BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25900_g1_i5 len=2444 path=[1:0-276 278:277-284 286:285-298
300:299-381 383:382-408 18246:409-552 22784:553-553 22785:554-576
18413:577-652 654:653-678 21714:679-730 732:731-763 765:764-894
896:895-943 22989:944-945 22991:946-952 954:953-971 973:972-1007
22332:1008-1009 23023:1010-1011 23025:1012-1022 23036:1023-1023
23037:1024-1038 12083:1039-1039 1041:1040-1072 23075:1073-1080
1082:1081-1093 1095:1094-1114 1116:1115-1153 @1155@!:1154-1568
12693:1569-1620 1578:1621-1700 1658:1701-1724 14755:1725-1781
1733:1782-1813 11696:1814-1895 1847:1896-1936 7802:1937-2091
7957:2092-2112 2067:2113-2136 8001:2137-2210 2165:2211-2302
23402:2303-2303 10794:2304-2422 23405:2423-2443]

Length=2444
                                                                      Score     E

ref|XP_009782473.1|  PREDICTED: probable receptor-like protein ki...    507   5e-166   
ref|XP_009782472.1|  PREDICTED: probable receptor-like protein ki...    507   7e-166   
ref|XP_010316640.1|  PREDICTED: glycerophosphodiester phosphodies...    496   5e-165   
ref|XP_006367678.1|  PREDICTED: probable receptor-like protein ki...    494   2e-164   
ref|XP_010316639.1|  PREDICTED: glycerophosphodiester phosphodies...    496   3e-164   
ref|XP_006348220.1|  PREDICTED: probable receptor-like protein ki...    492   1e-163   
ref|XP_009609372.1|  PREDICTED: probable receptor-like protein ki...    502   2e-163   
ref|XP_006363204.1|  PREDICTED: probable receptor-like protein ki...    493   3e-163   
ref|XP_009796756.1|  PREDICTED: probable receptor-like protein ki...    495   2e-162   
ref|XP_009778886.1|  PREDICTED: probable receptor-like protein ki...    499   4e-162   
ref|XP_009778885.1|  PREDICTED: probable receptor-like protein ki...    498   6e-162   
ref|XP_009796755.1|  PREDICTED: probable receptor-like protein ki...    494   5e-161   
ref|XP_009599583.1|  PREDICTED: probable receptor-like protein ki...    491   6e-161   
ref|XP_009629972.1|  PREDICTED: probable receptor-like protein ki...    494   7e-161   
ref|XP_006366545.1|  PREDICTED: probable receptor-like protein ki...    490   1e-160   
ref|XP_009599578.1|  PREDICTED: probable receptor-like protein ki...    491   3e-160   
ref|XP_009796754.1|  PREDICTED: probable receptor-like protein ki...    494   3e-160   
ref|XP_010316638.1|  PREDICTED: probable receptor-like protein ki...    493   4e-160   
ref|XP_009788881.1|  PREDICTED: probable receptor-like protein ki...    494   5e-160   
ref|XP_009599573.1|  PREDICTED: probable receptor-like protein ki...    491   7e-159   
ref|XP_009599566.1|  PREDICTED: probable receptor-like protein ki...    491   9e-159   
ref|XP_009599540.1|  PREDICTED: cysteine-rich receptor-like prote...    490   4e-158   
ref|XP_004249993.2|  PREDICTED: glycerophosphodiester phosphodies...    485   1e-157   
ref|XP_006348215.1|  PREDICTED: probable receptor-like protein ki...    485   2e-157   
ref|XP_006365625.1|  PREDICTED: probable receptor-like protein ki...    477   2e-157   
ref|XP_009759930.1|  PREDICTED: probable receptor-like protein ki...    472   2e-156   
ref|XP_006365630.1|  PREDICTED: probable receptor-like protein ki...    482   4e-156   
ref|XP_006365619.1|  PREDICTED: probable receptor-like protein ki...    474   6e-156   
ref|XP_010315122.1|  PREDICTED: probable receptor-like protein ki...    481   2e-155   
ref|XP_006363203.1|  PREDICTED: probable receptor-like protein ki...    468   7e-155   
gb|EYU28969.1|  hypothetical protein MIMGU_mgv1a0259881mg               466   9e-154   
ref|XP_011071484.1|  PREDICTED: glycerophosphodiester phosphodies...    464   3e-153   
ref|XP_002267774.2|  PREDICTED: probable receptor-like protein ki...    473   4e-153   Vitis vinifera
ref|XP_004249994.2|  PREDICTED: glycerophosphodiester phosphodies...    463   8e-153   
ref|XP_002268734.3|  PREDICTED: glycerophosphodiester phosphodies...    468   3e-151   Vitis vinifera
ref|XP_010662387.1|  PREDICTED: probable receptor-like protein ki...    470   4e-151   
gb|EYU32412.1|  hypothetical protein MIMGU_mgv11b0179042mg              460   4e-151   
ref|XP_010646609.1|  PREDICTED: glycerophosphodiester phosphodies...    458   1e-149   
ref|XP_010646610.1|  PREDICTED: glycerophosphodiester phosphodies...    458   2e-149   
ref|XP_010645763.1|  PREDICTED: probable receptor-like protein ki...    457   3e-149   
emb|CBI23153.3|  unnamed protein product                                456   4e-149   
ref|XP_010247811.1|  PREDICTED: glycerophosphodiester phosphodies...    464   4e-149   
ref|XP_010662818.1|  PREDICTED: probable receptor-like protein ki...    457   4e-149   
gb|EYU40246.1|  hypothetical protein MIMGU_mgv1a018460mg                454   4e-149   
ref|XP_010663016.1|  PREDICTED: glycerophosphodiester phosphodies...    462   5e-149   
ref|XP_010247812.1|  PREDICTED: glycerophosphodiester phosphodies...    454   8e-149   
ref|XP_010662457.1|  PREDICTED: glycerophosphodiester phosphodies...    454   9e-149   
gb|EYU40254.1|  hypothetical protein MIMGU_mgv1a018948mg                454   2e-148   
ref|XP_007036620.1|  Kinase superfamily protein, putative               460   3e-148   
ref|XP_002275176.2|  PREDICTED: glycerophosphodiester phosphodies...    461   3e-148   Vitis vinifera
ref|XP_010662662.1|  PREDICTED: glycerophosphodiester phosphodies...    461   3e-148   
gb|EYU21048.1|  hypothetical protein MIMGU_mgv1a025540mg                452   4e-148   
ref|XP_010662998.1|  PREDICTED: glycerophosphodiester phosphodies...    459   5e-148   
ref|XP_010247813.1|  PREDICTED: glycerophosphodiester phosphodies...    461   7e-148   
ref|XP_006366547.1|  PREDICTED: probable receptor-like protein ki...    456   8e-148   
ref|XP_010662385.1|  PREDICTED: glycerophosphodiester phosphodies...    459   9e-148   
ref|XP_003635153.1|  PREDICTED: glycerophosphodiester phosphodies...    459   1e-147   
ref|XP_010662827.1|  PREDICTED: glycerophosphodiester phosphodies...    459   1e-147   
ref|XP_010646613.1|  PREDICTED: glycerophosphodiester phosphodies...    459   1e-147   
ref|XP_010247816.1|  PREDICTED: glycerophosphodiester phosphodies...    457   2e-147   
ref|XP_006348214.1|  PREDICTED: probable receptor-like protein ki...    449   4e-147   
ref|XP_010662988.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    457   4e-147   
ref|XP_010662832.1|  PREDICTED: glycerophosphodiester phosphodies...    452   5e-147   
ref|XP_007036614.1|  Kinase superfamily protein, putative               458   9e-147   
ref|XP_010645762.1|  PREDICTED: probable receptor-like protein ki...    457   9e-147   
ref|XP_008232085.1|  PREDICTED: probable receptor-like protein ki...    448   9e-147   
ref|XP_007036623.1|  PR5-like receptor kinase                           450   1e-146   
ref|XP_002268153.3|  PREDICTED: glycerophosphodiester phosphodies...    456   1e-146   Vitis vinifera
ref|XP_010662812.1|  PREDICTED: glycerophosphodiester phosphodies...    456   1e-146   
ref|XP_010662813.1|  PREDICTED: glycerophosphodiester phosphodies...    456   1e-146   
ref|XP_010662835.1|  PREDICTED: glycerophosphodiester phosphodies...    456   2e-146   
emb|CBI23135.3|  unnamed protein product                                452   2e-146   
ref|XP_011037147.1|  PREDICTED: probable receptor-like protein ki...    449   2e-146   
ref|XP_010662995.1|  PREDICTED: glycerophosphodiester phosphodies...    456   3e-146   
ref|XP_010662810.1|  PREDICTED: glycerophosphodiester phosphodies...    455   3e-146   
ref|XP_010662809.1|  PREDICTED: glycerophosphodiester phosphodies...    455   4e-146   
ref|XP_002279967.2|  PREDICTED: glycerophosphodiester phosphodies...    454   6e-146   Vitis vinifera
ref|XP_008245765.1|  PREDICTED: probable receptor-like protein ki...    447   8e-146   
ref|XP_009796758.1|  PREDICTED: probable receptor-like protein ki...    448   9e-146   
ref|XP_010662458.1|  PREDICTED: probable receptor-like protein ki...    454   9e-146   
ref|XP_002513561.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    446   1e-145   Ricinus communis
gb|EYU21060.1|  hypothetical protein MIMGU_mgv1a021494mg                453   1e-145   
ref|XP_002513566.1|  receptor serine/threonine kinase, putative         450   1e-145   Ricinus communis
ref|XP_002513563.1|  receptor serine/threonine kinase, putative         445   2e-145   Ricinus communis
ref|XP_011014554.1|  PREDICTED: probable receptor-like protein ki...    452   3e-145   
ref|XP_010645761.1|  PREDICTED: glycerophosphodiester phosphodies...    452   3e-145   
ref|XP_007039002.1|  Kinase superfamily protein, putative               453   6e-145   
ref|XP_009343242.1|  PREDICTED: probable receptor-like protein ki...    444   6e-145   
ref|XP_009343235.1|  PREDICTED: probable receptor-like protein ki...    444   6e-145   
ref|XP_002268653.1|  PREDICTED: glycerophosphodiester phosphodies...    452   7e-145   Vitis vinifera
ref|XP_011003873.1|  PREDICTED: probable receptor-like protein ki...    453   8e-145   
ref|XP_010663000.1|  PREDICTED: glycerophosphodiester phosphodies...    452   8e-145   
ref|XP_002266286.1|  PREDICTED: glycerophosphodiester phosphodies...    451   8e-145   Vitis vinifera
ref|XP_003634115.2|  PREDICTED: glycerophosphodiester phosphodies...    445   1e-144   
ref|XP_008232172.1|  PREDICTED: probable receptor-like protein ki...    452   2e-144   
ref|XP_003634140.2|  PREDICTED: glycerophosphodiester phosphodies...    443   2e-144   
ref|XP_002513562.1|  receptor serine/threonine kinase, putative         451   2e-144   Ricinus communis
ref|XP_011037044.1|  PREDICTED: probable receptor-like protein ki...    449   2e-144   
ref|XP_002268775.1|  PREDICTED: probable receptor-like protein ki...    451   2e-144   Vitis vinifera
ref|XP_010662817.1|  PREDICTED: glycerophosphodiester phosphodies...    451   3e-144   
gb|EYU40245.1|  hypothetical protein MIMGU_mgv1a021311mg                448   3e-144   
ref|XP_004228892.1|  PREDICTED: probable receptor-like protein ki...    449   4e-144   
ref|XP_002262799.3|  PREDICTED: glycerophosphodiester phosphodies...    444   4e-144   Vitis vinifera
ref|XP_006368004.1|  PREDICTED: probable receptor-like protein ki...    449   4e-144   
ref|XP_011016149.1|  PREDICTED: probable receptor-like protein ki...    445   5e-144   
ref|XP_009629970.1|  PREDICTED: probable receptor-like protein ki...    449   6e-144   
ref|XP_010315114.1|  PREDICTED: probable receptor-like protein ki...    449   6e-144   
ref|XP_006374065.1|  hypothetical protein POPTR_0015s00230g             442   6e-144   
ref|XP_007010206.1|  Kinase superfamily protein, putative               447   8e-144   
gb|EYU21045.1|  hypothetical protein MIMGU_mgv1a022789mg                443   1e-143   
ref|XP_008231576.1|  PREDICTED: probable receptor-like protein ki...    441   1e-143   
ref|XP_002263649.2|  PREDICTED: probable receptor-like protein ki...    448   1e-143   Vitis vinifera
gb|EYU32407.1|  hypothetical protein MIMGU_mgv1a020426mg                448   1e-143   
emb|CBI23149.3|  unnamed protein product                                443   1e-143   
emb|CBI23151.3|  unnamed protein product                                447   2e-143   
ref|XP_009348963.1|  PREDICTED: probable receptor-like protein ki...    442   2e-143   
gb|EYU40252.1|  hypothetical protein MIMGU_mgv1a024546mg                446   2e-143   
ref|XP_010646611.1|  PREDICTED: glycerophosphodiester phosphodies...    448   2e-143   
ref|XP_010662831.1|  PREDICTED: glycerophosphodiester phosphodies...    448   2e-143   
ref|XP_002322015.2|  hypothetical protein POPTR_0015s02010g             448   3e-143   Populus trichocarpa [western balsam poplar]
ref|XP_008345483.1|  PREDICTED: probable receptor-like protein ki...    441   3e-143   
ref|XP_008232075.1|  PREDICTED: probable receptor-like protein ki...    443   4e-143   
gb|EYU21046.1|  hypothetical protein MIMGU_mgv1a023761mg                446   4e-143   
ref|XP_008345477.1|  PREDICTED: probable receptor-like protein ki...    441   4e-143   
gb|EYU21067.1|  hypothetical protein MIMGU_mgv1a023848mg                447   4e-143   
ref|XP_009599593.1|  PREDICTED: probable receptor-like protein ki...    447   4e-143   
ref|XP_007010207.1|  Kinase superfamily protein, putative               446   4e-143   
ref|XP_004305475.1|  PREDICTED: probable receptor-like protein ki...    449   4e-143   
ref|XP_009609373.1|  PREDICTED: probable receptor-like protein ki...    447   4e-143   
ref|XP_002264064.1|  PREDICTED: glycerophosphodiester phosphodies...    447   5e-143   Vitis vinifera
ref|XP_011003876.1|  PREDICTED: glycerophosphodiester phosphodies...    447   5e-143   
ref|XP_009796757.1|  PREDICTED: probable receptor-like protein ki...    447   6e-143   
gb|EYU37102.1|  hypothetical protein MIMGU_mgv1a023653mg                441   7e-143   
ref|XP_011003875.1|  PREDICTED: glycerophosphodiester phosphodies...    447   7e-143   
ref|XP_008232188.1|  PREDICTED: probable receptor-like protein ki...    450   7e-143   
ref|XP_010275239.1|  PREDICTED: probable receptor-like protein ki...    447   7e-143   
gb|EYU21042.1|  hypothetical protein MIMGU_mgv1a020230mg                443   7e-143   
ref|XP_004306407.1|  PREDICTED: probable receptor-like protein ki...    438   8e-143   
ref|XP_010275238.1|  PREDICTED: probable receptor-like protein ki...    447   9e-143   
emb|CBI23152.3|  unnamed protein product                                443   1e-142   
ref|XP_008245471.1|  PREDICTED: probable receptor-like protein ki...    439   1e-142   
ref|XP_007010199.1|  Kinase superfamily protein, putative               446   1e-142   
ref|XP_010645764.1|  PREDICTED: probable receptor-like protein ki...    446   1e-142   
ref|XP_006376636.1|  hypothetical protein POPTR_0012s01760g             446   1e-142   
ref|XP_002321441.2|  hypothetical protein POPTR_0015s02040g             446   2e-142   Populus trichocarpa [western balsam poplar]
ref|XP_009341644.1|  PREDICTED: probable receptor-like protein ki...    439   2e-142   
ref|XP_007036613.1|  PR5-like receptor kinase                           447   2e-142   
ref|XP_010646615.1|  PREDICTED: glycerophosphodiester phosphodies...    445   2e-142   
ref|XP_011037045.1|  PREDICTED: probable receptor-like protein ki...    447   2e-142   
ref|XP_002317767.2|  hypothetical protein POPTR_0012s01750g             445   3e-142   Populus trichocarpa [western balsam poplar]
ref|XP_010662565.1|  PREDICTED: glycerophosphodiester phosphodies...    444   3e-142   
ref|XP_002267821.3|  PREDICTED: glycerophosphodiester phosphodies...    446   4e-142   Vitis vinifera
ref|XP_007022127.1|  PR5-like receptor kinase                           439   4e-142   
gb|KCW52337.1|  hypothetical protein EUGRSUZ_J01754                     435   4e-142   
ref|XP_003634911.1|  PREDICTED: glycerophosphodiester phosphodies...    444   4e-142   
ref|XP_010646997.1|  PREDICTED: probable receptor-like protein ki...    444   6e-142   
ref|XP_009782477.1|  PREDICTED: probable receptor-like protein ki...    444   7e-142   
ref|XP_008245712.1|  PREDICTED: probable receptor-like protein ki...    446   8e-142   
ref|XP_010662564.1|  PREDICTED: glycerophosphodiester phosphodies...    444   8e-142   
ref|XP_007029389.1|  Receptor-like protein kinase                       444   9e-142   
ref|XP_010662821.1|  PREDICTED: probable LRR receptor-like serine...    450   1e-141   
ref|XP_008378068.1|  PREDICTED: probable receptor-like protein ki...    434   2e-141   
ref|XP_011001896.1|  PREDICTED: glycerophosphodiester phosphodies...    443   2e-141   
ref|XP_010662993.1|  PREDICTED: glycerophosphodiester phosphodies...    443   2e-141   
ref|XP_010662819.1|  PREDICTED: probable receptor-like protein ki...    435   2e-141   
ref|XP_009772453.1|  PREDICTED: probable receptor-like protein ki...    442   3e-141   
ref|XP_010662306.1|  PREDICTED: glycerophosphodiester phosphodies...    434   3e-141   
gb|EYU40244.1|  hypothetical protein MIMGU_mgv1a019217mg                439   3e-141   
ref|XP_010662994.1|  PREDICTED: probable receptor-like protein ki...    445   3e-141   
gb|KDP22153.1|  hypothetical protein JCGZ_25984                         442   4e-141   
ref|XP_008376288.1|  PREDICTED: probable receptor-like protein ki...    436   4e-141   
ref|XP_011001895.1|  PREDICTED: probable receptor-like protein ki...    442   4e-141   
ref|XP_007029390.1|  Kinase superfamily protein, putative               442   4e-141   
gb|EYU21051.1|  hypothetical protein MIMGU_mgv1a022486mg                439   5e-141   
ref|XP_010662989.1|  PREDICTED: probable receptor-like protein ki...    444   6e-141   
ref|XP_010275348.1|  PREDICTED: probable receptor-like protein ki...    432   6e-141   
gb|EYU37100.1|  hypothetical protein MIMGU_mgv1a023511mg                441   7e-141   
ref|XP_010662316.1|  PREDICTED: glycerophosphodiester phosphodies...    434   7e-141   
gb|EYU21057.1|  hypothetical protein MIMGU_mgv1a024072mg                441   8e-141   
gb|EYU21073.1|  hypothetical protein MIMGU_mgv1a003869mg                440   8e-141   
ref|XP_006348219.1|  PREDICTED: probable receptor-like protein ki...    433   8e-141   
gb|EYU32405.1|  hypothetical protein MIMGU_mgv1a019405mg                437   9e-141   
gb|EYU29477.1|  hypothetical protein MIMGU_mgv1a003032mg                441   1e-140   
ref|XP_003635630.2|  PREDICTED: probable receptor-like protein ki...    433   1e-140   
ref|XP_010662971.1|  PREDICTED: glycerophosphodiester phosphodies...    444   1e-140   
ref|XP_010662972.1|  PREDICTED: glycerophosphodiester phosphodies...    443   1e-140   
ref|XP_007039001.1|  Kinase, putative                                   442   1e-140   
ref|XP_008234877.1|  PREDICTED: probable receptor-like protein ki...    432   2e-140   
ref|XP_007022133.1|  PR5-like receptor kinase                           443   2e-140   
ref|XP_002322014.2|  hypothetical protein POPTR_0015s01990g             440   2e-140   Populus trichocarpa [western balsam poplar]
gb|KCW59546.1|  hypothetical protein EUGRSUZ_H02301                     433   2e-140   
ref|XP_008245839.1|  PREDICTED: probable receptor-like protein ki...    442   2e-140   
ref|XP_010662834.1|  PREDICTED: glycerophosphodiester phosphodies...    443   2e-140   
ref|XP_009348961.1|  PREDICTED: probable receptor-like protein ki...    439   3e-140   
ref|XP_002263061.2|  PREDICTED: glycerophosphodiester phosphodies...    432   5e-140   Vitis vinifera
ref|XP_007039000.1|  Kinase superfamily protein, putative               438   6e-140   
ref|XP_010038695.1|  PREDICTED: probable receptor-like protein ki...    434   6e-140   
ref|XP_009348966.1|  PREDICTED: probable receptor-like protein ki...    437   6e-140   
ref|XP_002324016.2|  hypothetical protein POPTR_0017s04140g             430   7e-140   Populus trichocarpa [western balsam poplar]
gb|EYU21041.1|  hypothetical protein MIMGU_mgv1a003344mg                438   9e-140   
ref|XP_007022122.1|  PR5-like receptor kinase                           439   1e-139   
emb|CAN72345.1|  hypothetical protein VITISV_041721                     434   2e-139   Vitis vinifera
ref|XP_007022130.1|  PR5-like receptor kinase                           433   2e-139   
ref|XP_010662776.1|  PREDICTED: probable receptor-like protein ki...    437   2e-139   
ref|XP_010662996.1|  PREDICTED: probable receptor-like protein ki...    440   2e-139   
ref|XP_007220557.1|  hypothetical protein PRUPE_ppa003241mg             437   3e-139   
ref|XP_010662781.1|  PREDICTED: probable receptor-like protein ki...    440   3e-139   
gb|KCW47330.1|  hypothetical protein EUGRSUZ_K01120                     432   3e-139   
ref|XP_010038694.1|  PREDICTED: probable receptor-like protein ki...    439   3e-139   
gb|KCW89167.1|  hypothetical protein EUGRSUZ_A01480                     430   3e-139   
ref|XP_010026257.1|  PREDICTED: probable receptor-like protein ki...    429   4e-139   
emb|CDP12537.1|  unnamed protein product                                433   4e-139   
ref|XP_004306408.1|  PREDICTED: probable receptor-like protein ki...    437   4e-139   
ref|XP_008232094.1|  PREDICTED: probable receptor-like protein ki...    427   5e-139   
ref|XP_011047738.1|  PREDICTED: probable receptor-like protein ki...    428   5e-139   
ref|XP_009765438.1|  PREDICTED: probable receptor-like protein ki...    438   6e-139   
ref|XP_009780293.1|  PREDICTED: probable receptor-like protein ki...    437   6e-139   
ref|XP_010662808.1|  PREDICTED: probable receptor-like protein ki...    436   6e-139   
gb|KCW47328.1|  hypothetical protein EUGRSUZ_K01118                     439   7e-139   
ref|XP_004498441.1|  PREDICTED: probable receptor-like protein ki...    430   7e-139   
ref|XP_011003874.1|  PREDICTED: glycerophosphodiester phosphodies...    436   1e-138   
gb|EYU32415.1|  hypothetical protein MIMGU_mgv1a021939mg                435   1e-138   
ref|XP_002513567.1|  kinase, putative                                   436   1e-138   Ricinus communis
ref|XP_002513565.1|  kinase, putative                                   437   1e-138   Ricinus communis
ref|XP_010662663.1|  PREDICTED: glycerophosphodiester phosphodies...    438   1e-138   
ref|XP_008232079.1|  PREDICTED: probable receptor-like protein ki...    437   1e-138   
gb|KCW58942.1|  hypothetical protein EUGRSUZ_H01564                     428   1e-138   
ref|XP_009367880.1|  PREDICTED: probable receptor-like protein ki...    429   1e-138   
ref|XP_010662566.1|  PREDICTED: cysteine-rich receptor-like prote...    439   2e-138   
ref|XP_006372927.1|  hypothetical protein POPTR_0017s06310g             439   2e-138   
ref|XP_008347622.1|  PREDICTED: probable receptor-like protein ki...    435   2e-138   
emb|CDP12527.1|  unnamed protein product                                432   2e-138   
gb|KCW58952.1|  hypothetical protein EUGRSUZ_H01578                     430   2e-138   
ref|XP_010026268.1|  PREDICTED: probable receptor-like protein ki...    434   2e-138   
ref|XP_008232089.1|  PREDICTED: probable receptor-like protein ki...    427   2e-138   
gb|KCW46535.1|  hypothetical protein EUGRSUZ_K00368                     426   3e-138   
gb|KDP42829.1|  hypothetical protein JCGZ_23771                         432   3e-138   
ref|XP_010662816.1|  PREDICTED: cysteine-rich receptor-like prote...    439   3e-138   
ref|XP_007206753.1|  hypothetical protein PRUPE_ppa025186mg             435   3e-138   
ref|XP_002323918.2|  hypothetical protein POPTR_0017s04200g             436   3e-138   Populus trichocarpa [western balsam poplar]
gb|KDP42825.1|  hypothetical protein JCGZ_23767                         435   4e-138   
ref|XP_009370622.1|  PREDICTED: probable receptor-like protein ki...    437   4e-138   
ref|XP_002272131.3|  PREDICTED: glycerophosphodiester phosphodies...    436   4e-138   Vitis vinifera
ref|XP_010026263.1|  PREDICTED: probable receptor-like protein ki...    431   4e-138   
gb|KCW46515.1|  hypothetical protein EUGRSUZ_K00342                     428   5e-138   
gb|EYU21049.1|  hypothetical protein MIMGU_mgv1a017815mg                432   7e-138   
gb|KCW88167.1|  hypothetical protein EUGRSUZ_A00554                     425   7e-138   
ref|XP_007021970.1|  PR5-like receptor kinase                           434   7e-138   
ref|XP_007022126.1|  PR5-like receptor kinase                           433   8e-138   
gb|EYU21065.1|  hypothetical protein MIMGU_mgv1a022786mg                424   9e-138   
emb|CDP12540.1|  unnamed protein product                                434   9e-138   
ref|XP_007038999.1|  Kinase, putative isoform 2                         432   1e-137   
gb|KCW58971.1|  hypothetical protein EUGRSUZ_H01601                     424   1e-137   
ref|XP_010662825.1|  PREDICTED: probable receptor-like protein ki...    424   1e-137   
ref|XP_010034532.1|  PREDICTED: probable receptor-like protein ki...    434   1e-137   
ref|XP_009335119.1|  PREDICTED: probable receptor-like protein ki...    434   1e-137   
ref|XP_008232095.1|  PREDICTED: probable receptor-like protein ki...    436   1e-137   
ref|XP_010646614.1|  PREDICTED: probable receptor-like protein ki...    429   1e-137   
ref|XP_010646999.1|  PREDICTED: probable receptor-like protein ki...    436   1e-137   
ref|XP_010026272.1|  PREDICTED: probable receptor-like protein ki...    426   1e-137   
ref|XP_007219143.1|  hypothetical protein PRUPE_ppa016018mg             434   1e-137   
ref|XP_009335039.1|  PREDICTED: probable receptor-like protein ki...    437   1e-137   
gb|EYU40255.1|  hypothetical protein MIMGU_mgv1a025285mg                431   1e-137   
ref|XP_002265870.3|  PREDICTED: lectin-domain containing receptor...    437   1e-137   Vitis vinifera
ref|XP_008347687.1|  PREDICTED: probable receptor-like protein ki...    425   1e-137   
ref|XP_004498440.1|  PREDICTED: probable receptor-like protein ki...    427   1e-137   
gb|KHG10630.1|  hypothetical protein F383_14633                         434   2e-137   
gb|KDP42830.1|  hypothetical protein JCGZ_23772                         435   2e-137   
gb|KEH40396.1|  stress-induced receptor-like kinase, putative           434   2e-137   
ref|XP_002513559.1|  receptor serine/threonine kinase, putative         433   2e-137   Ricinus communis
gb|KCW58968.1|  hypothetical protein EUGRSUZ_H01596                     425   2e-137   
ref|XP_007021958.1|  PR5-like receptor kinase                           427   2e-137   
ref|XP_010646996.1|  PREDICTED: glycerophosphodiester phosphodies...    434   2e-137   
ref|XP_008345516.1|  PREDICTED: probable receptor-like protein ki...    432   2e-137   
gb|KCW58941.1|  hypothetical protein EUGRSUZ_H01564                     431   2e-137   
ref|XP_010026256.1|  PREDICTED: probable receptor-like protein ki...    431   2e-137   
ref|XP_010662313.1|  PREDICTED: glycerophosphodiester phosphodies...    424   2e-137   
ref|XP_007022121.1|  PR5-like receptor kinase                           434   2e-137   
ref|XP_009356098.1|  PREDICTED: probable receptor-like protein ki...    423   3e-137   
ref|XP_010646612.1|  PREDICTED: probable receptor-like protein ki...    434   3e-137   
gb|KHG10629.1|  hypothetical protein F383_14633                         434   3e-137   
ref|XP_010038692.1|  PREDICTED: probable receptor-like protein ki...    424   3e-137   
ref|XP_008232081.1|  PREDICTED: probable receptor-like protein ki...    432   3e-137   
ref|XP_008385065.1|  PREDICTED: probable receptor-like protein ki...    426   4e-137   
gb|EYU40249.1|  hypothetical protein MIMGU_mgv1a0233662mg               430   4e-137   
gb|EYU21074.1|  hypothetical protein MIMGU_mgv1a024071mg                429   4e-137   
ref|XP_010038687.1|  PREDICTED: probable receptor-like protein ki...    431   4e-137   
ref|XP_008245746.1|  PREDICTED: probable receptor-like protein ki...    422   4e-137   
ref|XP_008345497.1|  PREDICTED: probable receptor-like protein ki...    426   4e-137   
gb|KEH40395.1|  stress-induced receptor-like kinase, putative           435   4e-137   
ref|XP_004307212.1|  PREDICTED: probable receptor-like protein ki...    434   4e-137   
gb|KCW47320.1|  hypothetical protein EUGRSUZ_K01107                     431   4e-137   
ref|XP_006373193.1|  hypothetical protein POPTR_0017s09520g             426   5e-137   
ref|XP_008245755.1|  PREDICTED: probable receptor-like protein ki...    422   5e-137   
ref|XP_004287327.1|  PREDICTED: probable receptor-like protein ki...    431   5e-137   
gb|KDP46881.1|  hypothetical protein JCGZ_24090                         434   6e-137   
emb|CDP21357.1|  unnamed protein product                                433   7e-137   
gb|KEH40397.1|  receptor-like kinase                                    431   7e-137   
emb|CDP20809.1|  unnamed protein product                                432   7e-137   
ref|XP_011084503.1|  PREDICTED: probable receptor-like protein ki...    432   8e-137   
ref|XP_009335117.1|  PREDICTED: probable receptor-like protein ki...    423   9e-137   
ref|XP_008344514.1|  PREDICTED: probable receptor-like protein ki...    423   9e-137   
emb|CAN66614.1|  hypothetical protein VITISV_023172                     429   1e-136   
ref|XP_004308548.1|  PREDICTED: probable receptor-like protein ki...    432   1e-136   
ref|XP_006350567.1|  PREDICTED: probable receptor-like protein ki...    432   1e-136   
ref|XP_004305474.1|  PREDICTED: probable receptor-like protein ki...    431   1e-136   
ref|XP_008381955.1|  PREDICTED: probable receptor-like protein ki...    421   1e-136   
ref|XP_009340420.1|  PREDICTED: probable receptor-like protein ki...    433   1e-136   
ref|XP_010662999.1|  PREDICTED: probable receptor-like protein ki...    432   1e-136   
ref|XP_009370623.1|  PREDICTED: probable receptor-like protein ki...    433   1e-136   
ref|XP_007038998.1|  Receptor-like protein kinase, putative isofo...    432   2e-136   
emb|CAN71175.1|  hypothetical protein VITISV_037666                     429   2e-136   
ref|XP_010662815.1|  PREDICTED: cysteine-rich receptor-like prote...    433   2e-136   
ref|XP_004298576.1|  PREDICTED: probable receptor-like protein ki...    430   2e-136   
ref|XP_009348964.1|  PREDICTED: probable receptor-like protein ki...    423   3e-136   
gb|KDP22160.1|  hypothetical protein JCGZ_25991                         429   3e-136   
ref|XP_011037049.1|  PREDICTED: probable receptor-like protein ki...    423   3e-136   
ref|XP_008346612.1|  PREDICTED: probable receptor-like protein ki...    432   3e-136   
ref|XP_010026531.1|  PREDICTED: uncharacterized protein LOC104416895    435   3e-136   
gb|KCW46629.1|  hypothetical protein EUGRSUZ_K00441                     420   3e-136   
ref|XP_008245767.1|  PREDICTED: probable receptor-like protein ki...    427   3e-136   
ref|XP_008355114.1|  PREDICTED: probable receptor-like protein ki...    422   3e-136   
ref|XP_011037048.1|  PREDICTED: probable receptor-like protein ki...    423   3e-136   
ref|XP_008232096.1|  PREDICTED: probable receptor-like protein ki...    422   4e-136   
ref|XP_011037047.1|  PREDICTED: probable receptor-like protein ki...    423   4e-136   
ref|XP_008246015.1|  PREDICTED: probable receptor-like protein ki...    429   4e-136   
ref|XP_009336987.1|  PREDICTED: probable receptor-like protein ki...    422   4e-136   
ref|XP_010646767.1|  PREDICTED: probable receptor-like protein ki...    433   4e-136   
ref|XP_010646766.1|  PREDICTED: probable receptor-like protein ki...    433   4e-136   
ref|XP_009760919.1|  PREDICTED: probable receptor-like protein ki...    431   5e-136   
ref|XP_009760918.1|  PREDICTED: probable receptor-like protein ki...    431   5e-136   
gb|KDP42843.1|  hypothetical protein JCGZ_23785                         422   6e-136   
emb|CDP17831.1|  unnamed protein product                                429   6e-136   
emb|CDP21418.1|  unnamed protein product                                433   6e-136   
ref|XP_009786425.1|  PREDICTED: probable receptor-like protein ki...    430   6e-136   
ref|XP_008245710.1|  PREDICTED: probable receptor-like protein ki...    421   6e-136   
gb|EYU28967.1|  hypothetical protein MIMGU_mgv1a003390mg                428   6e-136   
ref|XP_009592347.1|  PREDICTED: probable receptor-like protein ki...    430   6e-136   
ref|XP_004306204.1|  PREDICTED: probable receptor-like protein ki...    431   7e-136   
ref|XP_008354817.1|  PREDICTED: probable receptor-like protein ki...    427   8e-136   
ref|XP_007021960.1|  PR5-like receptor kinase                           427   9e-136   
ref|XP_006380303.1|  hypothetical protein POPTR_0007s02250g             424   9e-136   
ref|XP_010663014.1|  PREDICTED: probable receptor-like protein ki...    420   9e-136   
ref|XP_010091110.1|  putative receptor-like protein kinase              428   1e-135   
ref|XP_004498409.1|  PREDICTED: probable receptor-like protein ki...    430   1e-135   
ref|XP_010035323.1|  PREDICTED: probable receptor-like protein ki...    421   1e-135   
ref|XP_008232074.1|  PREDICTED: probable receptor-like protein ki...    422   1e-135   
ref|XP_008232189.1|  PREDICTED: probable receptor-like protein ki...    418   2e-135   
ref|XP_008347207.1|  PREDICTED: probable receptor-like protein ki...    421   2e-135   
ref|XP_004307211.1|  PREDICTED: probable receptor-like protein ki...    429   2e-135   
ref|XP_008232091.1|  PREDICTED: probable receptor-like protein ki...    427   2e-135   
ref|XP_010068890.1|  PREDICTED: probable receptor-like protein ki...    427   2e-135   
ref|XP_002263251.3|  PREDICTED: probable receptor-like protein ki...    420   2e-135   
ref|XP_008354881.1|  PREDICTED: probable receptor-like protein ki...    427   2e-135   
ref|XP_008363237.1|  PREDICTED: probable receptor-like protein ki...    427   3e-135   
ref|XP_010049259.1|  PREDICTED: probable receptor-like protein ki...    427   3e-135   
ref|XP_010049248.1|  PREDICTED: probable receptor-like protein ki...    427   3e-135   
ref|XP_009596791.1|  PREDICTED: probable receptor-like protein ki...    428   4e-135   
ref|XP_010049239.1|  PREDICTED: probable receptor-like protein ki...    427   4e-135   
ref|XP_008376310.1|  PREDICTED: probable receptor-like protein ki...    420   5e-135   
ref|XP_010040879.1|  PREDICTED: probable receptor-like protein ki...    422   5e-135   
ref|XP_008373817.1|  PREDICTED: probable receptor-like protein ki...    418   5e-135   
ref|XP_010038693.1|  PREDICTED: probable receptor-like protein ki...    427   5e-135   
ref|XP_010317309.1|  PREDICTED: uncharacterized protein LOC101250956    441   6e-135   
emb|CAN66613.1|  hypothetical protein VITISV_023171                     421   6e-135   
ref|XP_002264027.1|  PREDICTED: probable receptor-like protein ki...    429   7e-135   
gb|KCW89158.1|  hypothetical protein EUGRSUZ_A01470                     426   7e-135   
ref|XP_010662814.1|  PREDICTED: glycerophosphodiester phosphodies...    428   7e-135   
gb|KEH33223.1|  stress-induced receptor-like kinase                     419   1e-134   
ref|XP_008232076.1|  PREDICTED: probable receptor-like protein ki...    426   1e-134   
ref|XP_009343243.1|  PREDICTED: probable receptor-like protein ki...    426   1e-134   
ref|XP_011047639.1|  PREDICTED: L-type lectin-domain containing r...    429   1e-134   
ref|XP_010049204.1|  PREDICTED: probable receptor-like protein ki...    427   1e-134   
ref|XP_011047638.1|  PREDICTED: probable LRR receptor-like serine...    429   1e-134   
ref|XP_010662308.1|  PREDICTED: glycerophosphodiester phosphodies...    417   1e-134   
ref|XP_010038456.1|  PREDICTED: probable receptor-like protein ki...    428   1e-134   
ref|XP_011047635.1|  PREDICTED: L-type lectin-domain containing r...    429   1e-134   
ref|XP_011047634.1|  PREDICTED: L-type lectin-domain containing r...    429   2e-134   
ref|XP_003619232.1|  Kinase-like protein                                419   2e-134   
ref|XP_008373799.1|  PREDICTED: probable receptor-like protein ki...    416   2e-134   
ref|XP_008347200.1|  PREDICTED: probable receptor-like protein ki...    418   2e-134   
ref|XP_008232173.1|  PREDICTED: probable receptor-like protein ki...    425   2e-134   
ref|XP_010662830.1|  PREDICTED: probable receptor-like protein ki...    428   2e-134   
gb|KCW46521.1|  hypothetical protein EUGRSUZ_K003522                    417   2e-134   
gb|KCW44473.1|  hypothetical protein EUGRSUZ_L02016                     415   2e-134   
ref|XP_009341643.1|  PREDICTED: probable receptor-like protein ki...    425   2e-134   
ref|XP_004498416.1|  PREDICTED: probable receptor-like protein ki...    428   2e-134   
ref|XP_003635579.2|  PREDICTED: glycerophosphodiester phosphodies...    426   3e-134   
ref|XP_010035239.1|  PREDICTED: probable receptor-like protein ki...    426   3e-134   
ref|XP_008370381.1|  PREDICTED: probable receptor-like protein ki...    418   3e-134   
ref|XP_010645760.1|  PREDICTED: glycerophosphodiester phosphodies...    426   3e-134   
ref|XP_010662829.1|  PREDICTED: probable receptor-like protein ki...    427   4e-134   
ref|XP_009596790.1|  PREDICTED: probable receptor-like protein ki...    426   4e-134   
ref|XP_009765439.1|  PREDICTED: probable receptor-like protein ki...    425   4e-134   
ref|XP_008346578.1|  PREDICTED: probable receptor-like protein ki...    414   4e-134   
ref|XP_007161182.1|  hypothetical protein PHAVU_001G0490001g            416   4e-134   
gb|KCW46536.1|  hypothetical protein EUGRSUZ_K00369                     414   5e-134   
ref|XP_009596789.1|  PREDICTED: probable receptor-like protein ki...    426   5e-134   
gb|EYU19635.1|  hypothetical protein MIMGU_mgv1a003204mg                424   5e-134   
ref|XP_006372700.1|  hypothetical protein POPTR_0017s04100g             415   6e-134   
ref|XP_010068402.1|  PREDICTED: uncharacterized protein LOC104455285    430   6e-134   
gb|KCW44830.1|  hypothetical protein EUGRSUZ_L01599                     422   6e-134   
gb|KCW58957.1|  hypothetical protein EUGRSUZ_H01583                     419   6e-134   
gb|KCW64256.1|  hypothetical protein EUGRSUZ_G01897                     415   6e-134   
gb|KCW47326.1|  hypothetical protein EUGRSUZ_K01116                     426   7e-134   
gb|KCW46525.1|  hypothetical protein EUGRSUZ_K00355                     415   8e-134   
gb|KDP22159.1|  hypothetical protein JCGZ_25990                         424   9e-134   
ref|XP_008232078.1|  PREDICTED: probable receptor-like protein ki...    423   1e-133   
ref|XP_008232006.1|  PREDICTED: probable receptor-like protein ki...    423   1e-133   
ref|XP_010038381.1|  PREDICTED: probable receptor-like protein ki...    416   1e-133   
gb|EYU37097.1|  hypothetical protein MIMGU_mgv1a021978mg                421   1e-133   
ref|XP_011015080.1|  PREDICTED: probable L-type lectin-domain con...    426   1e-133   
ref|XP_004306205.1|  PREDICTED: probable receptor-like protein ki...    422   2e-133   
ref|XP_009335041.1|  PREDICTED: probable receptor-like protein ki...    421   2e-133   
ref|XP_007022132.1|  PR5-like receptor kinase                           427   2e-133   
ref|XP_004234168.1|  PREDICTED: probable receptor-like protein ki...    423   2e-133   
ref|XP_009335040.1|  PREDICTED: probable receptor-like protein ki...    422   2e-133   
ref|XP_006372706.1|  hypothetical protein POPTR_0017s04180g             415   2e-133   
gb|KCW46631.1|  hypothetical protein EUGRSUZ_K00443                     412   2e-133   
ref|XP_010026276.1|  PREDICTED: uncharacterized protein LOC104416604    426   2e-133   
gb|KDP42826.1|  hypothetical protein JCGZ_23768                         424   2e-133   
ref|XP_010034904.1|  PREDICTED: probable receptor-like protein ki...    421   2e-133   
ref|XP_008777484.1|  PREDICTED: probable receptor-like protein ki...    413   3e-133   
ref|XP_009335109.1|  PREDICTED: probable receptor-like protein ki...    423   4e-133   
ref|XP_011037043.1|  PREDICTED: glycerophosphodiester phosphodies...    421   4e-133   
gb|KCW64246.1|  hypothetical protein EUGRSUZ_G01891                     412   4e-133   
ref|XP_011037042.1|  PREDICTED: glycerophosphodiester phosphodies...    421   4e-133   
gb|KCW58965.1|  hypothetical protein EUGRSUZ_H01592                     412   4e-133   
ref|XP_007220160.1|  hypothetical protein PRUPE_ppa017667mg             421   4e-133   
ref|XP_004498488.1|  PREDICTED: G-type lectin S-receptor-like ser...    425   5e-133   
ref|XP_010662826.1|  PREDICTED: probable receptor-like protein ki...    424   5e-133   
ref|XP_011037041.1|  PREDICTED: glycerophosphodiester phosphodies...    421   5e-133   
gb|KCW59937.1|  hypothetical protein EUGRSUZ_H02661                     423   5e-133   
ref|XP_007161178.1|  hypothetical protein PHAVU_001G048800g             422   5e-133   
ref|XP_011037052.1|  PREDICTED: glycerophosphodiester phosphodies...    421   5e-133   
ref|XP_010038472.1|  PREDICTED: probable receptor-like protein ki...    412   6e-133   
ref|XP_009335107.1|  PREDICTED: probable receptor-like protein ki...    423   6e-133   
ref|XP_010042026.1|  PREDICTED: probable receptor-like protein ki...    413   6e-133   
ref|XP_010034903.1|  PREDICTED: probable receptor-like protein ki...    421   6e-133   
ref|XP_010942305.1|  PREDICTED: probable receptor-like protein ki...    422   7e-133   
ref|XP_011047641.1|  PREDICTED: probable receptor-like protein ki...    424   8e-133   
ref|XP_011047640.1|  PREDICTED: probable receptor-like protein ki...    424   8e-133   
ref|XP_004498487.1|  PREDICTED: G-type lectin S-receptor-like ser...    425   1e-132   
ref|XP_011047642.1|  PREDICTED: probable receptor-like protein ki...    423   1e-132   
gb|KCW46625.1|  hypothetical protein EUGRSUZ_K00436                     410   1e-132   
ref|XP_010038459.1|  PREDICTED: probable receptor-like protein ki...    414   1e-132   
ref|XP_009343234.1|  PREDICTED: probable receptor-like protein ki...    420   2e-132   
gb|KDP29653.1|  hypothetical protein JCGZ_18815                         417   2e-132   
ref|XP_010034901.1|  PREDICTED: probable receptor-like protein ki...    421   2e-132   
ref|XP_010035234.1|  PREDICTED: probable receptor-like protein ki...    417   2e-132   
ref|XP_009592348.1|  PREDICTED: probable receptor-like protein ki...    421   2e-132   
ref|XP_010041889.1|  PREDICTED: probable receptor-like protein ki...    412   2e-132   
ref|XP_004308549.1|  PREDICTED: probable receptor-like protein ki...    421   2e-132   
ref|XP_006601168.1|  PREDICTED: probable receptor-like protein ki...    421   3e-132   
ref|XP_002310448.2|  hypothetical protein POPTR_0007s02290g             418   3e-132   
ref|XP_008365840.1|  PREDICTED: probable receptor-like protein ki...    413   3e-132   
ref|XP_010111692.1|  putative receptor-like protein kinase              419   3e-132   
ref|XP_010039836.1|  PREDICTED: probable receptor-like protein ki...    412   4e-132   
ref|XP_010662307.1|  PREDICTED: G-type lectin S-receptor-like ser...    423   4e-132   
emb|CDP17838.1|  unnamed protein product                                410   4e-132   
ref|XP_010942304.1|  PREDICTED: putative cysteine-rich receptor-l...    422   4e-132   
ref|XP_010111693.1|  putative receptor-like protein kinase              410   4e-132   
ref|XP_010049268.1|  PREDICTED: probable receptor-like protein ki...    419   5e-132   
gb|KDP42824.1|  hypothetical protein JCGZ_23766                         418   5e-132   
ref|XP_010035321.1|  PREDICTED: probable receptor-like protein ki...    412   6e-132   
ref|XP_010034900.1|  PREDICTED: probable receptor-like protein ki...    421   6e-132   
ref|NP_001238112.1|  stress-induced receptor-like kinase precursor      421   7e-132   
ref|XP_008344513.1|  PREDICTED: probable receptor-like protein ki...    415   7e-132   
ref|XP_002309858.2|  hypothetical protein POPTR_0007s00820g             409   8e-132   
gb|KCW63685.1|  hypothetical protein EUGRSUZ_G01334                     407   8e-132   
ref|XP_011001827.1|  PREDICTED: probable receptor-like protein ki...    412   8e-132   
gb|KCW58944.1|  hypothetical protein EUGRSUZ_H01566                     409   8e-132   
ref|XP_010662822.1|  PREDICTED: G-type lectin S-receptor-like ser...    421   8e-132   
ref|XP_009367861.1|  PREDICTED: probable receptor-like protein ki...    418   8e-132   
emb|CAN65252.1|  hypothetical protein VITISV_011046                     422   1e-131   
ref|XP_008231870.1|  PREDICTED: probable receptor-like protein ki...    419   1e-131   
ref|XP_002267570.2|  PREDICTED: probable receptor-like protein ki...    420   1e-131   
ref|XP_010034906.1|  PREDICTED: probable receptor-like protein ki...    412   1e-131   
ref|XP_008363247.1|  PREDICTED: probable receptor-like protein ki...    414   2e-131   
ref|XP_004498418.1|  PREDICTED: G-type lectin S-receptor-like ser...    421   2e-131   
ref|XP_010035231.1|  PREDICTED: probable receptor-like protein ki...    420   2e-131   
ref|XP_008363397.1|  PREDICTED: probable receptor-like protein ki...    413   2e-131   
ref|XP_008381957.1|  PREDICTED: probable receptor-like protein ki...    413   2e-131   
ref|XP_010026246.1|  PREDICTED: uncharacterized protein LOC104416572    421   3e-131   
ref|XP_010035352.1|  PREDICTED: probable receptor-like protein ki...    409   3e-131   
ref|XP_008354479.1|  PREDICTED: probable receptor-like protein ki...    409   3e-131   
ref|XP_006372929.1|  hypothetical protein POPTR_0017s06330g             412   3e-131   
ref|XP_010035238.1|  PREDICTED: probable receptor-like protein ki...    418   3e-131   
ref|XP_008365837.1|  PREDICTED: probable receptor-like protein ki...    417   3e-131   
gb|KCW46682.1|  hypothetical protein EUGRSUZ_K00490                     407   4e-131   
ref|XP_011014404.1|  PREDICTED: probable receptor-like protein ki...    418   5e-131   
ref|XP_008365003.1|  PREDICTED: probable receptor-like protein ki...    412   5e-131   
ref|XP_008370222.1|  PREDICTED: probable receptor-like protein ki...    416   6e-131   
gb|KCW46704.1|  hypothetical protein EUGRSUZ_K00523                     410   6e-131   
ref|XP_008345489.1|  PREDICTED: probable receptor-like protein ki...    416   6e-131   
ref|XP_004308545.1|  PREDICTED: probable serine/threonine-protein...    427   6e-131   
ref|XP_010942308.1|  PREDICTED: probable receptor-like protein ki...    419   7e-131   
ref|XP_004308818.1|  PREDICTED: probable receptor-like protein ki...    416   7e-131   
ref|XP_007161453.1|  hypothetical protein PHAVU_001G070200g             409   8e-131   
ref|XP_006374064.1|  hypothetical protein POPTR_0015s00220g             413   8e-131   



>ref|XP_009782473.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana sylvestris]
Length=628

 Score =   507 bits (1306),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 249/362 (69%), Positives = 301/362 (83%), Gaps = 3/362 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  IVFL+ K++RRHLS+++ IE FL   NN  PIRY+Y HIK MT+ FKEKLGEGGFG 
Sbjct  256   PIIIVFLMFKFKRRHLSMYDMIEGFLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGFGK  315

Query  288   VYKGKLRSGSDVAVKIMSKPKSNG-QDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
             VYKGKLRSG DVAVK++SKPK+ G QDF+NE+ ++GRIHHVN+V LVGYC E ++ ALVY
Sbjct  316   VYKGKLRSGRDVAVKMLSKPKAGGGQDFMNEIATIGRIHHVNVVGLVGYCVETTERALVY  375

Query  465   DFMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             DFMPNGSLDKYI     + +L+WQRK+EIVVGVARGIEYLHRGCDI+ILHFDIKPHNILL
Sbjct  376   DFMPNGSLDKYIASQEGSPVLSWQRKYEIVVGVARGIEYLHRGCDIRILHFDIKPHNILL  435

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAK +PTD SIVTLTAARGTIGYVAPEL++R IGAIS+KADVYSFGML
Sbjct  436   DENFIPKISDFGLAKQYPTDNSIVTLTAARGTIGYVAPELISRSIGAISYKADVYSFGML  495

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             LMEML L R  V  ++ SS+YFPSWIY+   +GK I + EE +EDEK+I++KMTIV LWC
Sbjct  496   LMEMLDLKRNVVANEENSSQYFPSWIYDKFKRGKEIVVDEEANEDEKKISRKMTIVALWC  555

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV-HqeqssmsessesIAFLPN  1178
             IQ +P+ RP+MS V+EMLEG+VE+LQ+P     S+PI  + HQ +SS++ SS+S+A L N
Sbjct  556   IQTNPVQRPTMSEVIEMLEGEVEVLQLPPQPLQSQPIAPLFHQMESSITFSSDSMALLEN  615

Query  1179  SA  1184
             +A
Sbjct  616   AA  617


 Score =   312 bits (800),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 225/313 (72%), Gaps = 7/313 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSK-GN  2268
             FL+      P RY+++ IK++T    E+LGEGG+G VYKG++ S   VAVK+L+  K G 
Sbjct  280   FLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGFGKVYKGKLRSGRDVAVKMLSKPKAGG  339

Query  2267  GEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSW  2088
             G++F+NE+  IG+IHHVNVV LVGYC +   RALVY+++PN SL+KYI S E   V LSW
Sbjct  340   GQDFMNEIATIGRIHHVNVVGLVGYCVETTERALVYDFMPNGSLDKYIASQEGSPV-LSW  398

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             ++  EI +G+A+GIEYLH+GCD +ILHFDIKP NILLD N  PKI DFGLAK    + S 
Sbjct  399   QRKYEIVVGVARGIEYLHRGCDIRILHFDIKPHNILLDENFIPKISDFGLAKQYPTDNSI  458

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VT+TAARGT+GY+APE++SR+ G +S+K+DVYSFGMLL+EM+  ++N  A E  ++SQ  
Sbjct  459   VTLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEMLDLKRNVVANE-ENSSQY-  516

Query  1727  GSFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
               FP W+Y+   RG E+ +     +D++ I++K+ I+ALWCIQ  PV RP+M  V++MLE
Sbjct  517   --FPSWIYDKFKRGKEIVVDEEANEDEKKISRKMTIVALWCIQTNPVQRPTMSEVIEMLE  574

Query  1550  REGDDLVLPSSPF  1512
              E + L LP  P 
Sbjct  575   GEVEVLQLPPQPL  587



>ref|XP_009782472.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana sylvestris]
Length=638

 Score =   507 bits (1306),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 249/362 (69%), Positives = 301/362 (83%), Gaps = 3/362 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  IVFL+ K++RRHLS+++ IE FL   NN  PIRY+Y HIK MT+ FKEKLGEGGFG 
Sbjct  266   PIIIVFLMFKFKRRHLSMYDMIEGFLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGFGK  325

Query  288   VYKGKLRSGSDVAVKIMSKPKSNG-QDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
             VYKGKLRSG DVAVK++SKPK+ G QDF+NE+ ++GRIHHVN+V LVGYC E ++ ALVY
Sbjct  326   VYKGKLRSGRDVAVKMLSKPKAGGGQDFMNEIATIGRIHHVNVVGLVGYCVETTERALVY  385

Query  465   DFMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             DFMPNGSLDKYI     + +L+WQRK+EIVVGVARGIEYLHRGCDI+ILHFDIKPHNILL
Sbjct  386   DFMPNGSLDKYIASQEGSPVLSWQRKYEIVVGVARGIEYLHRGCDIRILHFDIKPHNILL  445

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAK +PTD SIVTLTAARGTIGYVAPEL++R IGAIS+KADVYSFGML
Sbjct  446   DENFIPKISDFGLAKQYPTDNSIVTLTAARGTIGYVAPELISRSIGAISYKADVYSFGML  505

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             LMEML L R  V  ++ SS+YFPSWIY+   +GK I + EE +EDEK+I++KMTIV LWC
Sbjct  506   LMEMLDLKRNVVANEENSSQYFPSWIYDKFKRGKEIVVDEEANEDEKKISRKMTIVALWC  565

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV-HqeqssmsessesIAFLPN  1178
             IQ +P+ RP+MS V+EMLEG+VE+LQ+P     S+PI  + HQ +SS++ SS+S+A L N
Sbjct  566   IQTNPVQRPTMSEVIEMLEGEVEVLQLPPQPLQSQPIAPLFHQMESSITFSSDSMALLEN  625

Query  1179  SA  1184
             +A
Sbjct  626   AA  627


 Score =   313 bits (801),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 225/313 (72%), Gaps = 7/313 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSK-GN  2268
             FL+      P RY+++ IK++T    E+LGEGG+G VYKG++ S   VAVK+L+  K G 
Sbjct  290   FLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGFGKVYKGKLRSGRDVAVKMLSKPKAGG  349

Query  2267  GEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSW  2088
             G++F+NE+  IG+IHHVNVV LVGYC +   RALVY+++PN SL+KYI S E   V LSW
Sbjct  350   GQDFMNEIATIGRIHHVNVVGLVGYCVETTERALVYDFMPNGSLDKYIASQEGSPV-LSW  408

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             ++  EI +G+A+GIEYLH+GCD +ILHFDIKP NILLD N  PKI DFGLAK    + S 
Sbjct  409   QRKYEIVVGVARGIEYLHRGCDIRILHFDIKPHNILLDENFIPKISDFGLAKQYPTDNSI  468

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VT+TAARGT+GY+APE++SR+ G +S+K+DVYSFGMLL+EM+  ++N  A E  ++SQ  
Sbjct  469   VTLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEMLDLKRNVVANE-ENSSQY-  526

Query  1727  GSFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
               FP W+Y+   RG E+ +     +D++ I++K+ I+ALWCIQ  PV RP+M  V++MLE
Sbjct  527   --FPSWIYDKFKRGKEIVVDEEANEDEKKISRKMTIVALWCIQTNPVQRPTMSEVIEMLE  584

Query  1550  REGDDLVLPSSPF  1512
              E + L LP  P 
Sbjct  585   GEVEVLQLPPQPL  597



>ref|XP_010316640.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2 isoform X3 [Solanum lycopersicum]
Length=383

 Score =   496 bits (1276),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 233/338 (69%), Positives = 283/338 (84%), Gaps = 2/338 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  +VFL+IK++RRHLS+++ IE FL + NN  PIRY+Y HIK MT+ FKEKLGEGG+GS
Sbjct  13    PFVVVFLVIKFKRRHLSMYDTIEGFLQSQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGS  72

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG DVAVK++SKPKS GQDF+NEV S+GRIHHVN+V LVGYC E +K ALVYD
Sbjct  73    VYKGKLQSGRDVAVKMLSKPKSGGQDFMNEVASIGRIHHVNVVGLVGYCVEGTKRALVYD  132

Query  468   FMPNGSLDKYINQGAYAS-LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSLDKYI+     S LL+WQRK++I++GVARG  YLHRGCD+QILHFDIKPHNILL
Sbjct  133   FMPNGSLDKYISISEEGSPLLSWQRKYDIILGVARGTGYLHRGCDVQILHFDIKPHNILL  192

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAKL+P   SIVTLTAARGTIGYVAPEL++R IG IS+KADVYSFGML
Sbjct  193   DENFIPKISDFGLAKLYPPGNSIVTLTAARGTIGYVAPELISRSIGEISYKADVYSFGML  252

