGNRFGYVVFPFSIA-LRN-----  359

Query  1173  SSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTN  1352
               +PL  +  AH+ + R++ S    LT  F     K  G+E  A  + R + NT++T +N
Sbjct  360   --DPLEHLRIAHKTINRKKNSFGAMLTYVFCRIIVKSLGIEVAATIINRLMSNTTMTFSN  417

Query  1353  MIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFID  1508
             M+GPVE+ +   HP+  +  +  G P +L +   SY  K+ +T++ +   I+
Sbjct  418   MVGPVEEVSFYGHPITYIASSAYGHPHALTLHCQSYMNKMTITLLVDPTVIN  469



>ref|XP_006293222.1| hypothetical protein CARUB_v10019546mg [Capsella rubella]
 gb|EOA26120.1| hypothetical protein CARUB_v10019546mg [Capsella rubella]
Length=522

 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 143/486 (29%), Positives = 243/486 (50%), Gaps = 52/486 (11%)
 Frame = +3

Query  129   KTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVF  308
             + T+E   E D      P SP ++  ++   + +I++V+     I+ D  VI+   +  F
Sbjct  7     RNTLEDEKEDDQ-----PLSPAARLFHAPEFNCNIVSVIGLKSKIDPD--VIIRGSKQTF  59

Query  309   LPINPRFSSIMVT-GKNGE-KNWKPVKVILEDHLKVPIFPVGKP--LEFYDYCLSEYLTK  476
             +  +PRFSSIMV+ G NG+ + W    V++EDH+   I P  KP  +E  D  L +Y++ 
Sbjct  60    IR-HPRFSSIMVSEGDNGQNQRWVRTNVVVEDHV---IIPEIKPQNIENADAFLEDYVSD  115

Query  477   ISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-AL  653
             +   P   ++PLWE+H+    TS+A    + K+H S+GDG S+M  +L+C+++  NP  L
Sbjct  116   LMKIPLDTSRPLWELHLLDLKTSDAENVAVLKIHHSVGDGMSIMSLVLACMRKTSNPDEL  175

Query  654   P-LTFPRRQGSGKK---QGENSNAVARAFKAVPRLLSGVV---DTVTDFSWNFLKSSL-L  809
             P L + +R  SG      G  S++  R    V  L + V+   +TV D +  FL ++L +
Sbjct  176   PSLPYQKRSSSGPALLPTGSRSDS--RLLWLVKLLWTAVILGLNTVCD-ALEFLVTTLFV  232

Query  810   DDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE  989
              D  T I       +   + +   T S   +K IK+++++T+NDV+ G+   G   Y++ 
Sbjct  233   KDTDTPIKGDLRSKKSTQLRLVHRTVSFDDIKLIKNAMDMTVNDVVLGVTEAGLSRYLER  292

Query  990   SERETCNG----------ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFL--P  1133
                E                 + +L N R   G  + +++M+   ++  WGN   ++  P
Sbjct  293   RYGEENTKMKQKHLPKRIRLRSALLVNLRPTTG-IQDLADMMAKGSKCRWGNWFGYVVFP  351

Query  1134  FAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFL  1313
             F+I  LR        +PL  +  AH+ + R++ S    LT  F     K  G +  A  +
Sbjct  352   FSIA-LRD-------DPLEHLERAHKTINRKKNSFGAMLTYIFCRIIVKSLGTKVAATII  403

Query  1314  RRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVS--GAPQSLVVTMLSYAGKLRLTII  1487
              R + NT++T +NM+GPVE+ +   HP+   YFA S  G P +L +   SY  K+ +T+I
Sbjct  404   NRFVSNTTMTFSNMVGPVEEVSFYGHPIT--YFASSAYGHPHALTIHCQSYMNKMTITLI  461

Query  1488  SEKDFI  1505
              +   I
Sbjct  462   VDPTVI  467



>gb|KHG08035.1| O-acyltransferase WSD1 -like protein [Gossypium arboreum]
 gb|KHG20520.1| O-acyltransferase WSD1 -like protein [Gossypium arboreum]
Length=481

 Score =   178 bits (452),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 136/456 (30%), Positives = 225/456 (49%), Gaps = 35/456 (8%)
 Frame = +3

Query  270   DDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYD  449
             D   I S I+   +  +PRF S++V  KNG ++W+   + ++ H+ V    + K   F D
Sbjct  39    DMDAIKSAIKSSLMVQHPRFCSLLVRDKNGFEHWRKTPIDIDQHVIVVNNRLDKSGNFID  98

Query  450   -------------YCLSEYLTKISMD-PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSL  587
                            +++Y+  +S+  P    +PLWE+H+   P        +F++H SL
Sbjct  99    ETQGSTTTEEDDEAAVNQYVADLSVSSPLSTDKPLWELHVL--PAHKCA---VFRIHHSL  153

Query  588   GDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVD  764
             GDG SLM  L++  +R D+  ALP   P ++   K  GE           +   L  VV 
Sbjct  154   GDGISLMSMLMANCRRTDDAEALPKMVPDKKTVIK--GEKGRDWFWLVGVLWWFLKIVVF  211

Query  765   TVTDFSWNF-LKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTIN  938
             T+  FS  F L+S L+ D+KTAI +  DGVE  P  + T  F L  +K +K ++ + TIN
Sbjct  212   TLL-FSVEFVLRSLLVSDEKTAI-TGGDGVELWPRKLATAKFLLDDMKLVKRAVPDTTIN  269

Query  939   DVISGIVTYGTRLYMQESERETCNG--ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWG  1112
             DV+ G+V+ G   Y+        +     T + + N R   G  + +S+++K N +  WG
Sbjct  270   DVLLGMVSSGLSRYLDHRTPNALHEGLRITGVAMVNIRPQPG-LQDLSKLMKSNTKARWG  328

Query  1113  NRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGL  1292
             N+  F    IP     G  D   PL ++  A   V ++++S   Y + +  +    L G 
Sbjct  329   NK--FGVILIPVYYHKGGND---PLEYLKRAKATVDKKKHSLEAYFSYKIGDLVMSLLGP  383

Query  1293  EATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKL  1472
             +       + L NT+ T++N+ GP+E+ +LA +P+  +    S  PQ++ + MLSYAGK+
Sbjct  384   KYACMLNYKLLCNTTFTLSNVAGPLEEISLAGNPLSSIKVNTSSLPQAITMHMLSYAGKV  443

Query  1473  RLTIISEKDFI-DVKKLKSCIESAFDEIFRLTLKSS  1577
              + I+  KD I D + L  C E A  E+    L+++
Sbjct  444   EMQILVAKDIIPDPEFLAKCFEDALLEMKEAVLRTN  479



>ref|XP_004979823.1| PREDICTED: O-acyltransferase WSD1-like [Setaria italica]
Length=508

 Score =   179 bits (453),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 139/477 (29%), Positives = 234/477 (49%), Gaps = 43/477 (9%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E DDE    P SP +Q+ +       I+AV+  + PI   D  +     +V L  +PRF 
Sbjct  29    EADDE----PLSPTAQFYSD----LCIVAVVGLAAPI---DIELARAGLEVTLVRHPRFC  77

Query  333   SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
             SI VT    E  W    V L+DH+ VP           D  L +Y++ +S  P  +++PL
Sbjct  78    SIHVT-DGPEHRWVRTPVNLDDHIIVPDLDPAAIAADPDKVLEDYVSSLSTLPMDKSRPL  136

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADN----PALPLTFP---R  671
             WE+HI  +PTS A    +F+++ +LGDG SL+  LL+C + A +    P +P   P   R
Sbjct  137   WELHILDFPTSEAASAAVFRINHALGDGTSLISLLLACTRSAADPKALPVMPSAMPPPAR  196

Query  672   RQGSGKKQGENSNAV--ARAFKAVPRLLSGVV---DTVTD-FSWNFLKSSLLDDDKTAIH  833
             R+G  +  G +      A A   V  +LS V+    T+ D  S+  L   L+ D +T + 
Sbjct  197   RKGRRRVYGASPTPARSAGAMAFVAWVLSCVLLAWHTIVDVVSFAALALDLVRDPRT-VF  255

Query  834   SQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYG-TRLYMQESERETCN  1010
             +   GVEFR     +   SL  +K +K+ L  T+NDV+ G+ +   +R Y ++S  +   
Sbjct  256   TGVKGVEFRRKRFVSRGLSLDDVKHVKNVLGCTVNDVLVGVTSAALSRYYFRKSGDDATK  315