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             LMEML L R  V  ++ SS+YFP +IY+  NKGK I + EE ++DEK++ +K+ +V LWC
Sbjct  253   LMEMLDLKRPEVANEENSSQYFPYYIYDKFNKGKEIVVDEEANDDEKKMARKLALVALWC  312

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIM  1115
             IQ +PI RPSMSRV+EMLEG+VE+L++P     S+PI+
Sbjct  313   IQTNPIQRPSMSRVLEMLEGEVEVLEVPPQPLQSQPIV  350


 Score =   311 bits (798),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 226/312 (72%), Gaps = 5/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RY+++ IK++T    E+LGEGGYG VYKG++ S   VAVK+L+  K  G
Sbjct  37    FLQSQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGSVYKGKLQSGRDVAVKMLSKPKSGG  96

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV LVGYC +G +RALVY+++PN SL+KYI  +E  +  LSW+
Sbjct  97    QDFMNEVASIGRIHHVNVVGLVGYCVEGTKRALVYDFMPNGSLDKYISISEEGSPLLSWQ  156

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  +I LG+A+G  YLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL     S V
Sbjct  157   RKYDIILGVARGTGYLHRGCDVQILHFDIKPHNILLDENFIPKISDFGLAKLYPPGNSIV  216

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE++SR+ G++S+K+DVYSFGMLL+EM+  ++   A E  ++SQ   
Sbjct  217   TLTAARGTIGYVAPELISRSIGEISYKADVYSFGMLLMEMLDLKRPEVANE-ENSSQY--  273

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP ++Y+  N+G E+ +     DD++ +A+KLA++ALWCIQ  P+ RPSM  V++MLE 
Sbjct  274   -FPYYIYDKFNKGKEIVVDEEANDDEKKMARKLALVALWCIQTNPIQRPSMSRVLEMLEG  332

Query  1547  EGDDLVLPSSPF  1512
             E + L +P  P 
Sbjct  333   EVEVLEVPPQPL  344



>ref|XP_006367678.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=392

 Score =   494 bits (1273),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/338 (69%), Positives = 285/338 (84%), Gaps = 2/338 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  I FL+ K++RRHLS+++ IE FL   NN  PIRY+Y +IK MT+ FKEKLGEGG+G+
Sbjct  26    PLVIAFLVYKFKRRHLSMYDTIEGFLQTQNNFMPIRYNYSNIKRMTRGFKEKLGEGGYGT  85

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG D AVK++SKPK++GQDF+NEV ++GRIHHVN+V LVGYC E +K ALVYD
Sbjct  86    VYKGKLQSGRDAAVKMLSKPKADGQDFMNEVATIGRIHHVNVVGLVGYCVEGTKRALVYD  145

Query  468   FMPNGSLDKYINQGAYAS-LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSLDKYI+     S LL+WQRK++I++GVARGI YLHRGCD++ILHFDIKPHNILL
Sbjct  146   FMPNGSLDKYISTSQEGSPLLSWQRKYDIILGVARGIGYLHRGCDVRILHFDIKPHNILL  205

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAKL+PTDKSIVTLTAARGTIGYVAPEL++R IGAIS+KADVYSFGML
Sbjct  206   DENFIPKISDFGLAKLYPTDKSIVTLTAARGTIGYVAPELISRSIGAISYKADVYSFGML  265

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             LMEML L R  V  ++ SS+YFP  IY+  NKGK I + EE ++DEK+I +K+++V LWC
Sbjct  266   LMEMLDLKRNEVANEENSSQYFPYNIYDKFNKGKEIVVDEEANDDEKKIARKLSLVALWC  325

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIM  1115
             IQ +PI RPSMS+VVEMLEG+VE+L++P     S+PI+
Sbjct  326   IQTNPIQRPSMSKVVEMLEGEVEVLEVPPLPLQSQPIV  363


 Score =   317 bits (813),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 230/312 (74%), Gaps = 5/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RY++++IK++T    E+LGEGGYG VYKG++ S    AVK+L+  K +G
Sbjct  50    FLQTQNNFMPIRYNYSNIKRMTRGFKEKLGEGGYGTVYKGKLQSGRDAAVKMLSKPKADG  109

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV LVGYC +G +RALVY+++PN SL+KYI +++  +  LSW+
Sbjct  110   QDFMNEVATIGRIHHVNVVGLVGYCVEGTKRALVYDFMPNGSLDKYISTSQEGSPLLSWQ  169

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  +I LG+A+GI YLH+GCD +ILHFDIKP NILLD N  PKI DFGLAKL   +KS V
Sbjct  170   RKYDIILGVARGIGYLHRGCDVRILHFDIKPHNILLDENFIPKISDFGLAKLYPTDKSIV  229

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE++SR+ G +S+K+DVYSFGMLL+EM+  ++N  A E  ++SQ   
Sbjct  230   TLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEMLDLKRNEVANE-ENSSQY--  286

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP  +Y+  N+G E+ +     DD++ IA+KL+++ALWCIQ  P+ RPSM  VV+MLE 
Sbjct  287   -FPYNIYDKFNKGKEIVVDEEANDDEKKIARKLSLVALWCIQTNPIQRPSMSKVVEMLEG  345

Query  1547  EGDDLVLPSSPF  1512
             E + L +P  P 
Sbjct  346   EVEVLEVPPLPL  357



>ref|XP_010316639.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2 isoform X2 [Solanum lycopersicum]
Length=435

 Score =   496 bits (1276),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 233/338 (69%), Positives = 283/338 (84%), Gaps = 2/338 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  +VFL+IK++RRHLS+++ IE FL + NN  PIRY+Y HIK MT+ FKEKLGEGG+GS
Sbjct  65    PFVVVFLVIKFKRRHLSMYDTIEGFLQSQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGS  124

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG DVAVK++SKPKS GQDF+NEV S+GRIHHVN+V LVGYC E +K ALVYD
Sbjct  125   VYKGKLQSGRDVAVKMLSKPKSGGQDFMNEVASIGRIHHVNVVGLVGYCVEGTKRALVYD  184

Query  468   FMPNGSLDKYINQGAYAS-LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSLDKYI+     S LL+WQRK++I++GVARG  YLHRGCD+QILHFDIKPHNILL
Sbjct  185   FMPNGSLDKYISISEEGSPLLSWQRKYDIILGVARGTGYLHRGCDVQILHFDIKPHNILL  244

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAKL+P   SIVTLTAARGTIGYVAPEL++R IG IS+KADVYSFGML
Sbjct  245   DENFIPKISDFGLAKLYPPGNSIVTLTAARGTIGYVAPELISRSIGEISYKADVYSFGML  304

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             LMEML L R  V  ++ SS+YFP +IY+  NKGK I + EE ++DEK++ +K+ +V LWC
Sbjct  305   LMEMLDLKRPEVANEENSSQYFPYYIYDKFNKGKEIVVDEEANDDEKKMARKLALVALWC  364

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIM  1115
             IQ +PI RPSMSRV+EMLEG+VE+L++P     S+PI+
Sbjct  365   IQTNPIQRPSMSRVLEMLEGEVEVLEVPPQPLQSQPIV  402


 Score =   311 bits (796),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 226/312 (72%), Gaps = 5/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RY+++ IK++T    E+LGEGGYG VYKG++ S   VAVK+L+  K  G
Sbjct  89    FLQSQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGSVYKGKLQSGRDVAVKMLSKPKSGG  148

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV LVGYC +G +RALVY+++PN SL+KYI  +E  +  LSW+
Sbjct  149   QDFMNEVASIGRIHHVNVVGLVGYCVEGTKRALVYDFMPNGSLDKYISISEEGSPLLSWQ  208

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  +I LG+A+G  YLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL     S V
Sbjct  209   RKYDIILGVARGTGYLHRGCDVQILHFDIKPHNILLDENFIPKISDFGLAKLYPPGNSIV  268

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE++SR+ G++S+K+DVYSFGMLL+EM+  ++   A E  ++SQ   
Sbjct  269   TLTAARGTIGYVAPELISRSIGEISYKADVYSFGMLLMEMLDLKRPEVANE-ENSSQY--  325

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP ++Y+  N+G E+ +     DD++ +A+KLA++ALWCIQ  P+ RPSM  V++MLE 
Sbjct  326   -FPYYIYDKFNKGKEIVVDEEANDDEKKMARKLALVALWCIQTNPIQRPSMSRVLEMLEG  384

Query  1547  EGDDLVLPSSPF  1512
             E + L +P  P 
Sbjct  385   EVEVLEVPPQPL  396



>ref|XP_006348220.1| PREDICTED: probable receptor-like protein kinase At1g67000-like, 
partial [Solanum tuberosum]
Length=387

 Score =   492 bits (1267),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 243/368 (66%), Positives = 299/368 (81%), Gaps = 4/368 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  I FL+ K++RRHLS+++ IE FL   NN  PIRY+Y HIK MT+ FKEKLGEGG+GS
Sbjct  17    PLVIAFLVYKFKRRHLSMYDTIEGFLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGS  76

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK++SKPK+ GQDF+NEV ++GRIHHVN+V LVGYC E +K AL+YD
Sbjct  77    VYKGKLRSGRDVAVKMLSKPKAGGQDFMNEVATIGRIHHVNVVGLVGYCVEGTKRALLYD  136

Query  468   FMPNGSLDKYINQGAYAS-LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSLDKYI+     S LL+WQRK++I++GVARGI YLHRGCD++ILHFDIKPHNILL
Sbjct  137   FMPNGSLDKYISTSQEGSPLLSWQRKYDIILGVARGIGYLHRGCDVRILHFDIKPHNILL  196

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAKL+PTD SIV LTAARGTIGYVAPEL++R IGAIS+KADVYSFGML
Sbjct  197   DENFIPKISDFGLAKLYPTDNSIVNLTAARGTIGYVAPELISRSIGAISYKADVYSFGML  256

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDED-EKRITKKMTIVGLWC  1001
             LMEML LNR  V  ++ SS+YFP +IY+  N+GK I + EE  D E ++ +K+++V LWC
Sbjct  257   LMEMLDLNRHEVANEENSSQYFPYYIYDKFNEGKEIPVDEEANDGENKMARKLSLVALWC  316

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEVHqeqssmsessesIAFLPNS  1181
             IQ +PI RPSMSRV+EMLEG+VE+L++P     S+ I+      SSM+ SS+S+A L NS
Sbjct  317   IQTNPIQRPSMSRVLEMLEGEVEVLEVPPQPLQSQRIVH-QLMGSSMTFSSDSMALLENS  375

Query  1182  ASSNSIGI  1205
             A  NS+ +
Sbjct  376   A-DNSVKV  382


 Score =   312 bits (799),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 222/317 (70%), Gaps = 5/317 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RY+++ IK++T    E+LGEGGYG VYKG++ S   VAVK+L+  K  G
Sbjct  41    FLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGSVYKGKLRSGRDVAVKMLSKPKAGG  100

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV LVGYC +G +RAL+Y+++PN SL+KYI +++  +  LSW+
Sbjct  101   QDFMNEVATIGRIHHVNVVGLVGYCVEGTKRALLYDFMPNGSLDKYISTSQEGSPLLSWQ  160

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  +I LG+A+GI YLH+GCD +ILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  161   RKYDIILGVARGIGYLHRGCDVRILHFDIKPHNILLDENFIPKISDFGLAKLYPTDNSIV  220

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              +TAARGT+GY+APE++SR+ G +S+K+DVYSFGMLL+EM+    + N  E  +      
Sbjct  221   NLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEML----DLNRHEVANEENSSQ  276

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP ++Y+  N G E+ +     D +  +A+KL+++ALWCIQ  P+ RPSM  V++MLE 
Sbjct  277   YFPYYIYDKFNEGKEIPVDEEANDGENKMARKLSLVALWCIQTNPIQRPSMSRVLEMLEG  336

Query  1547  EGDDLVLPSSPFAGSQM  1497
             E + L +P  P    ++
Sbjct  337   EVEVLEVPPQPLQSQRI  353



>ref|XP_009609372.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=667

 Score =   502 bits (1292),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/327 (71%), Positives = 279/327 (85%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRHLS+F+ IE+FL+++NN  PIRY Y +I+ MT+  KEKLG+GG+GS
Sbjct  298   PCIFVFLLIELRRRHLSIFDAIESFLHSENNFMPIRYPYSNIRKMTRNLKEKLGQGGYGS  357

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVKI+SKPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  358   VYKGKLRSGPDVAVKILSKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  417

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  418   FMPNGSLDKYITPQVEGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  477

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG +S+KADVYSFGMLL
Sbjct  478   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPVSYKADVYSFGMLL  537

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIE-MGEEDEDEKRITKKMTIVGLWCI  1004
             +EM G+ R     +D SS+YFP WIY+  +K K IE + E  +DEK+I KK+T+V LWCI
Sbjct  538   IEMAGMKRNSAAREDMSSQYFPHWIYDQFDKEKEIEVLDETHDDEKKIIKKLTLVALWCI  597

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM+P+ RPSM++VVEM+EG+++ LQ P
Sbjct  598   QMNPLYRPSMTKVVEMIEGELQALQTP  624


 Score =   325 bits (834),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 228/311 (73%), Gaps = 6/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RY +++I+K+T  L E+LG+GGYG VYKG++ S   VAVK+L+  K +G
Sbjct  322   FLHSENNFMPIRYPYSNIRKMTRNLKEKLGQGGYGSVYKGKLRSGPDVAVKILSKPKADG  381

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI + + +   LSW+
Sbjct  382   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYI-TPQVEGTLLSWQ  440

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  441   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  500

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G VS+K+DVYSFGMLL+EM G ++N  A+E  D S Q  
Sbjct  501   TLTAARGTIGYVAPELINRSIGPVSYKADVYSFGMLLIEMAGMKRNSAARE--DMSSQ--  556

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+  ++  E+++     DD++ I KKL ++ALWCIQ  P+ RPSM  VV+M+E 
Sbjct  557   YFPHWIYDQFDKEKEIEVLDETHDDEKKIIKKLTLVALWCIQMNPLYRPSMTKVVEMIEG  616

Query  1547  EGDDLVLPSSP  1515
             E   L  P  P
Sbjct  617   ELQALQTPPRP  627



>ref|XP_006363204.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=437

 Score =   493 bits (1270),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 242/368 (66%), Positives = 299/368 (81%), Gaps = 4/368 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  +VFL+IK++RRHLS+++ IE FL   NN  PIRY Y H+K MT+ FKEKLGEGG+GS
Sbjct  67    PLVLVFLVIKFKRRHLSMYDAIEGFLQTQNNFMPIRYKYSHVKRMTRGFKEKLGEGGYGS  126

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSG DVAVK+++KPK+ GQDF+NEV ++GRIHHVN+V LVGYC E +  ALVYD
Sbjct  127   VYKGNLRSGRDVAVKMLNKPKAGGQDFMNEVATIGRIHHVNVVGLVGYCVEGTIRALVYD  186

Query  468   FMPNGSLDKYINQGAYAS-LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FM NGSLDKYIN     S LL+WQ K++IV+GVARGI YLHRGCD++ILHFDIKPHNILL
Sbjct  187   FMSNGSLDKYINTSQEGSPLLSWQSKYDIVLGVARGIGYLHRGCDVRILHFDIKPHNILL  246

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+++ IGAIS+K DVYSFGML
Sbjct  247   DENFIPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELISKSIGAISYKVDVYSFGML  306

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             LMEML LNR  V  ++ SS+YFP +IY+  NKGK I + EE ++DEK++ +K+++V LWC
Sbjct  307   LMEMLDLNRHEVANEENSSQYFPYYIYDKFNKGKEILVDEEANDDEKKMARKLSLVALWC  366

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEVHqeqssmsessesIAFLPNS  1181
             IQ +PI RPSMS+V+EMLEG+VE+L++P     S+PI+      SSM  SS+S+A L NS
Sbjct  367   IQTNPIQRPSMSKVLEMLEGEVEVLEVPPQPLQSQPIV-YQMMGSSMIFSSDSMALLENS  425

Query  1182  ASSNSIGI  1205
             A  NS+ +
Sbjct  426   A-DNSVKV  432


 Score =   307 bits (786),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/312 (51%), Positives = 218/312 (70%), Gaps = 5/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RY ++ +K++T    E+LGEGGYG VYKG + S   VAVK+LN  K  G
Sbjct  91    FLQTQNNFMPIRYKYSHVKRMTRGFKEKLGEGGYGSVYKGNLRSGRDVAVKMLNKPKAGG  150

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV LVGYC +G  RALVY+++ N SL+KYI +++  +  LSW+
Sbjct  151   QDFMNEVATIGRIHHVNVVGLVGYCVEGTIRALVYDFMSNGSLDKYINTSQEGSPLLSWQ  210

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
                +I LG+A+GI YLH+GCD +ILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  211   SKYDIVLGVARGIGYLHRGCDVRILHFDIKPHNILLDENFIPKISDFGLAKLYPTDNSIV  270

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE++S++ G +S+K DVYSFGMLL+EM+    + N  E  +      
Sbjct  271   TLTAARGTIGYVAPELISKSIGAISYKVDVYSFGMLLMEML----DLNRHEVANEENSSQ  326

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP ++Y+  N+G E+ +     DD++ +A+KL+++ALWCIQ  P+ RPSM  V++MLE 
Sbjct  327   YFPYYIYDKFNKGKEILVDEEANDDEKKMARKLSLVALWCIQTNPIQRPSMSKVLEMLEG  386

Query  1547  EGDDLVLPSSPF  1512
             E + L +P  P 
Sbjct  387   EVEVLEVPPQPL  398



>ref|XP_009796756.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X3 [Nicotiana sylvestris]
Length=528

 Score =   495 bits (1274),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/332 (69%), Positives = 278/332 (84%), Gaps = 0/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRHLS+F+ IE+FL++ NN  PIRY Y  I+ MT+ FKEKLG+GG+GS
Sbjct  160   PCIFVFLVIELRRRHLSIFDAIESFLHSRNNFMPIRYPYSSIRKMTRNFKEKLGQGGYGS  219

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  220   VYKGKLQSGPNVAVKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  279

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  280   FMPNGSLDKYITPREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  339

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFGMLL
Sbjct  340   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLL  399

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             +E+ G+       +D SS+YFP WIY+  +K K IE+ +E  D++ I KK+T+V LWCIQ
Sbjct  400   IEIAGMKGNSAAREDMSSQYFPHWIYDQFDKEKEIEVLDETHDDEMIIKKLTLVALWCIQ  459

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             M+P+ RPSM++VVEMLEG+++ LQ P   F S
Sbjct  460   MNPLDRPSMTKVVEMLEGELQALQTPPRPFES  491


 Score =   332 bits (852),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 226/315 (72%), Gaps = 5/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RY ++ I+K+T    E+LG+GGYG VYKG++ S   VAVK+L   K +G
Sbjct  184   FLHSRNNFMPIRYPYSSIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILTKPKADG  243

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI   E   + LSW+
Sbjct  244   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITPREGGTL-LSWQ  302

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  303   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  362

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+E+ G + N  A+E  D S Q  
Sbjct  363   TLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEIAGMKGNSAARE--DMSSQ--  418

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++  E+++  E  DDE I KKL ++ALWCIQ  P+DRPSM  VV+MLE E
Sbjct  419   YFPHWIYDQFDKEKEIEVLDETHDDEMIIKKLTLVALWCIQMNPLDRPSMTKVVEMLEGE  478

Query  1544  GDDLVLPSSPFAGSQ  1500
                L  P  PF   Q
Sbjct  479   LQALQTPPRPFESLQ  493



>ref|XP_009778886.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana sylvestris]
Length=668

 Score =   499 bits (1284),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 230/327 (70%), Positives = 277/327 (85%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRH+S+F+ IE+FL+  NN  PIRY Y  I+ MT  FKEKLG+GG+GS
Sbjct  299   PCIFVFLMIELRRRHMSIFDAIESFLHNRNNFMPIRYPYSSIRKMTGNFKEKLGQGGYGS  358

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVA+KI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  359   VYKGKLRSGPDVAMKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  418

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  419   FMPNGSLDKYITPREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  478

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SI+TLTAARGTIGYVAPEL+NR IG +S+KADVYSFGMLL
Sbjct  479   ENFVPKISDFGLAKLYPTDNSIITLTAARGTIGYVAPELINRSIGPVSYKADVYSFGMLL  538

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIE-MGEEDEDEKRITKKMTIVGLWCI  1004
             +EM G+       +D SS+YFP WIY+ I+K K IE + E  +DEK+I KK+T+V LWCI
Sbjct  539   IEMAGMKSNSAAREDMSSQYFPHWIYDQIDKEKEIEVLDETHDDEKKIIKKLTLVALWCI  598

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM+P+ RPSM++VVEMLEG+++ LQMP
Sbjct  599   QMNPLDRPSMTKVVEMLEGELQALQMP  625


 Score =   328 bits (841),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 227/311 (73%), Gaps = 6/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL +     P RY ++ I+K+T    E+LG+GGYG VYKG++ S   VA+K+L   K +G
Sbjct  323   FLHNRNNFMPIRYPYSSIRKMTGNFKEKLGQGGYGSVYKGKLRSGPDVAMKILTKPKADG  382

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI   E   + LSW+
Sbjct  383   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITPREGGTL-LSWQ  441

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S +
Sbjct  442   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSII  501

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G VS+K+DVYSFGMLL+EM G + N  A+E  D S Q  
Sbjct  502   TLTAARGTIGYVAPELINRSIGPVSYKADVYSFGMLLIEMAGMKSNSAARE--DMSSQ--  557

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+ +++  E+++     DD++ I KKL ++ALWCIQ  P+DRPSM  VV+MLE 
Sbjct  558   YFPHWIYDQIDKEKEIEVLDETHDDEKKIIKKLTLVALWCIQMNPLDRPSMTKVVEMLEG  617

Query  1547  EGDDLVLPSSP  1515
             E   L +P  P
Sbjct  618   ELQALQMPPRP  628



>ref|XP_009778885.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana sylvestris]
Length=673

 Score =   498 bits (1283),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 230/327 (70%), Positives = 277/327 (85%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRH+S+F+ IE+FL+  NN  PIRY Y  I+ MT  FKEKLG+GG+GS
Sbjct  304   PCIFVFLMIELRRRHMSIFDAIESFLHNRNNFMPIRYPYSSIRKMTGNFKEKLGQGGYGS  363

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVA+KI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  364   VYKGKLRSGPDVAMKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  423

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  424   FMPNGSLDKYITPREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  483

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SI+TLTAARGTIGYVAPEL+NR IG +S+KADVYSFGMLL
Sbjct  484   ENFVPKISDFGLAKLYPTDNSIITLTAARGTIGYVAPELINRSIGPVSYKADVYSFGMLL  543

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIE-MGEEDEDEKRITKKMTIVGLWCI  1004
             +EM G+       +D SS+YFP WIY+ I+K K IE + E  +DEK+I KK+T+V LWCI
Sbjct  544   IEMAGMKSNSAAREDMSSQYFPHWIYDQIDKEKEIEVLDETHDDEKKIIKKLTLVALWCI  603

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM+P+ RPSM++VVEMLEG+++ LQMP
Sbjct  604   QMNPLDRPSMTKVVEMLEGELQALQMP  630


 Score =   328 bits (841),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 227/311 (73%), Gaps = 6/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL +     P RY ++ I+K+T    E+LG+GGYG VYKG++ S   VA+K+L   K +G
Sbjct  328   FLHNRNNFMPIRYPYSSIRKMTGNFKEKLGQGGYGSVYKGKLRSGPDVAMKILTKPKADG  387

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI   E   + LSW+
Sbjct  388   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITPREGGTL-LSWQ  446

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S +
Sbjct  447   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSII  506

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G VS+K+DVYSFGMLL+EM G + N  A+E  D S Q  
Sbjct  507   TLTAARGTIGYVAPELINRSIGPVSYKADVYSFGMLLIEMAGMKSNSAARE--DMSSQY-  563

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+ +++  E+++     DD++ I KKL ++ALWCIQ  P+DRPSM  VV+MLE 
Sbjct  564   -FPHWIYDQIDKEKEIEVLDETHDDEKKIIKKLTLVALWCIQMNPLDRPSMTKVVEMLEG  622

Query  1547  EGDDLVLPSSP  1515
             E   L +P  P
Sbjct  623   ELQALQMPPRP  633



>ref|XP_009796755.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana sylvestris]
Length=631

 Score =   494 bits (1273),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 229/332 (69%), Positives = 278/332 (84%), Gaps = 0/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRHLS+F+ IE+FL++ NN  PIRY Y  I+ MT+ FKEKLG+GG+GS
Sbjct  263   PCIFVFLVIELRRRHLSIFDAIESFLHSRNNFMPIRYPYSSIRKMTRNFKEKLGQGGYGS  322

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  323   VYKGKLQSGPNVAVKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  382

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  383   FMPNGSLDKYITPREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  442

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFGMLL
Sbjct  443   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLL  502

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             +E+ G+       +D SS+YFP WIY+  +K K IE+ +E  D++ I KK+T+V LWCIQ
Sbjct  503   IEIAGMKGNSAAREDMSSQYFPHWIYDQFDKEKEIEVLDETHDDEMIIKKLTLVALWCIQ  562

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             M+P+ RPSM++VVEMLEG+++ LQ P   F S
Sbjct  563   MNPLDRPSMTKVVEMLEGELQALQTPPRPFES  594


 Score =   332 bits (851),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 226/315 (72%), Gaps = 5/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RY ++ I+K+T    E+LG+GGYG VYKG++ S   VAVK+L   K +G
Sbjct  287   FLHSRNNFMPIRYPYSSIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILTKPKADG  346

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI   E   + LSW+
Sbjct  347   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITPREGGTL-LSWQ  405

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  406   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  465

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+E+ G + N  A+E  D S Q  
Sbjct  466   TLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEIAGMKGNSAARE--DMSSQ--  521

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++  E+++  E  DDE I KKL ++ALWCIQ  P+DRPSM  VV+MLE E
Sbjct  522   YFPHWIYDQFDKEKEIEVLDETHDDEMIIKKLTLVALWCIQMNPLDRPSMTKVVEMLEGE  581

Query  1544  GDDLVLPSSPFAGSQ  1500
                L  P  PF   Q
Sbjct  582   LQALQTPPRPFESLQ  596



>ref|XP_009599583.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X5 [Nicotiana tomentosiformis]
Length=529

 Score =   491 bits (1263),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 228/327 (70%), Positives = 277/327 (85%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRH+S+F+ IE+FL++ NN  PIRY Y +I+ MT+ FKEKLG+GG+GS
Sbjct  160   PCIFVFLMIELRRRHMSIFDAIESFLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGS  219

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  220   VYKGKLQSGPNVAVKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  279

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  280   FMPNGSLDKYITSREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  339

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFGMLL
Sbjct  340   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLL  399

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDED-EKRITKKMTIVGLWCI  1004
             +E+ G+       +D SS+YFP WIY+  +K K IE+ +E  D EK+I KK+T+V LWCI
Sbjct  400   IEIAGMKGNSAAREDMSSQYFPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCI  459

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P+ RPSM++VVEMLEG+++ LQ P
Sbjct  460   QMIPLDRPSMTKVVEMLEGELQTLQTP  486


 Score =   325 bits (833),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 170/311 (55%), Positives = 226/311 (73%), Gaps = 6/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RY +++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L   K +G
Sbjct  184   FLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILTKPKADG  243

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI S E   + LSW+
Sbjct  244   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITSREGGTL-LSWQ  302

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  303   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  362

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+E+ G + N  A+E  D S Q  
Sbjct  363   TLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEIAGMKGNSAARE--DMSSQ--  418

Query  1724  SFPEWVYNHLNRGGELQIRieedd-deaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+  ++  E+++  E  D ++ I KKL ++ALWCIQ  P+DRPSM  VV+MLE 
Sbjct  419   YFPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCIQMIPLDRPSMTKVVEMLEG  478

Query  1547  EGDDLVLPSSP  1515
             E   L  P  P
Sbjct  479   ELQTLQTPPRP  489



>ref|XP_009629972.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=641

 Score =   494 bits (1273),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 233/325 (72%), Positives = 276/325 (85%), Gaps = 2/325 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  IVFL+IK++RRHLS+++ IE FL   NN  PIRY+Y HIK MT+ FKEK+GEGG+G 
Sbjct  269   PIIIVFLMIKFKRRHLSMYDMIEGFLQTQNNFIPIRYNYSHIKRMTRGFKEKIGEGGYGK  328

Query  288   VYKGKLRSGSDVAVKIMSKPKSNG-QDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
             VYKGKLRSG DVAVK++SKPK+ G QDF+NEV ++GRIHHVN+V LVGYC E ++ ALVY
Sbjct  329   VYKGKLRSGRDVAVKMLSKPKAGGGQDFMNEVATIGRIHHVNVVGLVGYCVETTERALVY  388

Query  465   DFMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             DFMPNGSLDKYI     + +L+WQRK+EI+VGVARGIEYLHRGC+I+ILHFDIKPHNILL
Sbjct  389   DFMPNGSLDKYITSQEGSPVLSWQRKYEIIVGVARGIEYLHRGCEIRILHFDIKPHNILL  448

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL++R IGAIS+KADVYSFGML
Sbjct  449   DENFIPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELISRSIGAISYKADVYSFGML  508

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             LMEML L R     ++ SS+YFP W+Y+  NKGK I + EE +EDEK+I++KMTIV LWC
Sbjct  509   LMEMLDLKRNVAVNEENSSQYFPCWVYDKFNKGKEIMVDEEANEDEKKISRKMTIVALWC  568

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELL  1076
             IQ +P+ RPSMS VVEMLEG+VE L
Sbjct  569   IQTNPVQRPSMSVVVEMLEGEVESL  593


 Score =   309 bits (792),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 165/306 (54%), Positives = 223/306 (73%), Gaps = 7/306 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSK-GN  2268
             FL+      P RY+++ IK++T    E++GEGGYG VYKG++ S   VAVK+L+  K G 
Sbjct  293   FLQTQNNFIPIRYNYSHIKRMTRGFKEKIGEGGYGKVYKGKLRSGRDVAVKMLSKPKAGG  352

Query  2267  GEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSW  2088
             G++F+NEV  IG+IHHVNVV LVGYC +   RALVY+++PN SL+KYI S E   V LSW
Sbjct  353   GQDFMNEVATIGRIHHVNVVGLVGYCVETTERALVYDFMPNGSLDKYITSQEGSPV-LSW  411

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             ++  EI +G+A+GIEYLH+GC+ +ILHFDIKP NILLD N  PKI DFGLAKL   + S 
Sbjct  412   QRKYEIIVGVARGIEYLHRGCEIRILHFDIKPHNILLDENFIPKISDFGLAKLYPTDNSI  471

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VT+TAARGT+GY+APE++SR+ G +S+K+DVYSFGMLL+EM+  ++N    E  ++SQ  
Sbjct  472   VTLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEMLDLKRNVAVNE-ENSSQY-  529

Query  1727  GSFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
               FP WVY+  N+G E+ +     +D++ I++K+ I+ALWCIQ  PV RPSM  VV+MLE
Sbjct  530   --FPCWVYDKFNKGKEIMVDEEANEDEKKISRKMTIVALWCIQTNPVQRPSMSVVVEMLE  587

Query  1550  REGDDL  1533
              E + L
Sbjct  588   GEVESL  593



>ref|XP_006366545.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=525

 Score =   490 bits (1261),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 228/327 (70%), Positives = 280/327 (86%), Gaps = 4/327 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC +VFL+IK RRRHLS+++ IE+FL+ +NN  PIRYS  +I+ MT+ FKEKLG+GG+GS
Sbjct  158   PCIVVFLMIKLRRRHLSIYDAIESFLHGENNFAPIRYSNSNIRKMTRNFKEKLGQGGYGS  217

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI+SKPK++GQDFINEV ++GRIHHVNIV+L+GYCAE  K ALVYD
Sbjct  218   VYKGKLQSGPNVAVKILSKPKADGQDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYD  277

Query  468   FMPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSL+KYI  +G  A LL+W+RKFEI +GVARGIEYLHRGCDIQILHFDIKPHNILL
Sbjct  278   FMPNGSLEKYITPRGGGAELLSWERKFEIALGVARGIEYLHRGCDIQILHFDIKPHNILL  337

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPK+SDFGLAK +PTDKSIVTLTA RGTIGYVAPEL+NR IG IS+KADVYSFGML
Sbjct  338   DENFIPKLSDFGLAKSYPTDKSIVTLTAVRGTIGYVAPELINRSIGPISYKADVYSFGML  397

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             L++++GL       +D SS+YFP WIY+ ++KGK IE+ +E  D+    KK+T+V LWCI
Sbjct  398   LIDIVGLKTNSAAREDMSSQYFPHWIYDQLDKGKEIEVLDETHDD---VKKLTLVALWCI  454

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM+P+ RPSM++VVEMLEG+++ LQ P
Sbjct  455   QMNPLDRPSMTKVVEMLEGELQALQTP  481


 Score =   324 bits (831),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 223/310 (72%), Gaps = 7/310 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RYS ++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L+  K +G
Sbjct  182   FLHGENNFAPIRYSNSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILSKPKADG  241

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVN+V+L+GYCA+  +RALVY+++PN SLEKYI         LSW+
Sbjct  242   QDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYDFMPNGSLEKYITPRGGGAELLSWE  301

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAK    +KS V
Sbjct  302   RKFEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKLSDFGLAKSYPTDKSIV  361

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G +S+K+DVYSFGMLL+++VG + N  A+E  D S Q  
Sbjct  362   TLTAVRGTIGYVAPELINRSIGPISYKADVYSFGMLLIDIVGLKTNSAARE--DMSSQY-  418

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ L++G E+++    D+     KKL ++ALWCIQ  P+DRPSM  VV+MLE E
Sbjct  419   -FPHWIYDQLDKGKEIEV---LDETHDDVKKLTLVALWCIQMNPLDRPSMTKVVEMLEGE  474

Query  1544  GDDLVLPSSP  1515
                L  P  P
Sbjct  475   LQALQTPPRP  484



>ref|XP_009599578.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X4 [Nicotiana tomentosiformis]
Length=579

 Score =   491 bits (1263),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 228/327 (70%), Positives = 277/327 (85%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRH+S+F+ IE+FL++ NN  PIRY Y +I+ MT+ FKEKLG+GG+GS
Sbjct  210   PCIFVFLMIELRRRHMSIFDAIESFLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGS  269

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  270   VYKGKLQSGPNVAVKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  329

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  330   FMPNGSLDKYITSREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  389

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFGMLL
Sbjct  390   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLL  449

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDED-EKRITKKMTIVGLWCI  1004
             +E+ G+       +D SS+YFP WIY+  +K K IE+ +E  D EK+I KK+T+V LWCI
Sbjct  450   IEIAGMKGNSAAREDMSSQYFPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCI  509

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P+ RPSM++VVEMLEG+++ LQ P
Sbjct  510   QMIPLDRPSMTKVVEMLEGELQTLQTP  536


 Score =   325 bits (832),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 170/311 (55%), Positives = 226/311 (73%), Gaps = 6/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RY +++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L   K +G
Sbjct  234   FLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILTKPKADG  293

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI S E   + LSW+
Sbjct  294   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITSREGGTL-LSWQ  352

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  353   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  412

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+E+ G + N  A+E  D S Q  
Sbjct  413   TLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEIAGMKGNSAARE--DMSSQ--  468

Query  1724  SFPEWVYNHLNRGGELQIRieedd-deaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+  ++  E+++  E  D ++ I KKL ++ALWCIQ  P+DRPSM  VV+MLE 
Sbjct  469   YFPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCIQMIPLDRPSMTKVVEMLEG  528

Query  1547  EGDDLVLPSSP  1515
             E   L  P  P
Sbjct  529   ELQTLQTPPRP  539



>ref|XP_009796754.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana sylvestris]
Length=667

 Score =   494 bits (1271),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 229/332 (69%), Positives = 278/332 (84%), Gaps = 0/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRHLS+F+ IE+FL++ NN  PIRY Y  I+ MT+ FKEKLG+GG+GS
Sbjct  299   PCIFVFLVIELRRRHLSIFDAIESFLHSRNNFMPIRYPYSSIRKMTRNFKEKLGQGGYGS  358

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  359   VYKGKLQSGPNVAVKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  418

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  419   FMPNGSLDKYITPREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  478

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFGMLL
Sbjct  479   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLL  538

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             +E+ G+       +D SS+YFP WIY+  +K K IE+ +E  D++ I KK+T+V LWCIQ
Sbjct  539   IEIAGMKGNSAAREDMSSQYFPHWIYDQFDKEKEIEVLDETHDDEMIIKKLTLVALWCIQ  598

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             M+P+ RPSM++VVEMLEG+++ LQ P   F S
Sbjct  599   MNPLDRPSMTKVVEMLEGELQALQTPPRPFES  630


 Score =   332 bits (851),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 226/315 (72%), Gaps = 5/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RY ++ I+K+T    E+LG+GGYG VYKG++ S   VAVK+L   K +G
Sbjct  323   FLHSRNNFMPIRYPYSSIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILTKPKADG  382

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI   E   + LSW+
Sbjct  383   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITPREGGTL-LSWQ  441

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  442   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  501

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+E+ G + N  A+E  D S Q  
Sbjct  502   TLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEIAGMKGNSAARE--DMSSQ--  557

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++  E+++  E  DDE I KKL ++ALWCIQ  P+DRPSM  VV+MLE E
Sbjct  558   YFPHWIYDQFDKEKEIEVLDETHDDEMIIKKLTLVALWCIQMNPLDRPSMTKVVEMLEGE  617

Query  1544  GDDLVLPSSPFAGSQ  1500
                L  P  PF   Q
Sbjct  618   LQALQTPPRPFESLQ  632



>ref|XP_010316638.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Solanum lycopersicum]
Length=647

 Score =   493 bits (1269),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 233/338 (69%), Positives = 283/338 (84%), Gaps = 2/338 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  +VFL+IK++RRHLS+++ IE FL + NN  PIRY+Y HIK MT+ FKEKLGEGG+GS
Sbjct  277   PFVVVFLVIKFKRRHLSMYDTIEGFLQSQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGS  336

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG DVAVK++SKPKS GQDF+NEV S+GRIHHVN+V LVGYC E +K ALVYD
Sbjct  337   VYKGKLQSGRDVAVKMLSKPKSGGQDFMNEVASIGRIHHVNVVGLVGYCVEGTKRALVYD  396

Query  468   FMPNGSLDKYINQGAYAS-LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSLDKYI+     S LL+WQRK++I++GVARG  YLHRGCD+QILHFDIKPHNILL
Sbjct  397   FMPNGSLDKYISISEEGSPLLSWQRKYDIILGVARGTGYLHRGCDVQILHFDIKPHNILL  456

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAKL+P   SIVTLTAARGTIGYVAPEL++R IG IS+KADVYSFGML
Sbjct  457   DENFIPKISDFGLAKLYPPGNSIVTLTAARGTIGYVAPELISRSIGEISYKADVYSFGML  516

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             LMEML L R  V  ++ SS+YFP +IY+  NKGK I + EE ++DEK++ +K+ +V LWC
Sbjct  517   LMEMLDLKRPEVANEENSSQYFPYYIYDKFNKGKEIVVDEEANDDEKKMARKLALVALWC  576

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIM  1115
             IQ +PI RPSMSRV+EMLEG+VE+L++P     S+PI+
Sbjct  577   IQTNPIQRPSMSRVLEMLEGEVEVLEVPPQPLQSQPIV  614


 Score =   308 bits (790),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 226/312 (72%), Gaps = 5/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RY+++ IK++T    E+LGEGGYG VYKG++ S   VAVK+L+  K  G
Sbjct  301   FLQSQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGSVYKGKLQSGRDVAVKMLSKPKSGG  360

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV LVGYC +G +RALVY+++PN SL+KYI  +E  +  LSW+
Sbjct  361   QDFMNEVASIGRIHHVNVVGLVGYCVEGTKRALVYDFMPNGSLDKYISISEEGSPLLSWQ  420

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  +I LG+A+G  YLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL     S V
Sbjct  421   RKYDIILGVARGTGYLHRGCDVQILHFDIKPHNILLDENFIPKISDFGLAKLYPPGNSIV  480

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE++SR+ G++S+K+DVYSFGMLL+EM+  ++   A E  ++SQ   
Sbjct  481   TLTAARGTIGYVAPELISRSIGEISYKADVYSFGMLLMEMLDLKRPEVANE-ENSSQY--  537

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP ++Y+  N+G E+ +     DD++ +A+KLA++ALWCIQ  P+ RPSM  V++MLE 
Sbjct  538   -FPYYIYDKFNKGKEIVVDEEANDDEKKMARKLALVALWCIQTNPIQRPSMSRVLEMLEG  596

Query  1547  EGDDLVLPSSPF  1512
             E + L +P  P 
Sbjct  597   EVEVLEVPPQPL  608



>ref|XP_009788881.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=710

 Score =   494 bits (1273),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 228/332 (69%), Positives = 280/332 (84%), Gaps = 0/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRHLS+F+ IE+FL++++N  PI+Y Y +I+ MT+ FKEK+G+GG+GS
Sbjct  342   PCIFVFLMIELRRRHLSIFDAIESFLHSEHNFMPIQYPYSNIRKMTRNFKEKVGQGGYGS  401

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVKI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  402   VYKGKLRSGPDVAVKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  461

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  462   FMPNGSLDKYITPREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  521

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFGMLL
Sbjct  522   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLL  581

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             +E+ G+       +D SS+YFP WIY+  +K K IE+ +E  D++ I KK+T+V LWCIQ
Sbjct  582   IEIAGMKGNSAAREDMSSQYFPHWIYDQFDKEKEIEVLDETHDDEMIIKKLTLVALWCIQ  641

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             M+P+ RPSM++VVEMLEG+++ LQ P   F S
Sbjct  642   MNPLDRPSMTKVVEMLEGELQALQTPPRPFES  673


 Score =   329 bits (844),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 227/315 (72%), Gaps = 5/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P +Y +++I+K+T    E++G+GGYG VYKG++ S   VAVK+L   K +G
Sbjct  366   FLHSEHNFMPIQYPYSNIRKMTRNFKEKVGQGGYGSVYKGKLRSGPDVAVKILTKPKADG  425

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI   E   + LSW+
Sbjct  426   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITPREGGTL-LSWQ  484

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  485   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  544

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+E+ G + N  A+E  D S Q  
Sbjct  545   TLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEIAGMKGNSAARE--DMSSQ--  600

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++  E+++  E  DDE I KKL ++ALWCIQ  P+DRPSM  VV+MLE E
Sbjct  601   YFPHWIYDQFDKEKEIEVLDETHDDEMIIKKLTLVALWCIQMNPLDRPSMTKVVEMLEGE  660

Query  1544  GDDLVLPSSPFAGSQ  1500
                L  P  PF   Q
Sbjct  661   LQALQTPPRPFESLQ  675



>ref|XP_009599573.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X3 [Nicotiana tomentosiformis]
Length=672

 Score =   491 bits (1263),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 228/327 (70%), Positives = 277/327 (85%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRH+S+F+ IE+FL++ NN  PIRY Y +I+ MT+ FKEKLG+GG+GS
Sbjct  303   PCIFVFLMIELRRRHMSIFDAIESFLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGS  362

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  363   VYKGKLQSGPNVAVKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  422

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  423   FMPNGSLDKYITSREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  482

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFGMLL
Sbjct  483   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLL  542

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDED-EKRITKKMTIVGLWCI  1004
             +E+ G+       +D SS+YFP WIY+  +K K IE+ +E  D EK+I KK+T+V LWCI
Sbjct  543   IEIAGMKGNSAAREDMSSQYFPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCI  602

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P+ RPSM++VVEMLEG+++ LQ P
Sbjct  603   QMIPLDRPSMTKVVEMLEGELQTLQTP  629


 Score =   325 bits (832),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 170/311 (55%), Positives = 226/311 (73%), Gaps = 6/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RY +++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L   K +G
Sbjct  327   FLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILTKPKADG  386

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI S E   + LSW+
Sbjct  387   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITSREGGTL-LSWQ  445

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  446   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  505

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+E+ G + N  A+E  D S Q  
Sbjct  506   TLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEIAGMKGNSAARE--DMSSQY-  562

Query  1724  SFPEWVYNHLNRGGELQIRieedd-deaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+  ++  E+++  E  D ++ I KKL ++ALWCIQ  P+DRPSM  VV+MLE 
Sbjct  563   -FPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCIQMIPLDRPSMTKVVEMLEG  621

Query  1547  EGDDLVLPSSP  1515
             E   L  P  P
Sbjct  622   ELQTLQTPPRP  632



>ref|XP_009599566.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana tomentosiformis]
Length=686

 Score =   491 bits (1263),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 228/327 (70%), Positives = 277/327 (85%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRH+S+F+ IE+FL++ NN  PIRY Y +I+ MT+ FKEKLG+GG+GS
Sbjct  317   PCIFVFLMIELRRRHMSIFDAIESFLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGS  376

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  377   VYKGKLQSGPNVAVKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  436

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  437   FMPNGSLDKYITSREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  496

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFGMLL
Sbjct  497   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLL  556

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDED-EKRITKKMTIVGLWCI  1004
             +E+ G+       +D SS+YFP WIY+  +K K IE+ +E  D EK+I KK+T+V LWCI
Sbjct  557   IEIAGMKGNSAAREDMSSQYFPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCI  616

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P+ RPSM++VVEMLEG+++ LQ P
Sbjct  617   QMIPLDRPSMTKVVEMLEGELQTLQTP  643


 Score =   325 bits (832),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 170/311 (55%), Positives = 226/311 (73%), Gaps = 6/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RY +++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L   K +G
Sbjct  341   FLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILTKPKADG  400

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI S E   + LSW+
Sbjct  401   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITSREGGTL-LSWQ  459

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  460   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  519

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+E+ G + N  A+E  D S Q  
Sbjct  520   TLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEIAGMKGNSAARE--DMSSQY-  576

Query  1724  SFPEWVYNHLNRGGELQIRieedd-deaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+  ++  E+++  E  D ++ I KKL ++ALWCIQ  P+DRPSM  VV+MLE 
Sbjct  577   -FPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCIQMIPLDRPSMTKVVEMLEG  635

Query  1547  EGDDLVLPSSP  1515
             E   L  P  P
Sbjct  636   ELQTLQTPPRP  646



>ref|XP_009599540.1| PREDICTED: cysteine-rich receptor-like protein kinase 27 isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009599551.1| PREDICTED: cysteine-rich receptor-like protein kinase 27 isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009599560.1| PREDICTED: cysteine-rich receptor-like protein kinase 27 isoform 
X1 [Nicotiana tomentosiformis]
Length=722

 Score =   490 bits (1262),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 228/327 (70%), Positives = 277/327 (85%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFL+I+ RRRH+S+F+ IE+FL++ NN  PIRY Y +I+ MT+ FKEKLG+GG+GS
Sbjct  353   PCIFVFLMIELRRRHMSIFDAIESFLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGS  412

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI++KPK++GQDFINEV ++GRIHHVN+V+L+GYCAE SK ALVYD
Sbjct  413   VYKGKLQSGPNVAVKILTKPKADGQDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYD  472

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      +LL+WQRK EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  473   FMPNGSLDKYITSREGGTLLSWQRKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLD  532

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PTD SIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFGMLL
Sbjct  533   ENFVPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLL  592

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDED-EKRITKKMTIVGLWCI  1004
             +E+ G+       +D SS+YFP WIY+  +K K IE+ +E  D EK+I KK+T+V LWCI
Sbjct  593   IEIAGMKGNSAAREDMSSQYFPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCI  652

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P+ RPSM++VVEMLEG+++ LQ P
Sbjct  653   QMIPLDRPSMTKVVEMLEGELQTLQTP  679


 Score =   325 bits (832),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 170/311 (55%), Positives = 226/311 (73%), Gaps = 6/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RY +++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L   K +G
Sbjct  377   FLHSRNNFMPIRYPYSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILTKPKADG  436

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+GYCA+  +RALVY+++PN SL+KYI S E   + LSW+
Sbjct  437   QDFINEVATIGRIHHVNVVQLIGYCAERSKRALVYDFMPNGSLDKYITSREGGTL-LSWQ  495

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  496   RKSEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFVPKISDFGLAKLYPTDNSIV  555

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+E+ G + N  A+E  D S Q  
Sbjct  556   TLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIEIAGMKGNSAARE--DMSSQY-  612

Query  1724  SFPEWVYNHLNRGGELQIRieedd-deaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+  ++  E+++  E  D ++ I KKL ++ALWCIQ  P+DRPSM  VV+MLE 
Sbjct  613   -FPYWIYDQFDKEKEIEVLDETHDGEKKIIKKLTLVALWCIQMIPLDRPSMTKVVEMLEG  671

Query  1547  EGDDLVLPSSP  1515
             E   L  P  P
Sbjct  672   ELQTLQTPPRP  682



>ref|XP_004249993.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Solanum lycopersicum]
Length=597

 Score =   485 bits (1248),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/360 (66%), Positives = 293/360 (81%), Gaps = 3/360 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  I FL+ K++RRHLS+++ IE FL   NN  PIRY+Y HIK MT+ FKEKLGEGG+G+
Sbjct  231   PLVIAFLVYKFKRRHLSMYDTIERFLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGT  290

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG  VAVK++SKPK++GQDF+NEV ++GRIHHVN+V L GYC E +K ALVYD
Sbjct  291   VYKGKLQSGRYVAVKMLSKPKADGQDFMNEVATIGRIHHVNVVGLAGYCVEGTKRALVYD  350

Query  468   FMPNGSLDKYINQGAYAS-LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FM NGSLDKYI      S LL+WQRK++I++GVARGI YLHRGCD++ILHFDIKPHNILL
Sbjct  351   FMSNGSLDKYIRTDQEGSPLLSWQRKYDIILGVARGIGYLHRGCDVRILHFDIKPHNILL  410

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPKISDFGLAKL+PTDKSIVTLTAARGTIGYVAPEL++R IGAIS+KADVYSFGML
Sbjct  411   DENFIPKISDFGLAKLYPTDKSIVTLTAARGTIGYVAPELISRSIGAISYKADVYSFGML  470

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             LM ML LNR  V  ++ SS+YFP  IY+  NKGK I + EE ++DEK++ +K+++V LWC
Sbjct  471   LMGMLDLNRNEVANEENSSQYFPYNIYDKFNKGKEIVVDEEANDDEKKMARKLSLVALWC  530

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEVHqeqssmsessesIAFLPNS  1181
             IQ +PI RPSMS+VV+MLEG+VE L++P     S PI+     +SS + SS+SIA L NS
Sbjct  531   IQTNPIQRPSMSKVVQMLEGEVEALEVPPQPLQSPPIVH-QIMESSTTLSSDSIALLDNS  589


 Score =   310 bits (794),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 225/312 (72%), Gaps = 5/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RY+++ IK++T    E+LGEGGYG VYKG++ S   VAVK+L+  K +G
Sbjct  255   FLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGTVYKGKLQSGRYVAVKMLSKPKADG  314

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV L GYC +G +RALVY+++ N SL+KYI + +  +  LSW+
Sbjct  315   QDFMNEVATIGRIHHVNVVGLAGYCVEGTKRALVYDFMSNGSLDKYIRTDQEGSPLLSWQ  374

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  +I LG+A+GI YLH+GCD +ILHFDIKP NILLD N  PKI DFGLAKL   +KS V
Sbjct  375   RKYDIILGVARGIGYLHRGCDVRILHFDIKPHNILLDENFIPKISDFGLAKLYPTDKSIV  434

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE++SR+ G +S+K+DVYSFGMLL+ M+   +N  A E  ++SQ   
Sbjct  435   TLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMGMLDLNRNEVANE-ENSSQY--  491

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP  +Y+  N+G E+ +     DD++ +A+KL+++ALWCIQ  P+ RPSM  VVQMLE 
Sbjct  492   -FPYNIYDKFNKGKEIVVDEEANDDEKKMARKLSLVALWCIQTNPIQRPSMSKVVQMLEG  550

Query  1547  EGDDLVLPSSPF  1512
             E + L +P  P 
Sbjct  551   EVEALEVPPQPL  562



>ref|XP_006348215.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=633

 Score =   485 bits (1249),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 230/344 (67%), Positives = 286/344 (83%), Gaps = 8/344 (2%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  IVFL+IK++RRHLS+++ IE FL   NN  PIRY+Y H+K MT+ +KEKLGEGG+GS
Sbjct  261   PLVIVFLVIKFKRRHLSMYDTIEGFLRTQNNFKPIRYNYSHVKRMTRGYKEKLGEGGYGS  320

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG DVAVK+++KPK+ GQDF+NEV ++GRIHHVN+V LVGYC E +K ALVYD
Sbjct  321   VYKGKLQSGRDVAVKMLNKPKAGGQDFMNEVATIGRIHHVNVVGLVGYCVEGTKRALVYD  380

Query  468   FMPNGSLDKYINQGAYAS-LLNWQRKFEIVVGVARGIEYLHRGCDIQIL------HFDIK  626
             FMPNGSLDKYI+     S LL+WQRK++I++GVARGI YLHRGCD++IL      HFDIK
Sbjct  381   FMPNGSLDKYISTSQEGSPLLSWQRKYDIILGVARGIGYLHRGCDVRILHFDINPHFDIK  440

Query  627   PHNILLDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADV  806
             PHNILLDENFIPKISDFGLAKL+PTD SIV LTAARGTIGYVAPEL++R IGAIS+KADV
Sbjct  441   PHNILLDENFIPKISDFGLAKLYPTDNSIVNLTAARGTIGYVAPELISRSIGAISYKADV  500

Query  807   YSFGMLLMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMT  983
             YSFGMLLMEML LNR  V  ++ SS+YFP +IY+  NKGK I + EE ++DEK++ +K++
Sbjct  501   YSFGMLLMEMLDLNRHEVANEENSSQYFPYYIYDKFNKGKEILVDEEANDDEKKMARKLS  560

Query  984   IVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIM  1115
             +V LWCIQ +PI RP MS+V+EMLEG+VE+L++P     S+PI+
Sbjct  561   LVALWCIQTNPIQRPLMSKVLEMLEGEVEVLEVPPQPIQSQPIV  604


 Score =   304 bits (778),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 158/317 (50%), Positives = 222/317 (70%), Gaps = 11/317 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL      +P RY+++ +K++T    E+LGEGGYG VYKG++ S   VAVK+LN  K  G
Sbjct  285   FLRTQNNFKPIRYNYSHVKRMTRGYKEKLGEGGYGSVYKGKLQSGRDVAVKMLNKPKAGG  344

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV LVGYC +G +RALVY+++PN SL+KYI +++  +  LSW+
Sbjct  345   QDFMNEVATIGRIHHVNVVGLVGYCVEGTKRALVYDFMPNGSLDKYISTSQEGSPLLSWQ  404

Query  2084  KIQEIALGIAKGIEYLHQGCDQQIL------HFDIKPSNILLDHNMNPKICDFGLAKLCS  1923
             +  +I LG+A+GI YLH+GCD +IL      HFDIKP NILLD N  PKI DFGLAKL  
Sbjct  405   RKYDIILGVARGIGYLHRGCDVRILHFDINPHFDIKPHNILLDENFIPKISDFGLAKLYP  464

Query  1922  KEKSAVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTD  1743
              + S V +TAARGT+GY+APE++SR+ G +S+K+DVYSFGMLL+EM+    + N  E  +
Sbjct  465   TDNSIVNLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEML----DLNRHEVAN  520

Query  1742  TSQQEGSFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAV  1566
                    FP ++Y+  N+G E+ +     DD++ +A+KL+++ALWCIQ  P+ RP M  V
Sbjct  521   EENSSQYFPYYIYDKFNKGKEILVDEEANDDEKKMARKLSLVALWCIQTNPIQRPLMSKV  580

Query  1565  VQMLEREGDDLVLPSSP  1515
             ++MLE E + L +P  P
Sbjct  581   LEMLEGEVEVLEVPPQP  597



>ref|XP_006365625.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Solanum tuberosum]
Length=408

 Score =   477 bits (1227),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 225/329 (68%), Positives = 278/329 (84%), Gaps = 7/329 (2%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  +VFL+I+ RRRHLS+++ IE+FL+ +NN  PIRYS  +I+ MT+ FKEKLG+GG+GS
Sbjct  40    PFIVVFLMIELRRRHLSIYDAIESFLHGENNFAPIRYSNSNIRKMTRNFKEKLGQGGYGS  99

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI+SKPK++GQDFINEV ++GRIHHVNIV+L+GYCAE  K ALVYD
Sbjct  100   VYKGKLQSGPNVAVKILSKPKADGQDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYD  159

Query  468   FMPNGSLDKYIN---QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNI  638
             FMPNGSL+KYI    +GA   LL+W RKFEI +GVARGIEYLHRGCDIQILHFDIKPHNI
Sbjct  160   FMPNGSLEKYITSQEEGA-DQLLSWDRKFEIALGVARGIEYLHRGCDIQILHFDIKPHNI  218

Query  639   LLDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFG  818
             LLDENFIPK+SDFGLAKL+P DKSIVTLTAARGTIGYVAPEL+NR IG IS+KADVYSFG
Sbjct  219   LLDENFIPKLSDFGLAKLYPADKSIVTLTAARGTIGYVAPELINRSIGPISYKADVYSFG  278

Query  819   MLLMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLW  998
             MLL++++GL       +D SS+YFP WIY+ ++ GK IE+ +E  ++    KK+T+V LW
Sbjct  279   MLLIDIVGLKTNLAAREDVSSQYFPHWIYDQLDNGKEIEVLDETHED---IKKLTLVALW  335

Query  999   CIQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             CIQM+P+ RPSM++VVEMLEG+++ LQ P
Sbjct  336   CIQMNPLDRPSMTKVVEMLEGELQALQTP  364


 Score =   332 bits (851),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 226/311 (73%), Gaps = 8/311 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RYS ++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L+  K +G
Sbjct  64    FLHGENNFAPIRYSNSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILSKPKADG  123

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTES-KNVALSW  2088
             ++FINEV  IG+IHHVN+V+L+GYCA+  +RALVY+++PN SLEKYI S E   +  LSW
Sbjct  124   QDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYDFMPNGSLEKYITSQEEGADQLLSW  183

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
              +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAKL   +KS 
Sbjct  184   DRKFEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKLSDFGLAKLYPADKSI  243

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VT+TAARGT+GY+APE+++R+ G +S+K+DVYSFGMLL+++VG + N  A+E  D S Q 
Sbjct  244   VTLTAARGTIGYVAPELINRSIGPISYKADVYSFGMLLIDIVGLKTNLAARE--DVSSQ-  300

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FP W+Y+ L+ G E+++    D+     KKL ++ALWCIQ  P+DRPSM  VV+MLE 
Sbjct  301   -YFPHWIYDQLDNGKEIEV---LDETHEDIKKLTLVALWCIQMNPLDRPSMTKVVEMLEG  356

Query  1547  EGDDLVLPSSP  1515
             E   L  P  P
Sbjct  357   ELQALQTPPRP  367



>ref|XP_009759930.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=341

 Score =   472 bits (1214),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/332 (70%), Positives = 279/332 (84%), Gaps = 3/332 (1%)
 Frame = +3