Query  1011  GECT--ALVLFNTRAMGGGYKSVSEMIKP--NAEMPWGNRI--TFLPFAIPKLRSPGDGD  1172
              +    +L++ N R+   G + +++M++   N ++ WGN +    LPF I          
Sbjct  316   KDVCLRSLLMVNVRST-PGIQELAQMMESSKNNDVKWGNPVGQIILPFYIAMY-------  367

Query  1173  SSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTN  1352
               +PL ++  A ++V R+++S  + +T    +   +L G + +     R + NT++  +N
Sbjct  368   -DDPLEYVRKAKKVVDRKKHSLEVIVTHGIGKKGSELFGTKVSGAIFHRMISNTTVPFSN  426

Query  1353  MIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTI-ISEKDFIDVKKL  1520
             +IGPVE      H V  +  +V G P +L +   SYA  +R+ + + +  F D   L
Sbjct  427   IIGPVEPVEFYGHRVVYIAPSVYGHPSALTILWQSYADTIRVVLAVDDSQFPDCHHL  483



>dbj|BAJ84892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   178 bits (451),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 233/496 (47%), Gaps = 41/496 (8%)
 Frame = +3

Query  84    AKGTTIRKKLSSIQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPI  263
             A  TT+RK+  S+      +     + E+   P SP ++     V  F II ++ +S P+
Sbjct  4     AAATTLRKRALSVDTAAGRQGRTAPEAELG-EPVSPSARL----VEDFYIIVLMGASTPL  58

Query  264   EDDDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEF  443
                +   L    +  L   P F SI VTGK+G   W P  V +E+HL  P          
Sbjct  59    ---NIPALRAGIEAQLARYPHFRSIQVTGKDGNLRWAPTTVNVENHLIRPALDPAAVAAN  115

Query  444   YDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLS  623
              D  + +Y+  +S  P  ++QPLWE H+F +PTS A      ++H SLGDG SL+  L++
Sbjct  116   PDKAVEDYVASLSTLPMDRSQPLWEFHLFDFPTSEATSTAAIRVHHSLGDGMSLLTLLMA  175

Query  624   CLQRADN----PALPLTFPRRQGSGKKQGENSNA----VARAFKAVPRLLSGVVDTVTDF  779
             C + A +    PA+P   P R G+  ++   S      VA A+  V      VVD V   
Sbjct  176   CTRSAADPTRLPAMP-PLPARTGAIYQRPRPSAGVLPFVAWAWSFVVLAWHTVVDVV---  231

Query  780   SWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIV  959
                FL + L   D   +  + +  E +   +   + SL  +K +K+++  T+NDV+ G V
Sbjct  232   --GFLATILFLKDPHTMFKRMNHAETQRKRIVHRSLSLDDVKFVKNTMKCTVNDVLVG-V  288

Query  960   TYG--TRLYMQESERETCNGE--CTALVLFNTRAMGGGYKSVSEMIKP--NAEMPWGNRI  1121
             TY   +R + ++S       +    +++L N R     +  V+ MI+    +E+ WGN +
Sbjct  289   TYAALSRYHFRKSGETDTRKQIRVRSMLLVNLRPTTSLHACVN-MIESGKGSEVKWGNEL  347

Query  1122  TF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLE  1295
              F  LPF I        G   +PL ++    ++V R++ S  +  T    E   K+ GL+
Sbjct  348   GFIILPFFI--------GLHDDPLDYVRKGKKVVDRKKSSLEVVFTHVAAELILKVFGLK  399

Query  1296  ATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLR  1475
             A A    R + +T+I+  NM GPVE+     HPV  +  +  G P++L V   SY   + 
Sbjct  400   AAAAIFHRMISHTTISFANMTGPVEQVEFCGHPVVFIAPSGYGPPEALTVNYQSYVNTIM  459

Query  1476  LTI-ISEKDFIDVKKL  1520
             + + + E  F D  +L
Sbjct  460   INLALDEGRFPDYDEL  475



>ref|XP_010519416.1| PREDICTED: O-acyltransferase WSD1-like [Tarenaya hassleriana]
Length=500

 Score =   177 bits (450),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 133/483 (28%), Positives = 239/483 (49%), Gaps = 38/483 (8%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP ++  +S   +  II+V+     I+ D  VI   +++  +  +PRFSS +V   + 
Sbjct  20    PLSPAARLFHSPEFNCYIISVIGCKTKIDTD--VITQGLKETLIR-HPRFSSKLVIDGDK  76

Query  360   EKN--WKPVKVILEDHLKVPIFPVGKPL-EFYDYCLSEYLTKISMDPFPQTQPLWEIHIF  530
              +N  W   KV +EDH+ VP     + + E  D  L  Y++ ++  P   ++PLWE+H+ 
Sbjct  77    RQNQRWVRTKVNVEDHVVVPDMVASRRMTENPDEFLENYVSNLTSTPLDVSRPLWELHVL  136

Query  531   RYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSN  710
                TS+A    + K+H S+GDG SLM  +L+C ++  NP    + P +  S K +     
Sbjct  137   DIKTSDAENVAVLKVHHSIGDGMSLMSLVLACTRKTSNPMEIPSLPVKNRS-KSRLTGLR  195

Query  711   AVARAFKAVPRLLSGVVDTVTDF--SWNFLKSSL-LDDDKTAIHSQDDGV-EFRPISVTT  878
             + +R +  V  L S V+     F  ++ F+ ++L L D +T I  +  G+ E +P     
Sbjct  196   SQSRFWWLVLALWSSVLLVFNTFCDAFEFVATTLFLKDTETPIKGKRGGLMEEKPRRFVH  255

Query  879   MTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYM----------QESERETCNG-----  1013
              T S   +K IK+++N+T+NDV+ GI   G   Y+          QE++    +      
Sbjct  256   RTMSFDDIKLIKNTMNMTVNDVLLGITLAGLSRYLNRKYGDTEEKQEAKERNQDNLPKRI  315

Query  1014  ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPL  1187
                A VL N R    G +++++M+   ++  WGN I +  +PF+I            +PL
Sbjct  316   RLRAAVLVNLRP-DAGIQALADMMSKGSKCKWGNWIGYVVIPFSI--------ATRDDPL  366

Query  1188  RFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPV  1367
               +  A   + R+++S   +LT    +F  +  G++A A  + R + NT+++ +NM+GPV
Sbjct  367   EHLRRAKDTIDRKKHSLEAFLTFSVGKFILETFGVKAAADIIGRAVSNTTMSFSNMMGPV  426

Query  1368  EKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIESAF  1544
             E+ +   HP+  +  +  G P +L +   SY  K+ +++  +   I D  +L   +E + 
Sbjct  427   EEISFYGHPITYLAPSAYGHPHALTMHFQSYMNKMTMSLTVDSTVITDPHRLCDDLEESL  486

Query  1545  DEI  1553
               I
Sbjct  487   RTI  489



>ref|XP_002517896.1| hypothetical protein RCOM_1173910 [Ricinus communis]
 gb|EEF44414.1| hypothetical protein RCOM_1173910 [Ricinus communis]
Length=210

 Score =   169 bits (429),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 112/152 (74%), Gaps = 3/152 (2%)
 Frame = +3

Query  180  PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
            PASP  QY++SS+ S SIIAVLES VP+  DD  ++S ++D F  I+PR SSIMV    G
Sbjct  31   PASPTGQYLSSSMSSLSIIAVLESEVPV--DDYQVMSWLKDGF-HIHPRLSSIMVMNNRG  87

Query  360  EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
            EKNWK V+V LEDH++VPIFP G  L+  D  L +YL+K++M+  P+ QPLWE+HI +Y 
Sbjct  88   EKNWKKVEVKLEDHVEVPIFPTGMSLKSNDDHLDDYLSKVAMEELPKHQPLWEVHIVKYQ  147

Query  540  TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQR  635
            TSNA GN IFKLH SLGDG++LMG L SC + 
Sbjct  148  TSNAAGNVIFKLHHSLGDGFTLMGVLFSCFKE  179



>ref|XP_010054862.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
Length=517