Query  204   FPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPKSNG-QDFINEV  380
              PIRY+Y HIK MT+ FKEKLGEGGFG VYKGKLRSG DVAVK++SKPK+ G QDF+NEV
Sbjct  1     MPIRYNYSHIKRMTRGFKEKLGEGGFGKVYKGKLRSGGDVAVKMLSKPKAGGGQDFMNEV  60

Query  381   GSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASLLNWQRKFEIVVG  560
              ++GRIHHVN+V LVGYC E ++ ALVYDFMPNGSLDKYI     + +L+WQRK+EIVVG
Sbjct  61    ATIGRIHHVNVVGLVGYCVEGTERALVYDFMPNGSLDKYIASQQGSPVLSWQRKYEIVVG  120

Query  561   VARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDKSIVTLTAARGT  740
             VARGIEYLHRGCDI+ILHFDIKPHNILLDENFIPKISDFGLAKL+P D SIVTLTAARGT
Sbjct  121   VARGIEYLHRGCDIRILHFDIKPHNILLDENFIPKISDFGLAKLYPMDNSIVTLTAARGT  180

Query  741   IGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSKYFPSWIYNDINK  920
             IGYVAPEL++R IGAIS+KADVYSFGMLLMEML + R  V  ++ SS+YFPSWIY+   +
Sbjct  181   IGYVAPELISRSIGAISYKADVYSFGMLLMEMLDMKRNVVANEENSSQYFPSWIYDKFKR  240

Query  921   GKAIEMGEE-DEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             GK I + EE +EDEK+I++KMTIV LWCIQ +P+ RPSMS V+EMLEG+VE+LQ+P    
Sbjct  241   GKEIVVDEEANEDEKKISRKMTIVALWCIQTNPVQRPSMSEVIEMLEGEVEVLQLPPQPL  300

Query  1098  LSEPIMEV-HqeqssmsessesIAFLPNSASS  1190
              S+PI  + HQ +SS++ SS+S+A L N+A +
Sbjct  301   QSQPIAPLFHQMESSITFSSDSMALLENAADN  332


 Score =   317 bits (811),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 166/304 (55%), Positives = 224/304 (74%), Gaps = 7/304 (2%)
 Frame = -1

Query  2417  PTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSK-GNGEEFINEVG  2241
             P RY+++ IK++T    E+LGEGG+G VYKG++ S   VAVK+L+  K G G++F+NEV 
Sbjct  2     PIRYNYSHIKRMTRGFKEKLGEGGFGKVYKGKLRSGGDVAVKMLSKPKAGGGQDFMNEVA  61

Query  2240  IIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWKKIQEIALG  2061
              IG+IHHVNVV LVGYC +G  RALVY+++PN SL+KYI S +   V LSW++  EI +G
Sbjct  62    TIGRIHHVNVVGLVGYCVEGTERALVYDFMPNGSLDKYIASQQGSPV-LSWQRKYEIVVG  120

Query  2060  IAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAVTMTAARGT  1881
             +A+GIEYLH+GCD +ILHFDIKP NILLD N  PKI DFGLAKL   + S VT+TAARGT
Sbjct  121   VARGIEYLHRGCDIRILHFDIKPHNILLDENFIPKISDFGLAKLYPMDNSIVTLTAARGT  180

Query  1880  MGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEGSFPEWVYN  1701
             +GY+APE++SR+ G +S+K+DVYSFGMLL+EM+  ++N  A E  ++SQ    FP W+Y+
Sbjct  181   IGYVAPELISRSIGAISYKADVYSFGMLLMEMLDMKRNVVANE-ENSSQY---FPSWIYD  236

Query  1700  HLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLEREGDDLVLP  1524
                RG E+ +     +D++ I++K+ I+ALWCIQ  PV RPSM  V++MLE E + L LP
Sbjct  237   KFKRGKEIVVDEEANEDEKKISRKMTIVALWCIQTNPVQRPSMSEVIEMLEGEVEVLQLP  296

Query  1523  SSPF  1512
               P 
Sbjct  297   PQPL  300



>ref|XP_006365630.1| PREDICTED: probable receptor-like protein kinase At1g67000-like, 
partial [Solanum tuberosum]
Length=633

 Score =   482 bits (1240),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 226/327 (69%), Positives = 278/327 (85%), Gaps = 4/327 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC +VFL+I+ RRRHLS+++ IE+FL+ +N   PIRYS  +I+ MT+ FKEKLG+GG+GS
Sbjct  291   PCILVFLMIELRRRHLSIYDAIESFLHGENIFAPIRYSNSNIRKMTRNFKEKLGQGGYGS  350

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI+SKPK++GQDFINEV ++GRIHHVNIV+L+GYCAE  K ALVYD
Sbjct  351   VYKGKLQSGPNVAVKILSKPKADGQDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYD  410

Query  468   FMPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSL+KYI  +   A LL+W+RKFEI +GVARGIEYLHRGCDIQILHFDIKPHNILL
Sbjct  411   FMPNGSLEKYITPREGGAELLSWKRKFEIALGVARGIEYLHRGCDIQILHFDIKPHNILL  470

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPK+SDFGLAK +PTDKSIVTLTA RGTIGYVAPEL+NR IG IS+KADVYSFGML
Sbjct  471   DENFIPKLSDFGLAKSYPTDKSIVTLTAVRGTIGYVAPELINRSIGPISYKADVYSFGML  530

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             L++++GL       +D SS+YFP WIY+ ++KGK IE+ +E  D+    KK+T+V LWCI
Sbjct  531   LIDIVGLKTNSAAREDMSSQYFPHWIYDQLDKGKEIEVLDETHDD---VKKLTLVSLWCI  587

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM+P+ RPSM+RVVEMLEG+++ LQ P
Sbjct  588   QMNPLDRPSMTRVVEMLEGELQALQTP  614


 Score =   328 bits (841),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 224/310 (72%), Gaps = 7/310 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RYS ++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L+  K +G
Sbjct  315   FLHGENIFAPIRYSNSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILSKPKADG  374

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVN+V+L+GYCA+  +RALVY+++PN SLEKYI   E     LSWK
Sbjct  375   QDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYDFMPNGSLEKYITPREGGAELLSWK  434

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAK    +KS V
Sbjct  435   RKFEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKLSDFGLAKSYPTDKSIV  494

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G +S+K+DVYSFGMLL+++VG + N  A+E  D S Q  
Sbjct  495   TLTAVRGTIGYVAPELINRSIGPISYKADVYSFGMLLIDIVGLKTNSAARE--DMSSQY-  551

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ L++G E+++    D+     KKL +++LWCIQ  P+DRPSM  VV+MLE E
Sbjct  552   -FPHWIYDQLDKGKEIEV---LDETHDDVKKLTLVSLWCIQMNPLDRPSMTRVVEMLEGE  607

Query  1544  GDDLVLPSSP  1515
                L  P  P
Sbjct  608   LQALQTPPRP  617



>ref|XP_006365619.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=420

 Score =   474 bits (1219),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 222/328 (68%), Positives = 274/328 (84%), Gaps = 5/328 (2%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC +VFL+I+ RRRHLS+++ IE+FL+ +NN  PIRYS  +I+ MT+ FKEKLG+GG+GS
Sbjct  52    PCIVVFLMIELRRRHLSIYDAIESFLHGENNFAPIRYSNSNIRKMTRNFKEKLGQGGYGS  111

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI+SKPK++GQDFINEV ++GRIHHVNIV+L+GYCAE  K ALVYD
Sbjct  112   VYKGKLQSGPNVAVKILSKPKADGQDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYD  171

Query  468   FMPNGSLDKYIN--QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNIL  641
             FMPNGSL+KYI    G    LL+W RKFEI +GVARGIEYLHRGCD QILHFDIKPHNIL
Sbjct  172   FMPNGSLEKYITPQDGGADQLLSWDRKFEIALGVARGIEYLHRGCDFQILHFDIKPHNIL  231

Query  642   LDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGM  821
             LDENFIPK+SDFGLAK +PTDKSIVTLT ARGTIGY APEL+NR IG I +KA VYSFGM
Sbjct  232   LDENFIPKLSDFGLAKSYPTDKSIVTLTPARGTIGYAAPELINRSIGPIYYKAYVYSFGM  291

Query  822   LLMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             LL++++GL      ++D SS+YFP WIY+ ++KGK IE+ +E  ++    KK+T+V LWC
Sbjct  292   LLIDIVGLKTNSAAKEDISSQYFPYWIYDQLDKGKEIEVLDETHED---VKKLTLVALWC  348

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             IQM+P+ RPSM++VVEMLEG ++ LQMP
Sbjct  349   IQMNPLDRPSMTKVVEMLEGKLQALQMP  376


 Score =   315 bits (808),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 222/311 (71%), Gaps = 8/311 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RYS ++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L+  K +G
Sbjct  76    FLHGENNFAPIRYSNSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILSKPKADG  135

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTES-KNVALSW  2088
             ++FINEV  IG+IHHVN+V+L+GYCA+  +RALVY+++PN SLEKYI   +   +  LSW
Sbjct  136   QDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYDFMPNGSLEKYITPQDGGADQLLSW  195

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
              +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAK    +KS 
Sbjct  196   DRKFEIALGVARGIEYLHRGCDFQILHFDIKPHNILLDENFIPKLSDFGLAKSYPTDKSI  255

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VT+T ARGT+GY APE+++R+ G + +K+ VYSFGMLL+++VG + N  AKE  D S Q 
Sbjct  256   VTLTPARGTIGYAAPELINRSIGPIYYKAYVYSFGMLLIDIVGLKTNSAAKE--DISSQ-  312

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FP W+Y+ L++G E+++    D+     KKL ++ALWCIQ  P+DRPSM  VV+MLE 
Sbjct  313   -YFPYWIYDQLDKGKEIEV---LDETHEDVKKLTLVALWCIQMNPLDRPSMTKVVEMLEG  368

Query  1547  EGDDLVLPSSP  1515
             +   L +P  P
Sbjct  369   KLQALQMPPRP  379



>ref|XP_010315122.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Solanum 
lycopersicum]
Length=663

 Score =   481 bits (1239),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 239/370 (65%), Positives = 296/370 (80%), Gaps = 5/370 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC +VFL+I+ RRRHLS+++ IE+FL+ +NN  PIRYS  +I+ MT+ FKEKLG+GG+GS
Sbjct  296   PCIVVFLMIELRRRHLSIYDAIESFLHGENNFTPIRYSNSNIRKMTRNFKEKLGQGGYGS  355

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL+SG +VAVKI+SKPK++GQDFINEV ++GRIHHVNIV+L+GYCAE  K ALVYD
Sbjct  356   VYKGKLQSGPNVAVKILSKPKADGQDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYD  415

Query  468   FMPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMP GSL+KYI  +   A LL+W+RKFEI +GVARGIEYLHRGCDIQILHFDIKPHNILL
Sbjct  416   FMPKGSLEKYITPREGGAELLSWKRKFEIALGVARGIEYLHRGCDIQILHFDIKPHNILL  475

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENFIPK+SDFGLAK +PTDKSIVTLTA RGTIGYVAPEL+NR IG IS KADVYSFGML
Sbjct  476   DENFIPKLSDFGLAKSYPTDKSIVTLTAVRGTIGYVAPELINRSIGPISCKADVYSFGML  535

Query  825   LMEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             L++++GL    V  +D SS+YFP WIY+ ++KGK IE+ +E  ++    KK+T+V LWCI
Sbjct  536   LIDIVGLKTNSVAREDMSSQYFPHWIYDQLDKGKEIEVLDETHED---VKKLTLVALWCI  592

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS-EPIMEVHqeqssmsessesIAFLPNS  1181
             QM+P+  PSM+RVVEMLEGD++ LQ P  +  S EP        SS   S+ES+  L + 
Sbjct  593   QMNPLDHPSMTRVVEMLEGDLQALQTPPRSSESREPCSLEFNLTSSSMNSTESVKLLESC  652

Query  1182  ASSNSIGIIV  1211
             + S  I +IV
Sbjct  653   SDSAIIDVIV  662


 Score =   318 bits (816),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 222/310 (72%), Gaps = 9/310 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RYS ++I+K+T    E+LG+GGYG VYKG++ S   VAVK+L+  K +G
Sbjct  320   FLHGENNFTPIRYSNSNIRKMTRNFKEKLGQGGYGSVYKGKLQSGPNVAVKILSKPKADG  379

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVN+V+L+GYCA+  +RALVY+++P  SLEKYI   E     LSWK
Sbjct  380   QDFINEVATIGRIHHVNIVQLIGYCAERCKRALVYDFMPKGSLEKYITPREGGAELLSWK  439

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAK    +KS V
Sbjct  440   RKFEIALGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKLSDFGLAKSYPTDKSIV  499

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G +S K+DVYSFGMLL+++VG + N  A+E  D S Q  
Sbjct  500   TLTAVRGTIGYVAPELINRSIGPISCKADVYSFGMLLIDIVGLKTNSVARE--DMSSQY-  556

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ L++G E+++    D+     KKL ++ALWCIQ  P+D PSM  VV+ML  E
Sbjct  557   -FPHWIYDQLDKGKEIEV---LDETHEDVKKLTLVALWCIQMNPLDHPSMTRVVEML--E  610

Query  1544  GDDLVLPSSP  1515
             GD   L + P
Sbjct  611   GDLQALQTPP  620



>ref|XP_006363203.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=354

 Score =   468 bits (1205),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 222/321 (69%), Positives = 268/321 (83%), Gaps = 2/321 (1%)
 Frame = +3

Query  159   VFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIM  338
             ++  IE FL   NN  PIRY+Y HIK MT  FKEKLGEGG+GSVYKGKLRSG DVAVK++
Sbjct  1     MYHAIEGFLQTQNNFMPIRYNYSHIKRMTIGFKEKLGEGGYGSVYKGKLRSGRDVAVKML  60

Query  339   SKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYA  518
             +KPK+ GQDF+NEV ++GRIHHVN+V LVGYC E +K ALVYDFMPNGSLDKYI+     
Sbjct  61    NKPKAGGQDFMNEVATIGRIHHVNVVGLVGYCVEGTKRALVYDFMPNGSLDKYISTSQEE  120

Query  519   S-LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLF  695
             S LL+WQRK++I +G+ARGI YLHRGCD++ILHFDIKPHNILLDENFIPKISDFGLAKL+
Sbjct  121   SPLLSWQRKYDITLGMARGIGYLHRGCDVRILHFDIKPHNILLDENFIPKISDFGLAKLY  180

Query  696   PTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDE  875
             PTD SIV LTAARGTIGYVAPEL++R IGAIS+KADVYSFGMLLMEML L R  V  ++ 
Sbjct  181   PTDNSIVNLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEMLDLKRHEVANEEN  240

Query  876   SSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEM  1052
             SS+YFP +IYN  NKGK I + EE ++DEK++ +K+++V LWCIQ +PI RPSMSRV+EM
Sbjct  241   SSQYFPFYIYNKFNKGKEILVHEEANDDEKKMARKLSLVALWCIQTNPIQRPSMSRVLEM  300

Query  1053  LEGDVELLQMPTDTFLSEPIM  1115
             LEG+VE+L++P     S+PI+
Sbjct  301   LEGEVEVLEVPPQPIQSQPIV  321


 Score =   316 bits (809),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 230/312 (74%), Gaps = 5/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RY+++ IK++T    E+LGEGGYG VYKG++ S   VAVK+LN  K  G
Sbjct  8     FLQTQNNFMPIRYNYSHIKRMTIGFKEKLGEGGYGSVYKGKLRSGRDVAVKMLNKPKAGG  67

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV LVGYC +G +RALVY+++PN SL+KYI +++ ++  LSW+
Sbjct  68    QDFMNEVATIGRIHHVNVVGLVGYCVEGTKRALVYDFMPNGSLDKYISTSQEESPLLSWQ  127

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  +I LG+A+GI YLH+GCD +ILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  128   RKYDITLGMARGIGYLHRGCDVRILHFDIKPHNILLDENFIPKISDFGLAKLYPTDNSIV  187

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              +TAARGT+GY+APE++SR+ G +S+K+DVYSFGMLL+EM+  +++  A E  ++SQ   
Sbjct  188   NLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEMLDLKRHEVANE-ENSSQY--  244

Query  1724  SFPEWVYNHLNRGGELQIRieed-ddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP ++YN  N+G E+ +  E + D++ +A+KL+++ALWCIQ  P+ RPSM  V++MLE 
Sbjct  245   -FPFYIYNKFNKGKEILVHEEANDDEKKMARKLSLVALWCIQTNPIQRPSMSRVLEMLEG  303

Query  1547  EGDDLVLPSSPF  1512
             E + L +P  P 
Sbjct  304   EVEVLEVPPQPI  315



>gb|EYU28969.1| hypothetical protein MIMGU_mgv1a0259881mg, partial [Erythranthe 
guttata]
Length=369

 Score =   466 bits (1199),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 229/347 (66%), Positives = 275/347 (79%), Gaps = 12/347 (3%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  V LI  +RRRHLSVF+ IE FL ++NNL  IRYSY  +K +TK F+EKLG+GG+GS
Sbjct  8     PCVFVLLIYTFRRRHLSVFDAIECFLRSNNNLKTIRYSYSDMKKITKGFREKLGQGGYGS  67

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK+++KP SNGQDFINEV ++GRIHHVN+V+LV YCAE SK ALVYD
Sbjct  68    VYKGKLRSGHDVAVKVLAKPSSNGQDFINEVATIGRIHHVNVVKLVVYCAERSKRALVYD  127

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KYI     +  LN +RK+EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  128   FMPNGSLEKYIFNKEKSHSLNLKRKYEIAIGVARGIEYLHRGCDIQILHFDIKPHNILLD  187

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PKISDFGLAK + TD + VTLTA RGTIGYVAPEL+NR IG +S+KADVYSFGMLL
Sbjct  188   ENFTPKISDFGLAKFYSTDNTTVTLTAVRGTIGYVAPELMNRSIGGVSYKADVYSFGMLL  247

Query  828   MEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMGE-----------EDEDEKRIT  971
             MEMLGLN+ T    +++SS+YFP WIY+ +NKG+ IE+G            +D+D +++ 
Sbjct  248   MEMLGLNKGTGPNIENKSSQYFPCWIYDHLNKGEDIEIGNVYENNDDEEKEDDDDARKMR  307

Query  972   KKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPI  1112
             +KMTIVGLWCIQMSP  RPSMS V++MLEG+ E + +P     S  I
Sbjct  308   RKMTIVGLWCIQMSPTDRPSMSEVLKMLEGEDENMMIPPQPSQSSEI  354


 Score =   328 bits (842),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 170/327 (52%), Positives = 233/327 (71%), Gaps = 15/327 (5%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL     ++  RYS++D+KKIT    E+LG+GGYG VYKG++ S   VAVKVL     NG
Sbjct  32    FLRSNNNLKTIRYSYSDMKKITKGFREKLGQGGYGSVYKGKLRSGHDVAVKVLAKPSSNG  91

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+LV YCA+  +RALVY+++PN SLEKYIF+ E K+ +L+ K
Sbjct  92    QDFINEVATIGRIHHVNVVKLVVYCAERSKRALVYDFMPNGSLEKYIFNKE-KSHSLNLK  150

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIA+G+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAK  S + + V
Sbjct  151   RKYEIAIGVARGIEYLHRGCDIQILHFDIKPHNILLDENFTPKISDFGLAKFYSTDNTTV  210

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G VS+K+DVYSFGMLL+EM+G  K         +SQ   
Sbjct  211   TLTAVRGTIGYVAPELMNRSIGGVSYKADVYSFGMLLMEMLGLNKGTGPNIENKSSQY--  268

Query  1724  SFPEWVYNHLNRGGELQI-----------RieedddeaiakklaiiaLWCIQWQPVDRPS  1578
              FP W+Y+HLN+G +++I           + ++DD   + +K+ I+ LWCIQ  P DRPS
Sbjct  269   -FPCWIYDHLNKGEDIEIGNVYENNDDEEKEDDDDARKMRRKMTIVGLWCIQMSPTDRPS  327

Query  1577  MKAVVQMLEREGDDLVLPSSPFAGSQM  1497
             M  V++MLE E +++++P  P   S++
Sbjct  328   MSEVLKMLEGEDENMMIPPQPSQSSEI  354



>ref|XP_011071484.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Sesamum indicum]
Length=353

 Score =   464 bits (1194),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 224/335 (67%), Positives = 265/335 (79%), Gaps = 11/335 (3%)
 Frame = +3

Query  111   CAIVFLIIK-YRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             C +  LI K ++ + LS F+ IE FL ++NNL PIRYSY +IK  T+ F+EKLGEGG+GS
Sbjct  2     CTLALLIRKLWKTQRLSKFDVIECFLQSNNNLLPIRYSYSNIKKTTRGFREKLGEGGYGS  61

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DV VK++SKPK NGQDFINEV ++GRIHHVN+V LVGYCAE SK ALVYD
Sbjct  62    VYKGKLRSGRDVVVKVLSKPKENGQDFINEVATIGRIHHVNVVNLVGYCAERSKRALVYD  121

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             +M NGSLDKYI      + L+W++K+EI VGVARGIEY+HRGCDIQIL+FDIKPHNILLD
Sbjct  122   YMTNGSLDKYIMSRERTNSLSWEKKYEIAVGVARGIEYMHRGCDIQILYFDIKPHNILLD  181

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PKISDFGLAK + T+K+ VTLTAARGTIGYVAPEL+NR I  +S+K DVYSFGMLL
Sbjct  182   DNFTPKISDFGLAKFYSTEKATVTLTAARGTIGYVAPELINRNIVEVSYKVDVYSFGMLL  241

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMG----------EEDEDEKRITKK  977
             MEMLGL R  V  +DESS+YFP WIY+  NKGK IE G          ++DE  +RITK 
Sbjct  242   MEMLGLKRDIVAYKDESSRYFPYWIYDHFNKGKDIETGNADEIGNDDVDDDEHARRITKN  301

Query  978   MTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQM  1082
             MTIVGLWC+ MSP+ RPSMS VV+MLE   E LQ+
Sbjct  302   MTIVGLWCMHMSPVDRPSMSEVVKMLENGNENLQI  336


 Score =   322 bits (825),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/314 (53%), Positives = 221/314 (70%), Gaps = 15/314 (5%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS+++IKK T    E+LGEGGYG VYKG++ S   V VKVL+  K NG
Sbjct  26    FLQSNNNLLPIRYSYSNIKKTTRGFREKLGEGGYGSVYKGKLRSGRDVVVKVLSKPKENG  85

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV LVGYCA+  +RALVY+Y+ N SL+KYI S E  N +LSW+
Sbjct  86    QDFINEVATIGRIHHVNVVNLVGYCAERSKRALVYDYMTNGSLDKYIMSRERTN-SLSWE  144

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K  EIA+G+A+GIEY+H+GCD QIL+FDIKP NILLD N  PKI DFGLAK  S EK+ V
Sbjct  145   KKYEIAVGVARGIEYMHRGCDIQILYFDIKPHNILLDDNFTPKISDFGLAKFYSTEKATV  204

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+++RN  +VS+K DVYSFGMLL+EM+G +++  A +     +   
Sbjct  205   TLTAARGTIGYVAPELINRNIVEVSYKVDVYSFGMLLMEMLGLKRDIVAYK----DESSR  260

Query  1724  SFPEWVYNHLNRGGELQIRie----------edddeaiakklaiiaLWCIQWQPVDRPSM  1575
              FP W+Y+H N+G +++              ++    I K + I+ LWC+   PVDRPSM
Sbjct  261   YFPYWIYDHFNKGKDIETGNADEIGNDDVDDDEHARRITKNMTIVGLWCMHMSPVDRPSM  320

Query  1574  KAVVQMLEREGDDL  1533
               VV+MLE   ++L
Sbjct  321   SEVVKMLENGNENL  334



>ref|XP_002267774.2| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=591

 Score =   473 bits (1217),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 275/314 (88%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYSFADIKKITNQ  ++LG+GGYG VYKG++S+E+LVAVK+L++SKGNG
Sbjct  278   FLEDYRALKPSRYSFADIKKITNQFQDKLGQGGYGTVYKGKLSNEVLVAVKILSNSKGNG  337

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G+IHHVNVVRLVG+CADGF RAL+YE+LPNESLEK+IFST  KN +L WK
Sbjct  338   EEFINEVRTMGRIHHVNVVRLVGFCADGFSRALIYEFLPNESLEKFIFSTTIKNRSLGWK  397

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLDH++NPKI DFGLAKLCSKE+S V
Sbjct  398   KLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDHHLNPKISDFGLAKLCSKEQSTV  457

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV+SRNFG VS+KSDV+SFGMLLLEMVGGRKN +    T  +  + 
Sbjct  458   SMTAARGTMGYIAPEVLSRNFGHVSYKSDVFSFGMLLLEMVGGRKNIDV---TVDNTSQL  514

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW YNHL++G EL IRIE++ D+ IAK+L I+ LWCIQW P+DRP MKAVVQMLE E
Sbjct  515   YFPEWAYNHLDQGEELHIRIEKEGDDKIAKQLTIVGLWCIQWYPMDRPPMKAVVQMLEGE  574

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  575   GDSLTMPPNPFAST  588


 Score =   350 bits (899),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 231/313 (74%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYS+  IK +T  F++KLG+GG+G+VYKGKL +   VAVKI+S  K
Sbjct  275   IEKFLEDYRALKPSRYSFADIKKITNQFQDKLGQGGYGTVYKGKLSNEVLVAVKILSNSK  334

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MGRIHHVN+VRLVG+CA+    AL+Y+F+PN SL+K+I      +  L
Sbjct  335   GNGEEFINEVRTMGRIHHVNVVRLVGFCADGFSRALIYEFLPNESLEKFIFSTTIKNRSL  394

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD +  PKISDFGLAKL   ++
Sbjct  395   GWKKLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDHHLNPKISDFGLAKLCSKEQ  454

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++TAARGT+GY+APE+++R  G +S+K+DV+SFGMLL+EM+G  +   VT  + S  
Sbjct  455   STVSMTAARGTMGYIAPEVLSRNFGHVSYKSDVFSFGMLLLEMVGGRKNIDVTVDNTSQL  514

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W YN +++G+ + +  E E + +I K++TIVGLWCIQ  P+ RP M  VV+MLEG+
Sbjct  515   YFPEWAYNHLDQGEELHIRIEKEGDDKIAKQLTIVGLWCIQWYPMDRPPMKAVVQMLEGE  574

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  575   GDSLTMPPNPFAS  587



>ref|XP_004249994.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Solanum lycopersicum]
Length=350

 Score =   463 bits (1191),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 267/321 (83%), Gaps = 2/321 (1%)
 Frame = +3

Query  159   VFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIM  338
             +++ IE FL   NN  PIRY+Y HIK MT+ FKEKLGEGG+G+VYKGKL+SG  VAVK++
Sbjct  1     MYDTIERFLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGTVYKGKLQSGRYVAVKML  60

Query  339   SKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYA  518
             SKPK++GQDF+NEV ++GRIHHVN+V L GYC E +K ALVYDFM NGSLDKYI      
Sbjct  61    SKPKADGQDFMNEVATIGRIHHVNVVGLAGYCVEGTKRALVYDFMSNGSLDKYIRTDQEG  120

Query  519   S-LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLF  695
             S LL+WQRK++I++GVARGI YLHRGCD++ILHFDIKPHNILLDENFIPKISDFGLAKL+
Sbjct  121   SPLLSWQRKYDIILGVARGIGYLHRGCDVRILHFDIKPHNILLDENFIPKISDFGLAKLY  180

Query  696   PTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDE  875
             PTDKSIVTLTAARGTIGYVAPEL++R IGAIS+KADVYSFGMLLMEML L R  V  ++ 
Sbjct  181   PTDKSIVTLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEMLDLKRNEVANEEN  240

Query  876   SSKYFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEM  1052
             SS+YFP  IY+  NKGK I + EE ++DEK++ +K+++V LWCIQ +PI RPSMS+VV+M
Sbjct  241   SSQYFPYNIYDTFNKGKEIVVDEEANDDEKKMARKLSLVALWCIQTNPILRPSMSKVVQM  300

Query  1053  LEGDVELLQMPTDTFLSEPIM  1115
             LEG+VE L++P     S PI+
Sbjct  301   LEGEVEALEVPPQPLQSPPIV  321


 Score =   315 bits (808),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 227/312 (73%), Gaps = 5/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RY+++ IK++T    E+LGEGGYG VYKG++ S   VAVK+L+  K +G
Sbjct  8     FLQTQNNFMPIRYNYSHIKRMTRGFKEKLGEGGYGTVYKGKLQSGRYVAVKMLSKPKADG  67

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVV L GYC +G +RALVY+++ N SL+KYI + +  +  LSW+
Sbjct  68    QDFMNEVATIGRIHHVNVVGLAGYCVEGTKRALVYDFMSNGSLDKYIRTDQEGSPLLSWQ  127

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  +I LG+A+GI YLH+GCD +ILHFDIKP NILLD N  PKI DFGLAKL   +KS V
Sbjct  128   RKYDIILGVARGIGYLHRGCDVRILHFDIKPHNILLDENFIPKISDFGLAKLYPTDKSIV  187

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE++SR+ G +S+K+DVYSFGMLL+EM+  ++N  A E  ++SQ   
Sbjct  188   TLTAARGTIGYVAPELISRSIGAISYKADVYSFGMLLMEMLDLKRNEVANE-ENSSQY--  244

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP  +Y+  N+G E+ +     DD++ +A+KL+++ALWCIQ  P+ RPSM  VVQMLE 
Sbjct  245   -FPYNIYDTFNKGKEIVVDEEANDDEKKMARKLSLVALWCIQTNPILRPSMSKVVQMLEG  303

Query  1547  EGDDLVLPSSPF  1512
             E + L +P  P 
Sbjct  304   EVEALEVPPQPL  315



>ref|XP_002268734.3| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=575

 Score =   468 bits (1203),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 229/315 (73%), Positives = 270/315 (86%), Gaps = 3/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ D+KKITNQ  ++LGEGGYGIVYKG +S+E+ VAVK+L + KGNG
Sbjct  264   FLEDYIALKPSRYSYVDVKKITNQFKDKLGEGGYGIVYKGTLSNEVFVAVKILKNFKGNG  323

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVNVVRLVG+CADGFRRA++YEYLPNESLEK+IFST  KN +LSW+
Sbjct  324   EEFINEVETMGTIHHVNVVRLVGFCADGFRRAVIYEYLPNESLEKFIFSTTFKNYSLSWE  383

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q IALG+AKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  384   KLQNIALGVAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  443

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPE++SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T  +  + 
Sbjct  444   SMTAARGTMGYIAPEMLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---TVENSSQA  500

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL++G EL IRIEE+ D  IA+KL I+ LWCIQW PVDRPSMK VVQMLE E
Sbjct  501   YFPEWIYNHLDQGEELHIRIEEEGDTHIARKLTIVGLWCIQWYPVDRPSMKLVVQMLEGE  560

Query  1544  GDDLVLPSSPFAGSQ  1500
             G+ L +P +PF  ++
Sbjct  561   GESLPMPPNPFTCTR  575


 Score =   357 bits (916),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 232/311 (75%), Gaps = 2/311 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  +K +T  FK+KLGEGG+G VYKG L +   VAVKI+   K
Sbjct  261   IEKFLEDYIALKPSRYSYVDVKKITNQFKDKLGEGGYGIVYKGTLSNEVFVAVKILKNFK  320

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVN+VRLVG+CA+  + A++Y+++PN SL+K+I    + +  L
Sbjct  321   GNGEEFINEVETMGTIHHVNVVRLVGFCADGFRRAVIYEYLPNESLEKFIFSTTFKNYSL  380

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++   I +GVA+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  381   SWEKLQNIALGVAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  440

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   VT ++ S  
Sbjct  441   SAVSMTAARGTMGYIAPEMLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVTVENSSQA  500

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN +++G+ + +  E+E +  I +K+TIVGLWCIQ  P+ RPSM  VV+MLEG+
Sbjct  501   YFPEWIYNHLDQGEELHIRIEEEGDTHIARKLTIVGLWCIQWYPVDRPSMKLVVQMLEGE  560

Query  1065  VELLQMPTDTF  1097
              E L MP + F
Sbjct  561   GESLPMPPNPF  571



>ref|XP_010662387.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=652

 Score =   470 bits (1209),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 229/311 (74%), Positives = 271/311 (87%), Gaps = 3/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+ADIKKITNQ  ++LG+GGYG VYKG++S+EILVAVK+LN+S GNG
Sbjct  317   FLEDYRALKPSRYSYADIKKITNQFKDKLGQGGYGTVYKGKLSNEILVAVKILNNSTGNG  376

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHHVNVVRLVG+CADG RRAL+YE+LPNESLEK+IFS   KN +L W+
Sbjct  377   EEFINEVGTMGRIHHVNVVRLVGFCADGLRRALIYEFLPNESLEKFIFSAAMKNQSLGWE  436

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIAKGIEYLHQGC Q+ILHFDIKP NILLD N+NPKI DFGLAKLCSKEKS V
Sbjct  437   KLRDIALGIAKGIEYLHQGCAQRILHFDIKPHNILLDQNLNPKISDFGLAKLCSKEKSVV  496

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +M+AARGTMGYIAPEV+SRNFG VSHKSDVYSFGMLLLEMVGGR+N +    T  +  + 
Sbjct  497   SMSAARGTMGYIAPEVLSRNFGNVSHKSDVYSFGMLLLEMVGGRRNIDV---TVENTSQV  553

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYNHL++G EL IRIE++ D  +AK+L I+ LWCIQW P DRPSMK VVQMLE E
Sbjct  554   YFPEWVYNHLDQGEELHIRIEKEGDAKMAKQLTIVGLWCIQWYPKDRPSMKVVVQMLEGE  613

Query  1544  GDDLVLPSSPF  1512
             GD+L +PS+PF
Sbjct  614   GDNLTMPSNPF  624


 Score =   366 bits (940),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 238/313 (76%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL +   VAVKI++   
Sbjct  314   IEKFLEDYRALKPSRYSYADIKKITNQFKDKLGQGGYGTVYKGKLSNEILVAVKILNNST  373

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEVG+MGRIHHVN+VRLVG+CA+  + AL+Y+F+PN SL+K+I   A  +  L
Sbjct  374   GNGEEFINEVGTMGRIHHVNVVRLVGFCADGLRRALIYEFLPNESLEKFIFSAAMKNQSL  433

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GC  +ILHFDIKPHNILLD+N  PKISDFGLAKL   +K
Sbjct  434   GWEKLRDIALGIAKGIEYLHQGCAQRILHFDIKPHNILLDQNLNPKISDFGLAKLCSKEK  493

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S+V+++AARGT+GY+APE+++R  G +SHK+DVYSFGMLL+EM+G  R   VT ++ S  
Sbjct  494   SVVSMSAARGTMGYIAPEVLSRNFGNVSHKSDVYSFGMLLLEMVGGRRNIDVTVENTSQV  553

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN +++G+ + +  E E + ++ K++TIVGLWCIQ  P  RPSM  VV+MLEG+
Sbjct  554   YFPEWVYNHLDQGEELHIRIEKEGDAKMAKQLTIVGLWCIQWYPKDRPSMKVVVQMLEGE  613

Query  1065  VELLQMPTDTFLS  1103
              + L MP++ F+S
Sbjct  614   GDNLTMPSNPFIS  626



>gb|EYU32412.1| hypothetical protein MIMGU_mgv11b0179042mg, partial [Erythranthe 
guttata]
Length=391

 Score =   460 bits (1184),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 224/338 (66%), Positives = 272/338 (80%), Gaps = 12/338 (4%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC +  LI K+RRRHLS+F+ IE FL ++ NL  IRY+Y  +K +TK F+EKLG+GG+GS
Sbjct  16    PCMLGLLIYKFRRRHLSMFDVIEGFLQSNTNLKTIRYTYSDMKKITKGFREKLGQGGYGS  75

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK+++KP SN QDFINEV ++GRIHHVN+V+LVGYCAE SK ALVYD
Sbjct  76    VYKGKLRSGHDVAVKVLAKPSSNWQDFINEVATIGRIHHVNVVKLVGYCAERSKRALVYD  135

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KYI      + L  +RK+EI +GVARGIEYLHRGCDIQILHFDIKPHNILLD
Sbjct  136   FMPNGSLEKYIFNKEKGNSLTLKRKYEIAIGVARGIEYLHRGCDIQILHFDIKPHNILLD  195

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PKISDFGLAK + TD + VTLTA RGTIGYVAPEL+NR IG +S+KADVYSFGMLL
Sbjct  196   ENFTPKISDFGLAKFYSTDNTTVTLTAVRGTIGYVAPELMNRSIGGVSYKADVYSFGMLL  255

Query  828   MEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMGE-----------EDEDEKRIT  971
             MEMLGLN+ T    +++SS+YFP WIY+ +NKG+ IE+G            +D+D K++ 
Sbjct  256   MEMLGLNKGTGPNIENKSSQYFPCWIYDHLNKGEDIEIGNVYENNDDEENEDDDDGKKMR  315

Query  972   KKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             +KMTIVGLWCIQMSP  RPSMS V++MLEG+ E + +P
Sbjct  316   RKMTIVGLWCIQMSPTDRPSMSDVLKMLEGEDENMMIP  353


 Score =   329 bits (843),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/327 (52%), Positives = 233/327 (71%), Gaps = 15/327 (5%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    ++  RY+++D+KKIT    E+LG+GGYG VYKG++ S   VAVKVL     N 
Sbjct  40    FLQSNTNLKTIRYTYSDMKKITKGFREKLGQGGYGSVYKGKLRSGHDVAVKVLAKPSSNW  99

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+LVGYCA+  +RALVY+++PN SLEKYIF+ E  N +L+ K
Sbjct  100   QDFINEVATIGRIHHVNVVKLVGYCAERSKRALVYDFMPNGSLEKYIFNKEKGN-SLTLK  158

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIA+G+A+GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAK  S + + V
Sbjct  159   RKYEIAIGVARGIEYLHRGCDIQILHFDIKPHNILLDENFTPKISDFGLAKFYSTDNTTV  218

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G VS+K+DVYSFGMLL+EM+G  K         +SQ   
Sbjct  219   TLTAVRGTIGYVAPELMNRSIGGVSYKADVYSFGMLLMEMLGLNKGTGPNIENKSSQY--  276

Query  1724  SFPEWVYNHLNRGGELQI-----------RieedddeaiakklaiiaLWCIQWQPVDRPS  1578
              FP W+Y+HLN+G +++I             ++DD + + +K+ I+ LWCIQ  P DRPS
Sbjct  277   -FPCWIYDHLNKGEDIEIGNVYENNDDEENEDDDDGKKMRRKMTIVGLWCIQMSPTDRPS  335

Query  1577  MKAVVQMLEREGDDLVLPSSPFAGSQM  1497
             M  V++MLE E +++++P  P   S++
Sbjct  336   MSDVLKMLEGEDENMMIPPQPSQSSEI  362



>ref|XP_010646609.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=445

 Score =   458 bits (1179),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 267/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ D+K+IT+Q  ++LG+GGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  112   FLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQGNG  171

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  172   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWK  231

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  232   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  291

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  292   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  348

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  349   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  408

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  409   GDKLTMPPNPFAST  422


 Score =   347 bits (890),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  +K +T  FK+KLG+GG+G+VYKGKL     VAVKI++  +
Sbjct  109   VKKFLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQ  168

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  169   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSL  228

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  229   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  288

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  289   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  348

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  349   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  408

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  409   GDKLTMPPNPFAS  421



>ref|XP_010646610.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=443

 Score =   458 bits (1178),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 267/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ D+K+IT+Q  ++LG+GGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  110   FLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQGNG  169

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  170   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWK  229

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  230   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  289

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  290   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  346

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  347   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  406

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  407   GDKLTMPPNPFAST  420


 Score =   346 bits (888),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  +K +T  FK+KLG+GG+G+VYKGKL     VAVKI++  +
Sbjct  107   VKKFLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQ  166

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  167   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSL  226

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  227   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  286

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  287   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  346

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  347   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  406

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  407   GDKLTMPPNPFAS  419



>ref|XP_010645763.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Vitis vinifera]
Length=429

 Score =   457 bits (1175),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 220/335 (66%), Positives = 267/335 (80%), Gaps = 3/335 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FLI K+RRR+LS++  IE F+ A NNL PIRYSY +IK MTK F EKLGEGG+GS
Sbjct  72    PCVVIFLIYKWRRRNLSMYHAIEEFIQAQNNLTPIRYSYSNIKKMTKGFMEKLGEGGYGS  131

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG  VAVK+M+  K+NGQDFINEV ++GRIHHVN+V+L+G+CAE SK ALVYD
Sbjct  132   VYKGKLRSGHFVAVKMMANSKANGQDFINEVATIGRIHHVNVVQLIGFCAEGSKRALVYD  191

Query  468   FMPNGSLDKYI--NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNIL  641
             FMPNGSLDKYI   +    SLL+ ++ +EI +GVA GIEYLHRGCD QILHFDIKPHNIL
Sbjct  192   FMPNGSLDKYIFPEKEGNISLLSLEKMYEISLGVAYGIEYLHRGCDTQILHFDIKPHNIL  251

Query  642   LDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGM  821
             LD+NF PK+SDFGLAK +PTD SIV+LTAARGT GY+APEL  + IG +S+KADVYSFGM
Sbjct  252   LDKNFTPKVSDFGLAKSYPTDHSIVSLTAARGTRGYMAPELFYKNIGGVSYKADVYSFGM  311

Query  822   LLMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLW  998
             LLMEM G  +      + SS+ YFPSW+Y   N+GK IEM +  E+ K ++KK+ IV LW
Sbjct  312   LLMEMAGRRKNLNVFAEHSSQIYFPSWVYEQFNEGKDIEMEDATEEGKELSKKLIIVALW  371

Query  999   CIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             CIQ+ P  RPSM++VVEMLEG+VELLQMP    L+
Sbjct  372   CIQLKPSDRPSMNKVVEMLEGNVELLQMPPKPLLT  406


 Score =   335 bits (860),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 229/316 (72%), Gaps = 4/316 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             F++    + P RYS+++IKK+T    E+LGEGGYG VYKG++ S   VAVK++ +SK NG
Sbjct  96    FIQAQNNLTPIRYSYSNIKKMTKGFMEKLGEGGYGSVYKGKLRSGHFVAVKMMANSKANG  155

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVAL-SW  2088
             ++FINEV  IG+IHHVNVV+L+G+CA+G +RALVY+++PN SL+KYIF  +  N++L S 
Sbjct  156   QDFINEVATIGRIHHVNVVQLIGFCAEGSKRALVYDFMPNGSLDKYIFPEKEGNISLLSL  215

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             +K+ EI+LG+A GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAK    + S 
Sbjct  216   EKMYEISLGVAYGIEYLHRGCDTQILHFDIKPHNILLDKNFTPKVSDFGLAKSYPTDHSI  275

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             V++TAARGT GY+APE+  +N G VS+K+DVYSFGMLL+EM G RKN N      +SQ  
Sbjct  276   VSLTAARGTRGYMAPELFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNVF-AEHSSQI-  333

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FP WVY   N G ++++    ++ + ++KKL I+ALWCIQ +P DRPSM  VV+MLE 
Sbjct  334   -YFPSWVYEQFNEGKDIEMEDATEEGKELSKKLIIVALWCIQLKPSDRPSMNKVVEMLEG  392

Query  1547  EGDDLVLPSSPFAGSQ  1500
               + L +P  P    Q
Sbjct  393   NVELLQMPPKPLLTPQ  408



>emb|CBI23153.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   456 bits (1174),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 230/314 (73%), Positives = 271/314 (86%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DY A++P+RYS++DIK+ITNQ  ++LG+GGYGIVYKG++S E+ VAVK+LN+S+GNG
Sbjct  87    FLQDYEALKPSRYSYSDIKRITNQFKDKLGQGGYGIVYKGKLSHEVFVAVKILNNSQGNG  146

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVNVVRLVG+CADGF+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  147   EEFINEVATMGTIHHVNVVRLVGFCADGFKRALIYEYLPNESLEKFIFSRAVKNYSLSWK  206

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  207   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  266

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAP+V+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  267   SMTIARGTIGYIAPKVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  323

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  324   YFPEWIYNHLDHGEELLIRIEEEIDAKIAKKLAIVGLSCIQWYPVDRPSMKIVVQMLEGE  383

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  384   GDKLTMPPNPFAST  397


 Score =   343 bits (879),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 231/313 (74%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLG+GG+G VYKGKL     VAVKI++  +
Sbjct  84    VKKFLQDYEALKPSRYSYSDIKRITNQFKDKLGQGGYGIVYKGKLSHEVFVAVKILNNSQ  143

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVN+VRLVG+CA+  K AL+Y+++PN SL+K+I   A  +  L
Sbjct  144   GNGEEFINEVATMGTIHHVNVVRLVGFCADGFKRALIYEYLPNESLEKFIFSRAVKNYSL  203

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  204   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  263

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGTIGY+AP++++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  264   SAVSMTIARGTIGYIAPKVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  323

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E + +I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  324   YFPEWIYNHLDHGEELLIRIEEEIDAKIAKKLAIVGLSCIQWYPVDRPSMKIVVQMLEGE  383

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  384   GDKLTMPPNPFAS  396



>ref|XP_010247811.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
Length=634

 Score =   464 bits (1194),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 231/315 (73%), Positives = 272/315 (86%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A+RPTRYS+ADIK+ITNQ  E+LG+GGYG V+KG++S+EILVAVKVLN SKGNG
Sbjct  300   FLEDYQALRPTRYSYADIKRITNQFKEKLGQGGYGSVFKGKLSNEILVAVKVLNYSKGNG  359

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  IG+IHHVNVVRLVG+CADGFRRALVYE+LPNESLEK+IFS ++ N +L  +
Sbjct  360   EEFINEVSTIGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSKDANNPSLDSE  419

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSK+KS V
Sbjct  420   KLMDIAMGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKDKSIV  479

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T     + 
Sbjct  480   SMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDT---TVEKSSQA  536

Query  1724  SFPEWVYNHL-NRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FPEW+YNHL ++G EL+IRI ED D  I ++L I+ALWCIQW PVDRPSMKAVVQMLE 
Sbjct  537   YFPEWIYNHLISQGEELKIRIAEDGDGKIERRLTIVALWCIQWYPVDRPSMKAVVQMLEG  596

Query  1547  EGDDLVLPSSPFAGS  1503
             + ++L++P +PFA +
Sbjct  597   DAENLIMPPNPFAST  611


 Score =   359 bits (922),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 239/314 (76%), Gaps = 3/314 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FKEKLG+GG+GSV+KGKL +   VAVK+++  K
Sbjct  297   IEKFLEDYQALRPTRYSYADIKRITNQFKEKLGQGGYGSVFKGKLSNEILVAVKVLNYSK  356

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEV ++GRIHHVN+VRLVG+CA+  + ALVY+F+PN SL+K+I ++ A    L
Sbjct  357   GNGEEFINEVSTIGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSKDANNPSL  416

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             + ++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   DK
Sbjct  417   DSEKLMDIAMGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKDK  476

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             SIV++TAARGT+GY+APE+ +R  G +S+K+DVYSFGMLL+EM+G  +   T  ++SS+ 
Sbjct  477   SIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDTTVEKSSQA  536

Query  885   YFPSWIYND-INKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEG  1061
             YFP WIYN  I++G+ +++   ++ + +I +++TIV LWCIQ  P+ RPSM  VV+MLEG
Sbjct  537   YFPEWIYNHLISQGEELKIRIAEDGDGKIERRLTIVALWCIQWYPVDRPSMKAVVQMLEG  596

Query  1062  DVELLQMPTDTFLS  1103
             D E L MP + F S
Sbjct  597   DAENLIMPPNPFAS  610



>ref|XP_010662818.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Vitis 
vinifera]
Length=443

 Score =   457 bits (1176),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 228/314 (73%), Positives = 269/314 (86%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ADIK+ITNQ  ++LG+GGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  109   FLEDYEALKPSRYSYADIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQGNG  168

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CADGF+RAL+YEYLPNESLEK+IFS + KN +LSWK
Sbjct  169   EEFINEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSLSWK  228

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  229   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  288

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAP+V+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  289   SMTVARGTIGYIAPKVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  345

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+RG EL IRIEE  D  IAKKLAI+ L CIQW P+DRPSMK VVQMLE  
Sbjct  346   YFPEWIYNHLDRGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDRPSMKIVVQMLEGR  405

Query  1544  GDDLVLPSSPFAGS  1503
             G  L +P +PFA +
Sbjct  406   G-KLTMPPNPFAST  418


 Score =   342 bits (878),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 171/323 (53%), Positives = 233/323 (72%), Gaps = 10/323 (3%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL     VAVKI++  +
Sbjct  106   VKRFLEDYEALKPSRYSYADIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQ  165

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I ++      L
Sbjct  166   GNGEEFINEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSL  225

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  226   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  285

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGTIGY+AP++++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  286   SAVSMTVARGTIGYIAPKVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  345

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN +++G+ + +  E++ +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG 
Sbjct  346   YFPEWIYNHLDRGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDRPSMKIVVQMLEGR  405

Query  1065  VELL--------QMPTDTFLSEP  1109
              +L           PT T LS+P
Sbjct  406   GKLTMPPNPFASTTPTKTNLSKP  428



>gb|EYU40246.1| hypothetical protein MIMGU_mgv1a018460mg [Erythranthe guttata]
Length=378

 Score =   454 bits (1169),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 215/337 (64%), Positives = 268/337 (80%), Gaps = 11/337 (3%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P   V LIIK+R+RHLS+F  IE FL ++ +L  IRYSY  I+ MT+ F+EKLGEGG+GS
Sbjct  28    PSLFVLLIIKFRKRHLSLFSTIEAFLQSNTSLTTIRYSYSDIRKMTRGFREKLGEGGYGS  87

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK+++K ++NGQ+FINEV ++GRIHHVN+V+LVGYCAE SK ALVYD
Sbjct  88    VYKGKLRSGHDVAVKLLNKTRANGQEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYD  147

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KY+     ++ L+  RKFEI VGVARGIEY H GC+IQILHFDIKPHNILLD
Sbjct  148   FMPNGSLEKYLFSKETSNWLSLARKFEIAVGVARGIEYFHIGCNIQILHFDIKPHNILLD  207

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PKISDFGLAK + T+ + VTLTA RGTIGYVA EL+NR IG +S+KADVYSFGMLL
Sbjct  208   DNFTPKISDFGLAKSYSTENTAVTLTAVRGTIGYVAHELMNRSIGRVSYKADVYSFGMLL  267

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDE-----------DEKRITK  974
             MEMLGLNR      ++SS+YFP WIY+ +N+G  IE+G  D+           + +++ +
Sbjct  268   MEMLGLNRGTRHNDNKSSQYFPYWIYDHLNEGNDIEIGNADKNDYDDDDDDDDNARKMRR  327

Query  975   KMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             KMTIVGLWCIQMSP  RPSMS V++ML+G+++ LQ+P
Sbjct  328   KMTIVGLWCIQMSPTDRPSMSEVLKMLQGEIKNLQIP  364


 Score =   327 bits (838),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/321 (53%), Positives = 229/321 (71%), Gaps = 16/321 (5%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+   ++   RYS++DI+K+T    E+LGEGGYG VYKG++ S   VAVK+LN ++ NG
Sbjct  52    FLQSNTSLTTIRYSYSDIRKMTRGFREKLGEGGYGSVYKGKLRSGHDVAVKLLNKTRANG  111

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVV+LVGYCA+  +RALVY+++PN SLEKY+FS E+ N  LS  
Sbjct  112   QEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYDFMPNGSLEKYLFSKETSN-WLSLA  170

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIA+G+A+GIEY H GC+ QILHFDIKP NILLD N  PKI DFGLAK  S E +AV
Sbjct  171   RKFEIAVGVARGIEYFHIGCNIQILHFDIKPHNILLDDNFTPKISDFGLAKSYSTENTAV  230

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+A E+++R+ G+VS+K+DVYSFGMLL+EM+G   N   +   + S Q  
Sbjct  231   TLTAVRGTIGYVAHELMNRSIGRVSYKADVYSFGMLLMEMLG--LNRGTRHNDNKSSQ--  286

Query  1724  SFPEWVYNHLNRGGELQI-----------RieedddeaiakklaiiaLWCIQWQPVDRPS  1578
              FP W+Y+HLN G +++I             ++D+   + +K+ I+ LWCIQ  P DRPS
Sbjct  287   YFPYWIYDHLNEGNDIEIGNADKNDYDDDDDDDDNARKMRRKMTIVGLWCIQMSPTDRPS  346

Query  1577  MKAVVQMLEREGDDLVLPSSP  1515
             M  V++ML+ E  +L +P  P
Sbjct  347   MSEVLKMLQGEIKNLQIPPQP  367



>ref|XP_010663016.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=602

 Score =   462 bits (1190),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 227/312 (73%), Positives = 266/312 (85%), Gaps = 3/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RYS+ DIKKITN+  E+LGEGGYG VYKG++S++ILVAVKVLN+SKGNG
Sbjct  286   FLEDYKALKPSRYSYVDIKKITNKFKEKLGEGGYGTVYKGKLSNDILVAVKVLNNSKGNG  345

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHH+NVVRLVG+CADG  RAL+YE+LPNESLEK+IFS   +N +L W+
Sbjct  346   EEFINEVGTMGRIHHINVVRLVGFCADGSIRALIYEFLPNESLEKFIFSVAGENHSLGWE  405

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q IA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+S V
Sbjct  406   KLQHIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEESVV  465

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV+SRNFG  SHKSDVYSFGMLLLEMVGGRKN +A   T  +  + 
Sbjct  466   SMTVARGTIGYIAPEVLSRNFGNASHKSDVYSFGMLLLEMVGGRKNIDA---TVENTGQV  522

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVY HLN+G EL IR E+  D  IAKKL I+ LWCIQW P+DRPSMK  VQMLE E
Sbjct  523   YFPEWVYCHLNQGKELNIRAEKGGDTKIAKKLTIVGLWCIQWYPIDRPSMKVAVQMLEGE  582

Query  1544  GDDLVLPSSPFA  1509
             GD+L +P +PFA
Sbjct  583   GDNLTMPPNPFA  594


 Score =   365 bits (937),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 232/313 (74%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE+FL     L P RYSY  IK +T  FKEKLGEGG+G+VYKGKL +   VAVK+++  K
Sbjct  283   IESFLEDYKALKPSRYSYVDIKKITNKFKEKLGEGGYGTVYKGKLSNDILVAVKVLNNSK  342

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS-LL  527
              NG++FINEVG+MGRIHH+N+VRLVG+CA+ S  AL+Y+F+PN SL+K+I   A  +  L
Sbjct  343   GNGEEFINEVGTMGRIHHINVVRLVGFCADGSIRALIYEFLPNESLEKFIFSVAGENHSL  402

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++   I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  403   GWEKLQHIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEE  462

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S+V++T ARGTIGY+APE+++R  G  SHK+DVYSFGMLL+EM+G  +    T ++    
Sbjct  463   SVVSMTVARGTIGYIAPEVLSRNFGNASHKSDVYSFGMLLLEMVGGRKNIDATVENTGQV  522

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+Y  +N+GK + +  E   + +I KK+TIVGLWCIQ  PI RPSM   V+MLEG+
Sbjct  523   YFPEWVYCHLNQGKELNIRAEKGGDTKIAKKLTIVGLWCIQWYPIDRPSMKVAVQMLEGE  582

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  583   GDNLTMPPNPFAS  595



>ref|XP_010247812.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
Length=394

 Score =   454 bits (1169),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 221/368 (60%), Positives = 281/368 (76%), Gaps = 4/368 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   FLI K RRRHLS+ E IE+ L + NNL PIRYSY  IK +TK+FKEKLG+GG+GSV
Sbjct  16    CFFPFLIYKLRRRHLSIDESIEDLLQSHNNLMPIRYSYSSIKKVTKSFKEKLGQGGYGSV  75

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             +KGKL+SG  VA+K++ + K NGQDFINEV ++GRIHHVN+V+L+G+C+E SK AL+Y+F
Sbjct  76    FKGKLKSGHHVAIKMLDQTKGNGQDFINEVATIGRIHHVNVVQLIGFCSEGSKRALIYEF  135

Query  471   MPNGSLDKYINQGAYASL--LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             MPNGSLDKYI+     ++  L+W++   IV+GV RGIEYLHRGC+ QILHFDIKPHNILL
Sbjct  136   MPNGSLDKYISARQEENIISLSWEKMLGIVLGVGRGIEYLHRGCNTQILHFDIKPHNILL  195

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAA-RGTIGYVAPELVNRRIGAISHKADVYSFGM  821
             D+NF+PKISDFGLAK F TD SIV+LTAA RGTIGY+APE++ + IG IS+KADVYSFGM
Sbjct  196   DDNFVPKISDFGLAKFFSTDDSIVSLTAAPRGTIGYIAPEMIYKNIGGISNKADVYSFGM  255

Query  822   LLMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLW  998
             LL+E+ G  +     +D SS+ YFPSWIY+ +  G+ IE+G+  +DEK I KK+ IV LW
Sbjct  256   LLLEITGRKKAINALRDHSSQFYFPSWIYDRLCHGEDIEIGDATDDEKTIAKKLVIVALW  315

Query  999   CIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEVHqeqssmsessesIAFLPN  1178
             CIQM+P+ RPSMS+VV+MLE D+E+LQMP   FLS P + +       S S  S  +   
Sbjct  316   CIQMNPVDRPSMSKVVDMLEDDIEVLQMPPRPFLSPPELPIDDTSFDTSHSETSTTYPSE  375

Query  1179  SASSNSIG  1202
             S S NS+ 
Sbjct  376   SRSCNSVA  383


 Score =   333 bits (855),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 172/313 (55%), Positives = 234/313 (75%), Gaps = 5/313 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
              L+ +  + P RYS++ IKK+T    E+LG+GGYG V+KG++ S   VA+K+L+ +KGNG
Sbjct  39    LLQSHNNLMPIRYSYSSIKKVTKSFKEKLGQGGYGSVFKGKLKSGHHVAIKMLDQTKGNG  98

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKN-VALSW  2088
             ++FINEV  IG+IHHVNVV+L+G+C++G +RAL+YE++PN SL+KYI + + +N ++LSW
Sbjct  99    QDFINEVATIGRIHHVNVVQLIGFCSEGSKRALIYEFMPNGSLDKYISARQEENIISLSW  158

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             +K+  I LG+ +GIEYLH+GC+ QILHFDIKP NILLD N  PKI DFGLAK  S + S 
Sbjct  159   EKMLGIVLGVGRGIEYLHRGCNTQILHFDIKPHNILLDDNFVPKISDFGLAKFFSTDDSI  218

Query  1907  VTMTAA-RGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQ  1731
             V++TAA RGT+GYIAPE++ +N G +S+K+DVYSFGMLLLE+ G +K  NA    D S Q
Sbjct  219   VSLTAAPRGTIGYIAPEMIYKNIGGISNKADVYSFGMLLLEITGRKKAINALR--DHSSQ  276

Query  1730  EGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FP W+Y+ L  G +++I    DD++ IAKKL I+ALWCIQ  PVDRPSM  VV MLE
Sbjct  277   -FYFPSWIYDRLCHGEDIEIGDATDDEKTIAKKLVIVALWCIQMNPVDRPSMSKVVDMLE  335

Query  1550  REGDDLVLPSSPF  1512
              + + L +P  PF
Sbjct  336   DDIEVLQMPPRPF  348



>ref|XP_010662457.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=380

 Score =   454 bits (1167),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 227/312 (73%), Positives = 268/312 (86%), Gaps = 4/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++PTRYS+ADIKKITNQ  ++LGEGG G VYKG++S E+ VAVK+LN+SKGNG
Sbjct  46    FLEDYIALKPTRYSYADIKKITNQFQDKLGEGGCGTVYKGKLSDEVHVAVKILNNSKGNG  105

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHHVNVVRLVG+CADGFRRAL+YE+LPNESLEK+IFS  ++N +L WK
Sbjct  106   EEFINEVGTMGRIHHVNVVRLVGFCADGFRRALIYEFLPNESLEKFIFSRTTENHSLGWK  165

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  166   KLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  225

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT+ARGTMGYIAPE++SRNFG VS+KSDV+S+GMLLLEMVGGRKN +    T  +  + 
Sbjct  226   SMTSARGTMGYIAPEMLSRNFGNVSYKSDVFSYGMLLLEMVGGRKNIDI---TVDNTCQV  282

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL++G ELQIRI+ED D  I KKL I+ LWCIQW   DRPSMK VVQMLE E
Sbjct  283   YFPEWIYNHLDQGEELQIRIDEDGDTQIVKKLTIVGLWCIQWFSADRPSMKLVVQMLEGE  342

Query  1544  GDDLVLPSSPFA  1509
               +L +P +PF 
Sbjct  343   -HNLSMPPNPFT  353


 Score =   349 bits (896),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 232/311 (75%), Gaps = 3/311 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  F++KLGEGG G+VYKGKL     VAVKI++  K
Sbjct  43    IEKFLEDYIALKPTRYSYADIKKITNQFQDKLGEGGCGTVYKGKLSDEVHVAVKILNNSK  102

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEVG+MGRIHHVN+VRLVG+CA+  + AL+Y+F+PN SL+K+I ++      L
Sbjct  103   GNGEEFINEVGTMGRIHHVNVVRLVGFCADGFRRALIYEFLPNESLEKFIFSRTTENHSL  162

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  163   GWKKLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  222

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T+ARGT+GY+APE+++R  G +S+K+DV+S+GMLL+EM+G  +   +T  +    
Sbjct  223   SAVSMTSARGTMGYIAPEMLSRNFGNVSYKSDVFSYGMLLLEMVGGRKNIDITVDNTCQV  282

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN +++G+ +++  +++ + +I KK+TIVGLWCIQ     RPSM  VV+MLEG+
Sbjct  283   YFPEWIYNHLDQGEELQIRIDEDGDTQIVKKLTIVGLWCIQWFSADRPSMKLVVQMLEGE  342

Query  1065  VELLQMPTDTF  1097
                L MP + F
Sbjct  343   HN-LSMPPNPF  352



>gb|EYU40254.1| hypothetical protein MIMGU_mgv1a018948mg, partial [Erythranthe 
guttata]
Length=398

 Score =   454 bits (1167),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 219/337 (65%), Positives = 273/337 (81%), Gaps = 11/337 (3%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P   V LIIK+R RHLS+F PIE FL ++ NL  IRYSY  ++ MT+ F+EKLGEGG+GS
Sbjct  40    PSLCVLLIIKFRTRHLSMFGPIERFLQSNKNLTTIRYSYSDVRKMTRGFREKLGEGGYGS  99

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK+++KP++NGQDFINEV ++G IHHVN+V+LVGYCAE SK ALVYD
Sbjct  100   VYKGKLRSGHDVAVKVLNKPRANGQDFINEVATIGMIHHVNVVKLVGYCAERSKRALVYD  159

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KY+      + L+ +RKFEI VGVARGIEYLH+GC+IQILHFDIKPHNILLD
Sbjct  160   FMPNGSLEKYLFSKETRNSLSLERKFEIAVGVARGIEYLHKGCNIQILHFDIKPHNILLD  219

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PKISDFGLAK + T+ + VTLTA RGTIGYVAPEL+NR IG++S +ADVYSFGMLL
Sbjct  220   DNFTPKISDFGLAKFYSTENTTVTLTAVRGTIGYVAPELMNRSIGSVSSRADVYSFGMLL  279

Query  828   MEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMG----------EEDEDEKRITK  974
             MEMLGLNR T    +++SS+YFP WIY+ +N+   IE+G          +ED++ +++ +
Sbjct  280   MEMLGLNRGTGPNNENKSSQYFPYWIYDHLNERNDIEIGNADKNDYDDDDEDDNARKMRR  339

Query  975   KMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             KMTIVGLWCIQM P  RPSMS V++ML+G++E LQ+P
Sbjct  340   KMTIVGLWCIQMKPSDRPSMSDVLKMLQGEIENLQIP  376


 Score =   328 bits (842),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 230/320 (72%), Gaps = 14/320 (4%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+  + +   RYS++D++K+T    E+LGEGGYG VYKG++ S   VAVKVLN  + NG
Sbjct  64    FLQSNKNLTTIRYSYSDVRKMTRGFREKLGEGGYGSVYKGKLRSGHDVAVKVLNKPRANG  123

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG IHHVNVV+LVGYCA+  +RALVY+++PN SLEKY+FS E++N +LS +
Sbjct  124   QDFINEVATIGMIHHVNVVKLVGYCAERSKRALVYDFMPNGSLEKYLFSKETRN-SLSLE  182

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIA+G+A+GIEYLH+GC+ QILHFDIKP NILLD N  PKI DFGLAK  S E + V
Sbjct  183   RKFEIAVGVARGIEYLHKGCNIQILHFDIKPHNILLDDNFTPKISDFGLAKFYSTENTTV  242

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G VS ++DVYSFGMLL+EM+G  +         +SQ   
Sbjct  243   TLTAVRGTIGYVAPELMNRSIGSVSSRADVYSFGMLLMEMLGLNRGTGPNNENKSSQY--  300

Query  1724  SFPEWVYNHLNRGGELQI----------RieedddeaiakklaiiaLWCIQWQPVDRPSM  1575
              FP W+Y+HLN   +++I            E+D+   + +K+ I+ LWCIQ +P DRPSM
Sbjct  301   -FPYWIYDHLNERNDIEIGNADKNDYDDDDEDDNARKMRRKMTIVGLWCIQMKPSDRPSM  359

Query  1574  KAVVQMLEREGDDLVLPSSP  1515
               V++ML+ E ++L +P  P
Sbjct  360   SDVLKMLQGEIENLQIPPQP  379



>ref|XP_007036620.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY21121.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=589

 Score =   460 bits (1184),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 269/314 (86%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY++++P+RYS+ADIK+ITNQ  E+LGEGGYG V+KGR+S+++LVAVKVLN+ KGNG
Sbjct  256   FLEDYKSLKPSRYSYADIKRITNQFKEKLGEGGYGTVFKGRLSNDVLVAVKVLNNFKGNG  315

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG + +IHHVNV RLVG+CADG++RALVYEYLPNESLEK+IFS + ++  L W 
Sbjct  316   EEFINEVGSMSRIHHVNVARLVGFCADGYKRALVYEYLPNESLEKFIFSAKGESHFLGWD  375

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLHQGC+Q+ILHFDIKP NILLDHN  PKI DFGLAKLCSKE+SAV
Sbjct  376   KLQDIALGIAKGIEYLHQGCEQRILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQSAV  435

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T  +  + 
Sbjct  436   SMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---TVENTSQV  492

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYNHL+ G +L IRIE++    IA+KL+I+ LWCIQW PVDRPSMK V+QMLE E
Sbjct  493   YFPEWVYNHLDEGEDLGIRIEDERQSMIARKLSIVGLWCIQWFPVDRPSMKVVIQMLEGE  552

Query  1544  GDDLVLPSSPFAGS  1503
              D L LP +PFA +
Sbjct  553   ADSLTLPPNPFAST  566


 Score =   362 bits (930),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 239/319 (75%), Gaps = 2/319 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL    +L P RYSY  IK +T  FKEKLGEGG+G+V+KG+L +   VAVK+++  K
Sbjct  253   VEEFLEDYKSLKPSRYSYADIKRITNQFKEKLGEGGYGTVFKGRLSNDVLVAVKVLNNFK  312

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEVGSM RIHHVN+ RLVG+CA+  K ALVY+++PN SL+K+I +    +  L
Sbjct  313   GNGEEFINEVGSMSRIHHVNVARLVGFCADGYKRALVYEYLPNESLEKFIFSAKGESHFL  372

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W +  +I +G+A+GIEYLH+GC+ +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  373   GWDKLQDIALGIAKGIEYLHQGCEQRILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQ  432

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   VT ++ S  
Sbjct  433   SAVSMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVTVENTSQV  492

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN +++G+ + +  EDE +  I +K++IVGLWCIQ  P+ RPSM  V++MLEG+
Sbjct  493   YFPEWVYNHLDEGEDLGIRIEDERQSMIARKLSIVGLWCIQWFPVDRPSMKVVIQMLEGE  552

Query  1065  VELLQMPTDTFLSEPIMEV  1121
              + L +P + F S   M++
Sbjct  553   ADSLTLPPNPFASTDYMKL  571



>ref|XP_002275176.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=604

 Score =   461 bits (1185),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 224/313 (72%), Positives = 270/313 (86%), Gaps = 4/313 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RYS+ DIKK+TN   ++LG+GGYG VYKG++S+E+LVA+K+LNDSKGNG
Sbjct  272   FLEDYKALKPSRYSYNDIKKLTNHFKDKLGQGGYGTVYKGKLSNEVLVAIKILNDSKGNG  331

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG IG+IHHVNVVRLVG+CADG +RAL+YE+LPNESLEK+IFST  +  +L W+
Sbjct  332   EEFINEVGTIGRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKFIFSTSVETYSLGWE  391

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLD N NPKI DFGLAKLCSK++SAV
Sbjct  392   KLQDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQSAV  451

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV+SRNFG  S+KSDVYSFGMLLLEMVGGRKN +    T+    + 
Sbjct  452   SMTVARGTMGYIAPEVLSRNFGNASYKSDVYSFGMLLLEMVGGRKNIDVTMETN----QV  507

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G ++ IRIEE+ D  IAKKL I+ LWCIQW P+DRPSMK VVQMLERE
Sbjct  508   YFPEWVYNQLDQGEDVHIRIEEEGDIKIAKKLTIVGLWCIQWYPIDRPSMKVVVQMLERE  567

Query  1544  GDDLVLPSSPFAG  1506
             GD+L +P +PFA 
Sbjct  568   GDNLTIPPNPFAS  580


 Score =   362 bits (929),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 234/312 (75%), Gaps = 1/312 (0%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL +   VA+KI++  K
Sbjct  269   IEKFLEDYKALKPSRYSYNDIKKLTNHFKDKLGQGGYGTVYKGKLSNEVLVAIKILNDSK  328

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEVG++GRIHHVN+VRLVG+CA+  K AL+Y+F+PN SL+K+I   +  +  L
Sbjct  329   GNGEEFINEVGTIGRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKFIFSTSVETYSL  388

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLDENF PKISDFGLAKL   D+
Sbjct  389   GWEKLQDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQ  448

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSKY  887
             S V++T ARGT+GY+APE+++R  G  S+K+DVYSFGMLL+EM+G  +      + +  Y
Sbjct  449   SAVSMTVARGTMGYIAPEVLSRNFGNASYKSDVYSFGMLLLEMVGGRKNIDVTMETNQVY  508

Query  888   FPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDV  1067
             FP W+YN +++G+ + +  E+E + +I KK+TIVGLWCIQ  PI RPSM  VV+MLE + 
Sbjct  509   FPEWVYNQLDQGEDVHIRIEEEGDIKIAKKLTIVGLWCIQWYPIDRPSMKVVVQMLEREG  568

Query  1068  ELLQMPTDTFLS  1103
             + L +P + F S
Sbjct  569   DNLTIPPNPFAS  580



>ref|XP_010662662.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=613

 Score =   461 bits (1185),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 224/313 (72%), Positives = 270/313 (86%), Gaps = 4/313 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RYS+ DIKK+TN   ++LG+GGYG VYKG++S+E+LVA+K+LNDSKGNG
Sbjct  281   FLEDYKALKPSRYSYNDIKKLTNHFKDKLGQGGYGTVYKGKLSNEVLVAIKILNDSKGNG  340

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG IG+IHHVNVVRLVG+CADG +RAL+YE+LPNESLEK+IFST  +  +L W+
Sbjct  341   EEFINEVGTIGRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKFIFSTSVETYSLGWE  400

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLD N NPKI DFGLAKLCSK++SAV
Sbjct  401   KLQDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQSAV  460

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV+SRNFG  S+KSDVYSFGMLLLEMVGGRKN +    T+    + 
Sbjct  461   SMTVARGTMGYIAPEVLSRNFGNASYKSDVYSFGMLLLEMVGGRKNIDVTMETN----QV  516

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G ++ IRIEE+ D  IAKKL I+ LWCIQW P+DRPSMK VVQMLERE
Sbjct  517   YFPEWVYNQLDQGEDVHIRIEEEGDIKIAKKLTIVGLWCIQWYPIDRPSMKVVVQMLERE  576

Query  1544  GDDLVLPSSPFAG  1506
             GD+L +P +PFA 
Sbjct  577   GDNLTIPPNPFAS  589


 Score =   362 bits (929),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 234/312 (75%), Gaps = 1/312 (0%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL +   VA+KI++  K
Sbjct  278   IEKFLEDYKALKPSRYSYNDIKKLTNHFKDKLGQGGYGTVYKGKLSNEVLVAIKILNDSK  337

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEVG++GRIHHVN+VRLVG+CA+  K AL+Y+F+PN SL+K+I   +  +  L
Sbjct  338   GNGEEFINEVGTIGRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKFIFSTSVETYSL  397

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLDENF PKISDFGLAKL   D+
Sbjct  398   GWEKLQDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQ  457

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSKY  887
             S V++T ARGT+GY+APE+++R  G  S+K+DVYSFGMLL+EM+G  +      + +  Y
Sbjct  458   SAVSMTVARGTMGYIAPEVLSRNFGNASYKSDVYSFGMLLLEMVGGRKNIDVTMETNQVY  517

Query  888   FPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDV  1067
             FP W+YN +++G+ + +  E+E + +I KK+TIVGLWCIQ  PI RPSM  VV+MLE + 
Sbjct  518   FPEWVYNQLDQGEDVHIRIEEEGDIKIAKKLTIVGLWCIQWYPIDRPSMKVVVQMLEREG  577

Query  1068  ELLQMPTDTFLS  1103
             + L +P + F S
Sbjct  578   DNLTIPPNPFAS  589



>gb|EYU21048.1| hypothetical protein MIMGU_mgv1a025540mg, partial [Erythranthe 
guttata]
Length=382

 Score =   452 bits (1163),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 219/337 (65%), Positives = 273/337 (81%), Gaps = 11/337 (3%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  V LIIK+R RHLS+F PIE FL ++ NL  IRYSY  ++ MT+ F+EKLGEGG+GS
Sbjct  24    PCLCVLLIIKFRTRHLSMFGPIERFLQSNKNLTTIRYSYSDVRKMTRGFREKLGEGGYGS  83

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK+++KP++NGQDFINEV ++G IHH+N+V+LVGYCAE SK ALVYD
Sbjct  84    VYKGKLRSGHDVAVKVLNKPRANGQDFINEVATIGMIHHINVVKLVGYCAERSKRALVYD  143

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KY+     ++ L+  RKFEI VGVARGIEYLH GC+IQILHFDIKPHNILLD
Sbjct  144   FMPNGSLEKYLFSKETSNSLSLVRKFEIAVGVARGIEYLHIGCNIQILHFDIKPHNILLD  203

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PKISDFGLAK + T+ + VTLTA RGTIGYVAPEL+NR IG++S +ADVYSFGMLL
Sbjct  204   DNFTPKISDFGLAKSYSTENNTVTLTAVRGTIGYVAPELMNRSIGSVSCRADVYSFGMLL  263

Query  828   MEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMG----------EEDEDEKRITK  974
             MEMLGLNR T  +  ++SS+YFP WIY+ +N+G  IE+G          +ED++ +++ +
Sbjct  264   MEMLGLNRGTGPSNDNKSSQYFPYWIYDHLNEGNDIEIGNAENNDYDDDDEDDNARKMRR  323

Query  975   KMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             KMTIVGLWCIQM P  RPSMS V++ML+G++  LQ+P
Sbjct  324   KMTIVGLWCIQMRPSDRPSMSEVLKMLQGEIGNLQIP  360


 Score =   323 bits (828),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 227/320 (71%), Gaps = 14/320 (4%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+  + +   RYS++D++K+T    E+LGEGGYG VYKG++ S   VAVKVLN  + NG
Sbjct  48    FLQSNKNLTTIRYSYSDVRKMTRGFREKLGEGGYGSVYKGKLRSGHDVAVKVLNKPRANG  107

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG IHH+NVV+LVGYCA+  +RALVY+++PN SLEKY+FS E+ N +LS  
Sbjct  108   QDFINEVATIGMIHHINVVKLVGYCAERSKRALVYDFMPNGSLEKYLFSKETSN-SLSLV  166

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIA+G+A+GIEYLH GC+ QILHFDIKP NILLD N  PKI DFGLAK  S E + V
Sbjct  167   RKFEIAVGVARGIEYLHIGCNIQILHFDIKPHNILLDDNFTPKISDFGLAKSYSTENNTV  226

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G VS ++DVYSFGMLL+EM+G  +         +SQ   
Sbjct  227   TLTAVRGTIGYVAPELMNRSIGSVSCRADVYSFGMLLMEMLGLNRGTGPSNDNKSSQY--  284

Query  1724  SFPEWVYNHLNRGGELQI----------RieedddeaiakklaiiaLWCIQWQPVDRPSM  1575
              FP W+Y+HLN G +++I            E+D+   + +K+ I+ LWCIQ +P DRPSM
Sbjct  285   -FPYWIYDHLNEGNDIEIGNAENNDYDDDDEDDNARKMRRKMTIVGLWCIQMRPSDRPSM  343

Query  1574  KAVVQMLEREGDDLVLPSSP  1515
               V++ML+ E  +L +P  P
Sbjct  344   SEVLKMLQGEIGNLQIPHQP  363



>ref|XP_010662998.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=591

 Score =   459 bits (1182),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 230/314 (73%), Positives = 267/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ADIK+IT+Q  ++LGEGGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  258   FLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQGNG  317

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  318   EEFINEVATMGTIHHVNIVRLVGFCADRFNRALIYEYLPNESLEKFIFSKVVKNYSLSWK  377

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  378   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  437

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  438   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  494

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  495   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  554

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  555   GDKLTMPPNPFAST  568


 Score =   346 bits (887),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 228/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLGEGG+G+VYKGKL     VAVKI++  +
Sbjct  255   VKKFLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQ  314

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+    AL+Y+++PN SL+K+I      +  L
Sbjct  315   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFNRALIYEYLPNESLEKFIFSKVVKNYSL  374

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  375   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  434

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  435   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  494

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  495   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  554

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  555   GDKLTMPPNPFAS  567



>ref|XP_010247813.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
 ref|XP_010247814.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
Length=638

 Score =   461 bits (1185),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 273/314 (87%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DY+A+RP RYS+ADIK+ITNQ +E+LG+GGYG V+KG++S+EILVAVKVLN +KGNG
Sbjct  305   FLDDYKALRPRRYSYADIKRITNQFNEKLGQGGYGSVFKGKLSNEILVAVKVLNYAKGNG  364

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVVRLVG+CADGFRRALVYE+LPNESLEK+IFS  + N  L+W+
Sbjct  365   DEFINEVSTIGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSKNANNPFLNWE  424

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIA+G+EYLHQGCDQ+ILHFDIKP NILLDHN N KI DFGLAKLCSK+KS V
Sbjct  425   KLQKIAIGIARGMEYLHQGCDQRILHFDIKPHNILLDHNFNXKISDFGLAKLCSKDKSIV  484

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV SRNFG VS+KSDVYSFGMLLLEMVGGRKN +A E   TSQ   
Sbjct  485   SMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDATE-EKTSQV--  541

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYNHL++G E++IR+ ED D  IAKKL I+ALWCIQW PVDRPSM  VVQMLE E
Sbjct  542   YFPEWVYNHLSQGEEMEIRVIEDGDAKIAKKLTIVALWCIQWYPVDRPSMNVVVQMLEGE  601

Query  1544  GDDLVLPSSPFAGS  1503
              + L++P +PFA +
Sbjct  602   AERLIMPPNPFAST  615


 Score =   366 bits (940),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/313 (57%), Positives = 237/313 (76%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL+    L P RYSY  IK +T  F EKLG+GG+GSV+KGKL +   VAVK+++  K
Sbjct  302   IEKFLDDYKALRPRRYSYADIKRITNQFNEKLGQGGYGSVFKGKLSNEILVAVKVLNYAK  361

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG +FINEV ++GRIHHVN+VRLVG+CA+  + ALVY+F+PN SL+K+I ++ A    L
Sbjct  362   GNGDEFINEVSTIGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSKNANNPFL  421

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             NW++  +I +G+ARG+EYLH+GCD +ILHFDIKPHNILLD NF  KISDFGLAKL   DK
Sbjct  422   NWEKLQKIAIGIARGMEYLHQGCDQRILHFDIKPHNILLDHNFNXKISDFGLAKLCSKDK  481

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             SIV++TAARGT+GY+APE+ +R  G +S+K+DVYSFGMLL+EM+G  +    TE+  S  
Sbjct  482   SIVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDATEEKTSQV  541

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN +++G+ +E+   ++ + +I KK+TIV LWCIQ  P+ RPSM+ VV+MLEG+
Sbjct  542   YFPEWVYNHLSQGEEMEIRVIEDGDAKIAKKLTIVALWCIQWYPVDRPSMNVVVQMLEGE  601

Query  1065  VELLQMPTDTFLS  1103
              E L MP + F S
Sbjct  602   AERLIMPPNPFAS  614



>ref|XP_006366547.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=514

 Score =   456 bits (1174),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 234/313 (75%), Positives = 266/313 (85%), Gaps = 6/313 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA RPTRY++ADIKKITNQ  E LGEG YGIVYKG +S+EI VAVK+LNDS+GNG
Sbjct  186   FLEDYRAHRPTRYTYADIKKITNQFQEILGEGAYGIVYKGTLSNEIHVAVKILNDSEGNG  245

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESK-NVALSW  2088
             EEFINEV  +GKIHHVNVVRLVG+CADG RRALV+EYLPN+SL+K IF T  K N+ L+W
Sbjct  246   EEFINEVAAMGKIHHVNVVRLVGFCADGVRRALVFEYLPNQSLDKLIFPTSFKDNITLTW  305

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             KK+ +IA+GIAKG+EYLHQGCDQQILHFDIKP NILLDHN+NPKI DFGLAKLCSKEKS 
Sbjct  306   KKLHDIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKEKSV  365

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VTMT ARGTMGYIAPEV+S NFGK SHKSDVYSFGM+LLEMVGGRKNF+AK   DTSQ  
Sbjct  366   VTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAK--ADTSQM-  422

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +FPEW++  LN+G EL+IRIEEDDD  I +KLA+I LWCIQW   DRPS+K V QMLE 
Sbjct  423   -NFPEWIHQRLNQGEELKIRIEEDDDVIIVRKLAVIGLWCIQWNATDRPSIKIVTQMLEG  481

Query  1547  EGDDLVLPSSPFA  1509
             +  +L +P SPF 
Sbjct  482   DVSNLTVP-SPFT  493


 Score =   334 bits (856),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 220/308 (71%), Gaps = 2/308 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL       P RY+Y  IK +T  F+E LGEG +G VYKG L +   VAVKI++  +
Sbjct  183   VEKFLEDYRAHRPTRYTYADIKKITNQFQEILGEGAYGIVYKGTLSNEIHVAVKILNDSE  242

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEV +MG+IHHVN+VRLVG+CA+  + ALV++++PN SLDK I   ++     
Sbjct  243   GNGEEFINEVAAMGKIHHVNVVRLVGFCADGVRRALVFEYLPNQSLDKLIFPTSFKDNIT  302

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L W++  +I +G+A+G+EYLH+GCD QILHFDIKP NILLD N  PKISDFGLAKL   +
Sbjct  303   LTWKKLHDIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKE  362

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             KS+VT+T ARGT+GY+APE+++   G  SHK+DVYSFGM+L+EM+G  +    + D S  
Sbjct  363   KSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAKADTSQM  422

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
              FP WI+  +N+G+ +++  E++D+  I +K+ ++GLWCIQ +   RPS+  V +MLEGD
Sbjct  423   NFPEWIHQRLNQGEELKIRIEEDDDVIIVRKLAVIGLWCIQWNATDRPSIKIVTQMLEGD  482

Query  1065  VELLQMPT  1088
             V  L +P+
Sbjct  483   VSNLTVPS  490



>ref|XP_010662385.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
 ref|XP_010662386.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=598

 Score =   459 bits (1181),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 272/334 (81%), Gaps = 3/334 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  VFLI K+RRR+L ++  IE F+ + NNL PIRYSY +IK MTK FKEKLGEGGFGS
Sbjct  257   PCVFVFLIYKWRRRNLWIYSDIEEFIQSHNNLMPIRYSYSNIKKMTKNFKEKLGEGGFGS  316

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             V+KGKL+SG  VAVK M   K+NGQDFINEV ++GRIHHVN+V+L+G+CA+ SK ALV+D
Sbjct  317   VFKGKLQSGRLVAVK-MVNSKANGQDFINEVATIGRIHHVNVVQLIGFCAKGSKRALVFD  375

Query  468   FMPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSLDKYI     A++ LN+++ +EI +GVA GIEYLHRGCD+QILHFDIKPHNILL
Sbjct  376   FMPNGSLDKYIFPRTEANISLNFEKMYEISLGVAHGIEYLHRGCDMQILHFDIKPHNILL  435

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D+NF PK+SDFGLAKL+PTD SIV++TAARGT+GY+APELV + IG +S+KADVYSFGML
Sbjct  436   DKNFSPKVSDFGLAKLYPTDHSIVSVTAARGTMGYMAPELVYKNIGGVSYKADVYSFGML  495

Query  825   LMEMLGLNRT-PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             LMEM G  +   V  +  S  YFPSW+Y+  ++GK IEMG+  E+E+++ KKM IV LWC
Sbjct  496   LMEMAGRRKNLNVFAEHSSQMYFPSWVYDQFSEGKDIEMGDATEEEQKLAKKMIIVALWC  555

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             IQ+ P  RPSMS+VVEMLEG+VELLQMP   FL+
Sbjct  556   IQLKPSDRPSMSKVVEMLEGNVELLQMPPKPFLT  589


 Score =   344 bits (883),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 237/315 (75%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             F++ +  + P RYS+++IKK+T    E+LGEGG+G V+KG++ S  LVAVK++N SK NG
Sbjct  281   FIQSHNNLMPIRYSYSNIKKMTKNFKEKLGEGGFGSVFKGKLQSGRLVAVKMVN-SKANG  339

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+G+CA G +RALV++++PN SL+KYIF     N++L+++
Sbjct  340   QDFINEVATIGRIHHVNVVQLIGFCAKGSKRALVFDFMPNGSLDKYIFPRTEANISLNFE  399

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A GIEYLH+GCD QILHFDIKP NILLD N +PK+ DFGLAKL   + S V
Sbjct  400   KMYEISLGVAHGIEYLHRGCDMQILHFDIKPHNILLDKNFSPKVSDFGLAKLYPTDHSIV  459

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGY+APE+V +N G VS+K+DVYSFGMLL+EM G RKN N      +SQ   
Sbjct  460   SVTAARGTMGYMAPELVYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNVF-AEHSSQM--  516

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+  + G ++++    ++++ +AKK+ I+ALWCIQ +P DRPSM  VV+MLE  
Sbjct  517   YFPSWVYDQFSEGKDIEMGDATEEEQKLAKKMIIVALWCIQLKPSDRPSMSKVVEMLEGN  576

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  577   VELLQMPPKPFLTPQ  591



>ref|XP_003635153.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=599

 Score =   459 bits (1181),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 229/314 (73%), Positives = 268/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ADIK+IT+Q  ++LGEGGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  266   FLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQGNG  325

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  326   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWK  385

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  386   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  445

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  446   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  502

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRI+E+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  503   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  562

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  563   GDKLTMPPNPFAST  576


 Score =   345 bits (885),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLGEGG+G+VYKGKL     VAVKI++  +
Sbjct  263   VKKFLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQ  322

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  323   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSL  382

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  383   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  442

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  443   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  502

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  ++E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  503   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  562

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  563   GDKLTMPPNPFAS  575



>ref|XP_010662827.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=589

 Score =   459 bits (1180),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 229/314 (73%), Positives = 266/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ADIK+IT+Q  ++LGEGGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  256   FLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQGNG  315

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD   RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  316   EEFINEVATMGTIHHVNIVRLVGFCADRLNRALIYEYLPNESLEKFIFSKVVKNYSLSWK  375

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SA+
Sbjct  376   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAI  435

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T  S  + 
Sbjct  436   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---TVESTSQV  492

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  493   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  552

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  553   GDKLTMPPNPFAST  566


 Score =   347 bits (890),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 228/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLGEGG+G+VYKGKL     VAVKI++  +
Sbjct  253   VKKFLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQ  312

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+    AL+Y+++PN SL+K+I      +  L
Sbjct  313   GNGEEFINEVATMGTIHHVNIVRLVGFCADRLNRALIYEYLPNESLEKFIFSKVVKNYSL  372

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  373   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  432

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S +++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   VT +  S  
Sbjct  433   SAISMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVTVESTSQV  492

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  493   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  552

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  553   GDKLTMPPNPFAS  565



>ref|XP_010646613.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=608

 Score =   459 bits (1181),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 229/314 (73%), Positives = 268/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ADIK+IT+Q  ++LGEGGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  275   FLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQGNG  334

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  335   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWK  394

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  395   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  454

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  455   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  511

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRI+E+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  512   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  571

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  572   GDKLTMPPNPFAST  585


 Score =   345 bits (886),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLGEGG+G+VYKGKL     VAVKI++  +
Sbjct  272   VKKFLEDYEALKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQ  331

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  332   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSL  391

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  392   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  451

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  452   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  511

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  ++E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  512   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  571

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  572   GDKLTMPPNPFAS  584



>ref|XP_010247816.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Nelumbo nucifera]
Length=579

 Score =   457 bits (1177),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 276/341 (81%), Gaps = 4/341 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   FLI K RRRHLS+ + IE+FL + NNL PIRYSY  IK MTK FKEKLG+GG+GSV
Sbjct  205   CFFPFLIYKLRRRHLSMDDSIEDFLQSHNNLMPIRYSYSSIKKMTKGFKEKLGQGGYGSV  264

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             +KGKL+SG  VA+K++ + KSNGQ+FINEV ++GRIHHVN+V+L+G+C+E SK AL+Y+F
Sbjct  265   FKGKLKSGHLVAIKMLDQSKSNGQEFINEVATIGRIHHVNVVQLIGFCSEGSKRALIYEF  324

Query  471   MPNGSLDKYIN--QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             MPNGSLDKYI+  Q   +  L+W++  +IV+GV RGIEYLHRGC+IQILHFDIKPHNILL
Sbjct  325   MPNGSLDKYISARQEGNSISLSWEKMLDIVLGVGRGIEYLHRGCNIQILHFDIKPHNILL  384

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAA-RGTIGYVAPELVNRRIGAISHKADVYSFGM  821
             D+NF+PKISDFGLAK F TD   V+L+AA RGTIGY+APE++ + IG +++KADVYSFGM
Sbjct  385   DDNFVPKISDFGLAKFFATDDRTVSLSAAPRGTIGYIAPEMIYKNIGGVTYKADVYSFGM  444

Query  822   LLMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLW  998
             LL+E+ G  +     +D SS+ YFPSWIY+ +++G+ IE+G+  +DEK I KK+ IV LW
Sbjct  445   LLLEITGRKKAINASRDHSSQFYFPSWIYDRVSQGEDIEIGDATDDEKTIAKKLVIVALW  504

Query  999   CIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV  1121
             CIQM+P+ RPSM+R+V+MLEGD+E+LQMP   FLS P M +
Sbjct  505   CIQMNPVNRPSMNRIVDMLEGDIEVLQMPPRPFLSPPEMPI  545


 Score =   332 bits (850),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 236/313 (75%), Gaps = 5/313 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  + P RYS++ IKK+T    E+LG+GGYG V+KG++ S  LVA+K+L+ SK NG
Sbjct  228   FLQSHNNLMPIRYSYSSIKKMTKGFKEKLGQGGYGSVFKGKLKSGHLVAIKMLDQSKSNG  287

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKN-VALSW  2088
             +EFINEV  IG+IHHVNVV+L+G+C++G +RAL+YE++PN SL+KYI + +  N ++LSW
Sbjct  288   QEFINEVATIGRIHHVNVVQLIGFCSEGSKRALIYEFMPNGSLDKYISARQEGNSISLSW  347

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             +K+ +I LG+ +GIEYLH+GC+ QILHFDIKP NILLD N  PKI DFGLAK  + +   
Sbjct  348   EKMLDIVLGVGRGIEYLHRGCNIQILHFDIKPHNILLDDNFVPKISDFGLAKFFATDDRT  407

Query  1907  VTMTAA-RGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQ  1731
             V+++AA RGT+GYIAPE++ +N G V++K+DVYSFGMLLLE+ G +K  NA    D S Q
Sbjct  408   VSLSAAPRGTIGYIAPEMIYKNIGGVTYKADVYSFGMLLLEITGRKKAINASR--DHSSQ  465

Query  1730  EGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FP W+Y+ +++G +++I    DD++ IAKKL I+ALWCIQ  PV+RPSM  +V MLE
Sbjct  466   -FYFPSWIYDRVSQGEDIEIGDATDDEKTIAKKLVIVALWCIQMNPVNRPSMNRIVDMLE  524

Query  1550  REGDDLVLPSSPF  1512
              + + L +P  PF
Sbjct  525   GDIEVLQMPPRPF  537



>ref|XP_006348214.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Solanum tuberosum]
Length=379

 Score =   449 bits (1156),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 263/318 (83%), Gaps = 6/318 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A+RPTRY++ADIKKIT+  +E+LGEG YG +YKGR+SSEI VAVKVL+DSKG G
Sbjct  45    FLEDYKAIRPTRYTYADIKKITDDFNEKLGEGSYGTIYKGRLSSEIFVAVKVLHDSKGKG  104

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVA---L  2094
             EEFINE+G IG+IHHVNVVRLVG+CADGFRRAL+YEYLPN+SLE++I    S   +   +
Sbjct  105   EEFINEIGTIGRIHHVNVVRLVGFCADGFRRALIYEYLPNDSLERFILPVNSSTGSVSLI  164

Query  2093  SWKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEK  1914
             SW K+Q IALG A+GIEYLHQGCDQQILHFDIKP NILLDHN+NPKICDFGLAKLCSKEK
Sbjct  165   SWNKLQHIALGTARGIEYLHQGCDQQILHFDIKPQNILLDHNLNPKICDFGLAKLCSKEK  224

Query  1913  SAVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQ  1734
             S VTMTAARGT+GYIAPEV+SRNFGKVSHKSD+YSFGMLLLEMV GR   ++K  T+   
Sbjct  225   SVVTMTAARGTIGYIAPEVLSRNFGKVSHKSDIYSFGMLLLEMVDGRIKMDSK--TNNHS  282

Query  1733  QEGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQML  1554
             +  S  EW+Y HL +G EL+IRIEE+ D  I +KLAI+ LWCIQW P+DRPS+K V QML
Sbjct  283   KVNSL-EWIYRHLEKGEELKIRIEEEGDNTIVRKLAIVGLWCIQWHPIDRPSIKEVTQML  341

Query  1553  EREGDDLVLPSSPFAGSQ  1500
             E +G  L L  +PF  + 
Sbjct  342   EGDGSHLNLSPNPFMATN  359


 Score =   337 bits (865),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 166/339 (49%), Positives = 228/339 (67%), Gaps = 8/339 (2%)
 Frame = +3

Query  111   CAIVFLIIKY---RRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGF  281
             C IVF + K     R        +E FL     + P RY+Y  IK +T  F EKLGEG +
Sbjct  19    CIIVFSLYKLYLTSRNERESRVRLEKFLEDYKAIRPTRYTYADIKKITDDFNEKLGEGSY  78

Query  282   GSVYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALV  461
             G++YKG+L S   VAVK++   K  G++FINE+G++GRIHHVN+VRLVG+CA+  + AL+
Sbjct  79    GTIYKGRLSSEIFVAVKVLHDSKGKGEEFINEIGTIGRIHHVNVVRLVGFCADGFRRALI  138

Query  462   YDFMPNGSLDKYI----NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKP  629
             Y+++PN SL+++I    +     SL++W +   I +G ARGIEYLH+GCD QILHFDIKP
Sbjct  139   YEYLPNDSLERFILPVNSSTGSVSLISWNKLQHIALGTARGIEYLHQGCDQQILHFDIKP  198

Query  630   HNILLDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVY  809
              NILLD N  PKI DFGLAKL   +KS+VT+TAARGTIGY+APE+++R  G +SHK+D+Y
Sbjct  199   QNILLDHNLNPKICDFGLAKLCSKEKSVVTMTAARGTIGYIAPEVLSRNFGKVSHKSDIY  258

Query  810   SFGMLLMEML-GLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTI  986
             SFGMLL+EM+ G  +      + S      WIY  + KG+ +++  E+E +  I +K+ I
Sbjct  259   SFGMLLLEMVDGRIKMDSKTNNHSKVNSLEWIYRHLEKGEELKIRIEEEGDNTIVRKLAI  318

Query  987   VGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             VGLWCIQ  PI RPS+  V +MLEGD   L +  + F++
Sbjct  319   VGLWCIQWHPIDRPSIKEVTQMLEGDGSHLNLSPNPFMA  357



>ref|XP_010662988.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Vitis 
vinifera]
Length=583

 Score =   457 bits (1175),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 227/311 (73%), Positives = 268/311 (86%), Gaps = 3/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RY++ADIKKIT+   ++LGEGGYG VYKG++S+EILVAVK+LN+ KGNG
Sbjct  248   FLEDYKALKPSRYTYADIKKITSHFKDKLGEGGYGTVYKGKLSNEILVAVKILNNFKGNG  307

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG + +IHH+NVVRLVG+C+DGFRRAL+YE+LPNESLEK+IFS   KN  L W+
Sbjct  308   EEFINEVGTMDRIHHINVVRLVGFCSDGFRRALIYEFLPNESLEKFIFSAVDKNPLLGWE  367

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K++ IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLD N NPKI DFGLAKLCSKE+SAV
Sbjct  368   KLRSIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQSAV  427

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPE++SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T  +    
Sbjct  428   SMTAARGTMGYIAPEMLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---TVENPSGV  484

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYNHL++G ELQIRIEE+ D  IAKKL I+ L CIQW PVDRP+MK VVQMLE E
Sbjct  485   YFPEWVYNHLDQGKELQIRIEEEGDAKIAKKLTIVGLRCIQWYPVDRPTMKTVVQMLEGE  544

Query  1544  GDDLVLPSSPF  1512
             GD+L +P +PF
Sbjct  545   GDNLTMPPNPF  555


 Score =   359 bits (921),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 237/311 (76%), Gaps = 2/311 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RY+Y  IK +T  FK+KLGEGG+G+VYKGKL +   VAVKI++  K
Sbjct  245   IEKFLEDYKALKPSRYTYADIKKITSHFKDKLGEGGYGTVYKGKLSNEILVAVKILNNFK  304

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS-LL  527
              NG++FINEVG+M RIHH+N+VRLVG+C++  + AL+Y+F+PN SL+K+I      + LL
Sbjct  305   GNGEEFINEVGTMDRIHHINVVRLVGFCSDGFRRALIYEFLPNESLEKFIFSAVDKNPLL  364

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++   I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   ++
Sbjct  365   GWEKLRSIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQ  424

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   VT ++ S  
Sbjct  425   SAVSMTAARGTMGYIAPEMLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVTVENPSGV  484

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN +++GK +++  E+E + +I KK+TIVGL CIQ  P+ RP+M  VV+MLEG+
Sbjct  485   YFPEWVYNHLDQGKELQIRIEEEGDAKIAKKLTIVGLRCIQWYPVDRPTMKTVVQMLEGE  544

Query  1065  VELLQMPTDTF  1097
              + L MP + F
Sbjct  545   GDNLTMPPNPF  555



>ref|XP_010662832.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=443

 Score =   452 bits (1162),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 268/314 (85%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ADIK+ITNQ  ++LG+GGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  109   FLEDYEALKPSRYSYADIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQGNG  168

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CADGF+RAL+YEYLPNESLEK+IFS + KN +LSWK
Sbjct  169   EEFINEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSLSWK  228

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCD++ILHFDIKP NILLDHN NP++ DFGLAKLCSKE+SAV
Sbjct  229   KLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFNPRVSDFGLAKLCSKEQSAV  288

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  289   SMTVARGTIGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  345

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE  D  IAKKLAI+ L CIQW P+DRPSMK VVQMLE  
Sbjct  346   YFPEWIYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDRPSMKIVVQMLE-G  404

Query  1544  GDDLVLPSSPFAGS  1503
             G  L +P +PFA +
Sbjct  405   GGKLTMPPNPFAST  418


 Score =   340 bits (871),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 170/323 (53%), Positives = 232/323 (72%), Gaps = 10/323 (3%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL     VAVKI++  +
Sbjct  106   VKRFLEDYEALKPSRYSYADIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQ  165

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I ++      L
Sbjct  166   GNGEEFINEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSL  225

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF P++SDFGLAKL   ++
Sbjct  226   SWKKLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFNPRVSDFGLAKLCSKEQ  285

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGTIGY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  286   SAVSMTVARGTIGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  345

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E++ +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG 
Sbjct  346   YFPEWIYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDRPSMKIVVQMLEGG  405

Query  1065  VELL--------QMPTDTFLSEP  1109
              +L           PT T LS+P
Sbjct  406   GKLTMPPNPFASTTPTKTNLSKP  428



>ref|XP_007036614.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY21115.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=638

 Score =   458 bits (1178),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 223/315 (71%), Positives = 271/315 (86%), Gaps = 3/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYR+++P+RY++ADIK+ITNQ  E+LGEGGYG V+KGR+S+++LVAVKVLN+ KGNG
Sbjct  305   FLEDYRSLKPSRYAYADIKRITNQFKEKLGEGGYGTVFKGRLSNDVLVAVKVLNNFKGNG  364

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG + +IHHVNV RLVG+CADG++RALVYEYLPNESLEK+IFS + ++  L W 
Sbjct  365   EEFINEVGSMSRIHHVNVARLVGFCADGYKRALVYEYLPNESLEKFIFSAKGESHFLGWD  424

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++Q+IALGIAKGIEYLHQGC+Q+ILHFDIKP NILLDHN  PKI DFGLAKLCSKE+SAV
Sbjct  425   ELQDIALGIAKGIEYLHQGCEQRILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQSAV  484

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              MTAARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T  +  + 
Sbjct  485   FMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---TVENTSQV  541

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYNHL++G EL IRIE++    +A+KL+I+ LWCIQW PVDRPSMKAV+QMLE E
Sbjct  542   YFPEWVYNHLDKGEELGIRIEDERQSLVARKLSIVGLWCIQWFPVDRPSMKAVIQMLEGE  601

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P +PFA ++
Sbjct  602   ANSLTMPPNPFASTE  616


 Score =   363 bits (933),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 179/340 (53%), Positives = 245/340 (72%), Gaps = 5/340 (1%)
 Frame = +3

Query  117   IVFLIIKYRRRHLSVFEP---IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             IVF + K  R H +  E    IE FL    +L P RY+Y  IK +T  FKEKLGEGG+G+
Sbjct  281   IVFALYKLYRIHKTKEESQLKIEEFLEDYRSLKPSRYAYADIKRITNQFKEKLGEGGYGT  340

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             V+KG+L +   VAVK+++  K NG++FINEVGSM RIHHVN+ RLVG+CA+  K ALVY+
Sbjct  341   VFKGRLSNDVLVAVKVLNNFKGNGEEFINEVGSMSRIHHVNVARLVGFCADGYKRALVYE  400

Query  468   FMPNGSLDKYI-NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             ++PN SL+K+I +    +  L W    +I +G+A+GIEYLH+GC+ +ILHFDIKPHNILL
Sbjct  401   YLPNESLEKFIFSAKGESHFLGWDELQDIALGIAKGIEYLHQGCEQRILHFDIKPHNILL  460

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D NF PKISDFGLAKL   ++S V +TAARGT+GY+APE+++R  G +S+K+DVYSFGML
Sbjct  461   DHNFTPKISDFGLAKLCSKEQSAVFMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGML  520

Query  825   LMEMLGLNRT-PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  +   VT ++ S  YFP W+YN ++KG+ + +  EDE +  + +K++IVGLWC
Sbjct  521   LLEMVGGRKNIDVTVENTSQVYFPEWVYNHLDKGEELGIRIEDERQSLVARKLSIVGLWC  580

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV  1121
             IQ  P+ RPSM  V++MLEG+   L MP + F S   M++
Sbjct  581   IQWFPVDRPSMKAVIQMLEGEANSLTMPPNPFASTEHMKL  620



>ref|XP_010645762.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Vitis vinifera]
Length=628

 Score =   457 bits (1177),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 220/335 (66%), Positives = 267/335 (80%), Gaps = 3/335 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FLI K+RRR+LS++  IE F+ A NNL PIRYSY +IK MTK F EKLGEGG+GS
Sbjct  271   PCVVIFLIYKWRRRNLSMYHAIEEFIQAQNNLTPIRYSYSNIKKMTKGFMEKLGEGGYGS  330

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG  VAVK+M+  K+NGQDFINEV ++GRIHHVN+V+L+G+CAE SK ALVYD
Sbjct  331   VYKGKLRSGHFVAVKMMANSKANGQDFINEVATIGRIHHVNVVQLIGFCAEGSKRALVYD  390

Query  468   FMPNGSLDKYI--NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNIL  641
             FMPNGSLDKYI   +    SLL+ ++ +EI +GVA GIEYLHRGCD QILHFDIKPHNIL
Sbjct  391   FMPNGSLDKYIFPEKEGNISLLSLEKMYEISLGVAYGIEYLHRGCDTQILHFDIKPHNIL  450

Query  642   LDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGM  821
             LD+NF PK+SDFGLAK +PTD SIV+LTAARGT GY+APEL  + IG +S+KADVYSFGM
Sbjct  451   LDKNFTPKVSDFGLAKSYPTDHSIVSLTAARGTRGYMAPELFYKNIGGVSYKADVYSFGM  510

Query  822   LLMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLW  998
             LLMEM G  +      + SS+ YFPSW+Y   N+GK IEM +  E+ K ++KK+ IV LW
Sbjct  511   LLMEMAGRRKNLNVFAEHSSQIYFPSWVYEQFNEGKDIEMEDATEEGKELSKKLIIVALW  570

Query  999   CIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             CIQ+ P  RPSM++VVEMLEG+VELLQMP    L+
Sbjct  571   CIQLKPSDRPSMNKVVEMLEGNVELLQMPPKPLLT  605


 Score =   334 bits (857),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 229/316 (72%), Gaps = 4/316 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             F++    + P RYS+++IKK+T    E+LGEGGYG VYKG++ S   VAVK++ +SK NG
Sbjct  295   FIQAQNNLTPIRYSYSNIKKMTKGFMEKLGEGGYGSVYKGKLRSGHFVAVKMMANSKANG  354

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVAL-SW  2088
             ++FINEV  IG+IHHVNVV+L+G+CA+G +RALVY+++PN SL+KYIF  +  N++L S 
Sbjct  355   QDFINEVATIGRIHHVNVVQLIGFCAEGSKRALVYDFMPNGSLDKYIFPEKEGNISLLSL  414

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             +K+ EI+LG+A GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAK    + S 
Sbjct  415   EKMYEISLGVAYGIEYLHRGCDTQILHFDIKPHNILLDKNFTPKVSDFGLAKSYPTDHSI  474

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             V++TAARGT GY+APE+  +N G VS+K+DVYSFGMLL+EM G RKN N      +SQ  
Sbjct  475   VSLTAARGTRGYMAPELFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNVF-AEHSSQI-  532

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FP WVY   N G ++++    ++ + ++KKL I+ALWCIQ +P DRPSM  VV+MLE 
Sbjct  533   -YFPSWVYEQFNEGKDIEMEDATEEGKELSKKLIIVALWCIQLKPSDRPSMNKVVEMLEG  591

Query  1547  EGDDLVLPSSPFAGSQ  1500
               + L +P  P    Q
Sbjct  592   NVELLQMPPKPLLTPQ  607



>ref|XP_008232085.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=377

 Score =   448 bits (1153),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 217/333 (65%), Positives = 259/333 (78%), Gaps = 1/333 (0%)
 Frame = +3

Query  126   LIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKL  305
             LI K+RRRH S++  IE+FL ++NN  PIRYSY  IK MT+ FK+KLGEGG+GSV+KGKL
Sbjct  21    LIYKWRRRHFSMYTTIEDFLRSENNFIPIRYSYHDIKRMTRGFKDKLGEGGYGSVFKGKL  80

Query  306   RSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGS  485
             RSG   AVK++ KPK+NGQ+FI+EV ++GRIHHVN+V+LVGYCAE SK ALVYDFMPNGS
Sbjct  81    RSGRFAAVKMLGKPKANGQEFISEVATIGRIHHVNVVQLVGYCAEGSKRALVYDFMPNGS  140

Query  486   LDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPK  665
             LDKYI     +  LN ++ FEI +GVARGI+YLH GCD+QILHFDIKPHNILLD NFIPK
Sbjct  141   LDKYIYSKDESIPLNCKKAFEISLGVARGIKYLHEGCDMQILHFDIKPHNILLDGNFIPK  200

Query  666   ISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGL  845
             ISDFGLAKL+P D SIV+LTAARGT+GY+APEL  + IG +S KADVYSFGMLLMEM   
Sbjct  201   ISDFGLAKLYPVDNSIVSLTAARGTMGYMAPELFYKNIGGVSFKADVYSFGMLLMEMTSR  260

Query  846   NRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIP  1022
              +      + SS+ YFPSW+Y+  N+GK +EMG   E+EK I KKM I  LWCIQM P  
Sbjct  261   RKNLNAFVEHSSQIYFPSWVYDQYNEGKDLEMGNVPEEEKEIMKKMVITALWCIQMKPSD  320

Query  1023  RPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV  1121
             RPSM +V+EMLEG VE L+MP   FL    M V
Sbjct  321   RPSMKKVIEMLEGGVEFLKMPPKPFLCPQEMPV  353


 Score =   333 bits (853),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 174/315 (55%), Positives = 227/315 (72%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL       P RYS+ DIK++T    ++LGEGGYG V+KG++ S    AVK+L   K NG
Sbjct  39    FLRSENNFIPIRYSYHDIKRMTRGFKDKLGEGGYGSVFKGKLRSGRFAAVKMLGKPKANG  98

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFI+EV  IG+IHHVNVV+LVGYCA+G +RALVY+++PN SL+KYI+S + +++ L+ K
Sbjct  99    QEFISEVATIGRIHHVNVVQLVGYCAEGSKRALVYDFMPNGSLDKYIYSKD-ESIPLNCK  157

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K  EI+LG+A+GI+YLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  158   KAFEISLGVARGIKYLHEGCDMQILHFDIKPHNILLDGNFIPKISDFGLAKLYPVDNSIV  217

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGY+APE+  +N G VS K+DVYSFGMLL+EM   RKN NA    + S Q  
Sbjct  218   SLTAARGTMGYMAPELFYKNIGGVSFKADVYSFGMLLMEMTSRRKNLNA--FVEHSSQI-  274

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+  N G +L++    ++++ I KK+ I ALWCIQ +P DRPSMK V++MLE  
Sbjct  275   YFPSWVYDQYNEGKDLEMGNVPEEEKEIMKKMVITALWCIQMKPSDRPSMKKVIEMLEGG  334

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  335   VEFLKMPPKPFLCPQ  349



>ref|XP_007036623.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY21124.1| PR5-like receptor kinase [Theobroma cacao]
Length=413

 Score =   450 bits (1157),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 209/331 (63%), Positives = 261/331 (79%), Gaps = 1/331 (0%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C I  ++IK+RRRHLS+ + IE FL   NNL PIRYSY  +K MTK FK+KLG+GG+GSV
Sbjct  47    CLIAAVLIKFRRRHLSMDDTIEEFLQMQNNLMPIRYSYSEVKKMTKCFKDKLGQGGYGSV  106

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             +KG LRSG  VA+K+++  KS+GQDFINEV ++GRIHHVN+V+L+G+C E SK ALVYDF
Sbjct  107   FKGTLRSGRLVAIKLLNMSKSHGQDFINEVATIGRIHHVNVVQLIGFCVEGSKQALVYDF  166

Query  471   MPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             MPNGSLDK I  G   + L W++ FEI +GVARGIEYLH+GC +QILHFDIKPHNILLDE
Sbjct  167   MPNGSLDKIIFSGERDTTLCWEKIFEIAIGVARGIEYLHQGCQMQILHFDIKPHNILLDE  226

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NF PKISDFGLAKL+  D SIV+LTAARGT+GY+APEL  + IG+ISHK DVYSFGMLLM
Sbjct  227   NFTPKISDFGLAKLYAVDHSIVSLTAARGTLGYIAPELFYKNIGSISHKVDVYSFGMLLM  286

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  R      ++SS+ YFPSWIY+  +K + IE+G+  E+EK+  +KM I   WCIQ
Sbjct  287   EMVGKRRNLNAFAEQSSQIYFPSWIYDRFDKEEDIELGDVTENEKKTVRKMVITAFWCIQ  346

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             + P  RPS+S+V+EMLEG+VE L++P   FL
Sbjct  347   IKPTDRPSISKVLEMLEGEVEPLELPAKPFL  377


 Score =   342 bits (876),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 231/311 (74%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS++++KK+T    ++LG+GGYG V+KG + S  LVA+K+LN SK +G
Sbjct  70    FLQMQNNLMPIRYSYSEVKKMTKCFKDKLGQGGYGSVFKGTLRSGRLVAIKLLNMSKSHG  129

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+G+C +G ++ALVY+++PN SL+K IFS E ++  L W+
Sbjct  130   QDFINEVATIGRIHHVNVVQLIGFCVEGSKQALVYDFMPNGSLDKIIFSGE-RDTTLCWE  188

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             KI EIA+G+A+GIEYLHQGC  QILHFDIKP NILLD N  PKI DFGLAKL + + S V
Sbjct  189   KIFEIAIGVARGIEYLHQGCQMQILHFDIKPHNILLDENFTPKISDFGLAKLYAVDHSIV  248

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G +SHK DVYSFGMLL+EMVG R+N NA     +SQ   
Sbjct  249   SLTAARGTLGYIAPELFYKNIGSISHKVDVYSFGMLLMEMVGKRRNLNAF-AEQSSQI--  305

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++  ++++    ++++   +K+ I A WCIQ +P DRPS+  V++MLE E
Sbjct  306   YFPSWIYDRFDKEEDIELGDVTENEKKTVRKMVITAFWCIQIKPTDRPSISKVLEMLEGE  365

Query  1544  GDDLVLPSSPF  1512
              + L LP+ PF
Sbjct  366   VEPLELPAKPF  376



>ref|XP_002268153.3| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X3 [Vitis vinifera]
Length=593

 Score =   456 bits (1173),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 266/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY  ++P+RYS+ADIK+IT+Q  ++LGEGGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  260   FLEDYETLKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQGNG  319

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F RAL+YEYLPNESLEK+IFS   KN +L+WK
Sbjct  320   EEFINEVATMGTIHHVNIVRLVGFCADRFERALIYEYLPNESLEKFIFSKVVKNYSLNWK  379

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  380   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  439

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  440   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  496

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRI+E+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  497   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  556

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  557   GDKLTMPPNPFAST  570


 Score =   347 bits (890),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLGEGG+G+VYKGKL     VAVKI++  +
Sbjct  257   VKKFLEDYETLKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQ  316

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  + AL+Y+++PN SL+K+I      +  L
Sbjct  317   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFERALIYEYLPNESLEKFIFSKVVKNYSL  376

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             NW++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  377   NWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  436

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  437   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  496

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  ++E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  497   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  556

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  557   GDKLTMPPNPFAS  569



>ref|XP_010662812.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=611

 Score =   456 bits (1174),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 266/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY  ++P+RYS+ADIK+IT+Q  ++LGEGGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  278   FLEDYETLKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQGNG  337

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F RAL+YEYLPNESLEK+IFS   KN +L+WK
Sbjct  338   EEFINEVATMGTIHHVNIVRLVGFCADRFERALIYEYLPNESLEKFIFSKVVKNYSLNWK  397

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  398   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  457

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  458   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  514

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRI+E+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  515   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  574

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  575   GDKLTMPPNPFAST  588


 Score =   347 bits (891),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLGEGG+G+VYKGKL     VAVKI++  +
Sbjct  275   VKKFLEDYETLKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQ  334

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  + AL+Y+++PN SL+K+I      +  L
Sbjct  335   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFERALIYEYLPNESLEKFIFSKVVKNYSL  394

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             NW++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  395   NWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  454

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  455   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  514

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  ++E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  515   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  574

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  575   GDKLTMPPNPFAS  587



>ref|XP_010662813.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=602

 Score =   456 bits (1173),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 227/314 (72%), Positives = 266/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY  ++P+RYS+ADIK+IT+Q  ++LGEGGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  269   FLEDYETLKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F RAL+YEYLPNESLEK+IFS   KN +L+WK
Sbjct  329   EEFINEVATMGTIHHVNIVRLVGFCADRFERALIYEYLPNESLEKFIFSKVVKNYSLNWK  388

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  389   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  448

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  449   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  505

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRI+E+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  506   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  565

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  566   GDKLTMPPNPFAST  579


 Score =   347 bits (890),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLGEGG+G+VYKGKL     VAVKI++  +
Sbjct  266   VKKFLEDYETLKPSRYSYADIKRITSQFKDKLGEGGYGTVYKGKLSDEVFVAVKILNNSQ  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  + AL+Y+++PN SL+K+I      +  L
Sbjct  326   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFERALIYEYLPNESLEKFIFSKVVKNYSL  385

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             NW++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  386   NWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  445

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  446   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  505

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  ++E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  506   YFPEWIYNHLDIGEELHIRIKEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  565

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  566   GDKLTMPPNPFAS  578



>ref|XP_010662835.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=593

 Score =   456 bits (1172),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 228/314 (73%), Positives = 266/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ADIK+I +Q  ++LGE GYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  260   FLEDYEALKPSRYSYADIKRIASQFKDKLGEEGYGTVYKGKLSDEVFVAVKILNNSQGNG  319

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  320   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWK  379

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  380   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  439