 Score =   177 bits (450),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 134/463 (29%), Positives = 219/463 (47%), Gaps = 41/463 (9%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKN-  356
             P SP +Q  +    +  I+AV+    PI  D  VI S +    L  +PRFSS+ V  +  
Sbjct  44    PLSPSAQMFHEPNFNVYIVAVMGCKTPI--DLPVIKSNLVHTLLK-HPRFSSLQVEDEKE  100

Query  357   -GEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
              G+  W P  V LE H+ VP    G  ++  +  + +Y++ +S     +TQPLW+IHI  
Sbjct  101   KGKFRWIPTNVDLEKHIIVPKIKPG--MDSPERFIEDYVSNLSKTTICKTQPLWDIHILN  158

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQ-GENS  707
               TS+A    +F++H SLGDG SLM  LL+C ++  +P ALP T P ++   K+  G   
Sbjct  159   VKTSDAEAVGVFRIHHSLGDGTSLMSLLLACTRKISDPEALP-TIPVKKSKEKRDYGRIW  217

Query  708   NAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTF  887
               +      +  L +  VDT+      F  + L   D  +      GVE  P      T 
Sbjct  218   GWLLGVCWFLVLLWNTAVDTIM-----FGATVLFLKDSESPIKGPPGVELMPRRFVYRTV  272

Query  888   SLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQ---ESERETCNG------------ECT  1022
             SL  +K +K++LN T+NDV  G+   G   Y+     +E +  +G               
Sbjct  273   SLEDIKMVKNALNATVNDVALGVTQAGLSQYLHLRYAAETKKRHGATKIRNDLPKNLRLR  332

Query  1023  ALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFI  1196
             + +L N R    G + ++ M++ + E+ WGNRI +  +P  I           SNPL ++
Sbjct  333   STLLINLRP-SIGIQGLAAMMEKDTEVKWGNRIGYVLVPITI--------ALHSNPLDYV  383

Query  1197  YNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKT  1376
               A   + R+++S     T    E   KL G++A +    R + +T++  +N++GP+E+ 
Sbjct  384   REAKATINRKKHSLEAIFTHSIAEAVLKLFGIKAASALSHRVITHTTMCFSNLVGPLEEI  443

Query  1377  TLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
                 HP+  +     G P  L+V   SYA K+   + +++  I
Sbjct  444   GFYGHPLAYLAPGCYGQPHGLMVNFQSYANKMTFVVSADEGTI  486



>ref|XP_011092556.1| PREDICTED: O-acyltransferase WSD1-like isoform X1 [Sesamum indicum]
Length=465

 Score =   176 bits (447),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 142/488 (29%), Positives = 236/488 (48%), Gaps = 49/488 (10%)
 Frame = +3

Query  138   MESHLEGDDEVVLAPASP-FSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLP  314
             ME  +E D    L PA   F Q + + V++ +++       P  DD     +E+R   L 
Sbjct  1     MEEAMERDQP--LTPAGRLFLQPLMNQVINCAVVV----EFPF-DDVEAFKAELRSSILL  53

Query  315   INPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDY-CLSEYLTKISMD-  488
              +PRF S+MVT   G ++W+  +V ++ H+ V   P+   +   D   +++++  +S+  
Sbjct  54    QHPRFCSLMVTDSFGREHWRKTQVDVDRHVIVRHQPLSDDIHISDDDAVNDFVADLSVSS  113

Query  489   PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALPLTFP  668
             P P  +PLWEIH+       A    +F++H +LGDG SLM  LLSC +R D+P+ P   P
Sbjct  114   PLPTDKPLWEIHLLL-----AHKTVLFRVHHALGDGISLMSMLLSCCRRVDDPSQP---P  165

Query  669   RRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSW-------NFLKSSLLDDDKTA  827
                G G            A  + PR  +  V T+    W        F   +L   DKT 
Sbjct  166   TIGGVG------------AASSSPRRRAWSVSTLVKVVWYTLIYILEFSLRALCLRDKTT  213

Query  828   IHSQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTINDVISGIVTYGTRLYMQ-ESERE  1001
               S  DGVE  P  + +  F L  +K +K ++ + TINDV+ G+++ G   Y+  +S + 
Sbjct  214   AVSGGDGVELWPRRLASARFRLDDMKIVKRAVADATINDVLFGVISCGLSRYLDIKSPKG  273

Query  1002  TCNGE---CTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGD  1172
                 E    T + + N R   G  + + ++I   +   WGN+   L   +P     G   
Sbjct  274   KAMPEGLRITGVAMVNLRPQAG-LQEIWKLINSKSGSRWGNKFGML--LLPVYYHSG---  327

Query  1173  SSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTN  1352
              S+PL+F+  A  M+ +++ S     + +  +    L G +  +    R + NT+ T++N
Sbjct  328   GSDPLQFVKRAKTMIDKKKLSLEAPFSYKVGDLVMSLFGPKLASILNYRIVCNTTFTISN  387

Query  1353  MIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSC  1529
             ++GP E+ ++A +PVK +    S  P +L + M+SYAG   L I+  KD I D K L  C
Sbjct  388   VVGPREEISMAGNPVKNIRTTSSSLPHALTMHMVSYAGVADLQILVAKDIIPDPKVLADC  447

Query  1530  IESAFDEI  1553
              ++A  E+
Sbjct  448   FQNALLEM  455



>ref|NP_001276179.1| O-acyltransferase WSD1-like [Glycine max]
 gb|ACU20370.1| unknown [Glycine max]
Length=461

 Score =   176 bits (447),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 134/476 (28%), Positives = 233/476 (49%), Gaps = 34/476 (7%)
 Frame = +3

Query  153   EGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFS  332
             E  DE V+     F Q     V    I  V+    PI  D  ++ S++R+  +  +PRF+
Sbjct  3     ERGDEAVIPAGRLFLQAEMKQV----IHCVIGLKNPI--DAELVKSQVRNSTMLQHPRFT  56

Query  333   SIMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDP--FPQTQ  506
             S+MV G+ G ++W+P ++ ++ H+ +    VG+  E  +  +++YL ++S+D       +
Sbjct  57    SLMVRGEGGVEHWRPTEIDIDRHVLIIEEAVGEREEEDESAINKYLAELSIDSDGLSMEK  116

Query  507   PLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGS  683
             PLWEIH+ +     A    IF++H +LGDG SLM  LL+  ++ +NP ALP        S
Sbjct  117   PLWEIHLLK-----AHKCVIFRIHHALGDGISLMSMLLASCRKLNNPNALPTIAASASTS  171

Query  684   GKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRP  863
                    +N +        R L   +     F+  F+   L   D  +  +   GVE  P
Sbjct  172   ASTSASKTNLINF------RNLLATLWFCFIFALEFILRCLWIRDPKSALTGGAGVELWP  225

Query  864   ISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNG-----ECTAL  1028
               + T TFSL  +K +K++ N TINDV+  +++ G   Y+   +    NG     + T L
Sbjct  226   RKIATATFSLEDMKTVKTAANATINDVLFAVISSGISRYL---DFRAPNGLRDGVQLTGL  282

Query  1029  VLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAH  1208
              + N R    G + +S M++ N+   WGN+   +   I   R+    ++S+PL ++  A 
Sbjct  283   AMVNLRK-HPGLQELSNMMRSNSGARWGNKFGMILLPIYYHRT----NTSDPLEYLKRAK  337

Query  1209  RMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLAN  1388
              M+ R++ S     + +  +F     G +  +    R L +TS T++N++GP E+  +  
Sbjct  338   AMIDRKKRSLESSFSYKIGDFVMSTLGPKFASLLNYRILCHTSFTISNVVGPQEEIMIGG  397

Query  1389  HPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIESAFDEI  1553
             +P+  +    S  P +L++ M+SYAG+  + +   KD I D + L  C E A  E+
Sbjct  398   NPITFLRANNSALPHALILNMVSYAGRADMQVQVAKDIIPDPEFLAKCFEDALLEM  453



>ref|XP_008227241.1| PREDICTED: uncharacterized protein LOC103326781 [Prunus mume]
Length=382

 Score =   174 bits (442),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 126/194 (65%), Gaps = 7/194 (4%)
 Frame = +3

Query  981   MQESERETCNGECTALVLFNTRAMGGGYKSVSEMIKPN-AEMPWGNRITFLPFAIPKLRS  1157
             MQE  +++ N  CTALVL  TR + G Y S  EMI+ N A M  GN+  FL   +PK   
Sbjct  1     MQEVTQKSSNEHCTALVLLRTRNIEG-YTSTKEMIEHNNANMSRGNQFAFLHLPVPK---  56

Query  1158  PGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTS  1337
                 ++SNPL F++ A +M+K++R SA+ YLT   L+  +K RG E  A+++  TLKN+S
Sbjct  57    --STETSNPLDFVWEAQKMIKKKRNSATSYLTSWLLDVLKKFRGPEGAARYIHGTLKNSS  114

Query  1338  ITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFIDVKK  1517
             +T++NMIGPVEK  L + PV G+YF V G PQ L VT LSY GKLR+   +EK FID +K
Sbjct  115   MTISNMIGPVEKMALDSQPVGGLYFMVVGPPQCLTVTALSYMGKLRVAFGAEKGFIDSQK  174

Query  1518  LKSCIESAFDEIFR  1559
             LK+ +++AF  I  
Sbjct  175   LKASMQNAFGVILE  188



>emb|CDX96219.1| BnaC02g14320D [Brassica napus]
Length=490

 Score =   177 bits (448),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 126/457 (28%), Positives = 225/457 (49%), Gaps = 30/457 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI--MVTGK  353
             P SP S+  NS   + +II  +   V  + +   I+  ++   L  +PRFSSI  M  GK
Sbjct  18    PLSPCSRLFNSPDFNCAIIVTMGCKV--KGNPPAIIDGLKHT-LANHPRFSSILDMKNGK  74

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
              G+  W   KV +E+H+ VP   +    E  D  L +Y++K++  P   ++PLWEIH+  
Sbjct  75    KGKPRWVRTKVRVEEHVIVP--DIEPNTENPDQYLEDYISKLTTVPLDLSKPLWEIHVLC  132

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGEN-S  707
               TSNA    I K+H SLGDG SLM   L+C ++  +P ALP    +++  G        
Sbjct  133   LKTSNAESIGILKIHHSLGDGMSLMSLFLACTRKTSDPEALPTVAVQKKQFGPSCYTGFF  192

Query  708   NAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTF  887
             N +   F  +  +L  V +T  D     L    L D +T + ++  G E +P        
Sbjct  193   NKIWWLFVGLWFILRLVFNTFIDVLMFALTICFLGDTETPLLAK-PGSELKPKKFVYRII  251

Query  888   SLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECTAL---------VLFN  1040
             S   +K +K+++N+T+NDV+ G+   G   Y+     +    +   L         ++ N
Sbjct  252   SFDDVKLVKNAVNMTVNDVLLGVTQAGLSRYLSRRYDQAATPKSKDLMRRIRLRSAIMIN  311

Query  1041  TRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRM  1214
              R    G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A   
Sbjct  312   LRP-NTGIEALADMMAKKSKCRWGNLFGYILLPFSL--------GLETDPLEYLRRAKVT  362

Query  1215  VKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHP  1394
             V R+++S     +  F +   K+ GL+A+   +R+ + +T+++ +N++GP E+ T   HP
Sbjct  363   VDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGHP  422

Query  1395  VKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             +  +  +V G P +L +   SY  K+ +++ ++   I
Sbjct  423   LSYIAPSVFGHPHALTLHFQSYENKVIISVTADPTVI  459



>ref|NP_200151.2| bifunctional wax ester synthase/diacylglycerol acyltransferase 
[Arabidopsis thaliana]
 dbj|BAD83884.1| FOLDED PETALS [Arabidopsis thaliana]
 gb|AED96347.1| O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]
Length=486

 Score =   177 bits (448),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 124/455 (27%), Positives = 225/455 (49%), Gaps = 28/455 (6%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP S+  NS   + +II  + S V  + D   I+  +    +  +PRFSSI+      
Sbjct  16    PLSPCSRLFNSPDFNCAIIVTMGSKV--KGDTPAIIHGLEHTLVN-HPRFSSILEMNNGK  72

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             +  W   KV +E+H+ VP   V   +E  D  L +Y++K++  P   ++PLWE+H+    
Sbjct  73    KPRWVRTKVKVEEHVIVP--DVDPDIENPDQYLEDYISKLTTIPMDLSKPLWEMHLLGVK  130

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGEN-SNA  713
             TSNA    I K+H SLGDG SLM  LL+C ++  +P ALP     ++  G        N 
Sbjct  131   TSNAESYAILKIHHSLGDGMSLMSLLLACTRKTSDPEALPTVAVHKKRFGPSCNSGFFNK  190

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
             +   F  +  +L  + +T  D     L   +L D +T + ++  G E  P        S 
Sbjct  191   IWWLFVGLWFILRLLFNTFVDILMFALTIFVLRDTETPLLAK-PGSELIPKRFVHRIISF  249

Query  894   YHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQE----SERETCNGECTALVLFNTR  1046
               +K +K+++ +T+NDV+ G+   G     +R Y QE    S+         + ++ N R
Sbjct  250   DDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRKYDQEATPKSKESMRRIRLRSAIMINLR  309

Query  1047  AMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRMVK  1220
                 G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A   + 
Sbjct  310   P-NAGIEALADMMAKKSKCRWGNLFGYILLPFSV--------GLETDPLEYVRQAKATID  360

Query  1221  RQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVK  1400
             R+++S     +  F +   K+ GL+A+   +R+ + +T+++ +N++GP E+ T   HP+ 
Sbjct  361   RKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGHPLN  420

Query  1401  GMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
              +   V G P +L +   +YA K+ +++ ++   I
Sbjct  421   YISPCVFGHPHALTLHFQTYANKVIISVTADPTVI  455



>dbj|BAB09801.1| unnamed protein product [Arabidopsis thaliana]
Length=485

 Score =   176 bits (447),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 127/456 (28%), Positives = 229/456 (50%), Gaps = 31/456 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP S+  NS   + +II  + S V  + D   I+  +    +  +PRFSSI++   NG
Sbjct  16    PLSPCSRLFNSPDFNCAIIVTMGSKV--KGDTPAIIHGLEHTLVN-HPRFSSILMN--NG  70

Query  360   EK-NWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRY  536
             +K  W   KV +E+H+ VP   V   +E  D  L +Y++K++  P   ++PLWE+H+   
Sbjct  71    KKPRWVRTKVKVEEHVIVP--DVDPDIENPDQYLEDYISKLTTIPMDLSKPLWEMHLLGV  128

Query  537   PTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGEN-SN  710
              TSNA    I K+H SLGDG SLM  LL+C ++  +P ALP     ++  G        N
Sbjct  129   KTSNAESYAILKIHHSLGDGMSLMSLLLACTRKTSDPEALPTVAVHKKRFGPSCNSGFFN  188

Query  711   AVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFS  890
              +   F  +  +L  + +T  D     L   +L D +T + ++  G E  P        S
Sbjct  189   KIWWLFVGLWFILRLLFNTFVDILMFALTIFVLRDTETPLLAK-PGSELIPKRFVHRIIS  247

Query  891   LYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQE----SERETCNGECTALVLFNT  1043
                +K +K+++ +T+NDV+ G+   G     +R Y QE    S+         + ++ N 
Sbjct  248   FDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRKYDQEATPKSKESMRRIRLRSAIMINL  307

Query  1044  RAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRMV  1217
             R    G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A   +
Sbjct  308   RP-NAGIEALADMMAKKSKCRWGNLFGYILLPFSV--------GLETDPLEYVRQAKATI  358

Query  1218  KRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPV  1397
              R+++S     +  F +   K+ GL+A+   +R+ + +T+++ +N++GP E+ T   HP+
Sbjct  359   DRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGHPL  418

Query  1398  KGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
               +   V G P +L +   +YA K+ +++ ++   I
Sbjct  419   NYISPCVFGHPHALTLHFQTYANKVIISVTADPTVI  454



>ref|XP_004235106.1| PREDICTED: O-acyltransferase WSD1-like [Solanum lycopersicum]
Length=500

 Score =   177 bits (448),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 134/461 (29%), Positives = 223/461 (48%), Gaps = 42/461 (9%)
 Frame = +3

Query  183   ASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI-MVTGKNG  359
             ASP ++  ++  L+  IIA+L  +  I  D  VI   +    L  +PRFSSI +V  K G
Sbjct  35    ASPATRLFHTKNLNCHIIAILGCTTKINPD--VIKKGLESTLLN-HPRFSSIPVVDEKKG  91