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    + T   + 
Sbjct  440   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTT---QL  496

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  497   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  556

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  557   GDKLTMPPNPFAST  570


 Score =   342 bits (877),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 227/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +   FK+KLGE G+G+VYKGKL     VAVKI++  +
Sbjct  257   VKKFLEDYEALKPSRYSYADIKRIASQFKDKLGEEGYGTVYKGKLSDEVFVAVKILNNSQ  316

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  317   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSL  376

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  377   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  436

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  +  
Sbjct  437   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTTQL  496

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  497   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  556

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  557   GDKLTMPPNPFAS  569



>emb|CBI23135.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   452 bits (1163),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 222/316 (70%), Positives = 269/316 (85%), Gaps = 8/316 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+AD+KKIT+Q  ++LG+G YG VYKG++S+E+ VAVK+LNDSKGNG
Sbjct  159   FLEDYRALKPSRYSYADMKKITHQFKDKLGQGAYGTVYKGKLSNEVFVAVKILNDSKGNG  218

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  +G IHHV+VVRLVG+CAD F+RAL+YE+LPNESLEK+IF    KN +L W 
Sbjct  219   DEFINEVATMGTIHHVHVVRLVGFCADRFKRALIYEFLPNESLEKFIFPKNGKNHSLGWL  278

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLHQGCD++ILHFDIKP NILLDHN  PKI DFGLAKLCSKE+S V
Sbjct  279   KLQDIALGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQSVV  338

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV+SRNFG +++KSDVYSFGMLLLEMVGGRKN +      T ++ G
Sbjct  339   SMTTARGTIGYIAPEVLSRNFGNITYKSDVYSFGMLLLEMVGGRKNIDV-----TMEKTG  393

Query  1724  S--FPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FPEWVYNHL++G EL IRIEE+ D  IAKKL I+ LWCIQW P+DRPSMKAVVQMLE
Sbjct  394   QVYFPEWVYNHLDQGEELHIRIEEEGDAKIAKKLTIVGLWCIQWYPIDRPSMKAVVQMLE  453

Query  1550  REGDDLVLPSSPFAGS  1503
             RE D+L++P +PF  +
Sbjct  454   RE-DNLIMPPNPFTAT  468


 Score =   349 bits (895),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 230/317 (73%), Gaps = 2/317 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  +K +T  FK+KLG+G +G+VYKGKL +   VAVKI++  K
Sbjct  156   IEKFLEDYRALKPSRYSYADMKKITHQFKDKLGQGAYGTVYKGKLSNEVFVAVKILNDSK  215

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG +FINEV +MG IHHV++VRLVG+CA+  K AL+Y+F+PN SL+K+I  +      L
Sbjct  216   GNGDEFINEVATMGTIHHVHVVRLVGFCADRFKRALIYEFLPNESLEKFIFPKNGKNHSL  275

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W +  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  276   GWLKLQDIALGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQ  335

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S+V++T ARGTIGY+APE+++R  G I++K+DVYSFGMLL+EM+G  +   VT +     
Sbjct  336   SVVSMTTARGTIGYIAPEVLSRNFGNITYKSDVYSFGMLLLEMVGGRKNIDVTMEKTGQV  395

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN +++G+ + +  E+E + +I KK+TIVGLWCIQ  PI RPSM  VV+MLE +
Sbjct  396   YFPEWVYNHLDQGEELHIRIEEEGDAKIAKKLTIVGLWCIQWYPIDRPSMKAVVQMLERE  455

Query  1065  VELLQMPTDTFLSEPIM  1115
               L+  P     ++ IM
Sbjct  456   DNLIMPPNPFTATDRIM  472



>ref|XP_011037147.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Populus 
euphratica]
Length=423

 Score =   449 bits (1155),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 209/334 (63%), Positives = 267/334 (80%), Gaps = 2/334 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC IVFLI K+RRRHLSV++ +E FL   NNL P+RYSY  I+ +T+ FK+KLGEGGFG+
Sbjct  60    PCVIVFLIYKWRRRHLSVYDTVEQFLQGQNNLMPVRYSYSDIRKITRGFKDKLGEGGFGT  119

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG   AVK++ K K+NGQDFINEV ++GRIHH N+VRL+G+CAE SK ALVYD
Sbjct  120   VYKGKLRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHTNVVRLIGFCAEGSKRALVYD  179

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLD+++     +  L+WQ+  +I +GVARGI+YLH GCD+QILHFDIKPHNILLD
Sbjct  180   FMPNGSLDRHLFSREGSISLSWQKLHQISLGVARGIDYLHLGCDMQILHFDIKPHNILLD  239

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLA+L+PT+ SI +LTAARGTIGY+APEL  + IG +S+KADVYSFGMLL
Sbjct  240   ENFTPKVSDFGLARLYPTNGSITSLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLL  299

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             +EM G  +      + SS+ Y+P W+++ ++ GKAIE+G++  E+E +I KKM +VGLWC
Sbjct  300   LEMAGKRKNVNALAENSSQIYWPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGLWC  359

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             IQM P+ RP+M  VVEMLEGD+E LQ+P    L+
Sbjct  360   IQMKPMDRPTMKNVVEMLEGDLENLQLPPKPVLN  393


 Score =   334 bits (857),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 233/311 (75%), Gaps = 5/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS++DI+KIT    ++LGEGG+G VYKG++ S    AVK+L  SK NG
Sbjct  84    FLQGQNNLMPVRYSYSDIRKITRGFKDKLGEGGFGTVYKGKLRSGRFAAVKLLGKSKANG  143

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHH NVVRL+G+CA+G +RALVY+++PN SL++++FS E  +++LSW+
Sbjct  144   QDFINEVATIGRIHHTNVVRLIGFCAEGSKRALVYDFMPNGSLDRHLFSREG-SISLSWQ  202

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +I+LG+A+GI+YLH GCD QILHFDIKP NILLD N  PK+ DFGLA+L     S  
Sbjct  203   KLHQISLGVARGIDYLHLGCDMQILHFDIKPHNILLDENFTPKVSDFGLARLYPTNGSIT  262

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  +N G+VS+K+DVYSFGMLLLEM G RKN NA    ++SQ   
Sbjct  263   SLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLLLEMAGKRKNVNAL-AENSSQI--  319

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +P WV++ ++ G  ++I     +++  I KK+ ++ LWCIQ +P+DRP+MK VV+MLE 
Sbjct  320   YWPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGLWCIQMKPMDRPTMKNVVEMLEG  379

Query  1547  EGDDLVLPSSP  1515
             + ++L LP  P
Sbjct  380   DLENLQLPPKP  390



>ref|XP_010662995.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=612

 Score =   456 bits (1172),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 230/314 (73%), Positives = 271/314 (86%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DY A++P+RYS++DIK+ITNQ  ++LG+GGYGIVYKG++S E+ VAVK+LN+S+GNG
Sbjct  275   FLQDYEALKPSRYSYSDIKRITNQFKDKLGQGGYGIVYKGKLSHEVFVAVKILNNSQGNG  334

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVNVVRLVG+CADGF+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  335   EEFINEVATMGTIHHVNVVRLVGFCADGFKRALIYEYLPNESLEKFIFSRAVKNYSLSWK  394

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  395   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  454

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAP+V+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  455   SMTIARGTIGYIAPKVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  511

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  512   YFPEWIYNHLDHGEELLIRIEEEIDAKIAKKLAIVGLSCIQWYPVDRPSMKIVVQMLEGE  571

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  572   GDKLTMPPNPFAST  585


 Score =   342 bits (878),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 231/313 (74%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLG+GG+G VYKGKL     VAVKI++  +
Sbjct  272   VKKFLQDYEALKPSRYSYSDIKRITNQFKDKLGQGGYGIVYKGKLSHEVFVAVKILNNSQ  331

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVN+VRLVG+CA+  K AL+Y+++PN SL+K+I   A  +  L
Sbjct  332   GNGEEFINEVATMGTIHHVNVVRLVGFCADGFKRALIYEYLPNESLEKFIFSRAVKNYSL  391

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  392   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  451

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGTIGY+AP++++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  452   SAVSMTIARGTIGYIAPKVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  511

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E + +I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  512   YFPEWIYNHLDHGEELLIRIEEEIDAKIAKKLAIVGLSCIQWYPVDRPSMKIVVQMLEGE  571

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  572   GDKLTMPPNPFAS  584



>ref|XP_010662810.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=597

 Score =   455 bits (1170),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 226/314 (72%), Positives = 266/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ D+K+IT+Q  ++LG+GGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  264   FLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQGNG  323

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN  LSWK
Sbjct  324   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSRVVKNYTLSWK  383

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCD++ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  384   KLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  443

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  444   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  500

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  501   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  560

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  561   GDKLTMPPNPFAST  574


 Score =   346 bits (887),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  +K +T  FK+KLG+GG+G+VYKGKL     VAVKI++  +
Sbjct  261   VKKFLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQ  320

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS-LL  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  321   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSRVVKNYTL  380

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  381   SWKKLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  440

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  441   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  500

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  501   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  560

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  561   GDKLTMPPNPFAS  573



>ref|XP_010662809.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=599

 Score =   455 bits (1170),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 226/314 (72%), Positives = 266/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ D+K+IT+Q  ++LG+GGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  266   FLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQGNG  325

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN  LSWK
Sbjct  326   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSRVVKNYTLSWK  385

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCD++ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  386   KLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  445

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  446   SMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  502

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW PVDRPSMK VVQMLE E
Sbjct  503   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  562

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  563   GDKLTMPPNPFAST  576


 Score =   346 bits (888),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  +K +T  FK+KLG+GG+G+VYKGKL     VAVKI++  +
Sbjct  263   VKKFLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQ  322

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS-LL  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  323   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSRVVKNYTL  382

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  383   SWKKLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  442

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  443   SAVSMTIVRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  502

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  503   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPVDRPSMKIVVQMLEGE  562

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  563   GDKLTMPPNPFAS  575



>ref|XP_002279967.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=597

 Score =   454 bits (1169),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 223/313 (71%), Positives = 266/313 (85%), Gaps = 3/313 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RYS+ADIKKITN   E+LG+GGYG VYKGR+SS++LVAVK+LN+SK NG
Sbjct  261   FLEDYKALKPSRYSYADIKKITNHFKEKLGQGGYGTVYKGRLSSDVLVAVKILNNSKENG  320

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G+IHHVNVVRLVG+CADG +RALVYE+LPNESLEKYIFS   K+ +LSW+
Sbjct  321   EEFINEVATMGRIHHVNVVRLVGFCADGVKRALVYEFLPNESLEKYIFSKSIKDCSLSWE  380

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K++ +ALGIAKGIEYLHQGCD++ILHFDIKP NILLD N NPKI DFGLAKLCSKE+SAV
Sbjct  381   KLRNVALGIAKGIEYLHQGCDKRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQSAV  440

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV+SRNFG VS+KSD+YSFGMLLLEMVGGRKN +    T     + 
Sbjct  441   SMTTARGTMGYIAPEVLSRNFGNVSYKSDIYSFGMLLLEMVGGRKNIDV---TMEKTSQV  497

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G ++ IRI ED D  IAKKL I+ LWCIQW P+DRPSMK V+QMLE  
Sbjct  498   YFPEWVYNQLDQGEDVCIRIVEDGDTKIAKKLTIVGLWCIQWYPIDRPSMKVVIQMLEGG  557

Query  1544  GDDLVLPSSPFAG  1506
             G++L +P +PFA 
Sbjct  558   GNNLTMPPNPFAS  570


 Score =   363 bits (933),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 234/313 (75%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FKEKLG+GG+G+VYKG+L S   VAVKI++  K
Sbjct  258   IEQFLEDYKALKPSRYSYADIKKITNHFKEKLGQGGYGTVYKGRLSSDVLVAVKILNNSK  317

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEV +MGRIHHVN+VRLVG+CA+  K ALVY+F+PN SL+KYI ++      L
Sbjct  318   ENGEEFINEVATMGRIHHVNVVRLVGFCADGVKRALVYEFLPNESLEKYIFSKSIKDCSL  377

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++   + +G+A+GIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   ++
Sbjct  378   SWEKLRNVALGIAKGIEYLHQGCDKRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQ  437

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGT+GY+APE+++R  G +S+K+D+YSFGMLL+EM+G  +   VT +  S  
Sbjct  438   SAVSMTTARGTMGYIAPEVLSRNFGNVSYKSDIYSFGMLLLEMVGGRKNIDVTMEKTSQV  497

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN +++G+ + +   ++ + +I KK+TIVGLWCIQ  PI RPSM  V++MLEG 
Sbjct  498   YFPEWVYNQLDQGEDVCIRIVEDGDTKIAKKLTIVGLWCIQWYPIDRPSMKVVIQMLEGG  557

Query  1065  VELLQMPTDTFLS  1103
                L MP + F S
Sbjct  558   GNNLTMPPNPFAS  570



>ref|XP_008245765.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=406

 Score =   447 bits (1150),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 213/336 (63%), Positives = 263/336 (78%), Gaps = 5/336 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P     LI K+RRRHLS++E IE+FL ++NNL PIRYSY  IK M + FK+KLGEGG+GS
Sbjct  32    PLVTALLIYKWRRRHLSMYENIEDFLRSNNNLMPIRYSYSDIKKMARGFKDKLGEGGYGS  91

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ K K+ GQDFINEVG++GRI HVN+VRL+G+C + SK ALVYD
Sbjct  92    VYKAKLRSGRLVAIKMLGKSKTKGQDFINEVGTIGRIRHVNVVRLIGFCVDGSKRALVYD  151

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FM NGSL+KYI        L+ Q+ FEI +GVARGI+YLHRGCD+QILHFDIKPHNILLD
Sbjct  152   FMSNGSLEKYIFSQQGDVSLSCQKTFEIALGVARGIDYLHRGCDMQILHFDIKPHNILLD  211

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLAKL+P D SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  212   ENFTPKVSDFGLAKLYPLDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLL  271

Query  828   MEMLGLNRTPVTEQDESSK----YFPSWIYNDINKGKAIEMGEEDED-EKRITKKMTIVG  992
             MEM G  +      ++SS+    YFP+W+ + +  GK IE+G++  D EK+I KKM +V 
Sbjct  272   MEMAGRRKNLNAGIEQSSQFSQIYFPTWVSDQLKAGKNIEIGDDATDEEKKIIKKMMMVA  331

Query  993   LWCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             LWCIQM PI RPSM++VVEMLEG++E LQMP   FL
Sbjct  332   LWCIQMKPIERPSMNKVVEMLEGEIESLQMPPRPFL  367


 Score =   340 bits (873),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 175/316 (55%), Positives = 228/316 (72%), Gaps = 2/316 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL     + P RYS++DIKK+     ++LGEGGYG VYK ++ S  LVA+K+L  SK  G
Sbjct  56    FLRSNNNLMPIRYSYSDIKKMARGFKDKLGEGGYGSVYKAKLRSGRLVAIKMLGKSKTKG  115

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEVG IG+I HVNVVRL+G+C DG +RALVY+++ N SLEKYIFS +  +V+LS +
Sbjct  116   QDFINEVGTIGRIRHVNVVRLIGFCVDGSKRALVYDFMSNGSLEKYIFSQQG-DVSLSCQ  174

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K  EIALG+A+GI+YLH+GCD QILHFDIKP NILLD N  PK+ DFGLAKL   + S V
Sbjct  175   KTFEIALGVARGIDYLHRGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPLDNSIV  234

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGYIAPE+  +N G VS+K+DVYSFGMLL+EM G RKN NA     +   + 
Sbjct  235   SLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNAGIEQSSQFSQI  294

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP WV + L  G  ++I     D+++ I KK+ ++ALWCIQ +P++RPSM  VV+MLE 
Sbjct  295   YFPTWVSDQLKAGKNIEIGDDATDEEKKIIKKMMMVALWCIQMKPIERPSMNKVVEMLEG  354

Query  1547  EGDDLVLPSSPFAGSQ  1500
             E + L +P  PF   Q
Sbjct  355   EIESLQMPPRPFLYPQ  370



>ref|XP_009796758.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana sylvestris]
Length=426

 Score =   448 bits (1152),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 228/314 (73%), Positives = 261/314 (83%), Gaps = 6/314 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA+RPTRY++AD+KK+TN   ERLGEG YG+VYKG +S+EI VAVKVLNDS GNG
Sbjct  92    FLEDYRALRPTRYTYADLKKVTNLFQERLGEGAYGVVYKGTLSNEIHVAVKVLNDSIGNG  151

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKN-VALSW  2088
             EEFINEV  +GKIHH NVVRLVGYCADGFR ALVYEYLPN++L+K IF   SK+ + L+W
Sbjct  152   EEFINEVAAMGKIHHFNVVRLVGYCADGFRNALVYEYLPNQTLDKLIFPASSKDRIILNW  211

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             KK+Q+IA+GI KG+EYLHQGCDQQILHFDIKP NILLDHN+NPKI DFGLAKLCSKEKS 
Sbjct  212   KKLQDIAMGIGKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKEKSV  271

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VTMT ARGTMGYIAPEV+S NFGK SHKSDVYSFGM+L EMVGGRKNF+AK     S  +
Sbjct  272   VTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLHEMVGGRKNFDAK----ASNSQ  327

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +FPEW++  LN G EL+IRIEEDDD  I +KLAII LWCIQW   DRPS+K V QMLE 
Sbjct  328   VNFPEWIHQQLNEGEELKIRIEEDDDIIIVRKLAIIGLWCIQWNATDRPSIKVVTQMLEG  387

Query  1547  EGDDLVLPSSPFAG  1506
             +G +L +P  PF  
Sbjct  388   DGSNLTIP-PPFTA  400


 Score =   327 bits (839),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 217/307 (71%), Gaps = 2/307 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL     L P RY+Y  +K +T  F+E+LGEG +G VYKG L +   VAVK+++   
Sbjct  89    VEKFLEDYRALRPTRYTYADLKKVTNLFQERLGEGAYGVVYKGTLSNEIHVAVKVLNDSI  148

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEV +MG+IHH N+VRLVGYCA+  ++ALVY+++PN +LDK I   +     +
Sbjct  149   GNGEEFINEVAAMGKIHHFNVVRLVGYCADGFRNALVYEYLPNQTLDKLIFPASSKDRII  208

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             LNW++  +I +G+ +G+EYLH+GCD QILHFDIKP NILLD N  PKISDFGLAKL   +
Sbjct  209   LNWKKLQDIAMGIGKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKE  268

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             KS+VT+T ARGT+GY+APE+++   G  SHK+DVYSFGM+L EM+G  +    +   S  
Sbjct  269   KSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLHEMVGGRKNFDAKASNSQV  328

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
              FP WI+  +N+G+ +++  E++D+  I +K+ I+GLWCIQ +   RPS+  V +MLEGD
Sbjct  329   NFPEWIHQQLNEGEELKIRIEEDDDIIIVRKLAIIGLWCIQWNATDRPSIKVVTQMLEGD  388

Query  1065  VELLQMP  1085
                L +P
Sbjct  389   GSNLTIP  395



>ref|XP_010662458.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Vitis 
vinifera]
Length=607

 Score =   454 bits (1169),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 216/334 (65%), Positives = 269/334 (81%), Gaps = 2/334 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FLI K+RRR+LS++  IE F+ A NNL PIRYSY +IK MTK FKEKLGEGG+GS
Sbjct  251   PCVLIFLIYKWRRRNLSMYHAIEEFIQAQNNLTPIRYSYSNIKKMTKGFKEKLGEGGYGS  310

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG  VAVK+M+  K+NGQDFINEV ++GRIHHVN+V+L+G+C E SK  L+YD
Sbjct  311   VYKGKLRSGHLVAVKMMASSKANGQDFINEVATIGRIHHVNVVQLIGFCVEGSKRVLLYD  370

Query  468   FMPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSLDKYI      ++ L+ ++ +EI +GVA GIEYLHRGCD QILHFDIKPHNILL
Sbjct  371   FMPNGSLDKYIFPEKEGNISLSLEKMYEISLGVAHGIEYLHRGCDTQILHFDIKPHNILL  430

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D+NF PK+SDFGLAK +P D SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGML
Sbjct  431   DKNFTPKVSDFGLAKSYPIDHSIVSLTAARGTMGYMAPELFYKNIGGVSYKADVYSFGML  490

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             LMEM G  +      + SS+ YFPSW+Y+  +KGK IEM +  E+ K+++KK+ IV LWC
Sbjct  491   LMEMAGRRKNLNVFAEHSSQIYFPSWVYDQFSKGKDIEMEDATEEGKKLSKKLIIVALWC  550

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             IQ+ P  RPSM++VVEMLEG+VELLQMP + FL+
Sbjct  551   IQLKPSDRPSMNKVVEMLEGNVELLQMPPNPFLT  584


 Score =   340 bits (871),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 232/315 (74%), Gaps = 3/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             F++    + P RYS+++IKK+T    E+LGEGGYG VYKG++ S  LVAVK++  SK NG
Sbjct  275   FIQAQNNLTPIRYSYSNIKKMTKGFKEKLGEGGYGSVYKGKLRSGHLVAVKMMASSKANG  334

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+G+C +G +R L+Y+++PN SL+KYIF  +  N++LS +
Sbjct  335   QDFINEVATIGRIHHVNVVQLIGFCVEGSKRVLLYDFMPNGSLDKYIFPEKEGNISLSLE  394

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAK    + S V
Sbjct  395   KMYEISLGVAHGIEYLHRGCDTQILHFDIKPHNILLDKNFTPKVSDFGLAKSYPIDHSIV  454

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGY+APE+  +N G VS+K+DVYSFGMLL+EM G RKN N      +SQ   
Sbjct  455   SLTAARGTMGYMAPELFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNVF-AEHSSQI--  511

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+  ++G ++++    ++ + ++KKL I+ALWCIQ +P DRPSM  VV+MLE  
Sbjct  512   YFPSWVYDQFSKGKDIEMEDATEEGKKLSKKLIIVALWCIQLKPSDRPSMNKVVEMLEGN  571

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P +PF   Q
Sbjct  572   VELLQMPPNPFLTPQ  586



>ref|XP_002513561.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF48964.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=394

 Score =   446 bits (1148),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/333 (65%), Positives = 262/333 (79%), Gaps = 2/333 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I FL  K+RRRHLS+++ +E FL + NNL PI YSY  IK + + FK+KLGEGGFGS
Sbjct  27    PCVIAFLAYKWRRRHLSMYDKVEAFLRSHNNLMPIMYSYSDIKKIIRGFKDKLGEGGFGS  86

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL SG  VAVKI+SKPKS+GQDFINEV ++GRIHHVN+V+L+G+CAE SK ALVYD
Sbjct  87    VYKGKLSSGRIVAVKILSKPKSDGQDFINEVATIGRIHHVNVVQLIGFCAERSKRALVYD  146

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KYI        L+ ++ ++I +G ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  147   FMPNGSLEKYIFSENGDVPLSCEQMYKISLGTARGIEYLHRGCDMQILHFDIKPHNILLD  206

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLAKL+P + SIV+LTA RGT+GY+APEL  + IG IS+KADVYSFGMLL
Sbjct  207   ENFAPKVSDFGLAKLYPIEGSIVSLTAPRGTMGYMAPELFYKNIGGISYKADVYSFGMLL  266

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  +      + SS+ YFPSW+Y  +N G  IE+ E   +E++ITKKM IV L CI
Sbjct  267   MEMAGRRKNLNAFAEHSSQIYFPSWVYEQLNAGNEIEI-ENATEERKITKKMMIVALCCI  325

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             QM P  RPSM+RVVEMLEG+VE LQMP   FLS
Sbjct  326   QMKPGDRPSMNRVVEMLEGEVESLQMPPKPFLS  358


 Score =   336 bits (861),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 176/315 (56%), Positives = 230/315 (73%), Gaps = 5/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL  +  + P  YS++DIKKI     ++LGEGG+G VYKG++SS  +VAVK+L+  K +G
Sbjct  51    FLRSHNNLMPIMYSYSDIKKIIRGFKDKLGEGGFGSVYKGKLSSGRIVAVKILSKPKSDG  110

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+G+CA+  +RALVY+++PN SLEKYIFS E+ +V LS +
Sbjct  111   QDFINEVATIGRIHHVNVVQLIGFCAERSKRALVYDFMPNGSLEKYIFS-ENGDVPLSCE  169

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +I+LG A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAKL   E S V
Sbjct  170   QMYKISLGTARGIEYLHRGCDMQILHFDIKPHNILLDENFAPKVSDFGLAKLYPIEGSIV  229

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TA RGTMGY+APE+  +N G +S+K+DVYSFGMLL+EM G RKN NA     +SQ   
Sbjct  230   SLTAPRGTMGYMAPELFYKNIGGISYKADVYSFGMLLMEMAGRRKNLNAF-AEHSSQI--  286

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY  LN G E++I     ++  I KK+ I+AL CIQ +P DRPSM  VV+MLE E
Sbjct  287   YFPSWVYEQLNAGNEIEIE-NATEERKITKKMMIVALCCIQMKPGDRPSMNRVVEMLEGE  345

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  346   VESLQMPPKPFLSPQ  360



>gb|EYU21060.1| hypothetical protein MIMGU_mgv1a021494mg, partial [Erythranthe 
guttata]
Length=588

 Score =   453 bits (1166),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 218/337 (65%), Positives = 270/337 (80%), Gaps = 11/337 (3%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P   V LIIK+R+RHLS+F  IE FL ++ +L  IRYSY  I+ MT+ F+EKLGEGG GS
Sbjct  248   PSLFVLLIIKFRKRHLSLFSTIEAFLQSNTSLTTIRYSYSDIRKMTRGFREKLGEGGCGS  307

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK+++K ++NGQ+FINEV ++GRIHHVN+V+LVGYCAE SK ALVYD
Sbjct  308   VYKGKLRSGHDVAVKLLNKTRANGQEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYD  367

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KY+     ++ L+  RKFEI VGVARGIEYLH GC+IQILHFDIKPHNILLD
Sbjct  368   FMPNGSLEKYLFSNGTSNWLSLARKFEIAVGVARGIEYLHIGCNIQILHFDIKPHNILLD  427

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PKISDFGLAK + T+ + VTLTA RGTIGYVAPEL+NR IG +S+KADVYSFGMLL
Sbjct  428   DNFTPKISDFGLAKSYSTENTTVTLTAVRGTIGYVAPELMNRSIGRVSYKADVYSFGMLL  487

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMG-----------EEDEDEKRITK  974
             MEMLGLNR      ++SS+YFP WIY+ +N+G  IE+G           ++D++ +++ +
Sbjct  488   MEMLGLNRGARHNDNKSSQYFPYWIYDHLNEGNDIEIGNADKNDYDNDDDDDDNARKMRR  547

Query  975   KMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             KMTIVGLWCIQMSP  RPSMS V++ML G++E LQ+P
Sbjct  548   KMTIVGLWCIQMSPTDRPSMSEVLKMLHGEIENLQIP  584


 Score =   325 bits (833),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 169/321 (53%), Positives = 229/321 (71%), Gaps = 16/321 (5%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+   ++   RYS++DI+K+T    E+LGEGG G VYKG++ S   VAVK+LN ++ NG
Sbjct  272   FLQSNTSLTTIRYSYSDIRKMTRGFREKLGEGGCGSVYKGKLRSGHDVAVKLLNKTRANG  331

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVV+LVGYCA+  +RALVY+++PN SLEKY+FS  + N  LS  
Sbjct  332   QEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYDFMPNGSLEKYLFSNGTSN-WLSLA  390

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIA+G+A+GIEYLH GC+ QILHFDIKP NILLD N  PKI DFGLAK  S E + V
Sbjct  391   RKFEIAVGVARGIEYLHIGCNIQILHFDIKPHNILLDDNFTPKISDFGLAKSYSTENTTV  450

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G+VS+K+DVYSFGMLL+EM+G   N  A+   + S Q  
Sbjct  451   TLTAVRGTIGYVAPELMNRSIGRVSYKADVYSFGMLLMEMLG--LNRGARHNDNKSSQY-  507

Query  1724  SFPEWVYNHLNRGGELQI-----------RieedddeaiakklaiiaLWCIQWQPVDRPS  1578
              FP W+Y+HLN G +++I             ++D+   + +K+ I+ LWCIQ  P DRPS
Sbjct  508   -FPYWIYDHLNEGNDIEIGNADKNDYDNDDDDDDNARKMRRKMTIVGLWCIQMSPTDRPS  566

Query  1577  MKAVVQMLEREGDDLVLPSSP  1515
             M  V++ML  E ++L +P  P
Sbjct  567   MSEVLKMLHGEIENLQIPPQP  587



>ref|XP_002513566.1| receptor serine/threonine kinase, putative [Ricinus communis]
 gb|EEF48969.1| receptor serine/threonine kinase, putative [Ricinus communis]
Length=493

 Score =   450 bits (1157),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 264/314 (84%), Gaps = 5/314 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P RY ++DIK+ITN   ++LG+G YG V+KG +SSEI VAVKVLN+S G+G
Sbjct  153   FLGDYKALKPARYLYSDIKRITNHFKDKLGQGAYGSVFKGSLSSEIFVAVKVLNNSAGDG  212

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
              EFINEVG +GKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEK+IFS + K++ L W+
Sbjct  213   TEFINEVGTMGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKFIFSNDEKDIPLGWE  272

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLD N NPKI DFGLAKLCSK++SA+
Sbjct  273   KLRDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQSAI  332

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS+KSDVYSFGM+LL+MV GRKN +  +G+       
Sbjct  333   SMTTARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMVLLDMVRGRKNIDFADGSQV-----  387

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G EL+IRI+E +DE IAKKL  + LWCIQW P+DRPSMKAVVQMLE E
Sbjct  388   YFPEWVYNRLDQGEELRIRIKEVNDEKIAKKLIFVGLWCIQWNPMDRPSMKAVVQMLEGE  447

Query  1544  GDDLVLPSSPFAGS  1503
             G+ L +P +PF  +
Sbjct  448   GNKLTMPPNPFGSA  461


 Score =   345 bits (885),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/312 (53%), Positives = 228/312 (73%), Gaps = 2/312 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RY Y  IK +T  FK+KLG+G +GSV+KG L S   VAVK+++   
Sbjct  150   IEKFLGDYKALKPARYLYSDIKRITNHFKDKLGQGAYGSVFKGSLSSEIFVAVKVLNNSA  209

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              +G +FINEVG+MG+IHHVN+VRLVGYCA+  + ALVY+++PN SL+K+I       + L
Sbjct  210   GDGTEFINEVGTMGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKFIFSNDEKDIPL  269

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLDENF PKISDFGLAKL   D+
Sbjct  270   GWEKLRDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQ  329

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSKY  887
             S +++T ARGT+GY+APE+ +R  G +S+K+DVYSFGM+L++M+   R  +   D S  Y
Sbjct  330   SAISMTTARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMVLLDMV-RGRKNIDFADGSQVY  388

Query  888   FPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDV  1067
             FP W+YN +++G+ + +  ++ ++++I KK+  VGLWCIQ +P+ RPSM  VV+MLEG+ 
Sbjct  389   FPEWVYNRLDQGEELRIRIKEVNDEKIAKKLIFVGLWCIQWNPMDRPSMKAVVQMLEGEG  448

Query  1068  ELLQMPTDTFLS  1103
               L MP + F S
Sbjct  449   NKLTMPPNPFGS  460



>ref|XP_002513563.1| receptor serine/threonine kinase, putative [Ricinus communis]
 gb|EEF48966.1| receptor serine/threonine kinase, putative [Ricinus communis]
Length=378

 Score =   445 bits (1145),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/312 (69%), Positives = 262/312 (84%), Gaps = 3/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++PTRYS+ADIK+ITNQ  E+LG+G YG V+KG++S EI VAVK+LN+S GNG
Sbjct  52    FLEDYKALKPTRYSYADIKRITNQFKEKLGQGAYGTVFKGKLSDEIFVAVKILNNSTGNG  111

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G IHH+NVVRL+G+CADGFRRALVYEYLPNESLEK+I S + KN++LSWK
Sbjct  112   EEFINEVGTMGNIHHINVVRLIGHCADGFRRALVYEYLPNESLEKFISSGDGKNLSLSWK  171

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+ IA GI+YLHQGCD +ILHFDIKP NILLD N NPKI DFGLAKLCSK++SA+
Sbjct  172   KLQDIAVSIANGIQYLHQGCDHRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQSAI  231

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS+KSDVYSFGM+LLEMVGGRKN    + T  +  + 
Sbjct  232   SMTTARGTMGYIAPEVYSRNFGNVSYKSDVYSFGMVLLEMVGGRKN---NDVTVENDNQV  288

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPE VY  L+ G EL+IR++E+ D  I KKL I+ LWCIQW P+DRPSMK+VVQMLE +
Sbjct  289   YFPERVYKQLDEGEELRIRLKEEGDAEIVKKLTIVGLWCIQWHPIDRPSMKSVVQMLEED  348

Query  1544  GDDLVLPSSPFA  1509
              + L +P +PFA
Sbjct  349   VNKLTMPPNPFA  360


 Score =   353 bits (905),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 232/313 (74%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FKEKLG+G +G+V+KGKL     VAVKI++   
Sbjct  49    IEKFLEDYKALKPTRYSYADIKRITNQFKEKLGQGAYGTVFKGKLSDEIFVAVKILNNST  108

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEVG+MG IHH+N+VRL+G+CA+  + ALVY+++PN SL+K+I+ G   +L L
Sbjct  109   GNGEEFINEVGTMGNIHHINVVRLIGHCADGFRRALVYEYLPNESLEKFISSGDGKNLSL  168

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  +I V +A GI+YLH+GCD +ILHFDIKPHNILLDENF PKISDFGLAKL   D+
Sbjct  169   SWKKLQDIAVSIANGIQYLHQGCDHRILHFDIKPHNILLDENFNPKISDFGLAKLCSKDQ  228

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNR-TPVTEQDESSK  884
             S +++T ARGT+GY+APE+ +R  G +S+K+DVYSFGM+L+EM+G  +   VT ++++  
Sbjct  229   SAISMTTARGTMGYIAPEVYSRNFGNVSYKSDVYSFGMVLLEMVGGRKNNDVTVENDNQV  288

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP  +Y  +++G+ + +  ++E +  I KK+TIVGLWCIQ  PI RPSM  VV+MLE D
Sbjct  289   YFPERVYKQLDEGEELRIRLKEEGDAEIVKKLTIVGLWCIQWHPIDRPSMKSVVQMLEED  348

Query  1065  VELLQMPTDTFLS  1103
             V  L MP + F S
Sbjct  349   VNKLTMPPNPFAS  361



>ref|XP_011014554.1| PREDICTED: probable receptor-like protein kinase At1g67000, partial 
[Populus euphratica]
Length=595

 Score =   452 bits (1164),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 214/333 (64%), Positives = 262/333 (79%), Gaps = 4/333 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P    FLI K+ RRHLS+++ IE FL + NN  PIRYSY  IK +T  FKE+LG+GG+GS
Sbjct  229   PFVFAFLIYKWLRRHLSMYDIIEEFLQSQNNFAPIRYSYSDIKKITNGFKERLGQGGYGS  288

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG   AVK++ K  +NGQDFINEV ++GRIHHVN+VRL+G+CAE SK ALVYD
Sbjct  289   VYKGKLRSGHLAAVKMLDKSSANGQDFINEVATIGRIHHVNVVRLIGFCAEGSKRALVYD  348

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKY+      + L+WQ+ +EI +GVARGIEYLHRGCD+QILHFDIKPHN+LLD
Sbjct  349   FMPNGSLDKYVLSRQGNTTLSWQKMYEISLGVARGIEYLHRGCDMQILHFDIKPHNVLLD  408

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLAKL+PT+ + V LTAARGTIGY+APEL  + IG++S+KADVYSFGMLL
Sbjct  409   ENFAPKVSDFGLAKLYPTNNNTVMLTAARGTIGYIAPELFYKNIGSVSYKADVYSFGMLL  468

Query  828   MEMLG--LNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             MEM+G   N  PVTE + S  YFP W+YN +  G+ +E+G+  +DE ++ KKM IV LWC
Sbjct  469   MEMVGKRQNTNPVTESN-SENYFPDWVYNQVVDGR-VEIGDATKDENKLAKKMIIVALWC  526

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             IQM PI RP M++VVEMLEGDVE L+ P    L
Sbjct  527   IQMKPINRPPMNKVVEMLEGDVESLEFPPKPVL  559


 Score =   347 bits (891),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 227/310 (73%), Gaps = 5/310 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RYS++DIKKITN   ERLG+GGYG VYKG++ S  L AVK+L+ S  NG
Sbjct  253   FLQSQNNFAPIRYSYSDIKKITNGFKERLGQGGYGSVYKGKLRSGHLAAVKMLDKSSANG  312

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRL+G+CA+G +RALVY+++PN SL+KY+ S +  N  LSW+
Sbjct  313   QDFINEVATIGRIHHVNVVRLIGFCAEGSKRALVYDFMPNGSLDKYVLSRQG-NTTLSWQ  371

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A+GIEYLH+GCD QILHFDIKP N+LLD N  PK+ DFGLAKL     + V
Sbjct  372   KMYEISLGVARGIEYLHRGCDMQILHFDIKPHNVLLDENFAPKVSDFGLAKLYPTNNNTV  431

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              +TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG R+N N       S  E 
Sbjct  432   MLTAARGTIGYIAPELFYKNIGSVSYKADVYSFGMLLMEMVGKRQNTNP---VTESNSEN  488

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+WVYN +   G ++I     D+  +AKK+ I+ALWCIQ +P++RP M  VV+MLE +
Sbjct  489   YFPDWVYNQV-VDGRVEIGDATKDENKLAKKMIIVALWCIQMKPINRPPMNKVVEMLEGD  547

Query  1544  GDDLVLPSSP  1515
              + L  P  P
Sbjct  548   VESLEFPPKP  557



>ref|XP_010645761.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=600

 Score =   452 bits (1164),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 265/314 (84%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++PTRYS+ADIKKITN   ++LGEGGYG VYKG++S E+ VAVK+LN++ GNG
Sbjct  266   FLEDYIALKPTRYSYADIKKITNHFQDKLGEGGYGTVYKGKLSDEVHVAVKILNNTNGNG  325

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +G+IHHVNVVRLVG+CADGFRRAL+YE+LPNESLEK+IFS   KN +L WK
Sbjct  326   EEFLNEVGTMGRIHHVNVVRLVGFCADGFRRALIYEFLPNESLEKFIFSRTIKNHSLGWK  385

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  386   KLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKIADFGLAKLCSKEQSAV  445

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPE++SRN G VS+KSDV+S+GMLLLEMVGGRKN +    T  +  + 
Sbjct  446   SMTTARGTMGYIAPEMLSRNLGNVSYKSDVFSYGMLLLEMVGGRKNIDV---TVDNTSQV  502

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL++G ELQIRI+E+ D  I KKL II LWCIQW P DRPSMK VVQMLE E
Sbjct  503   YFPEWIYNHLDQGEELQIRIDEEGDTQIVKKLTIIGLWCIQWFPTDRPSMKLVVQMLEGE  562

Query  1544  GDDLVLPSSPFAGS  1503
               +L  P +PF  +
Sbjct  563   -HNLSTPPNPFTCT  575


 Score =   352 bits (903),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 167/315 (53%), Positives = 233/315 (74%), Gaps = 2/315 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  F++KLGEGG+G+VYKGKL     VAVKI++   
Sbjct  263   IEKFLEDYIALKPTRYSYADIKKITNHFQDKLGEGGYGTVYKGKLSDEVHVAVKILNNTN  322

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++F+NEVG+MGRIHHVN+VRLVG+CA+  + AL+Y+F+PN SL+K+I ++      L
Sbjct  323   GNGEEFLNEVGTMGRIHHVNVVRLVGFCADGFRRALIYEFLPNESLEKFIFSRTIKNHSL  382

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKI+DFGLAKL   ++
Sbjct  383   GWKKLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKIADFGLAKLCSKEQ  442

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGT+GY+APE+++R +G +S+K+DV+S+GMLL+EM+G  +   VT  + S  
Sbjct  443   SAVSMTTARGTMGYIAPEMLSRNLGNVSYKSDVFSYGMLLLEMVGGRKNIDVTVDNTSQV  502

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN +++G+ +++  ++E + +I KK+TI+GLWCIQ  P  RPSM  VV+MLEG+
Sbjct  503   YFPEWIYNHLDQGEELQIRIDEEGDTQIVKKLTIIGLWCIQWFPTDRPSMKLVVQMLEGE  562

Query  1065  VELLQMPTDTFLSEP  1109
               L   P     + P
Sbjct  563   HNLSTPPNPFTCTTP  577



>ref|XP_007039002.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY23503.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=631

 Score =   453 bits (1165),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 266/314 (85%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRAV+P+RYS+ADIK+ITN   ++LG+GGYG V+KGR+S+++LVAVKVLN+ KGNG
Sbjct  296   FLEDYRAVKPSRYSYADIKRITNHFKDKLGQGGYGTVFKGRLSNDVLVAVKVLNNFKGNG  355

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHHVNV RLVG+CADG+ RALVYEYLPNESLEK+IFS   +N  LSW+
Sbjct  356   EEFINEVGSMGRIHHVNVTRLVGFCADGYERALVYEYLPNESLEKFIFSATGENRFLSWE  415

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALG+AKGIEYLHQGC+Q+ILHFDIKP NILLD N NPKI DFGLAKLCSKE+SA+
Sbjct  416   KLQDIALGVAKGIEYLHQGCEQRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQSAI  475

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +     +TSQ   
Sbjct  476   SMTTARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVT-AENTSQV--  532

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW YN L++G EL IRIE+++   I KKL I+ LWCIQW PVDRP MK VVQMLE E
Sbjct  533   YFPEWAYNRLDKGEELGIRIEDEEHTGIVKKLTIVGLWCIQWYPVDRPPMKVVVQMLEGE  592

Query  1544  GDDLVLPSSPFAGS  1503
             G  L +P +PFA +
Sbjct  593   GSLLTVPPNPFAST  606


 Score =   357 bits (917),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/313 (55%), Positives = 235/313 (75%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     + P RYSY  IK +T  FK+KLG+GG+G+V+KG+L +   VAVK+++  K
Sbjct  293   IEKFLEDYRAVKPSRYSYADIKRITNHFKDKLGQGGYGTVFKGRLSNDVLVAVKVLNNFK  352

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEVGSMGRIHHVN+ RLVG+CA+  + ALVY+++PN SL+K+I +       L
Sbjct  353   GNGEEFINEVGSMGRIHHVNVTRLVGFCADGYERALVYEYLPNESLEKFIFSATGENRFL  412

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  +I +GVA+GIEYLH+GC+ +ILHFDIKPHNILLD+NF PKISDFGLAKL   ++
Sbjct  413   SWEKLQDIALGVAKGIEYLHQGCEQRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQ  472

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S +++T ARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   VT ++ S  
Sbjct  473   SAISMTTARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVTAENTSQV  532

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W YN ++KG+ + +  EDE+   I KK+TIVGLWCIQ  P+ RP M  VV+MLEG+
Sbjct  533   YFPEWAYNRLDKGEELGIRIEDEEHTGIVKKLTIVGLWCIQWYPVDRPPMKVVVQMLEGE  592

Query  1065  VELLQMPTDTFLS  1103
               LL +P + F S
Sbjct  593   GSLLTVPPNPFAS  605



>ref|XP_009343242.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=389

 Score =   444 bits (1142),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 209/332 (63%), Positives = 260/332 (78%), Gaps = 2/332 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I  +I K +RRHLS++E IE+FL  +N L P+RYSY  IK M + FK+KLGEGGFGS
Sbjct  19    PCLIALIIYKCKRRHLSMYENIEDFLQ-NNQLMPVRYSYSDIKKMARGFKDKLGEGGFGS  77

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+V+LVG+C E SK ALVYD
Sbjct  78    VYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLVGFCVEGSKRALVYD  137

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGS DK+I        L+ ++ FEI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  138   FMPNGSFDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLD  197

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PK+SDFGLA+L P + SIV+LTAARGTIGY+APE   + IG +S+KADVYSFGMLL
Sbjct  198   ENFLPKVSDFGLARLCPLNNSIVSLTAARGTIGYMAPEFFYKNIGGVSYKADVYSFGMLL  257

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  +      + SS+ YFP+W++N ++ GK + +G+  E+EK+I KKM +V  WCI
Sbjct  258   MEMAGKRKNLNANIEHSSQIYFPTWVFNQLSGGKDLTIGDATEEEKKIIKKMIVVASWCI  317

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RPSM++VVEMLEG++E LQMP   FL
Sbjct  318   QMKPSDRPSMNKVVEMLEGEIESLQMPPKLFL  349


 Score =   336 bits (862),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 230/317 (73%), Gaps = 7/317 (2%)
 Frame = -1

Query  2441  LEDY---RAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKG  2271
             +ED+     + P RYS++DIKK+     ++LGEGG+G VYK ++ S  LVA+K+L  SK 
Sbjct  40    IEDFLQNNQLMPVRYSYSDIKKMARGFKDKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKA  99

Query  2270  NGEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALS  2091
             NG++FINEV  IG+IHHVNVV+LVG+C +G +RALVY+++PN S +K+IFS +   ++LS
Sbjct  100   NGQDFINEVATIGRIHHVNVVQLVGFCVEGSKRALVYDFMPNGSFDKHIFSQQGV-ISLS  158

Query  2090  WKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKS  1911
              +K+ EI+LG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+LC    S
Sbjct  159   CEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLDENFLPKVSDFGLARLCPLNNS  218

Query  1910  AVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQ  1731
              V++TAARGT+GY+APE   +N G VS+K+DVYSFGMLL+EM G RKN NA    + S Q
Sbjct  219   IVSLTAARGTIGYMAPEFFYKNIGGVSYKADVYSFGMLLMEMAGKRKNLNAN--IEHSSQ  276

Query  1730  EGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FP WV+N L+ G +L I    ++++ I KK+ ++A WCIQ +P DRPSM  VV+MLE
Sbjct  277   I-YFPTWVFNQLSGGKDLTIGDATEEEKKIIKKMIVVASWCIQMKPSDRPSMNKVVEMLE  335

Query  1550  REGDDLVLPSSPFAGSQ  1500
              E + L +P   F   Q
Sbjct  336   GEIESLQMPPKLFLYPQ  352



>ref|XP_009343235.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=389

 Score =   444 bits (1142),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 210/332 (63%), Positives = 260/332 (78%), Gaps = 2/332 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I  +I K +RRHLS++E IE+FL  +N L P+RYSY  IK M + FK+KLGEGGFGS
Sbjct  19    PCLIALIIYKCKRRHLSMYENIEDFLQ-NNQLMPVRYSYSDIKKMARGFKDKLGEGGFGS  77

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+V+LVG+C E SK ALVYD
Sbjct  78    VYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLVGFCVEGSKRALVYD  137

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGS DK+I        L+ ++ FEI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  138   FMPNGSFDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLD  197

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PK+SDFGLA+L P D SIV+LTAARGTIGY+APEL  + IG +S+KADVYSFGMLL
Sbjct  198   ENFLPKVSDFGLARLCPLDNSIVSLTAARGTIGYIAPELFYKNIGGVSYKADVYSFGMLL  257

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  +      + SS+ YFP+W++N ++ G  + +G+  E+EK+I KKM +V  WCI
Sbjct  258   MEMAGKRKNLNANIEHSSQIYFPTWVFNQLSGGNDLPIGDATEEEKKIIKKMIVVASWCI  317

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RPSM++VVEMLEG++E LQMP   FL
Sbjct  318   QMKPSDRPSMNKVVEMLEGEIESLQMPPKLFL  349


 Score =   338 bits (866),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 232/317 (73%), Gaps = 7/317 (2%)
 Frame = -1

Query  2441  LEDY---RAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKG  2271
             +ED+     + P RYS++DIKK+     ++LGEGG+G VYK ++ S  LVA+K+L  SK 
Sbjct  40    IEDFLQNNQLMPVRYSYSDIKKMARGFKDKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKA  99

Query  2270  NGEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALS  2091
             NG++FINEV  IG+IHHVNVV+LVG+C +G +RALVY+++PN S +K+IFS +   ++LS
Sbjct  100   NGQDFINEVATIGRIHHVNVVQLVGFCVEGSKRALVYDFMPNGSFDKHIFSQQGV-ISLS  158

Query  2090  WKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKS  1911
              +K+ EI+LG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+LC  + S
Sbjct  159   CEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLDENFLPKVSDFGLARLCPLDNS  218

Query  1910  AVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQ  1731
              V++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EM G RKN NA    + S Q
Sbjct  219   IVSLTAARGTIGYIAPELFYKNIGGVSYKADVYSFGMLLMEMAGKRKNLNAN--IEHSSQ  276

Query  1730  EGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FP WV+N L+ G +L I    ++++ I KK+ ++A WCIQ +P DRPSM  VV+MLE
Sbjct  277   I-YFPTWVFNQLSGGNDLPIGDATEEEKKIIKKMIVVASWCIQMKPSDRPSMNKVVEMLE  335

Query  1550  REGDDLVLPSSPFAGSQ  1500
              E + L +P   F   Q
Sbjct  336   GEIESLQMPPKLFLYPQ  352



>ref|XP_002268653.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=619

 Score =   452 bits (1164),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 222/316 (70%), Positives = 269/316 (85%), Gaps = 8/316 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+AD+KKIT+Q  ++LG+G YG VYKG++S+E+ VAVK+LNDSKGNG
Sbjct  278   FLEDYRALKPSRYSYADMKKITHQFKDKLGQGAYGTVYKGKLSNEVFVAVKILNDSKGNG  337

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  +G IHHV+VVRLVG+CAD F+RAL+YE+LPNESLEK+IF    KN +L W 
Sbjct  338   DEFINEVATMGTIHHVHVVRLVGFCADRFKRALIYEFLPNESLEKFIFPKNGKNHSLGWL  397

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLHQGCD++ILHFDIKP NILLDHN  PKI DFGLAKLCSKE+S V
Sbjct  398   KLQDIALGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQSVV  457

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV+SRNFG +++KSDVYSFGMLLLEMVGGRKN +      T ++ G
Sbjct  458   SMTTARGTIGYIAPEVLSRNFGNITYKSDVYSFGMLLLEMVGGRKNIDV-----TMEKTG  512

Query  1724  S--FPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FPEWVYNHL++G EL IRIEE+ D  IAKKL I+ LWCIQW P+DRPSMKAVVQMLE
Sbjct  513   QVYFPEWVYNHLDQGEELHIRIEEEGDAKIAKKLTIVGLWCIQWYPIDRPSMKAVVQMLE  572

Query  1550  REGDDLVLPSSPFAGS  1503
             RE D+L++P +PF  +
Sbjct  573   RE-DNLIMPPNPFTAT  587


 Score =   348 bits (894),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 230/317 (73%), Gaps = 2/317 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  +K +T  FK+KLG+G +G+VYKGKL +   VAVKI++  K
Sbjct  275   IEKFLEDYRALKPSRYSYADMKKITHQFKDKLGQGAYGTVYKGKLSNEVFVAVKILNDSK  334

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG +FINEV +MG IHHV++VRLVG+CA+  K AL+Y+F+PN SL+K+I  +      L
Sbjct  335   GNGDEFINEVATMGTIHHVHVVRLVGFCADRFKRALIYEFLPNESLEKFIFPKNGKNHSL  394

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W +  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  395   GWLKLQDIALGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFTPKISDFGLAKLCSKEQ  454

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S+V++T ARGTIGY+APE+++R  G I++K+DVYSFGMLL+EM+G  +   VT +     
Sbjct  455   SVVSMTTARGTIGYIAPEVLSRNFGNITYKSDVYSFGMLLLEMVGGRKNIDVTMEKTGQV  514

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN +++G+ + +  E+E + +I KK+TIVGLWCIQ  PI RPSM  VV+MLE +
Sbjct  515   YFPEWVYNHLDQGEELHIRIEEEGDAKIAKKLTIVGLWCIQWYPIDRPSMKAVVQMLERE  574

Query  1065  VELLQMPTDTFLSEPIM  1115
               L+  P     ++ IM
Sbjct  575   DNLIMPPNPFTATDRIM  591



>ref|XP_011003873.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Populus 
euphratica]
Length=646

 Score =   453 bits (1166),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 214/333 (64%), Positives = 262/333 (79%), Gaps = 4/333 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P    FLI K+ RRHLS+++ IE FL + NN  PIRYSY  IK +T  FKE+LG+GG+GS
Sbjct  280   PFVFAFLIYKWLRRHLSMYDIIEEFLQSQNNFAPIRYSYSDIKKITNGFKERLGQGGYGS  339

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG   AVK++ K  +NGQDFINEV ++GRIHHVN+VRL+G+CAE SK ALVYD
Sbjct  340   VYKGKLRSGHLAAVKMLDKSSANGQDFINEVATIGRIHHVNVVRLIGFCAEGSKRALVYD  399

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKY+      + L+WQ+ +EI +GVARGIEYLHRGCD+QILHFDIKPHN+LLD
Sbjct  400   FMPNGSLDKYVLSRQGNTTLSWQKMYEISLGVARGIEYLHRGCDMQILHFDIKPHNVLLD  459

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLAKL+PT+ + V LTAARGTIGY+APEL  + IG++S+KADVYSFGMLL
Sbjct  460   ENFAPKVSDFGLAKLYPTNNNTVMLTAARGTIGYIAPELFYKNIGSVSYKADVYSFGMLL  519

Query  828   MEMLG--LNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             MEM+G   N  PVTE + S  YFP W+YN +  G+ +E+G+  +DE ++ KKM IV LWC
Sbjct  520   MEMVGKRQNTNPVTESN-SENYFPDWVYNQVVDGR-VEIGDATKDENKLAKKMIIVALWC  577

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             IQM PI RP M++VVEMLEGDVE L+ P    L
Sbjct  578   IQMKPINRPPMNKVVEMLEGDVESLEFPPKPVL  610


 Score =   348 bits (892),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 227/310 (73%), Gaps = 5/310 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RYS++DIKKITN   ERLG+GGYG VYKG++ S  L AVK+L+ S  NG
Sbjct  304   FLQSQNNFAPIRYSYSDIKKITNGFKERLGQGGYGSVYKGKLRSGHLAAVKMLDKSSANG  363

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRL+G+CA+G +RALVY+++PN SL+KY+ S +  N  LSW+
Sbjct  364   QDFINEVATIGRIHHVNVVRLIGFCAEGSKRALVYDFMPNGSLDKYVLSRQG-NTTLSWQ  422

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A+GIEYLH+GCD QILHFDIKP N+LLD N  PK+ DFGLAKL     + V
Sbjct  423   KMYEISLGVARGIEYLHRGCDMQILHFDIKPHNVLLDENFAPKVSDFGLAKLYPTNNNTV  482

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              +TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG R+N N       S  E 
Sbjct  483   MLTAARGTIGYIAPELFYKNIGSVSYKADVYSFGMLLMEMVGKRQNTNP---VTESNSEN  539

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+WVYN +   G ++I     D+  +AKK+ I+ALWCIQ +P++RP M  VV+MLE +
Sbjct  540   YFPDWVYNQV-VDGRVEIGDATKDENKLAKKMIIVALWCIQMKPINRPPMNKVVEMLEGD  598

Query  1544  GDDLVLPSSP  1515
              + L  P  P
Sbjct  599   VESLEFPPKP  608



>ref|XP_010663000.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=602

 Score =   452 bits (1162),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 226/314 (72%), Positives = 265/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ADIK+IT+Q   +LGEGGYG VYKG++S E+ VAVK+L++S+GNG
Sbjct  269   FLEDYEALKPSRYSYADIKRITSQFKNKLGEGGYGTVYKGKLSDEVFVAVKILDNSQGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  329   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWK  388

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GI KGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  389   KLQEIAIGITKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  448

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              MT  RGTMGYIAP+V+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  449   FMTIVRGTMGYIAPKVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  505

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE+ D  IAKKLAI+ L CIQW P+DRPSMK VVQMLE E
Sbjct  506   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPMDRPSMKIVVQMLEGE  565

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  566   GDKLTMPPNPFAST  579


 Score =   341 bits (875),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 225/313 (72%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK KLGEGG+G+VYKGKL     VAVKI+   +
Sbjct  266   VKKFLEDYEALKPSRYSYADIKRITSQFKNKLGEGGYGTVYKGKLSDEVFVAVKILDNSQ  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  326   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSL  385

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+ +GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  386   SWKKLQEIAIGITKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  445

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V +T  RGT+GY+AP++++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  446   SAVFMTIVRGTMGYIAPKVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  505

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E+E +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  506   YFPEWIYNHLDIGEELHIRIEEEGDVEIAKKLAIVGLSCIQWCPMDRPSMKIVVQMLEGE  565

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  566   GDKLTMPPNPFAS  578



>ref|XP_002266286.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=588

 Score =   451 bits (1160),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 221/313 (71%), Positives = 265/313 (85%), Gaps = 3/313 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A+ P+RYS+ DIKKITN   ++LG+GGYG VYKG++S+E+LVAVK+LNDSKGNG
Sbjct  253   FLEDYKALNPSRYSYVDIKKITNHFKDKLGQGGYGSVYKGKLSNEVLVAVKILNDSKGNG  312

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG + +IHHVNVVRLVG+CADG +RAL+YE+LPNESLEK+IF T  KN +L W+
Sbjct  313   EEFINEVGTMSRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKFIFPTPIKNHSLGWE  372

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIAKGIEYLHQGC+Q+ILHFDIKP NILLD N NPKI DFGLAKLCSKE+SA+
Sbjct  373   KLQDIAMGIAKGIEYLHQGCEQRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQSAI  432

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLL MVGGRKN +    T  +  + 
Sbjct  433   SMTAARGTMGYIAPEVISRNFGNVSYKSDVYSFGMLLLGMVGGRKNIDV---TVENTSQV  489

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVY  L++  E+ IRIE++ D  IAKKL I+ LWCIQW P+DRPSMK VVQMLE  
Sbjct  490   YFPEWVYTQLDQREEVHIRIEKEGDTKIAKKLTIVGLWCIQWYPIDRPSMKVVVQMLEGT  549

Query  1544  GDDLVLPSSPFAG  1506
             GD+L +P +PFA 
Sbjct  550   GDNLTMPPNPFAS  562


 Score =   355 bits (912),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/313 (55%), Positives = 233/313 (74%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FK+KLG+GG+GSVYKGKL +   VAVKI++  K
Sbjct  250   IEKFLEDYKALNPSRYSYVDIKKITNHFKDKLGQGGYGSVYKGKLSNEVLVAVKILNDSK  309

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS-LL  527
              NG++FINEVG+M RIHHVN+VRLVG+CA+  K AL+Y+F+PN SL+K+I      +  L
Sbjct  310   GNGEEFINEVGTMSRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKFIFPTPIKNHSL  369

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GC+ +ILHFDIKPHNILLD+NF PKISDFGLAKL   ++
Sbjct  370   GWEKLQDIAMGIAKGIEYLHQGCEQRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQ  429

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S +++TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+ M+G  +   VT ++ S  
Sbjct  430   SAISMTAARGTMGYIAPEVISRNFGNVSYKSDVYSFGMLLLGMVGGRKNIDVTVENTSQV  489