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
              +NWK  KV +E+H+  P   +   ++  D  L  Y + ++  P   T+PLWE+HI    
Sbjct  92    VRNWKKTKVNVEEHIVCP--DLDPDMDSPDEYLENYTSNLTTIPLDMTKPLWEVHILNIK  149

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGENSNAV  716
             TS A    I KLH S+GDG S++  +L+C ++A +P ALP T P    S  K+ +N   +
Sbjct  150   TSEANAIGILKLHHSIGDGMSIVSLILACTRKASDPEALP-TLP----SSTKKEKNDVGL  204

Query  717   ARAFKAVPRLLSGVV-DTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
              R F      L  V   T+ D    FL + L   D         GVE  P  +   T SL
Sbjct  205   LRRFCYYVWFLCMVFWYTIVDVVL-FLATILFLKDTETPMKGGVGVEHSPKRLVHTTASL  263

Query  894   YHLKQIKSSLNVTINDVISGIVTYGTRLYMQESERETCNGECT-------------ALVL  1034
               +K +K++LN+TINDV+ G+   G   Y+         G+ +               ++
Sbjct  264   DDMKIVKNALNLTINDVVMGMAQAGFSRYLNRRYGNKNGGKGSNKTNNLPKNIRLRGSIV  323

Query  1035  FNTRAMGGGYKSVSEMIKPNAEMPWGNRI----TFLPFAIPKLRSPGDGDSSNPLRFIYN  1202
             FN R    G K+++EM++  ++  WGN+I    T LP ++P           +PL +I  
Sbjct  324   FNIRP-STGIKALAEMMEKKSKARWGNKIGYVLTRLPISLP----------DDPLDYIRQ  372

Query  1203  AHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTL  1382
             A  ++ R++ S     +    + T+ + G +  ++  RR L +T++ ++N++GP E+ T 
Sbjct  373   AKNIIDRKKLSLESRFSFTAAKLTQDIFGSKVASKVTRRVLSSTTVLISNVVGPQEEITF  432

Query  1383  ANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
               H +  +     G P ++ +   SY  K+ +++  +   I
Sbjct  433   YGHKLAYVAPTTFGLPYAVTIHFQSYCNKMTISMAVDSQVI  473



>ref|XP_002865972.1| hypothetical protein ARALYDRAFT_918418 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42231.1| hypothetical protein ARALYDRAFT_918418 [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score =   176 bits (447),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 127/457 (28%), Positives = 226/457 (49%), Gaps = 30/457 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI--MVTGK  353
             P SP S+  NS   + +II  + S V  + D   I+  +    +  +PRFSSI  M  GK
Sbjct  16    PLSPCSRLFNSPDFNCAIIVTMGSRV--KGDTPAIIHGLEHTLVN-HPRFSSILEMNNGK  72

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
              G+  W   KV +E+H+ VP   +   +E  D  L +Y++K++  P   ++PLWE+H+  
Sbjct  73    KGKPRWVRTKVKVEEHVIVP--DIDPDIENPDQYLEDYISKLTTIPMDLSKPLWEMHLLG  130

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGEN-S  707
               T NA    I K+H SLGDG SLM  LL+C ++  +P ALP    +++  G        
Sbjct  131   LKTLNAESFAILKIHHSLGDGMSLMSLLLACTRKTSDPQALPTVAVQKKRFGPSCNSGFF  190

Query  708   NAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTF  887
             N +   F  +  ++  + +T  D     L    L D +T + ++  G E  P        
Sbjct  191   NKIWWLFVGLWFIIRLLFNTFVDILMFALTIFFLRDTETPLLAK-PGSELTPKRFIHRII  249

Query  888   SLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQE----SERETCNGECTALVLFN  1040
             S   +K +K+++ +T+NDV+ G+   G     +R Y QE    S+         + ++ N
Sbjct  250   SFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRRYDQEATPKSKESMRKIRLRSAIMIN  309

Query  1041  TRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRM  1214
              R    G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A   
Sbjct  310   LRP-NTGIEALADMMAKKSKCRWGNLFGYILLPFSV--------GLEADPLEYVRQAKAT  360

Query  1215  VKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHP  1394
             + R++ S     +  F +   K+ GL+A+   +R+ + +T++T +N++GP E+ T   HP
Sbjct  361   IDRKKNSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLTFSNVVGPKEEITFHGHP  420

Query  1395  VKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             +  +   V G P +L +   SYA K+ +++ ++   I
Sbjct  421   LNYISPCVFGHPHALTLHFQSYANKVIISVTADPTVI  457



>ref|XP_006401711.1| hypothetical protein EUTSA_v10013378mg [Eutrema salsugineum]
 gb|ESQ43164.1| hypothetical protein EUTSA_v10013378mg [Eutrema salsugineum]
Length=489

 Score =   176 bits (446),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 129/464 (28%), Positives = 233/464 (50%), Gaps = 31/464 (7%)
 Frame = +3

Query  162   DEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI-  338
             D V   P SP S+  NS   + +II  +   V  + + + I+  ++   +  +PRFSSI 
Sbjct  10    DTVEEEPLSPCSRLFNSPEFNCAIIVTMGCKV--KGNPAAIIDGLKHTLVN-HPRFSSIL  66

Query  339   -MVTGKNGEKNWKPVKVILEDHLKVP-IFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPL  512
              M  GK G+ +W   KV +E+H+ VP I P    +E +D  L +Y++K++  P   ++PL
Sbjct  67    EMDKGKKGKPSWVRTKVNVEEHVIVPDIDP--DNIENHDQYLEDYISKLTTIPMDLSKPL  124

Query  513   WEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGK  689
             WEIH+    TSNA    + K+H SLGDG SLM   L+C +++ +P ALP    +++  G 
Sbjct  125   WEIHLLCLKTSNAESIGLLKIHHSLGDGMSLMSLFLACTRKSSDPEALPTVAVQKKRFGP  184

Query  690   KQGEN-SNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPI  866
             +      N +   F  +  +L    +T  D     L    L D +T + ++  G E  P 
Sbjct  185   RCYSGFFNKIWWFFLGLWCILRLFFNTFVDVLMFALTICFLRDTETPLLAK-PGSELIPK  243

Query  867   SVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQE----SERETCNGEC  1019
                    S   +K +K+++ +T+NDV+ G+   G      R Y QE    S+        
Sbjct  244   RFVHRIISFDDVKLVKNAMKMTVNDVLLGVTQAGLSRYLNRRYDQEATPKSKESMRRIRL  303

Query  1020  TALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRF  1193
              + ++ N R    G +++++M+   ++  WGN   +  LPF++        G  ++PL +
Sbjct  304   RSAIMINLRP-NTGIEALADMMAKKSKCRWGNLFGYILLPFSV--------GLETDPLEY  354

Query  1194  IYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEK  1373
             +  A   V R+++S     +  F +   K+ GL+A+   +R+ + +T+++ +N++GP E+
Sbjct  355   VRRAKDTVDRKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEE  414

Query  1374  TTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
              T   HP+  +  +V G P +L +   SY  K+ +++ ++   I
Sbjct  415   ITFHGHPLSYIAPSVFGHPHALTLHFQSYENKVIISVTADPTVI  458



>gb|KDP25010.1| hypothetical protein JCGZ_23993 [Jatropha curcas]
Length=469

 Score =   175 bits (444),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 124/441 (28%), Positives = 212/441 (48%), Gaps = 38/441 (9%)
 Frame = +3

Query  270   DDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVPIFPV------GK  431
             D   I + +++  +  +PRF S++V  KNG ++W+  +V ++ H++V           G 
Sbjct  40    DIDTIKTIVKNSLMIQHPRFCSLLVRDKNGLEHWRRTEVDIDRHIRVVKTAASATSNDGY  99

Query  432   PLEFYDYCLSEYLTKISMD-PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLM  608
               +  +  +++Y+  +++  P    +PLWEIH             +F++H +LGDG SLM
Sbjct  100   SDDDVERIINDYIADLAVSTPLSLDKPLWEIHFLEKEKC-----LVFRIHHALGDGISLM  154

Query  609   GALLSCLQRADNP---ALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDF  779
               LL+  ++AD+P   A  +T  RR   G+K  +    +  A K +  L S V      F
Sbjct  155   SMLLASCRKADDPEAVATLVTAGRRDWQGRKGKDWIRTLMAALKMI--LFSFV------F  206