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+Y  +++ + + +  E E + +I KK+TIVGLWCIQ  PI RPSM  VV+MLEG 
Sbjct  490   YFPEWVYTQLDQREEVHIRIEKEGDTKIAKKLTIVGLWCIQWYPIDRPSMKVVVQMLEGT  549

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  550   GDNLTMPPNPFAS  562



>ref|XP_003634115.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=429

 Score =   445 bits (1145),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 211/327 (65%), Positives = 258/327 (79%), Gaps = 2/327 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+ RRHLS  E IE FL    N  PIRYSY H+K MT  FK KLG+GGFGSV
Sbjct  65    CLFSYLIFKFHRRHLSSDEDIEEFLQNHKNFQPIRYSYSHLKKMTNNFKNKLGQGGFGSV  124

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHH+N+VRLVG+C E SK AL+YDF
Sbjct  125   YKGKLRSGQIVAVKMLVISKANGQDFINEVATIGRIHHINVVRLVGFCVEGSKWALIYDF  184

Query  471   MPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             M NGSLDK+I  +G  +  L+W+R ++I +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  185   MSNGSLDKFIFLKGEKSIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  244

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  245   EDFTPKVSDFGLAKLYSTDESIVSLTAARGTLGYIAPELFYKNIGHVSYKADVYSFGMLL  304

Query  828   MEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  R     E++ S  +FPSWIY+ I +G  +EMG+  EDEK+  +KM IV LWC+
Sbjct  305   MEMVGKRRHVSAHEENLSEIFFPSWIYDQIEQGGHMEMGDATEDEKKYMRKMIIVALWCV  364

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM PI RPSMS+ + MLEGDVE+LQMP
Sbjct  365   QMKPIDRPSMSKALNMLEGDVEILQMP  391


 Score =   342 bits (876),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 234/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL++++  +P RYS++ +KK+TN    +LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  88    FLQNHKNFQPIRYSYSHLKKMTNNFKNKLGQGGFGSVYKGKLRSGQIVAVKMLVISKANG  147

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHH+NVVRLVG+C +G + AL+Y+++ N SL+K+IF    K++ LSW+
Sbjct  148   QDFINEVATIGRIHHINVVRLVGFCVEGSKWALIYDFMSNGSLDKFIFLKGEKSIPLSWE  207

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +IALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  208   RLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESIV  267

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG R++ +A E    +  E 
Sbjct  268   SLTAARGTLGYIAPELFYKNIGHVSYKADVYSFGMLLMEMVGKRRHVSAHE---ENLSEI  324

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ + +GG +++    +D++   +K+ I+ALWC+Q +P+DRPSM   + MLE +
Sbjct  325   FFPSWIYDQIEQGGHMEMGDATEDEKKYMRKMIIVALWCVQMKPIDRPSMSKALNMLEGD  384

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  385   VEILQMPLKP  394



>ref|XP_008232172.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=629

 Score =   452 bits (1162),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 215/332 (65%), Positives = 263/332 (79%), Gaps = 2/332 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PCA   +I K+RRRHLSV   IE+FL  +N L P+RYSY +IK M K FKEKLGEGG+GS
Sbjct  261   PCATALIIYKWRRRHLSVHHNIEDFLQ-NNELVPVRYSYSNIKKMAKGFKEKLGEGGYGS  319

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+VRL+G+C E SK ALVYD
Sbjct  320   VYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVRLIGFCVEGSKRALVYD  379

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKY+        LN ++ FEI VGVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  380   FMPNGSLDKYLFSQQGVISLNCEKMFEIAVGVARGIEYLHRGCDMQILHFDIKPHNILLD  439

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PK+SDFGLA+L P D SIV+LTAARGTIGY+APEL  + IG IS+KADVYSFGMLL
Sbjct  440   ENFLPKVSDFGLARLCPLDNSIVSLTAARGTIGYIAPELFYKNIGGISYKADVYSFGMLL  499

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  +      ++SS+ YFP+W+++ ++ GK I++ +  E+E++I KKM IV LWCI
Sbjct  500   MEMAGRRKNLNATIEKSSQIYFPTWVFDQLSDGKDIKVEDATEEEEKIIKKMIIVALWCI  559

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RPSM++ VEMLEG++E L+MP   FL
Sbjct  560   QMKPSDRPSMNKAVEMLEGEIECLEMPPKPFL  591


 Score =   340 bits (873),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 234/315 (74%), Gaps = 5/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL++   V P RYS+++IKK+     E+LGEGGYG VYK ++ S  LVA+K+L  SK NG
Sbjct  285   FLQNNELV-PVRYSYSNIKKMAKGFKEKLGEGGYGSVYKAKLRSGRLVAIKMLGKSKANG  343

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRL+G+C +G +RALVY+++PN SL+KY+FS +   ++L+ +
Sbjct  344   QDFINEVATIGRIHHVNVVRLIGFCVEGSKRALVYDFMPNGSLDKYLFSQQGV-ISLNCE  402

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EIA+G+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+LC  + S V
Sbjct  403   KMFEIAVGVARGIEYLHRGCDMQILHFDIKPHNILLDENFLPKVSDFGLARLCPLDNSIV  462

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G +S+K+DVYSFGMLL+EM G RKN NA   T     + 
Sbjct  463   SLTAARGTIGYIAPELFYKNIGGISYKADVYSFGMLLMEMAGRRKNLNA---TIEKSSQI  519

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WV++ L+ G ++++    +++E I KK+ I+ALWCIQ +P DRPSM   V+MLE E
Sbjct  520   YFPTWVFDQLSDGKDIKVEDATEEEEKIIKKMIIVALWCIQMKPSDRPSMNKAVEMLEGE  579

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  580   IECLEMPPKPFLYPQ  594



>ref|XP_003634140.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=385

 Score =   443 bits (1139),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 211/339 (62%), Positives = 263/339 (78%), Gaps = 2/339 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+ RRHLS+ + IE FL +  NL PI+YSY  IK MT  F  KLG+GGFGSV
Sbjct  21    CLFAYLIYKFHRRHLSLDDSIEEFLRSQKNLQPIKYSYSDIKKMTHNFANKLGQGGFGSV  80

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRLVG+C + SK AL+YDF
Sbjct  81    YKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCVQGSKWALIYDF  140

Query  471   MPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK+I  +    + L+W+R +++ +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  141   MPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  200

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  201   EDFTPKVSDFGLAKLYSTDESIVSLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLL  260

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  +        SS+ YFPSWIY+  ++G  I++G+  EDEK++ KKM IV LWCI
Sbjct  261   MEMVGRRKNVNANAAHSSQIYFPSWIYDRYDQGDNIDLGDATEDEKKLVKKMVIVALWCI  320

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV  1121
             QM PI RPSMS+ +EMLEG+VELL+MP    L    M V
Sbjct  321   QMKPIDRPSMSKALEMLEGEVELLEMPPKPTLYSEEMSV  359


 Score =   346 bits (888),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 232/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL   + ++P +YS++DIKK+T+  + +LG+GG+G VYKG++ S  +VAVKVL  SK NG
Sbjct  44    FLRSQKNLQPIKYSYSDIKKMTHNFANKLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANG  103

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+C  G + AL+Y+++PN SL+K+IF  E  N  LSW+
Sbjct  104   QDFINEVATIGRIHHVNVVRLVGFCVQGSKWALIYDFMPNGSLDKFIFLKEENNTFLSWE  163

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ ++ALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  164   RLYKVALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESIV  223

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG RKN NA     +   + 
Sbjct  224   SLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLLMEMVGRRKNVNANAAHSS---QI  280

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++G  + +    +D++ + KK+ I+ALWCIQ +P+DRPSM   ++MLE E
Sbjct  281   YFPSWIYDRYDQGDNIDLGDATEDEKKLVKKMVIVALWCIQMKPIDRPSMSKALEMLEGE  340

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  341   VELLEMPPKP  350



>ref|XP_002513562.1| receptor serine/threonine kinase, putative [Ricinus communis]
 gb|EEF48965.1| receptor serine/threonine kinase, putative [Ricinus communis]
Length=598

 Score =   451 bits (1159),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 223/311 (72%), Positives = 263/311 (85%), Gaps = 3/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++PTRYS+AD+K+ITNQ  ++LG+G YG V+KGR+S EI VAVK LN+S GNG
Sbjct  263   FLEDYKALKPTRYSYADLKRITNQFKDKLGQGAYGTVFKGRLSDEIFVAVKELNNSTGNG  322

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHHVNVVRLVG+CADGFRRALVYE+LPNESLEK+IFS +  N +L W+
Sbjct  323   EEFINEVGTMGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSNDGDNSSLGWE  382

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLD N  PKI DFGLAKLC+K++SAV
Sbjct  383   KLEDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDDNFTPKISDFGLAKLCAKDQSAV  442

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV SRNFG VS+KSDVYSFGMLLLEMVGGRKN +  +  ++SQ   
Sbjct  443   SMTAARGTMGYIAPEVFSRNFGSVSYKSDVYSFGMLLLEMVGGRKNIDI-DVENSSQV--  499

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+Y HL++  EL+IRI E  D  IAKKL I+ LWCIQW P DRPSMK VVQMLE E
Sbjct  500   FFPEWIYKHLDQEEELRIRILEIGDAKIAKKLTIVGLWCIQWYPADRPSMKVVVQMLEEE  559

Query  1544  GDDLVLPSSPF  1512
             G  L +P +PF
Sbjct  560   GGALTMPPNPF  570


 Score =   352 bits (903),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 175/340 (51%), Positives = 242/340 (71%), Gaps = 4/340 (1%)
 Frame = +3

Query  114   AIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVY  293
             A VF + +  R+       IE FL     L P RYSY  +K +T  FK+KLG+G +G+V+
Sbjct  241   AAVFHVYRIYRKQKENQARIEKFLEDYKALKPTRYSYADLKRITNQFKDKLGQGAYGTVF  300

Query  294   KGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFM  473
             KG+L     VAVK ++    NG++FINEVG+MGRIHHVN+VRLVG+CA+  + ALVY+F+
Sbjct  301   KGRLSDEIFVAVKELNNSTGNGEEFINEVGTMGRIHHVNVVRLVGFCADGFRRALVYEFL  360

Query  474   PNGSLDKYI--NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             PN SL+K+I  N G  +SL  W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD
Sbjct  361   PNESLEKFIFSNDGDNSSL-GWEKLEDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLD  419

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PKISDFGLAKL   D+S V++TAARGT+GY+APE+ +R  G++S+K+DVYSFGMLL
Sbjct  420   DNFTPKISDFGLAKLCAKDQSAVSMTAARGTMGYIAPEVFSRNFGSVSYKSDVYSFGMLL  479

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             +EM+G  +    + + SS+ +FP WIY  +++ + + +   +  + +I KK+TIVGLWCI
Sbjct  480   LEMVGGRKNIDIDVENSSQVFFPEWIYKHLDQEEELRIRILEIGDAKIAKKLTIVGLWCI  539

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEVH  1124
             Q  P  RPSM  VV+MLE +   L MP + F SE  M+ +
Sbjct  540   QWYPADRPSMKVVVQMLEEEGGALTMPPNPFNSESAMKAN  579



>ref|XP_011037044.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Populus 
euphratica]
Length=544

 Score =   449 bits (1154),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 209/334 (63%), Positives = 267/334 (80%), Gaps = 2/334 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC IVFLI K+RRRHLSV++ +E FL   NNL P+RYSY  I+ +T+ FK+KLGEGGFG+
Sbjct  181   PCVIVFLIYKWRRRHLSVYDTVEQFLQGQNNLMPVRYSYSDIRKITRGFKDKLGEGGFGT  240

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG   AVK++ K K+NGQDFINEV ++GRIHH N+VRL+G+CAE SK ALVYD
Sbjct  241   VYKGKLRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHTNVVRLIGFCAEGSKRALVYD  300

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLD+++     +  L+WQ+  +I +GVARGI+YLH GCD+QILHFDIKPHNILLD
Sbjct  301   FMPNGSLDRHLFSREGSISLSWQKLHQISLGVARGIDYLHLGCDMQILHFDIKPHNILLD  360

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLA+L+PT+ SI +LTAARGTIGY+APEL  + IG +S+KADVYSFGMLL
Sbjct  361   ENFTPKVSDFGLARLYPTNGSITSLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLL  420

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             +EM G  +      + SS+ Y+P W+++ ++ GKAIE+G++  E+E +I KKM +VGLWC
Sbjct  421   LEMAGKRKNVNALAENSSQIYWPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGLWC  480

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             IQM P+ RP+M  VVEMLEGD+E LQ+P    L+
Sbjct  481   IQMKPMDRPTMKNVVEMLEGDLENLQLPPKPVLN  514


 Score =   334 bits (856),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 233/311 (75%), Gaps = 5/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS++DI+KIT    ++LGEGG+G VYKG++ S    AVK+L  SK NG
Sbjct  205   FLQGQNNLMPVRYSYSDIRKITRGFKDKLGEGGFGTVYKGKLRSGRFAAVKLLGKSKANG  264

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHH NVVRL+G+CA+G +RALVY+++PN SL++++FS E  +++LSW+
Sbjct  265   QDFINEVATIGRIHHTNVVRLIGFCAEGSKRALVYDFMPNGSLDRHLFSREG-SISLSWQ  323

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +I+LG+A+GI+YLH GCD QILHFDIKP NILLD N  PK+ DFGLA+L     S  
Sbjct  324   KLHQISLGVARGIDYLHLGCDMQILHFDIKPHNILLDENFTPKVSDFGLARLYPTNGSIT  383

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  +N G+VS+K+DVYSFGMLLLEM G RKN NA    ++SQ   
Sbjct  384   SLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLLLEMAGKRKNVNAL-AENSSQI--  440

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +P WV++ ++ G  ++I     +++  I KK+ ++ LWCIQ +P+DRP+MK VV+MLE 
Sbjct  441   YWPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGLWCIQMKPMDRPTMKNVVEMLEG  500

Query  1547  EGDDLVLPSSP  1515
             + ++L LP  P
Sbjct  501   DLENLQLPPKP  511



>ref|XP_002268775.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Vitis 
vinifera]
Length=608

 Score =   451 bits (1159),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 211/328 (64%), Positives = 264/328 (80%), Gaps = 2/328 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FL+ K+RRR+LS+++ IE F+   N L PIRYSY +IK MTK F EKLGEGG+GS
Sbjct  252   PCVLIFLVYKWRRRNLSMYQAIEEFIQTHNKLMPIRYSYSNIKKMTKGFNEKLGEGGYGS  311

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG  VAVK+M+  KSNGQDFINEV ++G+IHHVN+V+L+G+C E SK ALVYD
Sbjct  312   VYKGKLRSGHLVAVKLMTNSKSNGQDFINEVATIGKIHHVNVVQLLGFCVEGSKRALVYD  371

Query  468   FMPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSLDKYI      ++ L++++ ++I +GVA GIEYLHRGCD+QILHFDIKPHNILL
Sbjct  372   FMPNGSLDKYIFPEKEGNISLSFEKMYQISLGVAHGIEYLHRGCDMQILHFDIKPHNILL  431

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D+NF PK+SDFGLAK +P D SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGML
Sbjct  432   DKNFTPKVSDFGLAKSYPVDHSIVSLTAARGTMGYMAPELFYKNIGGVSYKADVYSFGML  491

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             LMEM G  +      + SS+ YFPSW Y+  N+GK IEMG+  E+E+ + KKM IV LWC
Sbjct  492   LMEMAGRRKNLNVFAEHSSQIYFPSWAYDQFNEGKNIEMGDATEEERTLAKKMVIVALWC  551

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             IQ+ P  RPSM +V+EMLEG+V+LLQMP
Sbjct  552   IQLKPSDRPSMQKVIEMLEGNVDLLQMP  579


 Score =   344 bits (882),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 231/315 (73%), Gaps = 3/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             F++ +  + P RYS+++IKK+T   +E+LGEGGYG VYKG++ S  LVAVK++ +SK NG
Sbjct  276   FIQTHNKLMPIRYSYSNIKKMTKGFNEKLGEGGYGSVYKGKLRSGHLVAVKLMTNSKSNG  335

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IGKIHHVNVV+L+G+C +G +RALVY+++PN SL+KYIF  +  N++LS++
Sbjct  336   QDFINEVATIGKIHHVNVVQLLGFCVEGSKRALVYDFMPNGSLDKYIFPEKEGNISLSFE  395

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +I+LG+A GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAK    + S V
Sbjct  396   KMYQISLGVAHGIEYLHRGCDMQILHFDIKPHNILLDKNFTPKVSDFGLAKSYPVDHSIV  455

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGY+APE+  +N G VS+K+DVYSFGMLL+EM G RKN N          + 
Sbjct  456   SLTAARGTMGYMAPELFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNVFA---EHSSQI  512

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W Y+  N G  +++    +++  +AKK+ I+ALWCIQ +P DRPSM+ V++MLE  
Sbjct  513   YFPSWAYDQFNEGKNIEMGDATEEERTLAKKMVIVALWCIQLKPSDRPSMQKVIEMLEGN  572

Query  1544  GDDLVLPSSPFAGSQ  1500
              D L +P  P    Q
Sbjct  573   VDLLQMPPKPSLTPQ  587



>ref|XP_010662817.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=617

 Score =   451 bits (1159),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 220/313 (70%), Positives = 267/313 (85%), Gaps = 3/313 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+ADIKKITN   ++LG+GGYG VYKG++S+E+ VAVK+L+  KGNG
Sbjct  282   FLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSNEVFVAVKILDGFKGNG  341

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +  IHHVNVVRL+G+CADG++RAL+YE+LPNESL+K+IFS    N +L W 
Sbjct  342   EEFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPNESLDKFIFSAFGNNYSLGWH  401

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILH DIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  402   KLQEIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNSNPKISDFGLAKLCSKEQSAV  461

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPE++SRNFG VS+KSDVYSFGMLL+EMVGGRKN +A   T  +  + 
Sbjct  462   SMTAARGTMGYIAPEMLSRNFGNVSYKSDVYSFGMLLIEMVGGRKNIDA---TVENTSQA  518

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL++  E+ IRIE++ D  IAKKL+II LWCIQW P+DRPSMK V+ MLERE
Sbjct  519   YFPEWLYNHLDQEQEVHIRIEDESDIKIAKKLSIIGLWCIQWYPIDRPSMKIVIGMLERE  578

Query  1544  GDDLVLPSSPFAG  1506
             G +LV+P +PF  
Sbjct  579   GGNLVMPPNPFTS  591


 Score =   343 bits (881),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 229/314 (73%), Gaps = 4/314 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             I+ FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL +   VAVKI+   K
Sbjct  279   IQKFLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSNEVFVAVKILDGFK  338

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEVG+M  IHHVN+VRL+G+CA+  K AL+Y+F+PN SLDK+I   A+ +   
Sbjct  339   GNGEEFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPNESLDKFI-FSAFGNNYS  397

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L W +  EI +G+A+GIEYLH+GCD +ILH DIKPHNILLD N  PKISDFGLAKL   +
Sbjct  398   LGWHKLQEIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNSNPKISDFGLAKLCSKE  457

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESS  881
             +S V++TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +    T ++ S 
Sbjct  458   QSAVSMTAARGTMGYIAPEMLSRNFGNVSYKSDVYSFGMLLIEMVGGRKNIDATVENTSQ  517

Query  882   KYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEG  1061
              YFP W+YN +++ + + +  EDE + +I KK++I+GLWCIQ  PI RPSM  V+ MLE 
Sbjct  518   AYFPEWLYNHLDQEQEVHIRIEDESDIKIAKKLSIIGLWCIQWYPIDRPSMKIVIGMLER  577

Query  1062  DVELLQMPTDTFLS  1103
             +   L MP + F S
Sbjct  578   EGGNLVMPPNPFTS  591



>gb|EYU40245.1| hypothetical protein MIMGU_mgv1a021311mg, partial [Erythranthe 
guttata]
Length=538

 Score =   448 bits (1152),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 267/314 (85%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P+R+S++DIK+IT+Q SE+LGEGGYGIVYKG++++EI+VAVKVLN+S GNG
Sbjct  210   FLRDYKALKPSRFSYSDIKRITHQFSEKLGEGGYGIVYKGKLNNEIVVAVKVLNNSNGNG  269

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRL+G+CADGFRRALVYE+LPN SLEK IF   S  + L W+
Sbjct  270   EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRITLDWE  329

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIAKGIEYLH+GCDQQILHFDIKP N+LLDHN+NPKICDFGLAKLCSKE+SAV
Sbjct  330   KLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLNPKICDFGLAKLCSKEQSAV  389

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRK  N     D + Q  
Sbjct  390   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRK--NEDHNVDNTSQV-  446

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N   +  +  + ++  +IA+KL+I+ LWCIQW P DRPSMKAVVQMLE E
Sbjct  447   YFPQWIYNHIN-AEDNPLWAKNEEGNSIARKLSIVGLWCIQWCPTDRPSMKAVVQMLEGE  505

Query  1544  GDDLVLPSSPFAGS  1503
              DDL +P +PF  +
Sbjct  506   CDDLTMPPNPFPAT  519


 Score =   345 bits (884),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 236/332 (71%), Gaps = 8/332 (2%)
 Frame = +3

Query  114   AIVFLIIKYR--RRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             A V+L I+ R  R + ++   I  FL     L P R+SY  IK +T  F EKLGEGG+G 
Sbjct  189   AFVYLYIRVRTYRENRTM---IGMFLRDYKALKPSRFSYSDIKRITHQFSEKLGEGGYGI  245

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL +   VAVK+++    NG++F+NEV ++GRIHHVNIVRL+G+CA+  + ALVY+
Sbjct  246   VYKGKLNNEIVVAVKVLNNSNGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYE  305

Query  468   FMPNGSLDKYINQ-GAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             F+PNGSL+K I Q G+    L+W++  +I +G+A+GIEYLH GCD QILHFDIKP N+LL
Sbjct  306   FLPNGSLEKSIFQAGSNRITLDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLL  365

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D N  PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGML
Sbjct  366   DHNLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGML  425

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  +      D +S+ YFP WIYN IN  +   +  ++E+   I +K++IVGLWC
Sbjct  426   LLEMVGGRKNEDHNVDNTSQVYFPQWIYNHIN-AEDNPLWAKNEEGNSIARKLSIVGLWC  484

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             IQ  P  RPSM  VV+MLEG+ + L MP + F
Sbjct  485   IQWCPTDRPSMKAVVQMLEGECDDLTMPPNPF  516



>ref|XP_004228892.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Solanum lycopersicum]
Length=588

 Score =   449 bits (1156),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 228/309 (74%), Positives = 264/309 (85%), Gaps = 5/309 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYR  RPTRY++ADI+K+TNQ  E LGEG YGIVYKG +S+EI VAVKVL+DS+GNG
Sbjct  260   FLEDYRDRRPTRYTYADIRKMTNQFQEVLGEGAYGIVYKGTLSNEIHVAVKVLDDSEGNG  319

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESK-NVALSW  2088
             EEFINEV  +GKIHHVNVVRLVG+CADG RRALV+EYLPN+SL+K IF    K N+ L+W
Sbjct  320   EEFINEVAAMGKIHHVNVVRLVGFCADGVRRALVFEYLPNQSLDKLIFPISIKDNITLTW  379

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             KK+ +IA+GIAKG+EYLHQGCDQQILHFDIKP NILLDHN+NPKI DFGLAKLCSKEKS 
Sbjct  380   KKLHDIAIGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKEKSV  439

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VTMT ARGTMGYIAPEV+S NFGK SHKSDVYSFGM+LLEMVGGRKNF+AK   DTSQ  
Sbjct  440   VTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAK--ADTSQM-  496

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +FPEW++  LN+G EL+IRIE+DDD  I +KLA+I LWCIQW  +DRPS+K V QMLE 
Sbjct  497   -NFPEWIHEWLNQGDELKIRIEKDDDVIIVRKLAVIGLWCIQWNAIDRPSIKVVTQMLEG  555

Query  1547  EGDDLVLPS  1521
             +G +L +PS
Sbjct  556   DGSNLTVPS  564


 Score =   328 bits (841),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 217/308 (70%), Gaps = 2/308 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL    +  P RY+Y  I+ MT  F+E LGEG +G VYKG L +   VAVK++   +
Sbjct  257   VEKFLEDYRDRRPTRYTYADIRKMTNQFQEVLGEGAYGIVYKGTLSNEIHVAVKVLDDSE  316

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEV +MG+IHHVN+VRLVG+CA+  + ALV++++PN SLDK I   +      
Sbjct  317   GNGEEFINEVAAMGKIHHVNVVRLVGFCADGVRRALVFEYLPNQSLDKLIFPISIKDNIT  376

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L W++  +I +G+A+G+EYLH+GCD QILHFDIKP NILLD N  PKISDFGLAKL   +
Sbjct  377   LTWKKLHDIAIGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKE  436

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             KS+VT+T ARGT+GY+APE+++   G  SHK+DVYSFGM+L+EM+G  +    + D S  
Sbjct  437   KSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAKADTSQM  496

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
              FP WI+  +N+G  +++  E +D+  I +K+ ++GLWCIQ + I RPS+  V +MLEGD
Sbjct  497   NFPEWIHEWLNQGDELKIRIEKDDDVIIVRKLAVIGLWCIQWNAIDRPSIKVVTQMLEGD  556

Query  1065  VELLQMPT  1088
                L +P+
Sbjct  557   GSNLTVPS  564



>ref|XP_002262799.3| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=444

 Score =   444 bits (1142),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLE Y A++P+RYS+ADIK+I NQ  + LG+ GYG VYKG++S+E+ VAVK+LN+S+GNG
Sbjct  109   FLEYYEALKPSRYSYADIKRIRNQFKDTLGQEGYGTVYKGKLSNEVFVAVKILNNSQGNG  168

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  169   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSRVVKNYSLSWK  228

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  229   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  288

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVG RKN +    +  S  + 
Sbjct  289   SMTVARGTIGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGERKNIDV---SVESTSQV  345

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE  D  IAKKLAI+ L CIQW P+DRPSMK VVQMLE +
Sbjct  346   YFPEWIYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWYPMDRPSMKIVVQMLEGK  405

Query  1544  GDDLVLPSSPFAGS  1503
             G  L +P +PFA +
Sbjct  406   GGKLTIPPNPFAST  419


 Score =   336 bits (862),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 226/313 (72%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +   FK+ LG+ G+G+VYKGKL +   VAVKI++  +
Sbjct  106   VKRFLEYYEALKPSRYSYADIKRIRNQFKDTLGQEGYGTVYKGKLSNEVFVAVKILNNSQ  165

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  166   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSRVVKNYSL  225

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  226   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  285

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGTIGY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  286   SAVSMTVARGTIGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGERKNIDVSVESTSQV  345

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E++ +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG 
Sbjct  346   YFPEWIYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWYPMDRPSMKIVVQMLEGK  405

Query  1065  VELLQMPTDTFLS  1103
                L +P + F S
Sbjct  406   GGKLTIPPNPFAS  418



>ref|XP_006368004.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=597

 Score =   449 bits (1156),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 232/313 (74%), Positives = 265/313 (85%), Gaps = 6/313 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYR  RPTRY++ADIKKITNQ  E LGEG YGIVYKG +S+EI VAVK+LNDS+GNG
Sbjct  269   FLEDYRDRRPTRYTYADIKKITNQFQEILGEGAYGIVYKGTLSNEIHVAVKILNDSEGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESK-NVALSW  2088
             EEFINEV  +GKIHHVNVVRLVG+CADG RRALV+EYLPN+SL+K IF +  K N+ L+W
Sbjct  329   EEFINEVAAMGKIHHVNVVRLVGFCADGVRRALVFEYLPNQSLDKLIFPSSFKDNITLTW  388

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             KK+ +IA+GIAKG+EYLHQGCDQQILHFDIKP NILLDHN+NPKI DFGLAKLCSKEKS 
Sbjct  389   KKLHDIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKEKSV  448

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VTMT ARGTMGYIAPEV+S NFGK SHKSDVYSFGM+LLEMVGGRKNF+AK   DTSQ  
Sbjct  449   VTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAK--ADTSQM-  505

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +FPEW++  LN+G EL+IRIEEDDD  I +KLA+I LWCIQW   DRPS+K V QMLE 
Sbjct  506   -NFPEWIHQRLNQGEELKIRIEEDDDVIIVRKLAVIGLWCIQWNATDRPSIKIVTQMLEG  564

Query  1547  EGDDLVLPSSPFA  1509
             +  +L +P SPF 
Sbjct  565   DVSNLTVP-SPFT  576


 Score =   333 bits (855),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 221/308 (72%), Gaps = 2/308 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL    +  P RY+Y  IK +T  F+E LGEG +G VYKG L +   VAVKI++  +
Sbjct  266   VEKFLEDYRDRRPTRYTYADIKKITNQFQEILGEGAYGIVYKGTLSNEIHVAVKILNDSE  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEV +MG+IHHVN+VRLVG+CA+  + ALV++++PN SLDK I   ++     
Sbjct  326   GNGEEFINEVAAMGKIHHVNVVRLVGFCADGVRRALVFEYLPNQSLDKLIFPSSFKDNIT  385

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L W++  +I +G+A+G+EYLH+GCD QILHFDIKP NILLD N  PKISDFGLAKL   +
Sbjct  386   LTWKKLHDIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKE  445

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             KS+VT+T ARGT+GY+APE+++   G  SHK+DVYSFGM+L+EM+G  +    + D S  
Sbjct  446   KSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAKADTSQM  505

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
              FP WI+  +N+G+ +++  E++D+  I +K+ ++GLWCIQ +   RPS+  V +MLEGD
Sbjct  506   NFPEWIHQRLNQGEELKIRIEEDDDVIIVRKLAVIGLWCIQWNATDRPSIKIVTQMLEGD  565

Query  1065  VELLQMPT  1088
             V  L +P+
Sbjct  566   VSNLTVPS  573



>ref|XP_011016149.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Populus 
euphratica]
Length=473

 Score =   445 bits (1145),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 217/335 (65%), Positives = 266/335 (79%), Gaps = 3/335 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNA-DNNLFPIRYSYKHIKNMTKAFKEKLGEGGFG  284
             PC I+FL+ K+RRRHLS+++ IE FL + DN+L P+RYSY  IK +T  FK KLGEGGFG
Sbjct  107   PCFIIFLVYKWRRRHLSMYDNIEKFLQSHDNDLMPVRYSYSDIKKITNDFKNKLGEGGFG  166

Query  285   SVYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
              VYKGKLRSGS  AVKI+SK K+NGQDFINEV ++GRI+HVN+VRL+G+  E SK AL+Y
Sbjct  167   LVYKGKLRSGSFAAVKILSKSKANGQDFINEVATIGRIYHVNVVRLIGFTVEGSKRALIY  226

Query  465   DFMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             +FMPNGSLDKYI     +  L+ ++ +EI +GVARGIEYLH+GCD+QILHFDIKPHNILL
Sbjct  227   EFMPNGSLDKYIVSRQGSISLSNEKMYEISLGVARGIEYLHKGCDMQILHFDIKPHNILL  286

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DE FIPK+SDFGLAKL+PT+ SIV LTAARGTIGY+APEL  + IG +SHK+DVYSFGML
Sbjct  287   DEKFIPKLSDFGLAKLYPTNNSIVPLTAARGTIGYMAPELFYKNIGGVSHKSDVYSFGML  346

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDE-KRITKKMTIVGLW  998
             LMEM+G  +      D SS+ YFPSWIY+ +++GK +E+G+   +E K  TKKM IV LW
Sbjct  347   LMEMIGRRKNLNPLADHSSQIYFPSWIYDQVSEGKDVELGDHATEEGKETTKKMIIVALW  406

Query  999   CIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             CIQ+ P  RPSM  VV+MLE DVE LQMP   FL+
Sbjct  407   CIQLRPNDRPSMPNVVKMLESDVESLQMPPKPFLT  441


 Score =   333 bits (855),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 168/303 (55%), Positives = 225/303 (74%), Gaps = 5/303 (2%)
 Frame = -1

Query  2417  PTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNGEEFINEVGI  2238
             P RYS++DIKKITN    +LGEGG+G+VYKG++ S    AVK+L+ SK NG++FINEV  
Sbjct  141   PVRYSYSDIKKITNDFKNKLGEGGFGLVYKGKLRSGSFAAVKILSKSKANGQDFINEVAT  200

Query  2237  IGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWKKIQEIALGI  2058
             IG+I+HVNVVRL+G+  +G +RAL+YE++PN SL+KYI S +  +++LS +K+ EI+LG+
Sbjct  201   IGRIYHVNVVRLIGFTVEGSKRALIYEFMPNGSLDKYIVSRQG-SISLSNEKMYEISLGV  259

Query  2057  AKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAVTMTAARGTM  1878
             A+GIEYLH+GCD QILHFDIKP NILLD    PK+ DFGLAKL     S V +TAARGT+
Sbjct  260   ARGIEYLHKGCDMQILHFDIKPHNILLDEKFIPKLSDFGLAKLYPTNNSIVPLTAARGTI  319

Query  1877  GYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEGSFPEWVYNH  1698
             GY+APE+  +N G VSHKSDVYSFGMLL+EM+G RKN N     D S Q   FP W+Y+ 
Sbjct  320   GYMAPELFYKNIGGVSHKSDVYSFGMLLMEMIGRRKNLNPL--ADHSSQI-YFPSWIYDQ  376

Query  1697  LNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLEREGDDLVLPS  1521
             ++ G ++++     ++ +   KK+ I+ALWCIQ +P DRPSM  VV+MLE + + L +P 
Sbjct  377   VSEGKDVELGDHATEEGKETTKKMIIVALWCIQLRPNDRPSMPNVVKMLESDVESLQMPP  436

Query  1520  SPF  1512
              PF
Sbjct  437   KPF  439



>ref|XP_009629970.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Nicotiana 
tomentosiformis]
Length=607

 Score =   449 bits (1156),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 230/319 (72%), Positives = 266/319 (83%), Gaps = 6/319 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A+RPTRYS+ADIKKIT   +E+LGEG YG VYKG++S EI VAVKVL DSKG G
Sbjct  273   FLEDYKAIRPTRYSYADIKKITVDFNEKLGEGSYGTVYKGKLSREIYVAVKVLRDSKGKG  332

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIF--STESKNVAL-  2094
             EEFINE+G IG+IHHVNVVRLVG+CADGFRRAL+YEYLPN+SLE++I   S+ + +V+L 
Sbjct  333   EEFINEIGTIGRIHHVNVVRLVGFCADGFRRALIYEYLPNDSLERFILPMSSSTNSVSLI  392

Query  2093  SWKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEK  1914
             SW K+Q IALG A+GIEYLHQGCDQQILHFDIKP NILLDHN+NPKICDFGLAKLCSKEK
Sbjct  393   SWNKLQHIALGTARGIEYLHQGCDQQILHFDIKPQNILLDHNLNPKICDFGLAKLCSKEK  452

Query  1913  SAVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQ  1734
             SAVTMTAARGT+GYIAPEV+SRNFGKVSHKSD+YSFGMLLLEMVGGR   N+K  T+   
Sbjct  453   SAVTMTAARGTIGYIAPEVLSRNFGKVSHKSDIYSFGMLLLEMVGGRIKTNSK--TNNHS  510

Query  1733  QEGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQML  1554
             +  S  EW+Y  L +G ELQIRIEE+ D  I +KLAI+ LWCIQW P DRPS+K VVQML
Sbjct  511   KVSSL-EWIYRDLEKGEELQIRIEEEGDGTIVRKLAIVGLWCIQWHPNDRPSIKEVVQML  569

Query  1553  EREGDDLVLPSSPFAGSQM  1497
             E +G  L L  +PF  + M
Sbjct  570   EGDGSHLNLSPNPFMATNM  588


 Score =   337 bits (865),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/316 (52%), Positives = 222/316 (70%), Gaps = 5/316 (2%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL     + P RYSY  IK +T  F EKLGEG +G+VYKGKL     VAVK++   K
Sbjct  270   LEKFLEDYKAIRPTRYSYADIKKITVDFNEKLGEGSYGTVYKGKLSREIYVAVKVLRDSK  329

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI----NQGAYA  518
               G++FINE+G++GRIHHVN+VRLVG+CA+  + AL+Y+++PN SL+++I    +     
Sbjct  330   GKGEEFINEIGTIGRIHHVNVVRLVGFCADGFRRALIYEYLPNDSLERFILPMSSSTNSV  389

Query  519   SLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFP  698
             SL++W +   I +G ARGIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL  
Sbjct  390   SLISWNKLQHIALGTARGIEYLHQGCDQQILHFDIKPQNILLDHNLNPKICDFGLAKLCS  449

Query  699   TDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDES  878
              +KS VT+TAARGTIGY+APE+++R  G +SHK+D+YSFGMLL+EM+G      ++ +  
Sbjct  450   KEKSAVTMTAARGTIGYIAPEVLSRNFGKVSHKSDIYSFGMLLLEMVGGRIKTNSKTNNH  509

Query  879   SKYFP-SWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEML  1055
             SK     WIY D+ KG+ +++  E+E +  I +K+ IVGLWCIQ  P  RPS+  VV+ML
Sbjct  510   SKVSSLEWIYRDLEKGEELQIRIEEEGDGTIVRKLAIVGLWCIQWHPNDRPSIKEVVQML  569

Query  1056  EGDVELLQMPTDTFLS  1103
             EGD   L +  + F++
Sbjct  570   EGDGSHLNLSPNPFMA  585



>ref|XP_010315114.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Solanum lycopersicum]
Length=597

 Score =   449 bits (1155),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 228/309 (74%), Positives = 264/309 (85%), Gaps = 5/309 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYR  RPTRY++ADI+K+TNQ  E LGEG YGIVYKG +S+EI VAVKVL+DS+GNG
Sbjct  269   FLEDYRDRRPTRYTYADIRKMTNQFQEVLGEGAYGIVYKGTLSNEIHVAVKVLDDSEGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESK-NVALSW  2088
             EEFINEV  +GKIHHVNVVRLVG+CADG RRALV+EYLPN+SL+K IF    K N+ L+W
Sbjct  329   EEFINEVAAMGKIHHVNVVRLVGFCADGVRRALVFEYLPNQSLDKLIFPISIKDNITLTW  388

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             KK+ +IA+GIAKG+EYLHQGCDQQILHFDIKP NILLDHN+NPKI DFGLAKLCSKEKS 
Sbjct  389   KKLHDIAIGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKEKSV  448

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VTMT ARGTMGYIAPEV+S NFGK SHKSDVYSFGM+LLEMVGGRKNF+AK   DTSQ  
Sbjct  449   VTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAK--ADTSQM-  505

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +FPEW++  LN+G EL+IRIE+DDD  I +KLA+I LWCIQW  +DRPS+K V QMLE 
Sbjct  506   -NFPEWIHEWLNQGDELKIRIEKDDDVIIVRKLAVIGLWCIQWNAIDRPSIKVVTQMLEG  564

Query  1547  EGDDLVLPS  1521
             +G +L +PS
Sbjct  565   DGSNLTVPS  573


 Score =   328 bits (841),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 217/308 (70%), Gaps = 2/308 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL    +  P RY+Y  I+ MT  F+E LGEG +G VYKG L +   VAVK++   +
Sbjct  266   VEKFLEDYRDRRPTRYTYADIRKMTNQFQEVLGEGAYGIVYKGTLSNEIHVAVKVLDDSE  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEV +MG+IHHVN+VRLVG+CA+  + ALV++++PN SLDK I   +      
Sbjct  326   GNGEEFINEVAAMGKIHHVNVVRLVGFCADGVRRALVFEYLPNQSLDKLIFPISIKDNIT  385

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L W++  +I +G+A+G+EYLH+GCD QILHFDIKP NILLD N  PKISDFGLAKL   +
Sbjct  386   LTWKKLHDIAIGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKE  445

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             KS+VT+T ARGT+GY+APE+++   G  SHK+DVYSFGM+L+EM+G  +    + D S  
Sbjct  446   KSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAKADTSQM  505

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
              FP WI+  +N+G  +++  E +D+  I +K+ ++GLWCIQ + I RPS+  V +MLEGD
Sbjct  506   NFPEWIHEWLNQGDELKIRIEKDDDVIIVRKLAVIGLWCIQWNAIDRPSIKVVTQMLEGD  565

Query  1065  VELLQMPT  1088
                L +P+
Sbjct  566   GSNLTVPS  573



>ref|XP_006374065.1| hypothetical protein POPTR_0015s00230g, partial [Populus trichocarpa]
 gb|ERP51862.1| hypothetical protein POPTR_0015s00230g, partial [Populus trichocarpa]
Length=401

 Score =   442 bits (1137),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 262/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P RY++ADIK+ITN   E+LG+G YG V+KG++S+EI VAVK+LN+S GNG
Sbjct  91    FLADYKALKPARYTYADIKRITNDFKEKLGQGAYGTVFKGKLSNEIFVAVKILNNSTGNG  150

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +G+IHHVN+VRLVGYCADGFRRALVY+YLPNESLEK++ S   K   LSW+
Sbjct  151   EEFVNEVGTMGRIHHVNIVRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGKTCPLSWE  210

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIA+GIEYLHQGCDQ+ILHFDIKP NILLD N +PKI DFGLAKLCSK++SAV
Sbjct  211   KLQDIALGIARGIEYLHQGCDQRILHFDIKPHNILLDDNFSPKISDFGLAKLCSKDQSAV  270

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS KSDVYS+GM+LLEMVGGRK  + KE  + +Q   
Sbjct  271   SMTTARGTMGYIAPEVFSRNFGNVSSKSDVYSYGMVLLEMVGGRKTVD-KEVENNTQI--  327

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L+ G EL IR+E++ D  IAKKL I+ LWCIQW PV+RPSM  VVQMLE E
Sbjct  328   YFPEWVYNSLDNGEELIIRVEKEGDAQIAKKLTIVGLWCIQWHPVERPSMNTVVQMLEGE  387

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SPF+ +
Sbjct  388   GDKLTMPPSPFSSA  401


 Score =   360 bits (924),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/313 (55%), Positives = 235/313 (75%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RY+Y  IK +T  FKEKLG+G +G+V+KGKL +   VAVKI++   
Sbjct  88    IEIFLADYKALKPARYTYADIKRITNDFKEKLGQGAYGTVFKGKLSNEIFVAVKILNNST  147

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASLL  527
              NG++F+NEVG+MGRIHHVNIVRLVGYCA+  + ALVYD++PN SL+K+++ +      L
Sbjct  148   GNGEEFVNEVGTMGRIHHVNIVRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGKTCPL  207

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  +I +G+ARGIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   D+
Sbjct  208   SWEKLQDIALGIARGIEYLHQGCDQRILHFDIKPHNILLDDNFSPKISDFGLAKLCSKDQ  267

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S V++T ARGT+GY+APE+ +R  G +S K+DVYS+GM+L+EM+G  +T   E + +++ 
Sbjct  268   SAVSMTTARGTMGYIAPEVFSRNFGNVSSKSDVYSYGMVLLEMVGGRKTVDKEVENNTQI  327

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++ G+ + +  E E + +I KK+TIVGLWCIQ  P+ RPSM+ VV+MLEG+
Sbjct  328   YFPEWVYNSLDNGEELIIRVEKEGDAQIAKKLTIVGLWCIQWHPVERPSMNTVVQMLEGE  387

Query  1065  VELLQMPTDTFLS  1103
              + L MP   F S
Sbjct  388   GDKLTMPPSPFSS  400



>ref|XP_007010206.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY19016.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=542

 Score =   447 bits (1149),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 222/312 (71%), Positives = 266/312 (85%), Gaps = 3/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RYS+ADIK+ITNQ  E+LG+GGYG V+KG +S+++ VAVKVLN+ KGNG
Sbjct  214   FLEDYKALKPSRYSYADIKRITNQFKEKLGQGGYGTVFKGTLSNDVSVAVKVLNNFKGNG  273

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +G+IHHVNV RLVG+CADG+ RALVYEYLPNESLEK+IF+ + +N  LSW+
Sbjct  274   EEFVNEVGSMGRIHHVNVTRLVGFCADGYNRALVYEYLPNESLEKFIFAAKGENRFLSWE  333

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EIALGIAKGIEYLHQGC+Q+ILHFDIKP NILLD N  PKI DFGLAKLCSKE+SAV
Sbjct  334   KLHEIALGIAKGIEYLHQGCEQRILHFDIKPHNILLDQNFTPKISDFGLAKLCSKEQSAV  393

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T  ++ + 
Sbjct  394   SMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---TVANESQV  450

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G EL I IE++    IAKKL I+ L CIQW PVDRPSMK+VVQMLE E
Sbjct  451   YFPEWVYNRLDKGEELGIDIEDEGHHKIAKKLTIVGLRCIQWYPVDRPSMKSVVQMLEGE  510

Query  1544  GDDLVLPSSPFA  1509
              D+L +P +PFA
Sbjct  511   ADNLTMPPNPFA  522


 Score =   366 bits (939),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/314 (56%), Positives = 236/314 (75%), Gaps = 2/314 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FKEKLG+GG+G+V+KG L +   VAVK+++  K
Sbjct  211   IEQFLEDYKALKPSRYSYADIKRITNQFKEKLGQGGYGTVFKGTLSNDVSVAVKVLNNFK  270

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS-LL  527
              NG++F+NEVGSMGRIHHVN+ RLVG+CA+    ALVY+++PN SL+K+I      +  L
Sbjct  271   GNGEEFVNEVGSMGRIHHVNVTRLVGFCADGYNRALVYEYLPNESLEKFIFAAKGENRFL  330

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GC+ +ILHFDIKPHNILLD+NF PKISDFGLAKL   ++
Sbjct  331   SWEKLHEIALGIAKGIEYLHQGCEQRILHFDIKPHNILLDQNFTPKISDFGLAKLCSKEQ  390

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   VT  +ES  
Sbjct  391   SAVSMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVTVANESQV  450

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++KG+ + +  EDE   +I KK+TIVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  451   YFPEWVYNRLDKGEELGIDIEDEGHHKIAKKLTIVGLRCIQWYPVDRPSMKSVVQMLEGE  510

Query  1065  VELLQMPTDTFLSE  1106
              + L MP + F S+
Sbjct  511   ADNLTMPPNPFASK  524



>gb|EYU21045.1| hypothetical protein MIMGU_mgv1a022789mg, partial [Erythranthe 
guttata]
Length=438

 Score =   443 bits (1139),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 215/337 (64%), Positives = 270/337 (80%), Gaps = 11/337 (3%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P   V LIIK+R RHLS+F PIE FL ++ NL  IRYSY  ++ MT+ F+EKLGEGG+GS
Sbjct  80    PSLCVLLIIKFRTRHLSMFGPIERFLQSNKNLTTIRYSYSDVRKMTRGFREKLGEGGYGS  139

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK+++K ++NGQ+FINEV ++GRIHHVN+V+LVGYCAE SK ALVYD
Sbjct  140   VYKGKLRSGHDVAVKLLNKTRANGQEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYD  199

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KY+     ++ L+  RKFEI VGVARGIEYLH GC+IQILHFDIKP NILLD
Sbjct  200   FMPNGSLEKYLFSKETSTSLSLARKFEIAVGVARGIEYLHIGCNIQILHFDIKPDNILLD  259

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PKISDFGLAK +  + + +TLTA RGT+GYVAPEL+NR IG++S +ADVYSFGMLL
Sbjct  260   DNFTPKISDFGLAKSYSIENTTLTLTAVRGTVGYVAPELMNRSIGSVSCRADVYSFGMLL  319

Query  828   MEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMG----------EEDEDEKRITK  974
             MEMLGLNR T  T  ++SS+YFP WIY+ +N+G  IE+G          +ED++ +++ +
Sbjct  320   MEMLGLNRGTGPTNDNKSSQYFPYWIYDHLNEGNDIEIGNADKNDYDDDDEDDNARKMRR  379

Query  975   KMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             KMTIVGLWCIQM P  RPSMS V++ML+G++  LQ+P
Sbjct  380   KMTIVGLWCIQMRPSDRPSMSDVLKMLQGEIGNLQIP  416


 Score =   324 bits (830),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 166/320 (52%), Positives = 229/320 (72%), Gaps = 14/320 (4%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+  + +   RYS++D++K+T    E+LGEGGYG VYKG++ S   VAVK+LN ++ NG
Sbjct  104   FLQSNKNLTTIRYSYSDVRKMTRGFREKLGEGGYGSVYKGKLRSGHDVAVKLLNKTRANG  163

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVV+LVGYCA+  +RALVY+++PN SLEKY+FS E+ + +LS  
Sbjct  164   QEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYDFMPNGSLEKYLFSKET-STSLSLA  222

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIA+G+A+GIEYLH GC+ QILHFDIKP NILLD N  PKI DFGLAK  S E + +
Sbjct  223   RKFEIAVGVARGIEYLHIGCNIQILHFDIKPDNILLDDNFTPKISDFGLAKSYSIENTTL  282

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G VS ++DVYSFGMLL+EM+G  +         +SQ   
Sbjct  283   TLTAVRGTVGYVAPELMNRSIGSVSCRADVYSFGMLLMEMLGLNRGTGPTNDNKSSQY--  340

Query  1724  SFPEWVYNHLNRGGELQI----------RieedddeaiakklaiiaLWCIQWQPVDRPSM  1575
              FP W+Y+HLN G +++I            E+D+   + +K+ I+ LWCIQ +P DRPSM
Sbjct  341   -FPYWIYDHLNEGNDIEIGNADKNDYDDDDEDDNARKMRRKMTIVGLWCIQMRPSDRPSM  399

Query  1574  KAVVQMLEREGDDLVLPSSP  1515
               V++ML+ E  +L +P  P
Sbjct  400   SDVLKMLQGEIGNLQIPPQP  419



>ref|XP_008231576.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=399

 Score =   441 bits (1135),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 211/332 (64%), Positives = 262/332 (79%), Gaps = 2/332 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C IV LI K++RRHLS++  IE FL + NNL PIRYSY  I+ MTK FKEKLGEGG+GSV
Sbjct  28    CLIVLLIYKFKRRHLSMYGLIEEFLQSHNNLMPIRYSYSDIRKMTKGFKEKLGEGGYGSV  87

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VA+K++ K  +NGQDFINEV ++GRIHHV++V+L+GYC E SK ALVY+F
Sbjct  88    YKGKLRSGRLVAIKMLGKSNTNGQDFINEVATIGRIHHVHVVQLIGYCVEGSKRALVYEF  147

Query  471   MPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             M NGSLDK+I +    S LN+++ FEI +GVARGI+YLH+GC++QI HFDIKPHNILL+E
Sbjct  148   MTNGSLDKHIFRKEGPSSLNYKKSFEISLGVARGIDYLHQGCEMQIFHFDIKPHNILLNE  207

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             +F+PKISDFGLA+L P D+S +TLTAARGTIGY+APEL  + IG +S KAD+YSFGMLLM
Sbjct  208   DFVPKISDFGLARLCPLDESSLTLTAARGTIGYIAPELFYKNIGGVSSKADIYSFGMLLM  267

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             E+ G  +        SS+ YFPSW+Y+  N+GK I+M +  E+E +ITKKM IV LWCIQ
Sbjct  268   EIAGKRKNLNAVAAHSSQVYFPSWVYDQFNEGKDIDMEDATEEEMKITKKMLIVALWCIQ  327

Query  1008  MSPIPRP-SMSRVVEMLEGDVELLQMPTDTFL  1100
             M P  RP SMS+VV+MLEG+ E LQMP   FL
Sbjct  328   MKPSERPTSMSKVVQMLEGETEALQMPPKPFL  359


 Score =   336 bits (862),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 168/316 (53%), Positives = 230/316 (73%), Gaps = 5/316 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  + P RYS++DI+K+T    E+LGEGGYG VYKG++ S  LVA+K+L  S  NG
Sbjct  51    FLQSHNNLMPIRYSYSDIRKMTKGFKEKLGEGGYGSVYKGKLRSGRLVAIKMLGKSNTNG  110

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHV+VV+L+GYC +G +RALVYE++ N SL+K+IF  E  + +L++K
Sbjct  111   QDFINEVATIGRIHHVHVVQLIGYCVEGSKRALVYEFMTNGSLDKHIFRKEGPS-SLNYK  169

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K  EI+LG+A+GI+YLHQGC+ QI HFDIKP NILL+ +  PKI DFGLA+LC  ++S++
Sbjct  170   KSFEISLGVARGIDYLHQGCEMQIFHFDIKPHNILLNEDFVPKISDFGLARLCPLDESSL  229

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GYIAPE+  +N G VS K+D+YSFGMLL+E+ G RKN NA         + 
Sbjct  230   TLTAARGTIGYIAPELFYKNIGGVSSKADIYSFGMLLMEIAGKRKNLNA---VAAHSSQV  286

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRP-SMKAVVQMLER  1548
              FP WVY+  N G ++ +    +++  I KK+ I+ALWCIQ +P +RP SM  VVQMLE 
Sbjct  287   YFPSWVYDQFNEGKDIDMEDATEEEMKITKKMLIVALWCIQMKPSERPTSMSKVVQMLEG  346

Query  1547  EGDDLVLPSSPFAGSQ  1500
             E + L +P  PF   Q
Sbjct  347   ETEALQMPPKPFLYPQ  362



>ref|XP_002263649.2| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=596

 Score =   448 bits (1153),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 222/311 (71%), Positives = 264/311 (85%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RYS+AD+KKITN   E+LG+GGYG VYKGR+SS++LVAVK+LN+SK NG
Sbjct  261   FLEDYKALKPSRYSYADVKKITNHFKEKLGQGGYGTVYKGRLSSDVLVAVKILNNSKENG  320

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHHVNVVRLVG+CADG +RAL+YE+LPNESLEKYIFS   K+ +L W+
Sbjct  321   EEFINEVGTMGRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKYIFSKSVKDCSLRWE  380

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
              +Q IALGIAKGIEYLHQGCD++ILHFDIKP NILLD N NPKI DFGLAKLCSKE+SAV
Sbjct  381   TLQNIALGIAKGIEYLHQGCDKRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQSAV  440

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV+SRNFG VS+KSD+YSFGMLLLEMVGGRKN +    T     + 
Sbjct  441   SMTTARGTMGYIAPEVLSRNFGNVSYKSDIYSFGMLLLEMVGGRKNIDV---TMEKANQV  497

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G E+ IRIEE+ D  IAKKL I+ LWCIQW P+DRPS+K V+QMLE  
Sbjct  498   YFPEWVYNQLDKGEEVCIRIEEEGDIKIAKKLTIVGLWCIQWCPIDRPSIKVVIQMLEG-  556

Query  1544  GDDLVLPSSPF  1512
             GD L +P +PF
Sbjct  557   GDKLTMPPNPF  567


 Score =   363 bits (932),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 235/313 (75%), Gaps = 3/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  +K +T  FKEKLG+GG+G+VYKG+L S   VAVKI++  K
Sbjct  258   IEQFLEDYKALKPSRYSYADVKKITNHFKEKLGQGGYGTVYKGRLSSDVLVAVKILNNSK  317

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEVG+MGRIHHVN+VRLVG+CA+  K AL+Y+F+PN SL+KYI ++      L
Sbjct  318   ENGEEFINEVGTMGRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKYIFSKSVKDCSL  377

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W+    I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   ++
Sbjct  378   RWETLQNIALGIAKGIEYLHQGCDKRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQ  437

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGT+GY+APE+++R  G +S+K+D+YSFGMLL+EM+G  +   VT +  +  
Sbjct  438   SAVSMTTARGTMGYIAPEVLSRNFGNVSYKSDIYSFGMLLLEMVGGRKNIDVTMEKANQV  497

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++KG+ + +  E+E + +I KK+TIVGLWCIQ  PI RPS+  V++MLEG 
Sbjct  498   YFPEWVYNQLDKGEEVCIRIEEEGDIKIAKKLTIVGLWCIQWCPIDRPSIKVVIQMLEGG  557

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  558   -DKLTMPPNPFDS  569



>gb|EYU32407.1| hypothetical protein MIMGU_mgv1a020426mg [Erythranthe guttata]
Length=588

 Score =   448 bits (1152),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 266/314 (85%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P+R+S++DIK+IT+Q SE+LGEGGYGIVYKG++++EI+VAVKVLN+S GNG
Sbjct  260   FLRDYKALKPSRFSYSDIKRITHQFSEKLGEGGYGIVYKGKLNNEIVVAVKVLNNSNGNG  319

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRL+G+CADGFRRALVYE+LPN SLEK IF   S  + L W+
Sbjct  320   EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRITLDWE  379

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K++ IALGIAKGIEYLH+GCDQQILHFDIKP N+LLDHN+NPKICDFGLAKLCSKE+SAV
Sbjct  380   KLKNIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLNPKICDFGLAKLCSKEQSAV  439

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   +    TSQ   
Sbjct  440   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN-EDRNVNHTSQV--  496

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N  G+     + D+  +IA+KL+++ LWCIQW P DRPSMK VVQMLE E
Sbjct  497   YFPQWIYNHIN-AGDNNFWSQIDEGNSIARKLSMVGLWCIQWCPTDRPSMKVVVQMLEGE  555

Query  1544  GDDLVLPSSPFAGS  1503
              DDL +P +PF  +
Sbjct  556   FDDLTMPPNPFPAT  569


 Score =   342 bits (878),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 233/332 (70%), Gaps = 8/332 (2%)
 Frame = +3

Query  114   AIVFLIIKYR--RRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             A V+L I+ R  R + ++   I  FL     L P R+SY  IK +T  F EKLGEGG+G 
Sbjct  239   AFVYLYIRVRTYRENRTM---IGKFLRDYKALKPSRFSYSDIKRITHQFSEKLGEGGYGI  295

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL +   VAVK+++    NG++F+NEV ++GRIHHVNIVRL+G+CA+  + ALVY+
Sbjct  296   VYKGKLNNEIVVAVKVLNNSNGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYE  355

Query  468   FMPNGSLDKYINQ-GAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             F+PNGSL+K I Q G+    L+W++   I +G+A+GIEYLH GCD QILHFDIKP N+LL
Sbjct  356   FLPNGSLEKSIFQAGSNRITLDWEKLKNIALGIAKGIEYLHEGCDQQILHFDIKPQNVLL  415

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D N  PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGML
Sbjct  416   DHNLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGML  475

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  +      + +S+ YFP WIYN IN G      + DE    I +K+++VGLWC
Sbjct  476   LLEMVGGRKNEDRNVNHTSQVYFPQWIYNHINAGDNNFWSQIDEGNS-IARKLSMVGLWC  534

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             IQ  P  RPSM  VV+MLEG+ + L MP + F
Sbjct  535   IQWCPTDRPSMKVVVQMLEGEFDDLTMPPNPF  566



>emb|CBI23149.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   443 bits (1140),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 210/327 (64%), Positives = 262/327 (80%), Gaps = 2/327 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   ++I ++RRRHLS+ + IE+FL    NL PIRYSY  IK +T  FK+KLG+GGFGSV
Sbjct  98    CLSAYVIYRFRRRHLSLDDSIEDFLQNHRNLQPIRYSYSEIKKITNGFKDKLGQGGFGSV  157

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRL+G+C E  K AL+YDF
Sbjct  158   YKGKLRSGCIVAVKMLVMSKTNGQDFINEVATIGRIHHVNVVRLIGFCVEGPKWALIYDF  217