Query  780   SWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTINDVISGI  956
                F+   L   D+  + S  DG E  P  V T  F +  +K +K ++ N TINDV+ G+
Sbjct  207   CLEFILRCLFVRDRKTVISGGDGTELWPRKVATAKFRIEDMKAVKKAVANATINDVLFGV  266

Query  957   VTYGTRLYMQE----SERETCNGECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRIT  1124
             ++ G   Y+      S RE    + T L + N R   G  + + EM+K N+   WGN+  
Sbjct  267   ISAGLSRYLDHRSPNSLRE--GQQLTGLSMVNLREQPG-LQDLKEMMKSNSASRWGNKFG  323

Query  1125  FLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATA  1304
             FL   +             PL+++  A  M+ R++ +   + T +  +      G +   
Sbjct  324   FLLLPVHY------HHKMEPLQYVKRAKTMIDRKKQTLEAHFTYRIGDLVMSWLGSKVAY  377

Query  1305  QFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTI  1484
                 R L +T+ T++N+IGP E+ TL  +P+  M    S  PQ++ + M+SYAG+  + I
Sbjct  378   LLNYRILCHTTFTISNVIGPKEEITLEGNPITFMRANTSSLPQAVAMHMVSYAGRADMQI  437

Query  1485  ISEKDFI-DVKKLKSCIESAF  1544
             +  KD I D + L  C E + 
Sbjct  438   VVAKDIIPDPEFLAKCFEDSL  458



>ref|XP_009588191.1| PREDICTED: O-acyltransferase WSD1-like [Nicotiana tomentosiformis]
Length=482

 Score =   176 bits (445),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 132/446 (30%), Positives = 215/446 (48%), Gaps = 27/446 (6%)
 Frame = +3

Query  240   VLESSVPIED--DDSVILSEIRDVFLPINPRFSSIMVTGKNGEKNWKPVKVILEDHLKVP  413
             V+  ++ + D  D   +  EI +  L  +PRFSSIMV    G + W+  +V ++DH  + 
Sbjct  46    VINCAIAVHDPFDVDAVKLEISNSILVKHPRFSSIMVKDSCGRERWRKTEVNVDDHFIIR  105

Query  414   IFPVGKPLEFYDY-CLSEYLTKISMD-PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSL  587
               P+       D   ++EYL  +S+  P   T+PLWE H+       A    + +LH +L
Sbjct  106   REPLTDDPSVSDEDAINEYLADLSVSTPLSVTKPLWEFHLLL-----AHKCAVLRLHHAL  160

Query  588   GDGYSLMGALLSCLQRADNPALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDT  767
             GDG SLM   LSC +RAD+P      P  QG G      SN    + K + +++   +  
Sbjct  161   GDGISLMSMFLSCCRRADDPN---QHPTSQGIGTSTSL-SNHWRLSLKKLMKVIWYTLVY  216

Query  768   VTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSL-NVTINDV  944
             V  F    L+S  L D KTAI S   GVE  P  + T  F +  +K +K ++ N TINDV
Sbjct  217   VIKFG---LRSLWLKDKKTAI-SGGAGVELWPRKLATAKFKIDDMKTVKKAISNATINDV  272

Query  945   ISGIVTYGTRLYMQ-ESERETCNG-ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNR  1118
             + GI++ G   Y+   S +    G + T + + N R   G  +  S+++   +   WGN+
Sbjct  273   LFGIISCGLSRYLDLRSPKALQEGLQITGVAMVNLRKQSG-LQDFSQLMNSKSGARWGNK  331

Query  1119  ITFLPFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEA  1298
                L   +P     G    S+PL+++  A  M+ +++ S     + +  +      G++ 
Sbjct  332   FGML--LLPVYYHKG---GSDPLQYVRRAKEMIDKKKLSLEGPCSYKIGDTVMSYFGVKP  386

Query  1299  TAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRL  1478
              +    R   NT+ T++N+IGP E  T   + +  +    S  P ++ + M+SYAG+  +
Sbjct  387   ASLLNYRIFSNTTFTISNVIGPQEDITFVGNRISSVRVTSSALPHAITMHMVSYAGRADM  446

Query  1479  TIISEKDFI-DVKKLKSCIESAFDEI  1553
              I+  KD I D K L  C + A  E+
Sbjct  447   QILVAKDIIPDPKILAKCFQDALLEM  472



>ref|XP_010028434.1| PREDICTED: O-acyltransferase WSD1-like [Eucalyptus grandis]
Length=469

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 138/475 (29%), Positives = 225/475 (47%), Gaps = 33/475 (7%)
 Frame = +3

Query  156   GDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSS  335
             G DE    P +P  +      ++  I  V+    P++ D   + S I+   +  +PRF S
Sbjct  7     GPDE----PLTPAGRLFLQKEMNQVIYCVVGVKHPLDVD--ALKSAIQSSLMVKHPRFCS  60

Query  336   IMVTGKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDP---FPQTQ  506
             +MV    G ++W+  +V ++ H+ V   PV   L   +  ++EYL  +S D        +
Sbjct  61    LMVRDSAGREHWRRTRVDMDRHVVVVHGPVADGLS-DEAAVNEYLADLSTDSPGLLGDDK  119

Query  507   PLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGS  683
             PLW++H+       A    +F++H +LGDG SLM   L+  +R D+P ALP   P     
Sbjct  120   PLWDVHLLM-----AHRCLVFRIHHALGDGISLMSMFLASCRRVDDPEALPTIGP----P  170

Query  684   GKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNF-LKSSLLDDDKTAIHSQDDGVEFR  860
                +          +KAV R+L GVV     F   F L+S  + D KT + S   GVE  
Sbjct  171   SSGKRRRGGGGGEWWKAVERVL-GVVWFTLVFVVEFVLRSMWVSDRKTPV-SGGAGVELW  228

Query  861   PISVTTMTFSLYHLKQIKSSL-NVTINDVISGIVTYGTRLYMQESERETC--NGECTALV  1031
             P  + T  F L  +K +KS++ N TINDV+ GI++ G   Y+     +        T + 
Sbjct  229   PRKLATARFRLEDMKVVKSAVANATINDVLFGIISAGLFRYLDHRSPDAVREGTRITGVA  288

Query  1032  LFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFLPFAIPKLRSPGDGDSSNPLRFIYNAHR  1211
             + N R   G  + +S ++K N  + WGN+   L   +   RS GD     PL ++  A  
Sbjct  289   MVNLREQPG-LQELSNLMKGNPGLRWGNKFGILLLPVHYHRSSGD-----PLEYLRKAKS  342

Query  1212  MVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANH  1391
             M+ R++ S   +L+ +  +      G    +    R + NT+ T++N++GP E+  +  +
Sbjct  343   MIDRKKKSLEAHLSYKIGDIAMTYLGARIASLLNYRIVCNTTFTISNVLGPHEEIAVVGN  402

Query  1392  PVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DVKKLKSCIESAFDEI  1553
             P+  +    S  P +L + M+SYAG+  + I+  KD I D   L  C E A  E+
Sbjct  403   PITYIRANSSSLPHALTMHMVSYAGRADMQILVAKDIIPDPDFLAKCFEDALLEM  457



>ref|XP_009127172.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
 emb|CDY49169.1| BnaA02g10280D [Brassica napus]
Length=489

 Score =   175 bits (443),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 127/457 (28%), Positives = 228/457 (50%), Gaps = 30/457 (7%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSI--MVTGK  353
             P SP S+  NS   + +II  +   V  + +   I+  ++   L  +PRFSSI  M  GK
Sbjct  17    PLSPCSRLFNSPDFNCAIIVTMGCKV--KGNPPAIIEGLKHT-LANHPRFSSILDMKNGK  73

Query  354   NGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFR  533
              G   W   K+ +E+H+ VP   +    E  D  L +Y++K++  P   ++PLWEIH+  
Sbjct  74    KGTPRWVRTKIRVEEHVIVP--DIEPNTENPDQYLEDYISKLTTVPLDLSKPLWEIHVLC  131

Query  534   YPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGEN-S  707
               TSNA    I K+H SLGDG SLM   L+C ++  +P ALP    +++  G        
Sbjct  132   LKTSNAESIGILKIHHSLGDGMSLMSLFLACTRKTSDPEALPTVAVQKKQFGPSCYTGFF  191

Query  708   NAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTF  887
             N +   F  +  +L  V +T  D     L    L D +T + ++  G E +P        
Sbjct  192   NKIWWLFVGLWFILRLVFNTFIDVLMFALTICFLRDTETPLLAK-PGSELKPKKFVYRII  250

Query  888   SLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQESERETCNG----ECTALVLFN  1040
             S   +K +K+++N+T+NDV+ G+   G     +R Y QE+  ++ +        + ++ N
Sbjct  251   SFDDVKLVKNAMNMTVNDVLLGVTQAGLSRYLSRRYDQEATPKSKDLMRRIRLRSAIMIN  310

Query  1041  TRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRM  1214
              R    G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A   
Sbjct  311   LRP-NTGIEALADMMAKKSKCKWGNLFGYILLPFSL--------GLETDPLEYLRRAKVT  361

Query  1215  VKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHP  1394
             V R++ S     +  F +   K+ GL+A+   +R+ + +T+++ +N++GP E+ T   HP
Sbjct  362   VDRKKQSLEAVFSMAFFKLILKVMGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGHP  421

Query  1395  VKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
             +  +  +V G P +L +   SY  K+ +++ ++   I
Sbjct  422   LSYIAPSVFGHPHALTLHFQSYENKVIISVTADPTVI  458



>ref|XP_010266526.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Nelumbo nucifera]
Length=506

 Score =   175 bits (444),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 143/494 (29%), Positives = 234/494 (47%), Gaps = 43/494 (9%)
 Frame = +3

Query  135   TMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLP  314
             T  S+ E  DE    P SP ++       +  IIA++     I+ D  VI + +    L 
Sbjct  27    TEMSYGETTDE---QPLSPAARIFREPNFNCYIIAIMGCKTKIDPD--VIKAGLETTLLK  81

Query  315   INPRFSSIMVT--GKNGEKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMD  488
              +PRFSSI V   GK+GE NW   KV L++H+ VP   +   +E  D  L +Y++ ++  
Sbjct  82    -HPRFSSIQVASEGKSGEMNWVRTKVDLDNHVIVP--ELDPNMESLDQFLEDYVSDLTRT  138

Query  489   PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQR-ADNPALPLTF  665
                 ++PLWE+H+    TS A    +F++H SLGDG SL+  LL+C ++ +D  ALP   
Sbjct  139   AIDMSKPLWELHLLNVKTSEAEAVGVFRIHHSLGDGMSLISLLLACTRKSSDGGALPTIP  198

Query  666   PRRQGSGKKQGENSNAVARAFKAVPRLL-SGVVDTVTDFSWNFLKSSLLDDDKTAIHSQD  842
              +++ +    G     V  +  AV  LL +  VD      + FL +S+   D        
Sbjct  199   VQKRAATGTSGSWFLWVLSSVLAVLHLLWNSTVDI-----FKFLATSVFIKDTDTPLKGG  253

Query  843   DGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYM----------QES  992
              GV F        T SL  +K +K+ L +TINDV+ G+   G   Y+          +E+
Sbjct  254   RGVGFTRKRFVHRTVSLDDIKLVKNELKMTINDVVLGVTQGGLSRYLNRRYGESKMDEEA  313

Query  993   ERETCNG----ECTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLR  1154
              R+  N        A +L N R    G +++++M+   +E  WGN + +  LPF I    
Sbjct  314   TRKRNNLPKHIRLRAALLVNIRP-STGIQALADMMDNKSEAKWGNWLGYVLLPFKIAL--  370

Query  1155  SPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNT  1334
                     +PL ++  A   + R++ S     T        K  G +A A    R L NT
Sbjct  371   ------HDDPLDYVREAKATIDRKKISLESMFTFVCATIIVKSIGQKAAALLCHRILSNT  424

Query  1335  SITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI-DV  1511
             +++ +N++GPVE+ +   HP+  +  +V G P +L +   SY  K+ + +  ++D I D 
Sbjct  425   TMSYSNVVGPVEEISFCGHPIVYLAPSVYGHPHALTIHFQSYMDKMTIVLAVDQDVIPDP  484

Query  1512  KKLKSCIESAFDEI  1553
             ++L   +E +   I
Sbjct  485   QRLLGDLEESLKLI  498



>dbj|BAC42871.1| unknown protein [Arabidopsis thaliana]
Length=486

 Score =   174 bits (442),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 123/455 (27%), Positives = 225/455 (49%), Gaps = 28/455 (6%)
 Frame = +3

Query  180   PASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVFLPINPRFSSIMVTGKNG  359
             P SP S+  NS   + +II  + S V  + D   I+  +    +  +PRFSSI+      
Sbjct  16    PLSPCSRLFNSPDFNCAIIVTMGSKV--KGDTPAIIHGLEHTLVN-HPRFSSILEMNNGK  72

Query  360   EKNWKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYP  539
             +  W   KV +E+H+ VP   V   +E  D  L +Y++K++  P   ++PLWE+H+    
Sbjct  73    KPRWVRTKVKVEEHVIVP--DVDPDIENPDQYLEDYISKLTTIPMDLSKPLWEMHLLGVK  130

Query  540   TSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGEN-SNA  713
             TS+A    I K+H SLGDG SLM  LL+C ++  +P ALP     ++  G        N 
Sbjct  131   TSSAESYAILKIHHSLGDGMSLMSLLLACTRKTSDPEALPTVAVHKKRFGPSCNSGFFNK  190

Query  714   VARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSL  893
             +   F  +  +L  + +T  D     L   +L D +T + ++  G E  P        S 
Sbjct  191   IWWLFVGLWFILRLLFNTFVDILMFALTIFVLRDTETPLLAK-PGSELIPKRFVHRIISF  249

Query  894   YHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQE----SERETCNGECTALVLFNTR  1046
               +K +K+++ +T+NDV+ G+   G     +R Y QE    S+         + ++ N R
Sbjct  250   DDVKLVKNAMKMTVNDVLLGVTQAGLSRYLSRKYDQEATPKSKESMRRIRLRSAIMINLR  309

Query  1047  AMGGGYKSVSEMIKPNAEMPWGNRITF--LPFAIPKLRSPGDGDSSNPLRFIYNAHRMVK  1220
                 G +++++M+   ++  WGN   +  LPF++        G  ++PL ++  A   + 
Sbjct  310   P-NAGIEALADMMAKKSKCRWGNLFGYILLPFSV--------GLETDPLEYVRQAKATID  360

Query  1221  RQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVK  1400
             R+++S     +  F +   K+ GL+A+   +R+ + +T+++ +N++GP E+ T   HP+ 
Sbjct  361   RKKHSLEAVFSMAFFKLILKVLGLKASVVLVRKVIHSTTLSFSNVVGPKEEITFHGHPLN  420

Query  1401  GMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
              +   V G P +L +   +YA K+ +++ ++   I
Sbjct  421   YISPCVFGHPHALTLHFQTYANKVIISVTADPTVI  455



>ref|XP_009151884.1| PREDICTED: O-acyltransferase WSD1-like [Brassica rapa]
Length=511

 Score =   175 bits (443),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 141/504 (28%), Positives = 247/504 (49%), Gaps = 45/504 (9%)
 Frame = +3

Query  129   KTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPIEDDDSVILSEIRDVF  308
             +TTM    E +DE    P SP ++  ++   +  +I+V+     IE D  VI+  ++   
Sbjct  13    ETTMRKDEEEEDE---QPLSPAARVFHAPEFNCYVISVIGVKKKIEPD--VIMEGLKQTL  67

Query  309   LPINPRFSSIMVTGKN--GEKN-WKPVKVILEDHLKVP-IFPVGKPLEFYDYCLSEYLTK  476
             +  +PRFSS MV+ +N  G+   W    V++ DH+ VP I          D  L  Y++ 
Sbjct  68    IR-HPRFSSKMVSKRNENGQTQIWVRTNVVVSDHVIVPDIQTQNIENANADKFLESYVSD  126

Query  477   ISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNPALP  656
             +++ P   ++PLWE+H+    TS+A    + K H SLGDG SLM  +L+C+++  NP   
Sbjct  127   LTLIPLDTSKPLWELHLLDLKTSDAENVAVLKFHHSLGDGMSLMALVLACMRKTSNPDEL  186

Query  657   LTFPRRQGSGKKQ---GENSNAVARAFKAVPRLLSG---VVDTVTDFSWNFLKSSL-LDD  815
              T P +  S  +       S    R    +  L S    V++T+ D +  F+ +++ L D
Sbjct  187   PTLPNQNRSSSRSSRLKAGSRGDFRFLWLIMALWSAIMLVLNTMCD-ALEFIATAMFLKD  245