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDKYI      S+ L+W+  ++I +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  218   MPNGSLDKYIFPERKNSVPLSWEILYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  277

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             + F PK+SDFGLAKL+  ++SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  278   KTFAPKVSDFGLAKLYSVNQSIVSLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLL  337

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  R     +D+SS+ YFPSWIY+ INKG+ +EMG+  EDEK+  +KM IV LWCI
Sbjct  338   MEMVGKKRYVNAHKDDSSEMYFPSWIYDRINKGEDMEMGDATEDEKKCVRKMVIVALWCI  397

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P  RPSMS+ +EMLEGD+ELL+MP
Sbjct  398   QMKPTDRPSMSKALEMLEGDIELLKMP  424


 Score =   345 bits (886),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 238/315 (76%), Gaps = 3/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+++R ++P RYS+++IKKITN   ++LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  121   FLQNHRNLQPIRYSYSEIKKITNGFKDKLGQGGFGSVYKGKLRSGCIVAVKMLVMSKTNG  180

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRL+G+C +G + AL+Y+++PN SL+KYIF     +V LSW+
Sbjct  181   QDFINEVATIGRIHHVNVVRLIGFCVEGPKWALIYDFMPNGSLDKYIFPERKNSVPLSWE  240

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
              + +IALG+ +GIEYLHQGCD QILHFDIKP NILLD    PK+ DFGLAKL S  +S V
Sbjct  241   ILYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLDKTFAPKVSDFGLAKLYSVNQSIV  300

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG ++  NA +  D+S  E 
Sbjct  301   SLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLLMEMVGKKRYVNAHK-DDSS--EM  357

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ +N+G ++++    +D++   +K+ I+ALWCIQ +P DRPSM   ++MLE +
Sbjct  358   YFPSWIYDRINKGEDMEMGDATEDEKKCVRKMVIVALWCIQMKPTDRPSMSKALEMLEGD  417

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  P   SQ
Sbjct  418   IELLKMPPKPTLYSQ  432



>emb|CBI23151.3| unnamed protein product [Vitis vinifera]
Length=552

 Score =   447 bits (1149),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 210/331 (63%), Positives = 263/331 (79%), Gaps = 1/331 (0%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   FLI K++RRHLS+ + +E FL + NNL PIRYSY  IK MT  F++KLG+GGFGSV
Sbjct  189   CLCAFLIYKFQRRHLSMDDTLEEFLQSHNNLQPIRYSYSEIKKMTNNFQDKLGQGGFGSV  248

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   KSNGQDFINEV ++GRIHHVN+VRLVG+C E SK+ALVYDF
Sbjct  249   YKGKLRSGQIVAVKMLVVSKSNGQDFINEVATIGRIHHVNVVRLVGFCTEKSKYALVYDF  308

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             M NGSLDKY+      S+ L+W+R + I +GVA GIEYLHRGC++QILHFDIKPHNILLD
Sbjct  309   MANGSLDKYVFLERENSIPLSWERLYNIALGVAHGIEYLHRGCEMQILHFDIKPHNILLD  368

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLAKL+ +D++ VTLTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  369   ENFTPKVSDFGLAKLYSSDQNAVTLTAARGTLGYIAPELFYKNIGDVSYKADVYSFGMLL  428

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             MEM+G  +      ++S  +FPSWIY+ I++G+ +EMGE  E+EK+  +K+ IV LWC+Q
Sbjct  429   MEMMGKRKYMNARAEKSEIFFPSWIYDRIDRGEDMEMGEATEEEKKYIRKIIIVALWCVQ  488

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             M P  RPSMS+ +EMLE +VELLQMP+   L
Sbjct  489   MKPTNRPSMSKALEMLESEVELLQMPSKPTL  519


 Score =   345 bits (884),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 236/315 (75%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  ++P RYS+++IKK+TN   ++LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  212   FLQSHNNLQPIRYSYSEIKKMTNNFQDKLGQGGFGSVYKGKLRSGQIVAVKMLVVSKSNG  271

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+C +  + ALVY+++ N SL+KY+F     ++ LSW+
Sbjct  272   QDFINEVATIGRIHHVNVVRLVGFCTEKSKYALVYDFMANGSLDKYVFLERENSIPLSWE  331

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++  IALG+A GIEYLH+GC+ QILHFDIKP NILLD N  PK+ DFGLAKL S +++AV
Sbjct  332   RLYNIALGVAHGIEYLHRGCEMQILHFDIKPHNILLDENFTPKVSDFGLAKLYSSDQNAV  391

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EM+G RK  NA+      + E 
Sbjct  392   TLTAARGTLGYIAPELFYKNIGDVSYKADVYSFGMLLMEMMGKRKYMNAR----AEKSEI  447

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ ++RG ++++    ++++   +K+ I+ALWC+Q +P +RPSM   ++MLE E
Sbjct  448   FFPSWIYDRIDRGEDMEMGEATEEEKKYIRKIIIVALWCVQMKPTNRPSMSKALEMLESE  507

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +PS P   S+
Sbjct  508   VELLQMPSKPTLHSK  522



>ref|XP_009348963.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=430

 Score =   442 bits (1137),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 208/332 (63%), Positives = 260/332 (78%), Gaps = 2/332 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I  +I K +RRHLS++E IE+FL  +N L P+RYSY  IK M + FK+KLGEGGFGS
Sbjct  60    PCLIALIIYKCKRRHLSMYENIEDFLQ-NNQLMPVRYSYSDIKKMARGFKDKLGEGGFGS  118

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ + K+NGQDFINEV ++GRIHHVN+V+LVG+C E S+ ALVYD
Sbjct  119   VYKAKLRSGRLVAIKMLGRSKANGQDFINEVATIGRIHHVNVVQLVGFCVEGSERALVYD  178

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I        L+ ++ FEI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  179   FMPNGSLDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLD  238

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PK+SDFGLA+L P D SIV+LTA RGTIGY+APEL  + IG +S+KADVYSFGMLL
Sbjct  239   ENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPELFYKNIGGVSYKADVYSFGMLL  298

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  +      + SS+ YFP+W++N ++ G  + +G+  E+EK+I KKM +V  WCI
Sbjct  299   MEMAGKRKNLNANIEHSSQIYFPTWVFNQLSGGNDLAIGDATEEEKKIIKKMIVVASWCI  358

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RPSM++VVEMLEG++E LQMP   FL
Sbjct  359   QMKPSDRPSMNKVVEMLEGEIESLQMPPKLFL  390


 Score =   337 bits (864),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 231/317 (73%), Gaps = 7/317 (2%)
 Frame = -1

Query  2441  LEDY---RAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKG  2271
             +ED+     + P RYS++DIKK+     ++LGEGG+G VYK ++ S  LVA+K+L  SK 
Sbjct  81    IEDFLQNNQLMPVRYSYSDIKKMARGFKDKLGEGGFGSVYKAKLRSGRLVAIKMLGRSKA  140

Query  2270  NGEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALS  2091
             NG++FINEV  IG+IHHVNVV+LVG+C +G  RALVY+++PN SL+K+IFS +   ++LS
Sbjct  141   NGQDFINEVATIGRIHHVNVVQLVGFCVEGSERALVYDFMPNGSLDKHIFSQQGV-ISLS  199

Query  2090  WKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKS  1911
              +K+ EI+LG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+LC  + S
Sbjct  200   CEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLDENFLPKVSDFGLARLCPLDNS  259

Query  1910  AVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQ  1731
              V++TA RGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EM G RKN NA    + S Q
Sbjct  260   IVSLTAVRGTIGYIAPELFYKNIGGVSYKADVYSFGMLLMEMAGKRKNLNAN--IEHSSQ  317

Query  1730  EGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FP WV+N L+ G +L I    ++++ I KK+ ++A WCIQ +P DRPSM  VV+MLE
Sbjct  318   I-YFPTWVFNQLSGGNDLAIGDATEEEKKIIKKMIVVASWCIQMKPSDRPSMNKVVEMLE  376

Query  1550  REGDDLVLPSSPFAGSQ  1500
              E + L +P   F   Q
Sbjct  377   GEIESLQMPPKLFLYPQ  393



>gb|EYU40252.1| hypothetical protein MIMGU_mgv1a024546mg [Erythranthe guttata]
Length=545

 Score =   446 bits (1148),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 265/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P+R+S++DIK+IT+Q +E+LGEGGYGIVYKG++++EI VAVKVLN+SKGNG
Sbjct  216   FLRDYKALKPSRFSYSDIKRITHQFNEKLGEGGYGIVYKGKLNNEIDVAVKVLNNSKGNG  275

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRL+G+CADGFRRALVYE+LPN SLEK IF   S  + L W+
Sbjct  276   EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRITLDWE  335

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIAKGIEYLH+GCDQQILHFDIKP N+LLDHN+NPKICDFGLAKLCSKE+SAV
Sbjct  336   KLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLNPKICDFGLAKLCSKEQSAV  395

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN       +TSQ   
Sbjct  396   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN-EDHNVNNTSQV--  452

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+I+ LWCIQW P DRPSMK VVQMLE E
Sbjct  453   YFPQWIYNHINAEDNPMWAQIDEEGNSIARKLSIVGLWCIQWCPTDRPSMKVVVQMLEGE  512

Query  1544  GDDLVLPSSPFAGS  1503
              DDL +P +PF  +
Sbjct  513   CDDLTMPPNPFPAT  526


 Score =   350 bits (899),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 236/332 (71%), Gaps = 7/332 (2%)
 Frame = +3

Query  114   AIVFLIIKYR--RRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             + V+L I+ R  R + ++   I  FL     L P R+SY  IK +T  F EKLGEGG+G 
Sbjct  195   SFVYLYIRVRIYRENRTM---IGKFLRDYKALKPSRFSYSDIKRITHQFNEKLGEGGYGI  251

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL +  DVAVK+++  K NG++F+NEV ++GRIHHVNIVRL+G+CA+  + ALVY+
Sbjct  252   VYKGKLNNEIDVAVKVLNNSKGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYE  311

Query  468   FMPNGSLDKYINQ-GAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             F+PNGSL+K I Q G+    L+W++  +I +G+A+GIEYLH GCD QILHFDIKP N+LL
Sbjct  312   FLPNGSLEKSIFQAGSNRITLDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLL  371

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D N  PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGML
Sbjct  372   DHNLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGML  431

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  +      + +S+ YFP WIYN IN        + DE+   I +K++IVGLWC
Sbjct  432   LLEMVGGRKNEDHNVNNTSQVYFPQWIYNHINAEDNPMWAQIDEEGNSIARKLSIVGLWC  491

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             IQ  P  RPSM  VV+MLEG+ + L MP + F
Sbjct  492   IQWCPTDRPSMKVVVQMLEGECDDLTMPPNPF  523



>ref|XP_010646611.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=603

 Score =   448 bits (1152),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 225/314 (72%), Positives = 266/314 (85%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ DIK+ITNQ  ++LG+GGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  269   FLEDYEALKPSRYSYVDIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CADGF+RAL+YEYLPNESLEK+IFS + KN +LSWK
Sbjct  329   EEFINEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSLSWK  388

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+I+HFDIK  NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  389   KLQEIAIGIAKGIEYLHQGCDQRIIHFDIKSHNILLDHNFNPKISDFGLAKLCSKEQSAV  448

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  449   SMTVARGTIGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESTSQV  505

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE  D  IAKKLAI+ L CIQW P+DRPSMK VVQMLE  
Sbjct  506   YFPEWIYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDRPSMKIVVQMLEGR  565

Query  1544  GDDLVLPSSPFAGS  1503
             G  L +P +PFA +
Sbjct  566   G-KLTMPPNPFAST  578


 Score =   335 bits (860),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 229/313 (73%), Gaps = 3/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL     VAVKI++  +
Sbjct  266   VKRFLEDYEALKPSRYSYVDIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQ  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I ++      L
Sbjct  326   GNGEEFINEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSL  385

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +I+HFDIK HNILLD NF PKISDFGLAKL   ++
Sbjct  386   SWKKLQEIAIGIAKGIEYLHQGCDQRIIHFDIKSHNILLDHNFNPKISDFGLAKLCSKEQ  445

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGTIGY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  446   SAVSMTVARGTIGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESTSQV  505

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E++ +  I KK+ IVGL CIQ  P+ RPSM  VV+MLEG 
Sbjct  506   YFPEWIYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDRPSMKIVVQMLEGR  565

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  566   GK-LTMPPNPFAS  577



>ref|XP_010662831.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=597

 Score =   448 bits (1152),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 270/314 (86%), Gaps = 8/314 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA+ P+RYS+ADIKKITN   ++LGEGGYG +YKG++S+E+ VAVK+LNDSK NG
Sbjct  267   FLEDYRALNPSRYSYADIKKITNLFKDKLGEGGYGTIYKGKLSNEVFVAVKILNDSKENG  326

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G+IHH+NVVRLVG+CADG++RAL+YE+LPNESLEK+IF    KN +L W+
Sbjct  327   EEFINEVRTMGRIHHINVVRLVGFCADGYKRALIYEFLPNESLEKFIF----KNQSLGWQ  382

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLD N NPKI DFGLAKLCSKE+S V
Sbjct  383   KLHDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQSVV  442

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +A    +TSQ   
Sbjct  443   SMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNSDAI-MENTSQM--  499

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL + GE+ IRIE+++D  IAK+L+I+ LWCIQW P+DRPSMK V++MLE E
Sbjct  500   YFPEWLYNHLEQNGEIHIRIEKEEDTKIAKRLSIVGLWCIQWHPIDRPSMKIVLKMLEGE  559

Query  1544  GDDLVLPSSPFAGS  1503
              D++ LP +PFA S
Sbjct  560   -DNITLPPNPFASS  572


 Score =   355 bits (911),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 244/334 (73%), Gaps = 12/334 (4%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C  V+   K ++ H    + ++ FL     L P RYSY  IK +T  FK+KLGEGG+G++
Sbjct  247   CYNVYTTDKSKKEHS---KKLQKFLEDYRALNPSRYSYADIKKITNLFKDKLGEGGYGTI  303

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKL +   VAVKI++  K NG++FINEV +MGRIHH+N+VRLVG+CA+  K AL+Y+F
Sbjct  304   YKGKLSNEVFVAVKILNDSKENGEEFINEVRTMGRIHHINVVRLVGFCADGYKRALIYEF  363

Query  471   MPNGSLDKYI--NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             +PN SL+K+I  NQ      L WQ+  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILL
Sbjct  364   LPNESLEKFIFKNQS-----LGWQKLHDIALGIAKGIEYLHQGCDQRILHFDIKPHNILL  418

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D+NF PKISDFGLAKL   ++S+V++TAARGT+GY+APE+++R  G +S+K+DVYSFGML
Sbjct  419   DQNFNPKISDFGLAKLCSKEQSVVSMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGML  478

Query  825   LMEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  + +    ++ S  YFP W+YN + +   I +  E E++ +I K+++IVGLWC
Sbjct  479   LLEMVGGRKNSDAIMENTSQMYFPEWLYNHLEQNGEIHIRIEKEEDTKIAKRLSIVGLWC  538

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             IQ  PI RPSM  V++MLEG+ + + +P + F S
Sbjct  539   IQWHPIDRPSMKIVLKMLEGE-DNITLPPNPFAS  571



>ref|XP_002322015.2| hypothetical protein POPTR_0015s02010g [Populus trichocarpa]
 ref|XP_006374120.1| hypothetical protein POPTR_0015s02010g [Populus trichocarpa]
 gb|EEF06142.2| hypothetical protein POPTR_0015s02010g [Populus trichocarpa]
 gb|ERP51917.1| hypothetical protein POPTR_0015s02010g [Populus trichocarpa]
Length=607

 Score =   448 bits (1152),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 221/314 (70%), Positives = 262/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A +PTRY++ADIK+ITN+  ++LG+G YG V+KG++S EI VAVK+LN+S GNG
Sbjct  272   FLADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTVFKGQLSDEIFVAVKILNNSTGNG  331

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +GKIHHVNV+RLVGYCADGFRRALVY+YL NESLEK+I S +    ALSW+
Sbjct  332   EEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVYDYLSNESLEKFISSEQGDATALSWE  391

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALG+AKGIEYLHQGCDQ+ILHFDIKP NILLD N NPKI DFGLAKLCSK++SAV
Sbjct  392   KLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDNFNPKISDFGLAKLCSKDQSAV  451

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV SRNFG VS+KSDVYSFGM+LLEMVGGRK  + K     +  + 
Sbjct  452   SMTTARGTLGYIAPEVFSRNFGNVSYKSDVYSFGMVLLEMVGGRKTIDDKI---ENNNQI  508

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L+ G EL+IRIE++ D  IAKKL I+ LWCIQW PVDRPSM AVVQMLE  
Sbjct  509   YFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTIVGLWCIQWHPVDRPSMNAVVQMLEGA  568

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SPFA +
Sbjct  569   GDTLTMPPSPFASA  582


 Score =   357 bits (915),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 238/315 (76%), Gaps = 6/315 (2%)
 Frame = +3

Query  171   IENFLNADNNLF-PIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKP  347
             IENFL AD   F P RY+Y  IK +T  FK+KLG+G +G+V+KG+L     VAVKI++  
Sbjct  269   IENFL-ADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTVFKGQLSDEIFVAVKILNNS  327

Query  348   KSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASL  524
               NG++F+NEVG+MG+IHHVN++RLVGYCA+  + ALVYD++ N SL+K+I+ +   A+ 
Sbjct  328   TGNGEEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVYDYLSNESLEKFISSEQGDATA  387

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L+W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   D
Sbjct  388   LSWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDNFNPKISDFGLAKLCSKD  447

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             +S V++T ARGT+GY+APE+ +R  G +S+K+DVYSFGM+L+EM+G  R  + ++ E++ 
Sbjct  448   QSAVSMTTARGTLGYIAPEVFSRNFGNVSYKSDVYSFGMVLLEMVG-GRKTIDDKIENNN  506

Query  885   --YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLE  1058
               YFP W+YN ++ G+ + +  E E + +I KK+TIVGLWCIQ  P+ RPSM+ VV+MLE
Sbjct  507   QIYFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTIVGLWCIQWHPVDRPSMNAVVQMLE  566

Query  1059  GDVELLQMPTDTFLS  1103
             G  + L MP   F S
Sbjct  567   GAGDTLTMPPSPFAS  581



>ref|XP_008345483.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Malus domestica]
 ref|XP_008363210.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Malus domestica]
Length=428

 Score =   441 bits (1135),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 261/341 (77%), Gaps = 3/341 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  I  LI K++RRHLS++  IE FL ++ N  PIRYSY  +K MT  F EKLGEGG+GS
Sbjct  63    PFVIALLIYKWQRRHLSMYSTIEEFLQSEKNFVPIRYSYSDVKKMTSKFTEKLGEGGYGS  122

Query  288   VYKGKLRSGSDVAVKIM-SKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
             V+KGKLRSG  VA+KI+ +K K+NGQDFI+EV ++GRIHHVN+V+LVGYC E SKH LVY
Sbjct  123   VFKGKLRSGRFVAIKILGNKSKANGQDFISEVATIGRIHHVNVVQLVGYCVEGSKHGLVY  182

Query  465   DFMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             DFM NGSLDKYI     +  L+ ++ +EI +GVARGIEYLH+GCD+QILHFDIKPHNILL
Sbjct  183   DFMYNGSLDKYIYSKDGSVPLSCEKMYEIALGVARGIEYLHQGCDMQILHFDIKPHNILL  242

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENF+PK+SDFGLAKL+PTD SIVTLTAARGT+GY+APEL  + IG +S+KADVYSFGML
Sbjct  243   DENFVPKVSDFGLAKLYPTDNSIVTLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGML  302

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             LMEM    +      + SS+ YFP+W+Y+  + GK +EMG+  E+EK+I K M I  LWC
Sbjct  303   LMEMASKKKNLNAFAEHSSQIYFPTWVYDQYSDGKELEMGDVAEEEKKIIKNMVITALWC  362

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEVH  1124
             IQM P  RPSM +V+EMLEGD E  QMP    L  P  E+H
Sbjct  363   IQMKPSDRPSMKKVIEMLEGDAESQQMPPKPLLF-PQQEMH  402


 Score =   337 bits (864),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 231/316 (73%), Gaps = 5/316 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVL-NDSKGN  2268
             FL+  +   P RYS++D+KK+T++ +E+LGEGGYG V+KG++ S   VA+K+L N SK N
Sbjct  87    FLQSEKNFVPIRYSYSDVKKMTSKFTEKLGEGGYGSVFKGKLRSGRFVAIKILGNKSKAN  146

Query  2267  GEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSW  2088
             G++FI+EV  IG+IHHVNVV+LVGYC +G +  LVY+++ N SL+KYI+S +  +V LS 
Sbjct  147   GQDFISEVATIGRIHHVNVVQLVGYCVEGSKHGLVYDFMYNGSLDKYIYSKDG-SVPLSC  205

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             +K+ EIALG+A+GIEYLHQGCD QILHFDIKP NILLD N  PK+ DFGLAKL   + S 
Sbjct  206   EKMYEIALGVARGIEYLHQGCDMQILHFDIKPHNILLDENFVPKVSDFGLAKLYPTDNSI  265

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VT+TAARGTMGYIAPE+  +N G VS+K+DVYSFGMLL+EM   +KN NA     +SQ  
Sbjct  266   VTLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMASKKKNLNAF-AEHSSQI-  323

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FP WVY+  + G EL++    ++++ I K + I ALWCIQ +P DRPSMK V++MLE 
Sbjct  324   -YFPTWVYDQYSDGKELEMGDVAEEEKKIIKNMVITALWCIQMKPSDRPSMKKVIEMLEG  382

Query  1547  EGDDLVLPSSPFAGSQ  1500
             + +   +P  P    Q
Sbjct  383   DAESQQMPPKPLLFPQ  398



>ref|XP_008232075.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=488

 Score =   443 bits (1140),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 213/332 (64%), Positives = 257/332 (77%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I F+I K+RRRHLS +  IE+FL +DNN  PIRYSY  IK MT  FK+KLGEGG+GS
Sbjct  126   PCLIAFVIYKWRRRHLSSYSIIEDFLQSDNNFLPIRYSYSEIKKMTGKFKDKLGEGGYGS  185

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             V+KGKLRSG  VA+K++ KPK NGQDF +EV ++GRIHHVN+V+LVGYC E    ALVYD
Sbjct  186   VFKGKLRSGRFVAIKLLGKPKGNGQDFTSEVATIGRIHHVNVVQLVGYCVEGLNRALVYD  245

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPN SLDKYI        L+ ++ +EI +GVARGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  246   FMPNSSLDKYIYTKEENMPLSCKKMYEISLGVARGIEYLHQGCDMQILHFDIKPHNILLD  305

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PKISDFGLAKL+  D SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  306   ENFNPKISDFGLAKLYSVDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLL  365

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM    +   +  + SS+ YFP W Y+  NKG  +EMG+ +E+EK+I KKM I  LWCI
Sbjct  366   MEMASRRKNFSSMVERSSQTYFPLWAYDQYNKGNDLEMGDFNEEEKKIIKKMVITALWCI  425

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RPSM++V+EML GDVE L+MP   FL
Sbjct  426   QMKPSDRPSMNKVIEMLGGDVECLKMPIRPFL  457


 Score =   343 bits (879),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 233/315 (74%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RYS+++IKK+T +  ++LGEGGYG V+KG++ S   VA+K+L   KGNG
Sbjct  150   FLQSDNNFLPIRYSYSEIKKMTGKFKDKLGEGGYGSVFKGKLRSGRFVAIKLLGKPKGNG  209

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F +EV  IG+IHHVNVV+LVGYC +G  RALVY+++PN SL+KYI++ E +N+ LS K
Sbjct  210   QDFTSEVATIGRIHHVNVVQLVGYCVEGLNRALVYDFMPNSSLDKYIYTKE-ENMPLSCK  268

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A+GIEYLHQGCD QILHFDIKP NILLD N NPKI DFGLAKL S + S V
Sbjct  269   KMYEISLGVARGIEYLHQGCDMQILHFDIKPHNILLDENFNPKISDFGLAKLYSVDNSIV  328

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGYIAPE+  +N G VS+K+DVYSFGMLL+EM   RKNF++    + S Q  
Sbjct  329   SLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMASRRKNFSSM--VERSSQT-  385

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W Y+  N+G +L++    ++++ I KK+ I ALWCIQ +P DRPSM  V++ML  +
Sbjct  386   YFPLWAYDQYNKGNDLEMGDFNEEEKKIIKKMVITALWCIQMKPSDRPSMNKVIEMLGGD  445

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  446   VECLKMPIRPFLYPQ  460



>gb|EYU21046.1| hypothetical protein MIMGU_mgv1a023761mg [Erythranthe guttata]
Length=553

 Score =   446 bits (1146),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 264/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY A++P+R+S++ IK+IT+Q +E+LGEGGYGIVYKG++++EI VAVKVLN+SKGNG
Sbjct  224   FLRDYGALKPSRFSYSAIKRITHQFNEKLGEGGYGIVYKGKLNNEIDVAVKVLNNSKGNG  283

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRL+G+CADGFRRALVYE+LPN SLEK IF   S  +AL W+
Sbjct  284   EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRIALDWE  343

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIAKGIEYLH+GCDQQILHFDIKP N+LLDHN+NPKICDFGLAKLCSKE+SAV
Sbjct  344   KLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLNPKICDFGLAKLCSKEQSAV  403

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN       +TSQ   
Sbjct  404   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN-EDHNANNTSQV--  460

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+I+ LWCIQW P DRPSMK VVQMLE E
Sbjct  461   YFPQWIYNHINVEDNPMWAQIDEEGNSIARKLSIVGLWCIQWCPTDRPSMKVVVQMLEGE  520

Query  1544  GDDLVLPSSPFAGS  1503
              DDL LP +PF  +
Sbjct  521   CDDLTLPPNPFPAT  534


 Score =   350 bits (898),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/332 (53%), Positives = 236/332 (71%), Gaps = 7/332 (2%)
 Frame = +3

Query  114   AIVFLIIKYR--RRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             A ++L I+ R  R + ++   I  FL     L P R+SY  IK +T  F EKLGEGG+G 
Sbjct  203   AFLYLYIRVRIYRENRTM---IGKFLRDYGALKPSRFSYSAIKRITHQFNEKLGEGGYGI  259

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL +  DVAVK+++  K NG++F+NEV ++GRIHHVNIVRL+G+CA+  + ALVY+
Sbjct  260   VYKGKLNNEIDVAVKVLNNSKGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYE  319

Query  468   FMPNGSLDKYINQ-GAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             F+PNGSL+K I Q G+    L+W++  +I +G+A+GIEYLH GCD QILHFDIKP N+LL
Sbjct  320   FLPNGSLEKSIFQAGSNRIALDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLL  379

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D N  PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGML
Sbjct  380   DHNLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGML  439

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  +      + +S+ YFP WIYN IN        + DE+   I +K++IVGLWC
Sbjct  440   LLEMVGGRKNEDHNANNTSQVYFPQWIYNHINVEDNPMWAQIDEEGNSIARKLSIVGLWC  499

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             IQ  P  RPSM  VV+MLEG+ + L +P + F
Sbjct  500   IQWCPTDRPSMKVVVQMLEGECDDLTLPPNPF  531



>ref|XP_008345477.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Malus domestica]
 ref|XP_008363209.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Malus domestica]
Length=440

 Score =   441 bits (1135),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 213/341 (62%), Positives = 261/341 (77%), Gaps = 3/341 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  I  LI K++RRHLS++  IE FL ++ N  PIRYSY  +K MT  F EKLGEGG+GS
Sbjct  75    PFVIALLIYKWQRRHLSMYSTIEEFLQSEKNFVPIRYSYSDVKKMTSKFTEKLGEGGYGS  134

Query  288   VYKGKLRSGSDVAVKIM-SKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
             V+KGKLRSG  VA+KI+ +K K+NGQDFI+EV ++GRIHHVN+V+LVGYC E SKH LVY
Sbjct  135   VFKGKLRSGRFVAIKILGNKSKANGQDFISEVATIGRIHHVNVVQLVGYCVEGSKHGLVY  194

Query  465   DFMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             DFM NGSLDKYI     +  L+ ++ +EI +GVARGIEYLH+GCD+QILHFDIKPHNILL
Sbjct  195   DFMYNGSLDKYIYSKDGSVPLSCEKMYEIALGVARGIEYLHQGCDMQILHFDIKPHNILL  254

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENF+PK+SDFGLAKL+PTD SIVTLTAARGT+GY+APEL  + IG +S+KADVYSFGML
Sbjct  255   DENFVPKVSDFGLAKLYPTDNSIVTLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGML  314

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             LMEM    +      + SS+ YFP+W+Y+  + GK +EMG+  E+EK+I K M I  LWC
Sbjct  315   LMEMASKKKNLNAFAEHSSQIYFPTWVYDQYSDGKELEMGDVAEEEKKIIKNMVITALWC  374

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEVH  1124
             IQM P  RPSM +V+EMLEGD E  QMP    L  P  E+H
Sbjct  375   IQMKPSDRPSMKKVIEMLEGDAESQQMPPKPLLF-PQQEMH  414


 Score =   337 bits (865),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 231/316 (73%), Gaps = 5/316 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVL-NDSKGN  2268
             FL+  +   P RYS++D+KK+T++ +E+LGEGGYG V+KG++ S   VA+K+L N SK N
Sbjct  99    FLQSEKNFVPIRYSYSDVKKMTSKFTEKLGEGGYGSVFKGKLRSGRFVAIKILGNKSKAN  158

Query  2267  GEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSW  2088
             G++FI+EV  IG+IHHVNVV+LVGYC +G +  LVY+++ N SL+KYI+S +  +V LS 
Sbjct  159   GQDFISEVATIGRIHHVNVVQLVGYCVEGSKHGLVYDFMYNGSLDKYIYSKDG-SVPLSC  217

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             +K+ EIALG+A+GIEYLHQGCD QILHFDIKP NILLD N  PK+ DFGLAKL   + S 
Sbjct  218   EKMYEIALGVARGIEYLHQGCDMQILHFDIKPHNILLDENFVPKVSDFGLAKLYPTDNSI  277

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VT+TAARGTMGYIAPE+  +N G VS+K+DVYSFGMLL+EM   +KN NA     +SQ  
Sbjct  278   VTLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMASKKKNLNA-FAEHSSQI-  335

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FP WVY+  + G EL++    ++++ I K + I ALWCIQ +P DRPSMK V++MLE 
Sbjct  336   -YFPTWVYDQYSDGKELEMGDVAEEEKKIIKNMVITALWCIQMKPSDRPSMKKVIEMLEG  394

Query  1547  EGDDLVLPSSPFAGSQ  1500
             + +   +P  P    Q
Sbjct  395   DAESQQMPPKPLLFPQ  410



>gb|EYU21067.1| hypothetical protein MIMGU_mgv1a023848mg [Erythranthe guttata]
Length=599

 Score =   447 bits (1150),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 265/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P+R+S++DIK+IT Q +E+LGEGGYGIVYKG++++EI VAVKVLN+S GNG
Sbjct  270   FLRDYKALKPSRFSYSDIKRITRQFNEKLGEGGYGIVYKGKLNNEIDVAVKVLNNSNGNG  329

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVNVVRL+G+CADGFRRALVYE+LPN SLEK IF   S  + L W+
Sbjct  330   EEFVNEVSTIGRIHHVNVVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRITLDWE  389

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIAKGIEYLH+GCDQQILHFDIKP N+LLDHN+NPKICDFGLAKLCSKE+SAV
Sbjct  390   KLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLNPKICDFGLAKLCSKEQSAV  449

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   +   +TSQ   
Sbjct  450   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN-EDRNVNNTSQV--  506

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+II LWCIQW P DRPSMKAVVQMLE E
Sbjct  507   YFPQWIYNHINAEDNPMWAQIDEEGNSIARKLSIIGLWCIQWCPTDRPSMKAVVQMLEGE  566

Query  1544  GDDLVLPSSPFAGS  1503
              DDL +P +PF  +
Sbjct  567   CDDLTMPPNPFPAT  580


 Score =   350 bits (897),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 173/330 (52%), Positives = 235/330 (71%), Gaps = 7/330 (2%)
 Frame = +3

Query  120   VFLIIKYR--RRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVY  293
             V+L I+ R  R + ++   I  FL     L P R+SY  IK +T+ F EKLGEGG+G VY
Sbjct  251   VYLYIRVRIYRENQTM---IGKFLRDYKALKPSRFSYSDIKRITRQFNEKLGEGGYGIVY  307

Query  294   KGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFM  473
             KGKL +  DVAVK+++    NG++F+NEV ++GRIHHVN+VRL+G+CA+  + ALVY+F+
Sbjct  308   KGKLNNEIDVAVKVLNNSNGNGEEFVNEVSTIGRIHHVNVVRLLGFCADGFRRALVYEFL  367

Query  474   PNGSLDKYINQ-GAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             PNGSL+K I Q G+    L+W++  +I +G+A+GIEYLH GCD QILHFDIKP N+LLD 
Sbjct  368   PNGSLEKSIFQAGSNRITLDWEKLKDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDH  427

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             N  PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+
Sbjct  428   NLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLL  487

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      + +S+ YFP WIYN IN        + DE+   I +K++I+GLWCIQ
Sbjct  488   EMVGGRKNEDRNVNNTSQVYFPQWIYNHINAEDNPMWAQIDEEGNSIARKLSIIGLWCIQ  547

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
               P  RPSM  VV+MLEG+ + L MP + F
Sbjct  548   WCPTDRPSMKAVVQMLEGECDDLTMPPNPF  577



>ref|XP_009599593.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=604

 Score =   447 bits (1150),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 230/314 (73%), Positives = 263/314 (84%), Gaps = 6/314 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA+RPTRY++AD+KK+TN   ERLGEG YG+VYKG +S+EI VAVKVLNDS GNG
Sbjct  270   FLEDYRALRPTRYTYADLKKVTNLFQERLGEGAYGVVYKGTLSNEIHVAVKVLNDSIGNG  329

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKN-VALSW  2088
             EEFINEV  +GKIHH NVVRLVGYCADGFR ALVYEYLPN++LEK IF   SK+ + L+W
Sbjct  330   EEFINEVAAMGKIHHFNVVRLVGYCADGFRNALVYEYLPNQTLEKLIFPASSKDHIILNW  389

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             KK+Q IA+GIAKG+EYLHQGCDQQILHFDIKP NILLD N+NPKI DFGLAKLCSKEKS 
Sbjct  390   KKLQNIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDRNLNPKISDFGLAKLCSKEKSV  449

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VTMT ARGTMGYIAPEV+S NFGK SHKSDVYSFGM+LLEMVGGRKNF+AK   +TSQ  
Sbjct  450   VTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAK--ANTSQM-  506

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +FPEW++  LN+G  L+IRIEEDDD  I +KLAII LWCIQW   DRPS+K V QM+E 
Sbjct  507   -NFPEWIHQQLNQGEVLKIRIEEDDDIIIVRKLAIIGLWCIQWNATDRPSIKVVTQMVEG  565

Query  1547  EGDDLVLPSSPFAG  1506
             +G +L +P  PF  
Sbjct  566   DGSNLTIP-PPFTA  578


 Score =   328 bits (842),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/307 (50%), Positives = 219/307 (71%), Gaps = 2/307 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL     L P RY+Y  +K +T  F+E+LGEG +G VYKG L +   VAVK+++   
Sbjct  267   VEKFLEDYRALRPTRYTYADLKKVTNLFQERLGEGAYGVVYKGTLSNEIHVAVKVLNDSI  326

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEV +MG+IHH N+VRLVGYCA+  ++ALVY+++PN +L+K I   +     +
Sbjct  327   GNGEEFINEVAAMGKIHHFNVVRLVGYCADGFRNALVYEYLPNQTLEKLIFPASSKDHII  386

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             LNW++   I +G+A+G+EYLH+GCD QILHFDIKP NILLD N  PKISDFGLAKL   +
Sbjct  387   LNWKKLQNIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDRNLNPKISDFGLAKLCSKE  446

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             KS+VT+T ARGT+GY+APE+++   G  SHK+DVYSFGM+L+EM+G  +    + + S  
Sbjct  447   KSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLLEMVGGRKNFDAKANTSQM  506

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
              FP WI+  +N+G+ +++  E++D+  I +K+ I+GLWCIQ +   RPS+  V +M+EGD
Sbjct  507   NFPEWIHQQLNQGEVLKIRIEEDDDIIIVRKLAIIGLWCIQWNATDRPSIKVVTQMVEGD  566

Query  1065  VELLQMP  1085
                L +P
Sbjct  567   GSNLTIP  573



>ref|XP_007010207.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY19017.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=577

 Score =   446 bits (1148),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 222/312 (71%), Positives = 266/312 (85%), Gaps = 3/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RYS+ADIK+ITNQ  E+LG+GGYG V+KG +S+++ VAVKVLN+ KGNG
Sbjct  249   FLEDYKALKPSRYSYADIKRITNQFKEKLGQGGYGTVFKGTLSNDVSVAVKVLNNFKGNG  308

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +G+IHHVNV RLVG+CADG+ RALVYEYLPNESLEK+IF+ + +N  LSW+
Sbjct  309   EEFVNEVGSMGRIHHVNVTRLVGFCADGYNRALVYEYLPNESLEKFIFAAKGENRFLSWE  368

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EIALGIAKGIEYLHQGC+Q+ILHFDIKP NILLD N  PKI DFGLAKLCSKE+SAV
Sbjct  369   KLHEIALGIAKGIEYLHQGCEQRILHFDIKPHNILLDQNFTPKISDFGLAKLCSKEQSAV  428

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T  ++ + 
Sbjct  429   SMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---TVANESQV  485

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G EL I IE++    IAKKL I+ L CIQW PVDRPSMK+VVQMLE E
Sbjct  486   YFPEWVYNRLDKGEELGIDIEDEGHHKIAKKLTIVGLRCIQWYPVDRPSMKSVVQMLEGE  545

Query  1544  GDDLVLPSSPFA  1509
              D+L +P +PFA
Sbjct  546   ADNLTMPPNPFA  557


 Score =   366 bits (939),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 175/314 (56%), Positives = 235/314 (75%), Gaps = 2/314 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FKEKLG+GG+G+V+KG L +   VAVK+++  K
Sbjct  246   IEQFLEDYKALKPSRYSYADIKRITNQFKEKLGQGGYGTVFKGTLSNDVSVAVKVLNNFK  305

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQG-AYASLL  527
              NG++F+NEVGSMGRIHHVN+ RLVG+CA+    ALVY+++PN SL+K+I         L
Sbjct  306   GNGEEFVNEVGSMGRIHHVNVTRLVGFCADGYNRALVYEYLPNESLEKFIFAAKGENRFL  365

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GC+ +ILHFDIKPHNILLD+NF PKISDFGLAKL   ++
Sbjct  366   SWEKLHEIALGIAKGIEYLHQGCEQRILHFDIKPHNILLDQNFTPKISDFGLAKLCSKEQ  425

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   VT  +ES  
Sbjct  426   SAVSMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVTVANESQV  485

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++KG+ + +  EDE   +I KK+TIVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  486   YFPEWVYNRLDKGEELGIDIEDEGHHKIAKKLTIVGLRCIQWYPVDRPSMKSVVQMLEGE  545

Query  1065  VELLQMPTDTFLSE  1106
              + L MP + F S+
Sbjct  546   ADNLTMPPNPFASK  559



>ref|XP_004305475.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=671

 Score =   449 bits (1156),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 210/335 (63%), Positives = 260/335 (78%), Gaps = 4/335 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC    LI K+RRRHLS+++ IE+FL  +NNL P+RYSY  IK MT+ FKEKLG+GG+G+
Sbjct  306   PCLTALLIYKWRRRHLSMYDDIEDFLRTNNNLMPVRYSYSDIKKMTRDFKEKLGQGGYGT  365

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK  LRSG  VA+K++ K ++NGQDFINEV ++GRIHHVN+V+L+G+C E S  ALVYD
Sbjct  366   VYKATLRSGRLVAIKMLGKSQANGQDFINEVATIGRIHHVNVVQLIGFCVEGSTRALVYD  425

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      S L++++ FEI + VARGI+YLHRGCD+QILHFDIKPHNILLD
Sbjct  426   FMPNGSLDKYIFLPQGVSTLSFKKIFEIALRVARGIDYLHRGCDMQILHFDIKPHNILLD  485

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLA+L+P D SIV+LTA RGTIGY+APEL  + IG +S+KADVYSFGMLL
Sbjct  486   ENFTPKVSDFGLARLYPLDNSIVSLTAVRGTIGYIAPELFYKNIGGVSYKADVYSFGMLL  545

Query  828   MEMLG----LNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGL  995
             MEM G    LN         S  YFPSW+ N +N+GK IE+ +  EDE +I KKM +V +
Sbjct  546   MEMAGRRKNLNAGIEYSSQFSENYFPSWVSNQLNEGKDIEIEDATEDEMKIIKKMIVVAM  605

Query  996   WCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             WCIQM P  RPSM++VVEMLEG++E LQ+P   FL
Sbjct  606   WCIQMKPSERPSMTKVVEMLEGELESLQIPPKPFL  640


 Score =   345 bits (886),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 226/315 (72%), Gaps = 1/315 (0%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL     + P RYS++DIKK+T    E+LG+GGYG VYK  + S  LVA+K+L  S+ NG
Sbjct  330   FLRTNNNLMPVRYSYSDIKKMTRDFKEKLGQGGYGTVYKATLRSGRLVAIKMLGKSQANG  389

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+G+C +G  RALVY+++PN SL+KYIF  +  +  LS+K
Sbjct  390   QDFINEVATIGRIHHVNVVQLIGFCVEGSTRALVYDFMPNGSLDKYIFLPQGVS-TLSFK  448

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             KI EIAL +A+GI+YLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+L   + S V
Sbjct  449   KIFEIALRVARGIDYLHRGCDMQILHFDIKPHNILLDENFTPKVSDFGLARLYPLDNSIV  508

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TA RGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EM G RKN NA     +   E 
Sbjct  509   SLTAVRGTIGYIAPELFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNAGIEYSSQFSEN  568

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WV N LN G +++I    +D+  I KK+ ++A+WCIQ +P +RPSM  VV+MLE E
Sbjct  569   YFPSWVSNQLNEGKDIEIEDATEDEMKIIKKMIVVAMWCIQMKPSERPSMTKVVEMLEGE  628

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  629   LESLQIPPKPFLYPQ  643



>ref|XP_009609373.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=603

 Score =   447 bits (1150),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 231/314 (74%), Positives = 261/314 (83%), Gaps = 6/314 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA+RPTRY++A+IKKITN   ERLGEG YG+VYKG +S+EI VAVKVLNDS GNG
Sbjct  269   FLEDYRALRPTRYTYAEIKKITNMFHERLGEGAYGVVYKGTLSNEIHVAVKVLNDSIGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKN-VALSW  2088
             EEFINEV  +GKIHH NV+RLVGYCADGFR ALVYEYLPN+SL+K IF   SK+ + L+W
Sbjct  329   EEFINEVAAMGKIHHFNVIRLVGYCADGFRNALVYEYLPNQSLDKLIFPARSKDHINLNW  388

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             KK+ +IA+GIAKG+EYLHQGCDQQILHFDIKP NILLDHN+NPKI DFGLAKLCSKEKS 
Sbjct  389   KKLHDIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKEKSV  448

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VTMT ARGTMGYIAPEV+S NFGK SHKSDVYSFGMLLLEMVGGRKNF+AK     S  +
Sbjct  449   VTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMLLLEMVGGRKNFDAK----ASNSQ  504

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +F EW++  LN G EL+IRIEEDDD  IA+KLAII LWCIQW   DRPS+K V QMLE 
Sbjct  505   VNFSEWIHQRLNEGEELKIRIEEDDDIIIARKLAIIGLWCIQWNATDRPSIKIVTQMLEG  564

Query  1547  EGDDLVLPSSPFAG  1506
              G +L +P  PF  
Sbjct  565   NGSNLTIP-PPFTA  577


 Score =   324 bits (830),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/307 (50%), Positives = 215/307 (70%), Gaps = 2/307 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL     L P RY+Y  IK +T  F E+LGEG +G VYKG L +   VAVK+++   
Sbjct  266   VEKFLEDYRALRPTRYTYAEIKKITNMFHERLGEGAYGVVYKGTLSNEIHVAVKVLNDSI  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL--  524
              NG++FINEV +MG+IHH N++RLVGYCA+  ++ALVY+++PN SLDK I          
Sbjct  326   GNGEEFINEVAAMGKIHHFNVIRLVGYCADGFRNALVYEYLPNQSLDKLIFPARSKDHIN  385

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             LNW++  +I +G+A+G+EYLH+GCD QILHFDIKP NILLD N  PKISDFGLAKL   +
Sbjct  386   LNWKKLHDIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKE  445

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             KS+VT+T ARGT+GY+APE+++   G  SHK+DVYSFGMLL+EM+G  +    +   S  
Sbjct  446   KSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMLLLEMVGGRKNFDAKASNSQV  505

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
              F  WI+  +N+G+ +++  E++D+  I +K+ I+GLWCIQ +   RPS+  V +MLEG+
Sbjct  506   NFSEWIHQRLNEGEELKIRIEEDDDIIIARKLAIIGLWCIQWNATDRPSIKIVTQMLEGN  565

Query  1065  VELLQMP  1085
                L +P
Sbjct  566   GSNLTIP  572



>ref|XP_002264064.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=596

 Score =   447 bits (1149),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 222/313 (71%), Positives = 263/313 (84%), Gaps = 4/313 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RYS+AD+KKITN   E+LG+GGYG VYKGR+S ++LVAVK+LN+SK NG
Sbjct  261   FLEDYKALKPSRYSYADVKKITNHFKEKLGQGGYGTVYKGRLSRDVLVAVKILNNSKENG  320

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHHVNVVRLVG+CADG +RAL+YE+LPNESLEKYIFS   K+ +L W+
Sbjct  321   EEFINEVGTMGRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKYIFSKSVKDCSLRWE  380

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
              +Q I LGIAKGIEYLHQGCD++ILHFDIKP NILLD N NPKI DFGLAKLCSKE+SAV
Sbjct  381   TLQNIVLGIAKGIEYLHQGCDKRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQSAV  440

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV+SRNFG VS+KSD+YSFGMLLLEMVGGRKN +    T     + 
Sbjct  441   SMTTARGTMGYIAPEVLSRNFGNVSYKSDIYSFGMLLLEMVGGRKNIDV---TMEKANQV  497

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G E+ IRIEED D  IAKKL I+ LWCIQW P+DRPS+K V+QMLE  
Sbjct  498   YFPEWVYNQLDKGEEVCIRIEEDGDIKIAKKLTIVGLWCIQWCPIDRPSIKVVIQMLEG-  556

Query  1544  GDDLVLPSSPFAG  1506
             GD L +P +PFA 
Sbjct  557   GDKLTMPPNPFAS  569


 Score =   362 bits (930),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 235/313 (75%), Gaps = 3/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  +K +T  FKEKLG+GG+G+VYKG+L     VAVKI++  K
Sbjct  258   IEQFLEDYKALKPSRYSYADVKKITNHFKEKLGQGGYGTVYKGRLSRDVLVAVKILNNSK  317

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEVG+MGRIHHVN+VRLVG+CA+  K AL+Y+F+PN SL+KYI ++      L
Sbjct  318   ENGEEFINEVGTMGRIHHVNVVRLVGFCADGVKRALIYEFLPNESLEKYIFSKSVKDCSL  377

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W+    IV+G+A+GIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   ++
Sbjct  378   RWETLQNIVLGIAKGIEYLHQGCDKRILHFDIKPHNILLDQNFNPKISDFGLAKLCSKEQ  437

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGT+GY+APE+++R  G +S+K+D+YSFGMLL+EM+G  +   VT +  +  
Sbjct  438   SAVSMTTARGTMGYIAPEVLSRNFGNVSYKSDIYSFGMLLLEMVGGRKNIDVTMEKANQV  497

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++KG+ + +  E++ + +I KK+TIVGLWCIQ  PI RPS+  V++MLEG 
Sbjct  498   YFPEWVYNQLDKGEEVCIRIEEDGDIKIAKKLTIVGLWCIQWCPIDRPSIKVVIQMLEGG  557

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  558   -DKLTMPPNPFAS  569



>ref|XP_011003876.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Populus euphratica]
Length=609

 Score =   447 bits (1151),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 261/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A +PTRY++ADIK+ITN+  ++LG+G YG V+KG++S EI VAVK+LN+S GNG
Sbjct  274   FLADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTVFKGQLSDEIFVAVKILNNSTGNG  333

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +GKIHHVNV+RLVGYCADGFRRALVY+YL NESLEK+I S      ALSW+
Sbjct  334   EEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVYDYLSNESLEKFISSEHGDATALSWE  393

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALG+AKGIEYLHQGCDQ+ILHFDIKP NILLD N NPKI DFGLAKLCSK++SAV
Sbjct  394   KLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDNFNPKISDFGLAKLCSKDQSAV  453

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV SRNFG VS+KSDVYSFGM+LLEMVGGRK  + K     +  + 
Sbjct  454   SMTTARGTLGYIAPEVFSRNFGNVSYKSDVYSFGMVLLEMVGGRKTIDDKI---ENNNQI  510

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L+ G EL+IRIE++ D  IAKKL ++ LWCIQW PVDRPSM AVVQMLE  
Sbjct  511   YFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTVVGLWCIQWHPVDRPSMNAVVQMLEGA  570

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SPFA +
Sbjct  571   GDTLTMPPSPFASA  584


 Score =   355 bits (912),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 238/315 (76%), Gaps = 6/315 (2%)
 Frame = +3

Query  171   IENFLNADNNLF-PIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKP  347
             IENFL AD   F P RY+Y  IK +T  FK+KLG+G +G+V+KG+L     VAVKI++  
Sbjct  271   IENFL-ADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTVFKGQLSDEIFVAVKILNNS  329

Query  348   KSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASL  524
               NG++F+NEVG+MG+IHHVN++RLVGYCA+  + ALVYD++ N SL+K+I+ +   A+ 
Sbjct  330   TGNGEEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVYDYLSNESLEKFISSEHGDATA  389

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L+W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   D
Sbjct  390   LSWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDNFNPKISDFGLAKLCSKD  449

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             +S V++T ARGT+GY+APE+ +R  G +S+K+DVYSFGM+L+EM+G  R  + ++ E++ 
Sbjct  450   QSAVSMTTARGTLGYIAPEVFSRNFGNVSYKSDVYSFGMVLLEMVG-GRKTIDDKIENNN  508

Query  885   --YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLE  1058
               YFP W+YN ++ G+ + +  E E + +I KK+T+VGLWCIQ  P+ RPSM+ VV+MLE
Sbjct  509   QIYFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTVVGLWCIQWHPVDRPSMNAVVQMLE  568

Query  1059  GDVELLQMPTDTFLS  1103
             G  + L MP   F S
Sbjct  569   GAGDTLTMPPSPFAS  583



>ref|XP_009796757.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana sylvestris]
Length=603

 Score =   447 bits (1149),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 228/314 (73%), Positives = 261/314 (83%), Gaps = 6/314 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA+RPTRY++AD+KK+TN   ERLGEG YG+VYKG +S+EI VAVKVLNDS GNG
Sbjct  269   FLEDYRALRPTRYTYADLKKVTNLFQERLGEGAYGVVYKGTLSNEIHVAVKVLNDSIGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKN-VALSW  2088
             EEFINEV  +GKIHH NVVRLVGYCADGFR ALVYEYLPN++L+K IF   SK+ + L+W
Sbjct  329   EEFINEVAAMGKIHHFNVVRLVGYCADGFRNALVYEYLPNQTLDKLIFPASSKDRIILNW  388

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             KK+Q+IA+GI KG+EYLHQGCDQQILHFDIKP NILLDHN+NPKI DFGLAKLCSKEKS 
Sbjct  389   KKLQDIAMGIGKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKEKSV  448

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VTMT ARGTMGYIAPEV+S NFGK SHKSDVYSFGM+L EMVGGRKNF+AK     S  +
Sbjct  449   VTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLHEMVGGRKNFDAK----ASNSQ  504

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +FPEW++  LN G EL+IRIEEDDD  I +KLAII LWCIQW   DRPS+K V QMLE 
Sbjct  505   VNFPEWIHQQLNEGEELKIRIEEDDDIIIVRKLAIIGLWCIQWNATDRPSIKVVTQMLEG  564

Query  1547  EGDDLVLPSSPFAG  1506
             +G +L +P  PF  
Sbjct  565   DGSNLTIP-PPFTA  577


 Score =   327 bits (838),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 217/307 (71%), Gaps = 2/307 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL     L P RY+Y  +K +T  F+E+LGEG +G VYKG L +   VAVK+++   
Sbjct  266   VEKFLEDYRALRPTRYTYADLKKVTNLFQERLGEGAYGVVYKGTLSNEIHVAVKVLNDSI  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEV +MG+IHH N+VRLVGYCA+  ++ALVY+++PN +LDK I   +     +
Sbjct  326   GNGEEFINEVAAMGKIHHFNVVRLVGYCADGFRNALVYEYLPNQTLDKLIFPASSKDRII  385

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             LNW++  +I +G+ +G+EYLH+GCD QILHFDIKP NILLD N  PKISDFGLAKL   +
Sbjct  386   LNWKKLQDIAMGIGKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKISDFGLAKLCSKE  445

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             KS+VT+T ARGT+GY+APE+++   G  SHK+DVYSFGM+L EM+G  +    +   S  
Sbjct  446   KSVVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMMLHEMVGGRKNFDAKASNSQV  505

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
              FP WI+  +N+G+ +++  E++D+  I +K+ I+GLWCIQ +   RPS+  V +MLEGD
Sbjct  506   NFPEWIHQQLNEGEELKIRIEEDDDIIIVRKLAIIGLWCIQWNATDRPSIKVVTQMLEGD  565

Query  1065  VELLQMP  1085
                L +P
Sbjct  566   GSNLTIP  572



>gb|EYU37102.1| hypothetical protein MIMGU_mgv1a023653mg, partial [Erythranthe 
guttata]
Length=439

 Score =   441 bits (1134),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 266/314 (85%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P+R+S++DIK+IT+Q SE+LGEGGYGIVYKG++++EI+V+VKVLN+S GNG
Sbjct  111   FLRDYKALKPSRFSYSDIKRITHQFSEKLGEGGYGIVYKGKLNNEIVVSVKVLNNSNGNG  170

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRL+G+CADGFRRALVYE+LPN SLEK IF   S  + L W+
Sbjct  171   EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRITLDWE  230

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIAKGIEYLH+GC+QQILHFDIKP N+LLDHN+NPKICDFGLAKLCSKE+SAV
Sbjct  231   KLKDIALGIAKGIEYLHEGCEQQILHFDIKPQNVLLDHNLNPKICDFGLAKLCSKEQSAV  290

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARG MGYIAPEV+SR FG+VS+KSDVYSFG+LLLEMVGGRK  N     D + Q  
Sbjct  291   TMTAARGKMGYIAPEVLSRTFGRVSYKSDVYSFGLLLLEMVGGRK--NEDHNVDNTSQV-  347

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N   +  +  + ++  +IA+KL+I+ LWCIQW P DRPSMKAVVQMLE E
Sbjct  348   YFPQWIYNHIN-AEDNPLWAKNEEGNSIARKLSIVGLWCIQWCPTDRPSMKAVVQMLEGE  406

Query  1544  GDDLVLPSSPFAGS  1503
              DDL +P +PF  +
Sbjct  407   CDDLTMPPNPFPAT  420


 Score =   340 bits (871),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/332 (52%), Positives = 235/332 (71%), Gaps = 8/332 (2%)
 Frame = +3

Query  114   AIVFLIIKYR--RRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             A V+L I+ R  R + ++   I  FL     L P R+SY  IK +T  F EKLGEGG+G 
Sbjct  90    AFVYLYIRVRTYRENRTM---IGKFLRDYKALKPSRFSYSDIKRITHQFSEKLGEGGYGI  146

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKL +   V+VK+++    NG++F+NEV ++GRIHHVNIVRL+G+CA+  + ALVY+
Sbjct  147   VYKGKLNNEIVVSVKVLNNSNGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYE  206

Query  468   FMPNGSLDKYINQ-GAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             F+PNGSL+K I Q G+    L+W++  +I +G+A+GIEYLH GC+ QILHFDIKP N+LL
Sbjct  207   FLPNGSLEKSIFQAGSNRITLDWEKLKDIALGIAKGIEYLHEGCEQQILHFDIKPQNVLL  266

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D N  PKI DFGLAKL   ++S VT+TAARG +GY+APE+++R  G +S+K+DVYSFG+L
Sbjct  267   DHNLNPKICDFGLAKLCSKEQSAVTMTAARGKMGYIAPEVLSRTFGRVSYKSDVYSFGLL  326

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  +      D +S+ YFP WIYN IN  +   +  ++E+   I +K++IVGLWC
Sbjct  327   LLEMVGGRKNEDHNVDNTSQVYFPQWIYNHIN-AEDNPLWAKNEEGNSIARKLSIVGLWC  385

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             IQ  P  RPSM  VV+MLEG+ + L MP + F
Sbjct  386   IQWCPTDRPSMKAVVQMLEGECDDLTMPPNPF  417



>ref|XP_011003875.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Populus euphratica]
Length=608

 Score =   447 bits (1149),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 261/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A +PTRY++ADIK+ITN+  ++LG+G YG V+KG++S EI VAVK+LN+S GNG
Sbjct  273   FLADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTVFKGQLSDEIFVAVKILNNSTGNG  332

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +GKIHHVNV+RLVGYCADGFRRALVY+YL NESLEK+I S      ALSW+
Sbjct  333   EEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVYDYLSNESLEKFISSEHGDATALSWE  392

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALG+AKGIEYLHQGCDQ+ILHFDIKP NILLD N NPKI DFGLAKLCSK++SAV
Sbjct  393   KLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDNFNPKISDFGLAKLCSKDQSAV  452

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV SRNFG VS+KSDVYSFGM+LLEMVGGRK  + K     +  + 
Sbjct  453   SMTTARGTLGYIAPEVFSRNFGNVSYKSDVYSFGMVLLEMVGGRKTIDDKI---ENNNQI  509

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L+ G EL+IRIE++ D  IAKKL ++ LWCIQW PVDRPSM AVVQMLE  
Sbjct  510   YFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTVVGLWCIQWHPVDRPSMNAVVQMLEGA  569

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SPFA +
Sbjct  570   GDTLTMPPSPFASA  583


 Score =   355 bits (911),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 238/315 (76%), Gaps = 6/315 (2%)
 Frame = +3

Query  171   IENFLNADNNLF-PIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKP  347
             IENFL AD   F P RY+Y  IK +T  FK+KLG+G +G+V+KG+L     VAVKI++  
Sbjct  270   IENFL-ADYKAFKPTRYTYADIKRITNEFKDKLGQGAYGTVFKGQLSDEIFVAVKILNNS  328

Query  348   KSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASL  524
               NG++F+NEVG+MG+IHHVN++RLVGYCA+  + ALVYD++ N SL+K+I+ +   A+ 
Sbjct  329   TGNGEEFVNEVGTMGKIHHVNVIRLVGYCADGFRRALVYDYLSNESLEKFISSEHGDATA  388