Query  816   DKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYGTRLYMQE--  989
              +T I       + + +S+   T SL  +K IK+++N+T+NDV+ G+   G   Y++   
Sbjct  246   TETPIKGDFRLSKHKRMSLVHRTVSLDDIKLIKNTMNMTVNDVVLGVTQAGLSQYLETRY  305

Query  990   SERETCNGE-------------CTALVLFNTRAMGGGYKSVSEMIKPNAEMPWGNRITFL  1130
              E++   GE               + +L N R    G + +S+M+   ++  WGN I ++
Sbjct  306   GEKKKKLGEDQRNSNHMPKIIRLRSAILVNLRP-TTGIQDLSDMMAKGSKCRWGNWIGYI  364

Query  1131  --PFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATA  1304
               PF+I        G   +PL  + +A R++ R++ S    LT    +   K  G++ TA
Sbjct  365   VFPFSI--------GLRKDPLEHLRSAKRIIDRKKNSLEAALTFIVGKLMIKSFGVKMTA  416

Query  1305  QFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTI  1484
               + R L NT+++ +N+IGP+E+ +   HP+  M  +V G P +L +   SY  K+ +++
Sbjct  417   NIINRALSNTTMSFSNLIGPIEEISFFGHPIAYMAPSVYGHPHALTMHFQSYMNKMTISL  476

Query  1485  ISEKDFI-DVKKLKSCIESAFDEI  1553
               +   I D  +L    E +   I
Sbjct  477   TVDPTVISDTHRLLDNWEESLKNI  500



>ref|XP_002523348.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39064.1| conserved hypothetical protein [Ricinus communis]
Length=506

 Score =   174 bits (441),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 144/492 (29%), Positives = 238/492 (48%), Gaps = 48/492 (10%)
 Frame = +3

Query  87    KGTTIRK-KLSSIQVKTTMESHLEGDDEVVLAPASPFSQYMNSSVLSFSIIAVLESSVPI  263
             +G   RK  L  I++ T +++  EG  E    P SP S+  +    +  +IAV+     +
Sbjct  2     EGLKCRKPDLKPIEI-TKVDNDREGIAEEEEEPLSPASRLFHEPNFNVYVIAVIGCKTQV  60

Query  264   EDDDSVILSEIRDVFLPINPRFSSIMVTGK--NGEKNWKPVKVILEDHLKVPIF------  419
             +    ++ + +    L  +PRFSS+ VT +  N E  W   KV L+ H+ VP        
Sbjct  61    QP--HIVKANLEHTLLK-HPRFSSLQVTDEKNNKEMKWVRTKVDLDKHVIVPELNRSMDS  117

Query  420   PVGKPLEFYDYCLSEYLTKISMDPFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGY  599
             P  K +E Y + L++  T IS     ++QPLW++H+    TS+A    +F++H SLGDG 
Sbjct  118   PADKFIEDYIFNLTK--TTIS-----KSQPLWDLHLLNISTSDAESIGVFRIHHSLGDGT  170

Query  600   SLMGALLSCLQRADNP-ALPLTFPRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTD  776
             SLM  LL+C ++  +P ALP T P      KK+ E +    R   AV  ++    +TV D
Sbjct  171   SLMSLLLACTRQVSDPEALP-TLPTMTKKKKKKQEENGKFWRYVMAVWWVIQLFWNTVVD  229

Query  777   FSWNFLKSSLLDDDKTAIHSQDDGVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGI  956
                  + +  L+D +T I  +  GVEF P  +   T SL  +K +K+++N TINDV  G+
Sbjct  230   VLMFTVTALFLNDSETPIKGR-PGVEFTPRRLIWRTVSLDDIKLVKNAMNTTINDVALGV  288

Query  957   VTYGTRLYM------QESERETC--------NGECTALVLFNTRAMGGGYKSVSEMIKPN  1094
                G   Y+      ++ + ET         N    A +L N R    G +++++M++ N
Sbjct  289   TQAGLSQYLNRKYGGRKKDEETTQFRNNLPKNISLRATLLINIRP-APGIQALADMMEKN  347

Query  1095  AEMPWGNRITFL--PFAIPKLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLE  1268
             +E  WGN I ++  PF I        G   +PL +I  A     R++ S     T    E
Sbjct  348   SEAKWGNWIGYVLFPFTI--------GIRDDPLDYIREAKAAADRKKQSLEAIYTFSIAE  399

Query  1269  FTRKLRGLEATAQFLRRTLKNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVT  1448
                KL G +       RT+ +T++  ++++GP E+     HP+  +  +    P +L++ 
Sbjct  400   IVLKLFGTKVANALSHRTIYHTTMCFSSLVGPPEEIEFYGHPIAFLAPSSFNQPHALMIN  459

Query  1449  MLSYAGKLRLTI  1484
               SYA K+ + +
Sbjct  460   FQSYANKMTIVL  471



>ref|XP_011024820.1| PREDICTED: O-acyltransferase WSD1-like isoform X2 [Populus euphratica]
Length=525

 Score =   174 bits (442),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 132/437 (30%), Positives = 217/437 (50%), Gaps = 41/437 (9%)
 Frame = +3

Query  318   NPRFSSIMVTGKN--GEKN-WKPVKVILEDHLKVPIFPVGKPLEFYDYCLSEYLTKISMD  488
             +PRFS  +V   N  G K+ W+   V +E+H+ VP   +   ++  D  + +Y++ +S  
Sbjct  93    HPRFSKKLVIDDNKCGSKSKWESTIVNVENHVTVP--NLDPNMDSPDQFVEDYISSLSTI  150

Query  489   PFPQTQPLWEIHIFRYPTSNAGGNYIFKLHQSLGDGYSLMGALLSCLQRADNP-ALPLTF  665
             P   ++PLWE+HI    TS+A    +F++H SLGDG SL+  LL+C ++  +P ALP + 
Sbjct  151   PLDLSKPLWEMHILNVKTSDAEAIAVFRIHHSLGDGASLISLLLACTRKTSDPDALP-SI  209

Query  666   PRRQGSGKKQGENSNAVARAFKAVPRLLSGVVDTVTDFSWNFLKSSLLDDDKTAIHSQDD  845
             P +Q +G      S      F A+  +L  + +T  D          L+D KT +     
Sbjct  210   PAQQRAG---SHFSGGFWGLFFAMWTVLRVIWNTSVDLVLFAATMLFLEDTKTPLKGA-S  265

Query  846   GVEFRPISVTTMTFSLYHLKQIKSSLNVTINDVISGIVTYG-----TRLYMQESERETC-  1007
             GVE +P      T SL  +K +K+++N+TIND I G+   G      R Y  +SE E   
Sbjct  266   GVELKPKRFVHRTVSLDDIKLVKNAMNMTINDAIMGVTQAGLSRYLNRKYGDQSEIEDGE  325

Query  1008  NGE---------CTALVLFNTRAMGGGYKSVSEMIKPNAEMP---WGNRITF--LPFAIP  1145
             NG+           A VL N R    G +++++++   +  P   WGNRI +  LPF + 
Sbjct  326   NGKKNNIPKSIRLRASVLVNVRPT-PGIQTLADLMADESNNPKWGWGNRIGYIILPFTV-  383

Query  1146  KLRSPGDGDSSNPLRFIYNAHRMVKRQRYSASLYLTGQFLEFTRKLRGLEATAQFLRRTL  1325
                    G   +PL  +  A  M+ R++ S     +        KL G +A+A   RR +
Sbjct  384   -------GLQDDPLEHLRRAKAMIDRKKLSLEATFSFHSAILVIKLFGAKASAAIARRVI  436

Query  1326  KNTSITMTNMIGPVEKTTLANHPVKGMYFAVSGAPQSLVVTMLSYAGKLRLTIISEKDFI  1505
              NT++  +N++GP+E+ +   HPV  +  +V G+P +L +   SY  K+ + +  + D I
Sbjct  437   SNTTLAFSNVVGPLEEISFYGHPVAYIAPSVYGSPHALTIHFQSYCKKMTIVLAVDPDVI  496

Query  1506  -DVKKLKSCIESAFDEI  1553
              D  KL   +E + + I
Sbjct  497   PDPHKLCDDLEKSLEII  513



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5415623577640