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L+W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   D
Sbjct  389   LSWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDNFNPKISDFGLAKLCSKD  448

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             +S V++T ARGT+GY+APE+ +R  G +S+K+DVYSFGM+L+EM+G  R  + ++ E++ 
Sbjct  449   QSAVSMTTARGTLGYIAPEVFSRNFGNVSYKSDVYSFGMVLLEMVG-GRKTIDDKIENNN  507

Query  885   --YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLE  1058
               YFP W+YN ++ G+ + +  E E + +I KK+T+VGLWCIQ  P+ RPSM+ VV+MLE
Sbjct  508   QIYFPEWVYNSLDNGEELRIRIEKEGDAQIAKKLTVVGLWCIQWHPVDRPSMNAVVQMLE  567

Query  1059  GDVELLQMPTDTFLS  1103
             G  + L MP   F S
Sbjct  568   GAGDTLTMPPSPFAS  582



>ref|XP_008232188.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=697

 Score =   450 bits (1157),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 212/332 (64%), Positives = 265/332 (80%), Gaps = 2/332 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PCAI F+I K++RRHLS+ + IE+FL  +N L P+RYSY +IK M K FKEKLGEGG+GS
Sbjct  240   PCAIAFIIYKWKRRHLSMHDNIEDFLQ-NNKLMPVRYSYSNIKKMAKGFKEKLGEGGYGS  298

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+VRL+G+C E S  AL+YD
Sbjct  299   VYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVRLIGFCVEGSTRALIYD  358

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKY+        LN ++ FEI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  359   FMPNGSLDKYLFSQQGVISLNCEKMFEIALGVARGIEYLHRGCDMQILHFDIKPHNILLD  418

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PK+SDFGLA+L P D SIV+LTAARGTIGY+APEL  + IG IS+KADVYSFGMLL
Sbjct  419   ENFLPKVSDFGLARLCPLDNSIVSLTAARGTIGYIAPELFYKNIGGISYKADVYSFGMLL  478

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  +      ++SS+ YFP+W+++ ++ GK I++ +  E+E++I KKM IV LWCI
Sbjct  479   MEMAGRRKNLNATIEKSSQIYFPTWVFDQLSDGKDIKVEDATEEEEKIIKKMIIVALWCI  538

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RPSM++ VEMLEG++E L+MP   FL
Sbjct  539   QMKPSDRPSMNKAVEMLEGEIECLEMPPKPFL  570


 Score =   340 bits (872),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 234/315 (74%), Gaps = 5/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL++ + + P RYS+++IKK+     E+LGEGGYG VYK ++ S  LVA+K+L  SK NG
Sbjct  264   FLQNNK-LMPVRYSYSNIKKMAKGFKEKLGEGGYGSVYKAKLRSGRLVAIKMLGKSKANG  322

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRL+G+C +G  RAL+Y+++PN SL+KY+FS +   ++L+ +
Sbjct  323   QDFINEVATIGRIHHVNVVRLIGFCVEGSTRALIYDFMPNGSLDKYLFSQQGV-ISLNCE  381

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+LC  + S V
Sbjct  382   KMFEIALGVARGIEYLHRGCDMQILHFDIKPHNILLDENFLPKVSDFGLARLCPLDNSIV  441

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G +S+K+DVYSFGMLL+EM G RKN NA   T     + 
Sbjct  442   SLTAARGTIGYIAPELFYKNIGGISYKADVYSFGMLLMEMAGRRKNLNA---TIEKSSQI  498

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WV++ L+ G ++++    +++E I KK+ I+ALWCIQ +P DRPSM   V+MLE E
Sbjct  499   YFPTWVFDQLSDGKDIKVEDATEEEEKIIKKMIIVALWCIQMKPSDRPSMNKAVEMLEGE  558

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  559   IECLEMPPKPFLYPQ  573



>ref|XP_010275239.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nelumbo nucifera]
Length=617

 Score =   447 bits (1150),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 226/333 (68%), Positives = 275/333 (83%), Gaps = 6/333 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DY+A++P+RYS+A+IK+ITN   ++LG+GGYG V+KG +S++ILVAVKVLN+SKGNG
Sbjct  281   FLDDYKALKPSRYSYAEIKRITNNFKDKLGQGGYGSVFKGNLSNDILVAVKVLNNSKGNG  340

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG IG+IHHVNVVRLVG+CADGFRRALVYE+LPNESLEK+IFS ++KN +L W+
Sbjct  341   EEFINEVGTIGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSRDAKNPSLGWE  400

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+  IA+GIAKGI+YLHQGC+Q+ILHFDIKP NILLDH++NPKI DFGLAKLCSK+ S V
Sbjct  401   KLHIIAVGIAKGIDYLHQGCEQRILHFDIKPHNILLDHSLNPKISDFGLAKLCSKDVSVV  460

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV SRNFG VS+KSDVYSFGMLLLEMVGGRKN + +    TSQ   
Sbjct  461   SMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDLR-AERTSQV--  517

Query  1724  SFPEWVYNHLNRGGELQIRiee--dddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
              FPEW+YN L +G EL+IR +E  D +  I KKL  +ALWCIQW P DRPSMK VVQMLE
Sbjct  518   YFPEWIYNRLIQGEELEIREDEDGDSNSRIVKKLTTVALWCIQWYPADRPSMKDVVQMLE  577

Query  1550  REGDDLVLPSSPFAGSQM*ITTIVIYVLLPLRQ  1452
              + + L +P +PFA +   I T ++    PL Q
Sbjct  578   GDAESLSMPPNPFASATS-INTSMLNTKKPLHQ  609


 Score =   354 bits (909),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/316 (55%), Positives = 233/316 (74%), Gaps = 6/316 (2%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL+    L P RYSY  IK +T  FK+KLG+GG+GSV+KG L +   VAVK+++  K
Sbjct  278   VEKFLDDYKALKPSRYSYAEIKRITNNFKDKLGQGGYGSVFKGNLSNDILVAVKVLNNSK  337

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEVG++GRIHHVN+VRLVG+CA+  + ALVY+F+PN SL+K+I ++ A    L
Sbjct  338   GNGEEFINEVGTIGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSRDAKNPSL  397

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++   I VG+A+GI+YLH+GC+ +ILHFDIKPHNILLD +  PKISDFGLAKL   D 
Sbjct  398   GWEKLHIIAVGIAKGIDYLHQGCEQRILHFDIKPHNILLDHSLNPKISDFGLAKLCSKDV  457

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S+V++TAARGT+GY+APE+ +R  G +S+K+DVYSFGMLL+EM+G  +      + +S+ 
Sbjct  458   SVVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDLRAERTSQV  517

Query  885   YFPSWIYNDINKGKAIEMGEEDED---EKRITKKMTIVGLWCIQMSPIPRPSMSRVVEML  1055
             YFP WIYN + +G+ +E+  EDED     RI KK+T V LWCIQ  P  RPSM  VV+ML
Sbjct  518   YFPEWIYNRLIQGEELEI-REDEDGDSNSRIVKKLTTVALWCIQWYPADRPSMKDVVQML  576

Query  1056  EGDVELLQMPTDTFLS  1103
             EGD E L MP + F S
Sbjct  577   EGDAESLSMPPNPFAS  592



>gb|EYU21042.1| hypothetical protein MIMGU_mgv1a020230mg, partial [Erythranthe 
guttata]
Length=499

 Score =   443 bits (1139),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 213/314 (68%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P+R+S++DIK+IT+Q +E+LGEGGYGIVYKG++++EI VAVKVLN+SKGNG
Sbjct  170   FLRDYKALKPSRFSYSDIKRITHQFNEKLGEGGYGIVYKGKLNNEIDVAVKVLNNSKGNG  229

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRL+G+CADGFRRALVYE+LPN SLEK IF   S  + L W+
Sbjct  230   EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRITLDWE  289

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K++ IALGIAKGIEYLH+GCDQQILHFDI P N+LLDHN+NPKICDFGLAKLCSKE+SAV
Sbjct  290   KLKVIALGIAKGIEYLHEGCDQQILHFDINPQNVLLDHNLNPKICDFGLAKLCSKEQSAV  349

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   ++    +  + 
Sbjct  350   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN---EDHNVNNTSQV  406

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+I+ LWCIQW P DRPSMK VVQMLE E
Sbjct  407   YFPQWIYNHINAEDNPMWAQIDEEGNSIARKLSIVGLWCIQWCPADRPSMKVVVQMLEGE  466

Query  1544  GDDLVLPSSPFAGS  1503
              DDL +P +PF  +
Sbjct  467   CDDLTMPPNPFPAT  480


 Score =   346 bits (887),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 223/309 (72%), Gaps = 2/309 (1%)
 Frame = +3

Query  177   NFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPKSN  356
             +FL     L P R+SY  IK +T  F EKLGEGG+G VYKGKL +  DVAVK+++  K N
Sbjct  169   HFLRDYKALKPSRFSYSDIKRITHQFNEKLGEGGYGIVYKGKLNNEIDVAVKVLNNSKGN  228

Query  357   GQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQ-GAYASLLNW  533
             G++F+NEV ++GRIHHVNIVRL+G+CA+  + ALVY+F+PNGSL+K I Q G+    L+W
Sbjct  229   GEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRITLDW  288

Query  534   QRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDKSI  713
             ++   I +G+A+GIEYLH GCD QILHFDI P N+LLD N  PKI DFGLAKL   ++S 
Sbjct  289   EKLKVIALGIAKGIEYLHEGCDQQILHFDINPQNVLLDHNLNPKICDFGLAKLCSKEQSA  348

Query  714   VTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-YF  890
             VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +      + +S+ YF
Sbjct  349   VTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKNEDHNVNNTSQVYF  408

Query  891   PSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVE  1070
             P WIYN IN        + DE+   I +K++IVGLWCIQ  P  RPSM  VV+MLEG+ +
Sbjct  409   PQWIYNHINAEDNPMWAQIDEEGNSIARKLSIVGLWCIQWCPADRPSMKVVVQMLEGECD  468

Query  1071  LLQMPTDTF  1097
              L MP + F
Sbjct  469   DLTMPPNPF  477



>ref|XP_004306407.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=376

 Score =   438 bits (1127),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 209/337 (62%), Positives = 265/337 (79%), Gaps = 8/337 (2%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P     LI K+RRRHLS++E IE+FL ++ NL P+RYSY  IK M   FK++LG GGFG 
Sbjct  9     PFITALLIYKWRRRHLSMYEKIEDFLQSNINLMPVRYSYSDIKKMANGFKDRLGGGGFGI  68

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++S+ K+NG+DFINEV ++GRIHHVN+VRL+G+CA+ SK ALVYD
Sbjct  69    VYKAKLRSGRLVAIKMLSESKTNGEDFINEVATIGRIHHVNVVRLIGFCADRSKRALVYD  128

Query  468   FMPNGSLDKYI--NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNIL  641
             FM NGSL+K+I   QGA +  L+ ++ FEI VGVARGI+YLH+GCD++ILHFD+KPHNIL
Sbjct  129   FMSNGSLEKHIFAQQGAIS--LSCEKIFEIAVGVARGIQYLHQGCDMRILHFDLKPHNIL  186

Query  642   LDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGM  821
             LD+NF  KISDFGLA+L+P D SIV+LTAARGTIGY+APEL  + IG +S+KADVYSFGM
Sbjct  187   LDDNFTAKISDFGLARLYPLDNSIVSLTAARGTIGYMAPELFYKNIGGVSYKADVYSFGM  246

Query  822   LLMEMLGLNRTPVTEQDESSK----YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIV  989
             L++EM G  +      D SS+    YFP+W+ + +N+GK IE+G+  EDE +I KKM IV
Sbjct  247   LMLEMAGRRKNLNAAIDHSSEFSQMYFPTWVSDQLNQGKEIEVGDFTEDEMKIIKKMIIV  306

Query  990   GLWCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
              LWCIQM P+ RPSMS+VVEMLEGD+E LQ+P   FL
Sbjct  307   ALWCIQMKPVERPSMSKVVEMLEGDIESLQIPPKPFL  343


 Score =   344 bits (883),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 173/315 (55%), Positives = 234/315 (74%), Gaps = 1/315 (0%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS++DIKK+ N   +RLG GG+GIVYK ++ S  LVA+K+L++SK NG
Sbjct  33    FLQSNINLMPVRYSYSDIKKMANGFKDRLGGGGFGIVYKAKLRSGRLVAIKMLSESKTNG  92

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             E+FINEV  IG+IHHVNVVRL+G+CAD  +RALVY+++ N SLEK+IF+ +   ++LS +
Sbjct  93    EDFINEVATIGRIHHVNVVRLIGFCADRSKRALVYDFMSNGSLEKHIFAQQGA-ISLSCE  151

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             KI EIA+G+A+GI+YLHQGCD +ILHFD+KP NILLD N   KI DFGLA+L   + S V
Sbjct  152   KIFEIAVGVARGIQYLHQGCDMRILHFDLKPHNILLDDNFTAKISDFGLARLYPLDNSIV  211

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  +N G VS+K+DVYSFGML+LEM G RKN NA     +   + 
Sbjct  212   SLTAARGTIGYMAPELFYKNIGGVSYKADVYSFGMLMLEMAGRRKNLNAAIDHSSEFSQM  271

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WV + LN+G E+++    +D+  I KK+ I+ALWCIQ +PV+RPSM  VV+MLE +
Sbjct  272   YFPTWVSDQLNQGKEIEVGDFTEDEMKIIKKMIIVALWCIQMKPVERPSMSKVVEMLEGD  331

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  332   IESLQIPPKPFLYPQ  346



>ref|XP_010275238.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nelumbo nucifera]
Length=626

 Score =   447 bits (1150),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 226/333 (68%), Positives = 275/333 (83%), Gaps = 6/333 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DY+A++P+RYS+A+IK+ITN   ++LG+GGYG V+KG +S++ILVAVKVLN+SKGNG
Sbjct  290   FLDDYKALKPSRYSYAEIKRITNNFKDKLGQGGYGSVFKGNLSNDILVAVKVLNNSKGNG  349

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG IG+IHHVNVVRLVG+CADGFRRALVYE+LPNESLEK+IFS ++KN +L W+
Sbjct  350   EEFINEVGTIGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSRDAKNPSLGWE  409

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+  IA+GIAKGI+YLHQGC+Q+ILHFDIKP NILLDH++NPKI DFGLAKLCSK+ S V
Sbjct  410   KLHIIAVGIAKGIDYLHQGCEQRILHFDIKPHNILLDHSLNPKISDFGLAKLCSKDVSVV  469

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV SRNFG VS+KSDVYSFGMLLLEMVGGRKN + +    TSQ   
Sbjct  470   SMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDLR-AERTSQV--  526

Query  1724  SFPEWVYNHLNRGGELQIRiee--dddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
              FPEW+YN L +G EL+IR +E  D +  I KKL  +ALWCIQW P DRPSMK VVQMLE
Sbjct  527   YFPEWIYNRLIQGEELEIREDEDGDSNSRIVKKLTTVALWCIQWYPADRPSMKDVVQMLE  586

Query  1550  REGDDLVLPSSPFAGSQM*ITTIVIYVLLPLRQ  1452
              + + L +P +PFA +   I T ++    PL Q
Sbjct  587   GDAESLSMPPNPFASATS-INTSMLNTKKPLHQ  618


 Score =   354 bits (909),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 175/316 (55%), Positives = 233/316 (74%), Gaps = 6/316 (2%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL+    L P RYSY  IK +T  FK+KLG+GG+GSV+KG L +   VAVK+++  K
Sbjct  287   VEKFLDDYKALKPSRYSYAEIKRITNNFKDKLGQGGYGSVFKGNLSNDILVAVKVLNNSK  346

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEVG++GRIHHVN+VRLVG+CA+  + ALVY+F+PN SL+K+I ++ A    L
Sbjct  347   GNGEEFINEVGTIGRIHHVNVVRLVGFCADGFRRALVYEFLPNESLEKFIFSRDAKNPSL  406

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++   I VG+A+GI+YLH+GC+ +ILHFDIKPHNILLD +  PKISDFGLAKL   D 
Sbjct  407   GWEKLHIIAVGIAKGIDYLHQGCEQRILHFDIKPHNILLDHSLNPKISDFGLAKLCSKDV  466

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S+V++TAARGT+GY+APE+ +R  G +S+K+DVYSFGMLL+EM+G  +      + +S+ 
Sbjct  467   SVVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDLRAERTSQV  526

Query  885   YFPSWIYNDINKGKAIEMGEEDED---EKRITKKMTIVGLWCIQMSPIPRPSMSRVVEML  1055
             YFP WIYN + +G+ +E+  EDED     RI KK+T V LWCIQ  P  RPSM  VV+ML
Sbjct  527   YFPEWIYNRLIQGEELEI-REDEDGDSNSRIVKKLTTVALWCIQWYPADRPSMKDVVQML  585

Query  1056  EGDVELLQMPTDTFLS  1103
             EGD E L MP + F S
Sbjct  586   EGDAESLSMPPNPFAS  601



>emb|CBI23152.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   443 bits (1140),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 267/314 (85%), Gaps = 7/314 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+ADIKKIT+Q    LG+GGYG VYKG++S+E+LVAVK+LN+ +GNG
Sbjct  185   FLEDYRALKPSRYSYADIKKITDQFKYILGQGGYGTVYKGKLSNEVLVAVKILNNFRGNG  244

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINE+  +G+IHHVNVVRLVG+CADG RRAL++E+LPN+SL K+IFS +    +L W+
Sbjct  245   EEFINEMATMGRIHHVNVVRLVGFCADGMRRALIFEFLPNDSLNKFIFSAKH---SLVWE  301

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIAKG+EYLHQGC+Q+ILHFDIKP NILLDHN NPKI DFGLAKLCSK++SAV
Sbjct  302   KLQDIAIGIAKGMEYLHQGCEQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKDQSAV  361

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMV GRKN    + T  +  + 
Sbjct  362   SMTIARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVSGRKN---SDVTAENPSQV  418

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHLN+G EL IRI E+ D  IAKKLAI+ LWCIQW PVDRPSMK VVQMLE E
Sbjct  419   YFPEWIYNHLNQGEELHIRIMENRDATIAKKLAIVGLWCIQWYPVDRPSMKLVVQMLEGE  478

Query  1544  GDDLVLPSSPFAGS  1503
              D+L +P +PFA +
Sbjct  479   -DNLTMPPNPFAST  491


 Score =   348 bits (893),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 231/312 (74%), Gaps = 4/312 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FK  LG+GG+G+VYKGKL +   VAVKI++  +
Sbjct  182   IEKFLEDYRALKPSRYSYADIKKITDQFKYILGQGGYGTVYKGKLSNEVLVAVKILNNFR  241

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASLLN  530
              NG++FINE+ +MGRIHHVN+VRLVG+CA+  + AL+++F+PN SL+K+I    ++  L 
Sbjct  242   GNGEEFINEMATMGRIHHVNVVRLVGFCADGMRRALIFEFLPNDSLNKFIFSAKHS--LV  299

Query  531   WQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDKS  710
             W++  +I +G+A+G+EYLH+GC+ +ILHFDIKPHNILLD NF PKISDFGLAKL   D+S
Sbjct  300   WEKLQDIAIGIAKGMEYLHQGCEQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKDQS  359

Query  711   IVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEML-GLNRTPVTEQDESSKY  887
              V++T ARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+ G   + VT ++ S  Y
Sbjct  360   AVSMTIARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVSGRKNSDVTAENPSQVY  419

Query  888   FPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDV  1067
             FP WIYN +N+G+ + +   +  +  I KK+ IVGLWCIQ  P+ RPSM  VV+MLEG+ 
Sbjct  420   FPEWIYNHLNQGEELHIRIMENRDATIAKKLAIVGLWCIQWYPVDRPSMKLVVQMLEGE-  478

Query  1068  ELLQMPTDTFLS  1103
             + L MP + F S
Sbjct  479   DNLTMPPNPFAS  490



>ref|XP_008245471.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=400

 Score =   439 bits (1128),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 210/332 (63%), Positives = 262/332 (79%), Gaps = 2/332 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C IV LI K++RRHLS++  IE FL + NNL PIRYSY  I+ MTK FKEKLGEGG+GSV
Sbjct  28    CLIVLLIYKFKRRHLSMYGLIEEFLQSHNNLMPIRYSYSDIRKMTKGFKEKLGEGGYGSV  87

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VA+K++ K  +NGQDFINEV ++GRIHHV++V+L+GYC E SK ALVY+F
Sbjct  88    YKGKLRSGRLVAIKMLGKSNTNGQDFINEVATIGRIHHVHVVQLIGYCVEGSKRALVYEF  147

Query  471   MPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             M NGSLDK+I +    S LN+++ FEI +GVARGI+YLH+GC++QI HFDIKPHNILL+E
Sbjct  148   MTNGSLDKHIFRKEGPSSLNYKKSFEISLGVARGIDYLHQGCEMQIFHFDIKPHNILLNE  207

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             +F+PKISDFGLA+L P D+S +TLTAARGTIGY+APEL  + IG +S+KAD+YSFGMLLM
Sbjct  208   DFVPKISDFGLARLCPLDESSLTLTAARGTIGYIAPELFYKNIGGVSNKADIYSFGMLLM  267

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             E+ G  +        SS+ YFPSW+Y+  N+GK I+M +  E+E +ITKKM IV LWCIQ
Sbjct  268   EIAGKRKNLNAIAAHSSQIYFPSWVYDQFNEGKDIDMEDATEEEMKITKKMLIVALWCIQ  327

Query  1008  MSPIPRP-SMSRVVEMLEGDVELLQMPTDTFL  1100
             M P  RP SM +VVEMLEG++E LQM    FL
Sbjct  328   MKPSERPNSMGKVVEMLEGEIESLQMSPKPFL  359


 Score =   331 bits (848),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 230/316 (73%), Gaps = 5/316 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  + P RYS++DI+K+T    E+LGEGGYG VYKG++ S  LVA+K+L  S  NG
Sbjct  51    FLQSHNNLMPIRYSYSDIRKMTKGFKEKLGEGGYGSVYKGKLRSGRLVAIKMLGKSNTNG  110

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHV+VV+L+GYC +G +RALVYE++ N SL+K+IF  E  + +L++K
Sbjct  111   QDFINEVATIGRIHHVHVVQLIGYCVEGSKRALVYEFMTNGSLDKHIFRKEGPS-SLNYK  169

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K  EI+LG+A+GI+YLHQGC+ QI HFDIKP NILL+ +  PKI DFGLA+LC  ++S++
Sbjct  170   KSFEISLGVARGIDYLHQGCEMQIFHFDIKPHNILLNEDFVPKISDFGLARLCPLDESSL  229

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GYIAPE+  +N G VS+K+D+YSFGMLL+E+ G RKN NA         + 
Sbjct  230   TLTAARGTIGYIAPELFYKNIGGVSNKADIYSFGMLLMEIAGKRKNLNA---IAAHSSQI  286

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRP-SMKAVVQMLER  1548
              FP WVY+  N G ++ +    +++  I KK+ I+ALWCIQ +P +RP SM  VV+MLE 
Sbjct  287   YFPSWVYDQFNEGKDIDMEDATEEEMKITKKMLIVALWCIQMKPSERPNSMGKVVEMLEG  346

Query  1547  EGDDLVLPSSPFAGSQ  1500
             E + L +   PF   Q
Sbjct  347   EIESLQMSPKPFLYPQ  362



>ref|XP_007010199.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY19009.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=610

 Score =   446 bits (1148),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 221/312 (71%), Positives = 266/312 (85%), Gaps = 3/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RYS+AD+K+ITNQ  E+LG+GGYG V+KG +S+++ VAVKVLN+ KGNG
Sbjct  282   FLEDYKALKPSRYSYADVKRITNQFKEKLGQGGYGTVFKGTLSNDVSVAVKVLNNFKGNG  341

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +G+IHHVNV RLVG+CADG+ RALVYEYLPNESLEK+IF+ + +N  LSW+
Sbjct  342   EEFVNEVGSMGRIHHVNVTRLVGFCADGYNRALVYEYLPNESLEKFIFAAKGENRFLSWE  401

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EIALGIAKGIEYLHQGC+Q+ILHFDIKP NILLD N  PKI DFGLAKLCSKE+SAV
Sbjct  402   KLHEIALGIAKGIEYLHQGCEQRILHFDIKPHNILLDQNFTPKISDFGLAKLCSKEQSAV  461

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T  ++ + 
Sbjct  462   SMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---TVANESQV  518

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G EL I IE++    IAKKL I+ L CIQW PVDRPSMK+VVQMLE E
Sbjct  519   YFPEWVYNRLDKGEELGIDIEDEGHHKIAKKLTIVGLRCIQWYPVDRPSMKSVVQMLEGE  578

Query  1544  GDDLVLPSSPFA  1509
              D+L +P +PFA
Sbjct  579   ADNLTMPPNPFA  590


 Score =   365 bits (937),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 235/314 (75%), Gaps = 2/314 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  +K +T  FKEKLG+GG+G+V+KG L +   VAVK+++  K
Sbjct  279   IEQFLEDYKALKPSRYSYADVKRITNQFKEKLGQGGYGTVFKGTLSNDVSVAVKVLNNFK  338

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++F+NEVGSMGRIHHVN+ RLVG+CA+    ALVY+++PN SL+K+I         L
Sbjct  339   GNGEEFVNEVGSMGRIHHVNVTRLVGFCADGYNRALVYEYLPNESLEKFIFAAKGENRFL  398

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GC+ +ILHFDIKPHNILLD+NF PKISDFGLAKL   ++
Sbjct  399   SWEKLHEIALGIAKGIEYLHQGCEQRILHFDIKPHNILLDQNFTPKISDFGLAKLCSKEQ  458

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   VT  +ES  
Sbjct  459   SAVSMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVTVANESQV  518

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++KG+ + +  EDE   +I KK+TIVGL CIQ  P+ RPSM  VV+MLEG+
Sbjct  519   YFPEWVYNRLDKGEELGIDIEDEGHHKIAKKLTIVGLRCIQWYPVDRPSMKSVVQMLEGE  578

Query  1065  VELLQMPTDTFLSE  1106
              + L MP + F S+
Sbjct  579   ADNLTMPPNPFASK  592



>ref|XP_010645764.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=608

 Score =   446 bits (1147),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 220/312 (71%), Positives = 265/312 (85%), Gaps = 3/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A++P+RY +ADIKKITN   ++LG+GGYG VYKGR+S+E+ VAVK+LND KGNG
Sbjct  273   FLEDYKALKPSRYCYADIKKITNNFKDKLGQGGYGTVYKGRLSNEVFVAVKILNDFKGNG  332

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVNVVRLVG+CADG++RAL+ E+LPN+SLEK+IFST   N +L W 
Sbjct  333   EEFINEVRTMGTIHHVNVVRLVGFCADGYKRALICEFLPNDSLEKFIFSTFGNNRSLGWC  392

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+S V
Sbjct  393   KLHDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSTV  452

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TA RGTMGYIAPE++SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    T  +  + 
Sbjct  453   SVTATRGTMGYIAPEMLSRNFGSVSYKSDVYSFGMLLLEMVGGRKNIDV---TVENISQA  509

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              F EW+YNHL++  E+ IRIEE++D  IAKKL+II LWCIQW P DRPSMK VV+MLERE
Sbjct  510   YFSEWLYNHLDQEQEVHIRIEEENDTKIAKKLSIIGLWCIQWYPSDRPSMKVVVRMLERE  569

Query  1544  GDDLVLPSSPFA  1509
              D+LV+P +PFA
Sbjct  570   EDNLVMPPNPFA  581


 Score =   340 bits (872),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 169/329 (51%), Positives = 235/329 (71%), Gaps = 5/329 (2%)
 Frame = +3

Query  117   IVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYK  296
             IV+   K +R H      I+ FL     L P RY Y  IK +T  FK+KLG+GG+G+VYK
Sbjct  255   IVYRSNKLKREHKI---NIQRFLEDYKALKPSRYCYADIKKITNNFKDKLGQGGYGTVYK  311

Query  297   GKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMP  476
             G+L +   VAVKI++  K NG++FINEV +MG IHHVN+VRLVG+CA+  K AL+ +F+P
Sbjct  312   GRLSNEVFVAVKILNDFKGNGEEFINEVRTMGTIHHVNVVRLVGFCADGYKRALICEFLP  371

Query  477   NGSLDKYI-NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDEN  653
             N SL+K+I +       L W +  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD N
Sbjct  372   NDSLEKFIFSTFGNNRSLGWCKLHDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHN  431

Query  654   FIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLME  833
             F PKISDFGLAKL   ++S V++TA RGT+GY+APE+++R  G++S+K+DVYSFGMLL+E
Sbjct  432   FNPKISDFGLAKLCSKEQSTVSVTATRGTMGYIAPEMLSRNFGSVSYKSDVYSFGMLLLE  491

Query  834   MLGLNRT-PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQM  1010
             M+G  +   VT ++ S  YF  W+YN +++ + + +  E+E++ +I KK++I+GLWCIQ 
Sbjct  492   MVGGRKNIDVTVENISQAYFSEWLYNHLDQEQEVHIRIEEENDTKIAKKLSIIGLWCIQW  551

Query  1011  SPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
              P  RPSM  VV MLE + + L MP + F
Sbjct  552   YPSDRPSMKVVVRMLEREEDNLVMPPNPF  580



>ref|XP_006376636.1| hypothetical protein POPTR_0012s01760g [Populus trichocarpa]
 gb|ERP54433.1| hypothetical protein POPTR_0012s01760g [Populus trichocarpa]
Length=608

 Score =   446 bits (1147),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 264/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P RY++ADIK+IT++  ++LG+G YG V+KG++S EI VAVK+LN+S GNG
Sbjct  273   FLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFKGKLSDEIFVAVKILNNSTGNG  332

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +GKIHHVNV+RLVGYCADGFRRALVY+YLPNESLEK++ S   +  +LSW+
Sbjct  333   EEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGETSSLSWE  392

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALG+AKGIEYLHQGCDQ+ILHFDIKP NILLD + NPKI DFGLAKLCSK++SAV
Sbjct  393   KLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDHFNPKISDFGLAKLCSKDQSAV  452

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS+KSDVYSFGM+LLEMVGGRK  + K   + S Q  
Sbjct  453   SMTTARGTMGYIAPEVFSRNFGHVSYKSDVYSFGMVLLEMVGGRKTIDDK--VENSNQI-  509

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G EL+IRIE++ D  IAKKL ++ LWCIQW PVDRPSM  VVQMLE E
Sbjct  510   YFPEWVYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWCIQWHPVDRPSMNTVVQMLEGE  569

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SPFA +
Sbjct  570   GDKLTMPPSPFASA  583


 Score =   359 bits (921),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 239/320 (75%), Gaps = 2/320 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IENFL     L P RY+Y  IK +T  FK+KLG+G +G+V+KGKL     VAVKI++   
Sbjct  270   IENFLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFKGKLSDEIFVAVKILNNST  329

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASLL  527
              NG++FINEV +MG+IHHVN++RLVGYCA+  + ALVYD++PN SL+K+++ +    S L
Sbjct  330   GNGEEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGETSSL  389

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD++F PKISDFGLAKL   D+
Sbjct  390   SWEKLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDHFNPKISDFGLAKLCSKDQ  449

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S V++T ARGT+GY+APE+ +R  G +S+K+DVYSFGM+L+EM+G  +T   + + S++ 
Sbjct  450   SAVSMTTARGTMGYIAPEVFSRNFGHVSYKSDVYSFGMVLLEMVGGRKTIDDKVENSNQI  509

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++KG+ + +  E E + +I KK+T+VGLWCIQ  P+ RPSM+ VV+MLEG+
Sbjct  510   YFPEWVYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWCIQWHPVDRPSMNTVVQMLEGE  569

Query  1065  VELLQMPTDTFLSEPIMEVH  1124
              + L MP   F S     +H
Sbjct  570   GDKLTMPPSPFASAGPGRMH  589



>ref|XP_002321441.2| hypothetical protein POPTR_0015s02040g [Populus trichocarpa]
 gb|EEF05568.2| hypothetical protein POPTR_0015s02040g [Populus trichocarpa]
Length=618

 Score =   446 bits (1148),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 210/333 (63%), Positives = 262/333 (79%), Gaps = 4/333 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P    FL+ ++ RRHLS+++ IE FL + NN  PIRYSY  IK +T  FKEKLG+GG+GS
Sbjct  252   PFVFAFLVYRWLRRHLSMYDIIEEFLQSQNNFAPIRYSYSDIKKITNGFKEKLGQGGYGS  311

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG   AVK++ K  +NGQDFINEV ++GRIHHVN+VRL+G+CAE SK ALVYD
Sbjct  312   VYKGKLRSGHLAAVKMLDKSSANGQDFINEVATIGRIHHVNVVRLIGFCAEGSKRALVYD  371

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKY+      ++L+WQ+ +EI +GVARGIEYLHRGCD+QILHFDIKPHN+LLD
Sbjct  372   FMPNGSLDKYVLSRQGNTILSWQKMYEISLGVARGIEYLHRGCDMQILHFDIKPHNVLLD  431

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLAKL+PT+ + V LTAARGT+GY+APEL  + IG++S+KADVYSFGMLL
Sbjct  432   ENFAPKVSDFGLAKLYPTNNNTVMLTAARGTLGYIAPELFYKNIGSVSYKADVYSFGMLL  491

Query  828   MEMLGLNRT--PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             MEM+G  ++  PVTE + S  YFP W+YN +  G+ +E+ +   DE ++ KKM IV LWC
Sbjct  492   MEMVGKRQSTNPVTESN-SKNYFPDWVYNQVVDGR-VEIEDATIDENKLAKKMIIVALWC  549

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             IQM PI RP M++VVEMLEGDVE L+ P    L
Sbjct  550   IQMKPIDRPPMNKVVEMLEGDVENLKFPPKPVL  582


 Score =   347 bits (890),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 228/310 (74%), Gaps = 5/310 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RYS++DIKKITN   E+LG+GGYG VYKG++ S  L AVK+L+ S  NG
Sbjct  276   FLQSQNNFAPIRYSYSDIKKITNGFKEKLGQGGYGSVYKGKLRSGHLAAVKMLDKSSANG  335

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRL+G+CA+G +RALVY+++PN SL+KY+ S +  N  LSW+
Sbjct  336   QDFINEVATIGRIHHVNVVRLIGFCAEGSKRALVYDFMPNGSLDKYVLSRQG-NTILSWQ  394

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A+GIEYLH+GCD QILHFDIKP N+LLD N  PK+ DFGLAKL     + V
Sbjct  395   KMYEISLGVARGIEYLHRGCDMQILHFDIKPHNVLLDENFAPKVSDFGLAKLYPTNNNTV  454

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              +TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG R++ N       S  + 
Sbjct  455   MLTAARGTLGYIAPELFYKNIGSVSYKADVYSFGMLLMEMVGKRQSTNP---VTESNSKN  511

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+WVYN +   G ++I     D+  +AKK+ I+ALWCIQ +P+DRP M  VV+MLE +
Sbjct  512   YFPDWVYNQV-VDGRVEIEDATIDENKLAKKMIIVALWCIQMKPIDRPPMNKVVEMLEGD  570

Query  1544  GDDLVLPSSP  1515
              ++L  P  P
Sbjct  571   VENLKFPPKP  580



>ref|XP_009341644.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=428

 Score =   439 bits (1130),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/332 (62%), Positives = 259/332 (78%), Gaps = 2/332 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I  +I K +RRHLS++E IE+FL  +N L P+RYSY  IK M + FK+KLGEGGFGS
Sbjct  45    PCVIALIIYKCKRRHLSMYENIEDFLQ-NNQLMPVRYSYSDIKKMARGFKDKLGEGGFGS  103

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+V+LVG+C E SK ALVYD
Sbjct  104   VYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLVGFCVEGSKRALVYD  163

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+K+I        L+ ++ FEI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  164   FMPNGSLNKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLD  223

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PK+SDFGLA+L P D SIV+LTA RGTIGY+APE   + IG +S+KADVYSFGMLL
Sbjct  224   ENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPEFFYKNIGGVSYKADVYSFGMLL  283

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  +      + SS+ YFP+W+++ ++ G  + +G+  E+EK+I KKM +V  WCI
Sbjct  284   MEMAGKRKNLNANIEHSSQIYFPTWVFDQLSGGNDLTIGDATEEEKKIIKKMIVVASWCI  343

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RPSM++VVEMLEG++E LQMP   FL
Sbjct  344   QMKPSDRPSMNKVVEMLEGEIESLQMPPKLFL  375


 Score =   335 bits (858),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 171/317 (54%), Positives = 230/317 (73%), Gaps = 7/317 (2%)
 Frame = -1

Query  2441  LEDY---RAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKG  2271
             +ED+     + P RYS++DIKK+     ++LGEGG+G VYK ++ S  LVA+K+L  SK 
Sbjct  66    IEDFLQNNQLMPVRYSYSDIKKMARGFKDKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKA  125

Query  2270  NGEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALS  2091
             NG++FINEV  IG+IHHVNVV+LVG+C +G +RALVY+++PN SL K+IFS +   ++LS
Sbjct  126   NGQDFINEVATIGRIHHVNVVQLVGFCVEGSKRALVYDFMPNGSLNKHIFSQQGV-ISLS  184

Query  2090  WKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKS  1911
              +K+ EI+LG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+LC  + S
Sbjct  185   CEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLDENFLPKVSDFGLARLCPLDNS  244

Query  1910  AVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQ  1731
              V++TA RGT+GYIAPE   +N G VS+K+DVYSFGMLL+EM G RKN NA    + S Q
Sbjct  245   IVSLTAVRGTIGYIAPEFFYKNIGGVSYKADVYSFGMLLMEMAGKRKNLNAN--IEHSSQ  302

Query  1730  EGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FP WV++ L+ G +L I    ++++ I KK+ ++A WCIQ +P DRPSM  VV+MLE
Sbjct  303   I-YFPTWVFDQLSGGNDLTIGDATEEEKKIIKKMIVVASWCIQMKPSDRPSMNKVVEMLE  361

Query  1550  REGDDLVLPSSPFAGSQ  1500
              E + L +P   F   Q
Sbjct  362   GEIESLQMPPKLFLYPQ  378



>ref|XP_007036613.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY21114.1| PR5-like receptor kinase [Theobroma cacao]
Length=639

 Score =   447 bits (1149),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/330 (63%), Positives = 262/330 (79%), Gaps = 1/330 (0%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C IV ++IK+RRRHLS  + IE FL   NNL PI+YSY  IK MTK FK+KLG+GG+GSV
Sbjct  273   CLIVVVLIKFRRRHLSTDDTIEEFLQMQNNLKPIKYSYSEIKKMTKCFKDKLGQGGYGSV  332

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             +KG LRSG  +AVK++   KS+GQDFINEV ++GRIHHVN+V+L+G+C + SK ALVYDF
Sbjct  333   FKGTLRSGRPIAVKLLEMSKSHGQDFINEVATIGRIHHVNVVQLIGFCVDGSKQALVYDF  392

Query  471   MPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             MPNGSLDK I      + L W++ FEI +GV RGIEYLH+GC++QILHFDIKPHNILLD+
Sbjct  393   MPNGSLDKIIFSREKDTTLCWEKIFEIAIGVVRGIEYLHQGCEMQILHFDIKPHNILLDK  452

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NFIPKISDFGLAKL+  D+SIV+LTAARGT+GY+APEL  + IG+ISHKADVYSFGMLLM
Sbjct  453   NFIPKISDFGLAKLYAVDQSIVSLTAARGTLGYIAPELFYKNIGSISHKADVYSFGMLLM  512

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      ++SS+ YFP+WIY+   KG+  E+G+  E EK+I +KM IV  WCIQ
Sbjct  513   EMVGRRKNLNAFAEQSSQIYFPTWIYDRFEKGEDAELGDATESEKKIVRKMVIVAFWCIQ  572

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             M P  RPS+S+V+EMLEG+VE+L++P   F
Sbjct  573   MRPTDRPSISKVLEMLEGEVEVLELPPQPF  602


 Score =   338 bits (867),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 169/314 (54%), Positives = 232/314 (74%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    ++P +YS+++IKK+T    ++LG+GGYG V+KG + S   +AVK+L  SK +G
Sbjct  296   FLQMQNNLKPIKYSYSEIKKMTKCFKDKLGQGGYGSVFKGTLRSGRPIAVKLLEMSKSHG  355

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+G+C DG ++ALVY+++PN SL+K IFS E K+  L W+
Sbjct  356   QDFINEVATIGRIHHVNVVQLIGFCVDGSKQALVYDFMPNGSLDKIIFSRE-KDTTLCWE  414

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             KI EIA+G+ +GIEYLHQGC+ QILHFDIKP NILLD N  PKI DFGLAKL + ++S V
Sbjct  415   KIFEIAIGVVRGIEYLHQGCEMQILHFDIKPHNILLDKNFIPKISDFGLAKLYAVDQSIV  474

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G +SHK+DVYSFGMLL+EMVG RKN NA     +SQ   
Sbjct  475   SLTAARGTLGYIAPELFYKNIGSISHKADVYSFGMLLMEMVGRRKNLNAF-AEQSSQI--  531

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+   +G + ++    + ++ I +K+ I+A WCIQ +P DRPS+  V++MLE E
Sbjct  532   YFPTWIYDRFEKGEDAELGDATESEKKIVRKMVIVAFWCIQMRPTDRPSISKVLEMLEGE  591

Query  1544  GDDLVLPSSPFAGS  1503
              + L LP  PF  S
Sbjct  592   VEVLELPPQPFEFS  605



>ref|XP_010646615.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=588

 Score =   445 bits (1144),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 268/314 (85%), Gaps = 8/314 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA+ P+RYS+ADIKKITN   ++LGEGGYG +YKG++S+E+ VAVK+LNDSK NG
Sbjct  258   FLEDYRALNPSRYSYADIKKITNLFKDKLGEGGYGTIYKGKLSNEVFVAVKILNDSKENG  317

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G+IHH+NVVRLVG+CADG++RAL+YE+LPNESLEK+IF    KN +L W+
Sbjct  318   EEFINEVRTMGRIHHINVVRLVGFCADGYKRALIYEFLPNESLEKFIF----KNQSLGWQ  373

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLD   NPKI DFGLAKLCSKE+S V
Sbjct  374   KLHDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDQKFNPKISDFGLAKLCSKEQSVV  433

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +A    +TSQ   
Sbjct  434   SMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNSDAI-MENTSQM--  490

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL   GE+ IRIE+++D  IAK+L+I+ LWCIQW P+DRPSMK V++MLE E
Sbjct  491   YFPEWLYNHLKHNGEIHIRIEKEEDTKIAKRLSIVGLWCIQWHPIDRPSMKIVLKMLEGE  550

Query  1544  GDDLVLPSSPFAGS  1503
              D++ LP +PFA S
Sbjct  551   -DNITLPPNPFASS  563


 Score =   352 bits (903),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 173/334 (52%), Positives = 242/334 (72%), Gaps = 12/334 (4%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C  V+   K ++ H    + ++ FL     L P RYSY  IK +T  FK+KLGEGG+G++
Sbjct  238   CYNVYTTDKSKKEHS---KKLQKFLEDYRALNPSRYSYADIKKITNLFKDKLGEGGYGTI  294

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKL +   VAVKI++  K NG++FINEV +MGRIHH+N+VRLVG+CA+  K AL+Y+F
Sbjct  295   YKGKLSNEVFVAVKILNDSKENGEEFINEVRTMGRIHHINVVRLVGFCADGYKRALIYEF  354

Query  471   MPNGSLDKYI--NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             +PN SL+K+I  NQ      L WQ+  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILL
Sbjct  355   LPNESLEKFIFKNQS-----LGWQKLHDIALGIAKGIEYLHQGCDQRILHFDIKPHNILL  409

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D+ F PKISDFGLAKL   ++S+V++TAARGT+GY+APE+++R  G +S+K+DVYSFGML
Sbjct  410   DQKFNPKISDFGLAKLCSKEQSVVSMTAARGTMGYIAPEVLSRNFGNVSYKSDVYSFGML  469

Query  825   LMEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  + +    ++ S  YFP W+YN +     I +  E E++ +I K+++IVGLWC
Sbjct  470   LLEMVGGRKNSDAIMENTSQMYFPEWLYNHLKHNGEIHIRIEKEEDTKIAKRLSIVGLWC  529

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             IQ  PI RPSM  V++MLEG+ + + +P + F S
Sbjct  530   IQWHPIDRPSMKIVLKMLEGE-DNITLPPNPFAS  562



>ref|XP_011037045.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Populus 
euphratica]
Length=667

 Score =   447 bits (1151),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/328 (63%), Positives = 264/328 (80%), Gaps = 2/328 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC IVFLI K+RRRHLSV++ +E FL   NNL P+RYSY  I+ +T+ FK+KLGEGGFG+
Sbjct  304   PCVIVFLIYKWRRRHLSVYDTVEQFLQGQNNLMPVRYSYSDIRKITRGFKDKLGEGGFGT  363

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGK RSG   AVK++ K K+NGQDFINEV ++GRIHH N+VRL+G+CAE SK ALVYD
Sbjct  364   VYKGKFRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHTNVVRLIGFCAEGSKRALVYD  423

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLD+++     +  L+WQ+  +I +GVARGI+YLH GCD+QILHFDIKPHNILLD
Sbjct  424   FMPNGSLDRHLFSREGSISLSWQKLHQISLGVARGIDYLHLGCDMQILHFDIKPHNILLD  483

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLA+L+PT+ SI +LTAARGTIGY+APEL  + IG +S+KADVYSFGMLL
Sbjct  484   ENFTPKVSDFGLARLYPTNGSITSLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLL  543

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             +EM G  +      + SS+ Y+P W+++ ++ GKAIE+G++  E+E +I KKM +VGLWC
Sbjct  544   LEMAGKRKNVNALAENSSQIYWPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGLWC  603

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             IQM P+ RP+M  VVEMLEGD+E LQ+P
Sbjct  604   IQMKPMDRPTMKNVVEMLEGDLENLQLP  631


 Score =   333 bits (855),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 232/311 (75%), Gaps = 5/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS++DI+KIT    ++LGEGG+G VYKG+  S    AVK+L  SK NG
Sbjct  328   FLQGQNNLMPVRYSYSDIRKITRGFKDKLGEGGFGTVYKGKFRSGRFAAVKLLGKSKANG  387

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHH NVVRL+G+CA+G +RALVY+++PN SL++++FS E  +++LSW+
Sbjct  388   QDFINEVATIGRIHHTNVVRLIGFCAEGSKRALVYDFMPNGSLDRHLFSREG-SISLSWQ  446

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +I+LG+A+GI+YLH GCD QILHFDIKP NILLD N  PK+ DFGLA+L     S  
Sbjct  447   KLHQISLGVARGIDYLHLGCDMQILHFDIKPHNILLDENFTPKVSDFGLARLYPTNGSIT  506

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  +N G+VS+K+DVYSFGMLLLEM G RKN NA    ++SQ   
Sbjct  507   SLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLLLEMAGKRKNVNAL-AENSSQIY-  564

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +P WV++ ++ G  ++I     +++  I KK+ ++ LWCIQ +P+DRP+MK VV+MLE 
Sbjct  565   -WPYWVHDQVSDGKAIEIGDDATEEESKIVKKMIMVGLWCIQMKPMDRPTMKNVVEMLEG  623

Query  1547  EGDDLVLPSSP  1515
             + ++L LP  P
Sbjct  624   DLENLQLPPKP  634



>ref|XP_002317767.2| hypothetical protein POPTR_0012s01750g [Populus trichocarpa]
 gb|EEE95987.2| hypothetical protein POPTR_0012s01750g [Populus trichocarpa]
Length=603

 Score =   445 bits (1145),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 264/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P RY++ADIK+IT++  ++LG+G YG V+KG++S EI VAVK+LN+S GNG
Sbjct  268   FLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFKGKLSDEIFVAVKILNNSTGNG  327

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +GKIHHVNV+RLVGYCADGFRRALVY+YLPNESLEK++ S   +  +LSW+
Sbjct  328   EEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGETSSLSWE  387

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++Q+IALG+AKGIEYLHQGCDQ+ILHFDIKP NILLD + NPKI DFGLAKLCSK++SAV
Sbjct  388   RLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDHFNPKISDFGLAKLCSKDQSAV  447

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS+KSDVYSFGM+LLEMVGGRK  + K   + S Q  
Sbjct  448   SMTTARGTMGYIAPEVFSRNFGHVSYKSDVYSFGMVLLEMVGGRKTIDDK--VENSNQI-  504

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++G EL+IRIE++ D  IAKKL ++ LWCIQW PVDRPSM  VVQMLE E
Sbjct  505   YFPEWVYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWCIQWHPVDRPSMNTVVQMLEGE  564

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SPFA +
Sbjct  565   GDKLTMPPSPFASA  578


 Score =   360 bits (924),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 239/320 (75%), Gaps = 2/320 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IENFL     L P RY+Y  IK +T  FK+KLG+G +G+V+KGKL     VAVKI++   
Sbjct  265   IENFLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFKGKLSDEIFVAVKILNNST  324

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASLL  527
              NG++FINEV +MG+IHHVN++RLVGYCA+  + ALVYD++PN SL+K+++ +    S L
Sbjct  325   GNGEEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGETSSL  384

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W+R  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD++F PKISDFGLAKL   D+
Sbjct  385   SWERLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDHFNPKISDFGLAKLCSKDQ  444

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S V++T ARGT+GY+APE+ +R  G +S+K+DVYSFGM+L+EM+G  +T   + + S++ 
Sbjct  445   SAVSMTTARGTMGYIAPEVFSRNFGHVSYKSDVYSFGMVLLEMVGGRKTIDDKVENSNQI  504

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++KG+ + +  E E + +I KK+T+VGLWCIQ  P+ RPSM+ VV+MLEG+
Sbjct  505   YFPEWVYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWCIQWHPVDRPSMNTVVQMLEGE  564

Query  1065  VELLQMPTDTFLSEPIMEVH  1124
              + L MP   F S     +H
Sbjct  565   GDKLTMPPSPFASAGPGRMH  584



>ref|XP_010662565.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=579

 Score =   444 bits (1142),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 217/312 (70%), Positives = 264/312 (85%), Gaps = 3/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+ADIKKITN   ++LG+GGYG VYKG++S+E+ VAVK+L+D KGNG
Sbjct  244   FLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSNEVFVAVKILDDFKGNG  303

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             E+FINEVG +  IHHVNVVRL+G+CADG++RAL+YE+LPNESL+K+IFS    N +L W 
Sbjct  304   EDFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPNESLDKFIFSAFGNNYSLGWH  363

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIAKGIEYLHQGCDQ+ILH DIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  364   KLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  423

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPE++SRNFG VS KSDVYSFGMLL+EMVGGRKN +A   T  +  + 
Sbjct  424   SMTAARGTMGYIAPEMLSRNFGNVSSKSDVYSFGMLLIEMVGGRKNIDA---TVENISQA  480

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL++  E+ IRIE++ D  I KKL+II LWCIQW P+DRPSMK VV MLE E
Sbjct  481   YFPEWLYNHLDQEQEVHIRIEDESDIKITKKLSIIGLWCIQWYPIDRPSMKIVVGMLEGE  540

Query  1544  GDDLVLPSSPFA  1509
               +LV+P +PF 
Sbjct  541   EGNLVMPPNPFT  552


 Score =   352 bits (902),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 237/331 (72%), Gaps = 7/331 (2%)
 Frame = +3

Query  120   VFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKG  299
             V+   K +R H      I+ FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKG
Sbjct  227   VYCSNKLKREHRI---NIQKFLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKG  283

Query  300   KLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPN  479
             KL +   VAVKI+   K NG+DFINEVG+M  IHHVN+VRL+G+CA+  K AL+Y+F+PN
Sbjct  284   KLSNEVFVAVKILDDFKGNGEDFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPN  343

Query  480   GSLDKYINQGAYAS--LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDEN  653
              SLDK+I   A+ +   L W +  +I +G+A+GIEYLH+GCD +ILH DIKPHNILLD N
Sbjct  344   ESLDKFIFS-AFGNNYSLGWHKLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHN  402

Query  654   FIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLME  833
             F PKISDFGLAKL   ++S V++TAARGT+GY+APE+++R  G +S K+DVYSFGMLL+E
Sbjct  403   FNPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEMLSRNFGNVSSKSDVYSFGMLLIE  462

Query  834   MLGLNRT-PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQM  1010
             M+G  +    T ++ S  YFP W+YN +++ + + +  EDE + +ITKK++I+GLWCIQ 
Sbjct  463   MVGGRKNIDATVENISQAYFPEWLYNHLDQEQEVHIRIEDESDIKITKKLSIIGLWCIQW  522

Query  1011  SPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
              PI RPSM  VV MLEG+   L MP + F S
Sbjct  523   YPIDRPSMKIVVGMLEGEEGNLVMPPNPFTS  553



>ref|XP_002267821.3| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=632

 Score =   446 bits (1146),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 213/334 (64%), Positives = 264/334 (79%), Gaps = 2/334 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  ++FLI K+RRR+LS++  IE F+   NNL PIRYSY +IK MTK F EKLGEGG+GS
Sbjct  276   PFVLIFLIYKWRRRNLSMYAAIEEFIQTHNNLMPIRYSYSNIKKMTKGFSEKLGEGGYGS  335

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG  VAVK+M+  K+NGQDFINEV ++GRIHHVN+V+L+G+CAE SK ALVYD
Sbjct  336   VYKGKLRSGHLVAVKVMNISKANGQDFINEVATIGRIHHVNVVQLIGFCAEESKRALVYD  395

Query  468   FMPNGSLDKYI-NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             FMPNGSLDKYI  Q      L++++ +EI +GVA GIEYLHRGCDIQILHFDIKPHNILL
Sbjct  396   FMPNGSLDKYIFPQQEDRISLSYRKMYEISLGVAHGIEYLHRGCDIQILHFDIKPHNILL  455

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             D+NF PKISDFGLAK +PTD + V+LTAARGT+GY+APEL  + IG +S+KADVYS+GML
Sbjct  456   DQNFTPKISDFGLAKSYPTDHNTVSLTAARGTMGYMAPELFYKNIGGVSYKADVYSYGML  515

Query  825   LMEMLGLNRT-PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             LMEM    +   V  +  S  YFP+W+Y+ + +GK IEM +  E+E+++ KKM  V LWC
Sbjct  516   LMEMASRRKNLNVFAESLSQIYFPTWVYDQLTEGKDIEMEDTSEEEQKLAKKMITVALWC  575

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             IQ+ P  RPSM++VVEMLE +VELLQMP   FL+
Sbjct  576   IQLKPSDRPSMNKVVEMLEENVELLQMPPKPFLT  609


 Score =   348 bits (893),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 170/311 (55%), Positives = 231/311 (74%), Gaps = 3/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             F++ +  + P RYS+++IKK+T   SE+LGEGGYG VYKG++ S  LVAVKV+N SK NG
Sbjct  300   FIQTHNNLMPIRYSYSNIKKMTKGFSEKLGEGGYGSVYKGKLRSGHLVAVKVMNISKANG  359

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+G+CA+  +RALVY+++PN SL+KYIF  +   ++LS++
Sbjct  360   QDFINEVATIGRIHHVNVVQLIGFCAEESKRALVYDFMPNGSLDKYIFPQQEDRISLSYR  419

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAK    + + V
Sbjct  420   KMYEISLGVAHGIEYLHRGCDIQILHFDIKPHNILLDQNFTPKISDFGLAKSYPTDHNTV  479

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGY+APE+  +N G VS+K+DVYS+GMLL+EM   RKN N       S  + 
Sbjct  480   SLTAARGTMGYMAPELFYKNIGGVSYKADVYSYGMLLMEMASRRKNLNVFA---ESLSQI  536

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L  G ++++    ++++ +AKK+  +ALWCIQ +P DRPSM  VV+MLE  
Sbjct  537   YFPTWVYDQLTEGKDIEMEDTSEEEQKLAKKMITVALWCIQLKPSDRPSMNKVVEMLEEN  596

Query  1544  GDDLVLPSSPF  1512
              + L +P  PF
Sbjct  597   VELLQMPPKPF  607



>ref|XP_007022127.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13652.1| PR5-like receptor kinase [Theobroma cacao]
Length=433

 Score =   439 bits (1128),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 208/330 (63%), Positives = 258/330 (78%), Gaps = 1/330 (0%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C I  +  K+RRRHLS+ + IE FL + NNL  IRYSY+ IK MT++F++KLGEGG+GSV
Sbjct  69    CLIALVTYKWRRRHLSMDDTIEEFLQSQNNLMSIRYSYREIKKMTRSFRDKLGEGGYGSV  128

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             +KGKLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+ +L+G+C E SK ALVYDF
Sbjct  129   FKGKLRSGHLVAIKLLGKSKANGQDFINEVATIGRIHHVNVAKLIGFCVEGSKQALVYDF  188

Query  471   MPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             M NGSLDK I        L+WQ+ F+I +GVA+GIEYLH+GCD+QILHFDIKPHNILLD+
Sbjct  189   MSNGSLDKIIFAEENKITLSWQKMFDIALGVAQGIEYLHQGCDMQILHFDIKPHNILLDD  248

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NFIPK+SDFGLAKL+  D SIV+LTAARGTIGY+APELV + IG IS+KADVYSFGMLLM
Sbjct  249   NFIPKVSDFGLAKLYSVDDSIVSLTAARGTIGYIAPELVYKNIGGISNKADVYSFGMLLM  308

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      +  S+ YFPSWIY   ++G+ IE+GE  + EK I +KM I   WCIQ
Sbjct  309   EMVGRRKNLNAFAEHLSQIYFPSWIYGQFHRGEDIELGEVTDGEKIIVRKMIITACWCIQ  368

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             + P  RPSMS+V+EMLE +VELLQMP   F
Sbjct  369   VPPNDRPSMSKVLEMLETNVELLQMPPKPF  398


 Score =   335 bits (860),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 227/311 (73%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    +   RYS+ +IKK+T    ++LGEGGYG V+KG++ S  LVA+K+L  SK NG
Sbjct  92    FLQSQNNLMSIRYSYREIKKMTRSFRDKLGEGGYGSVFKGKLRSGHLVAIKLLGKSKANG  151

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNV +L+G+C +G ++ALVY+++ N SL+K IF+ E+K + LSW+
Sbjct  152   QDFINEVATIGRIHHVNVAKLIGFCVEGSKQALVYDFMSNGSLDKIIFAEENK-ITLSWQ  210

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IALG+A+GIEYLHQGCD QILHFDIKP NILLD N  PK+ DFGLAKL S + S V
Sbjct  211   KMFDIALGVAQGIEYLHQGCDMQILHFDIKPHNILLDDNFIPKVSDFGLAKLYSVDDSIV  270

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+V +N G +S+K+DVYSFGMLL+EMVG RKN NA         + 
Sbjct  271   SLTAARGTIGYIAPELVYKNIGGISNKADVYSFGMLLMEMVGRRKNLNA---FAEHLSQI  327

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y   +RG ++++    D ++ I +K+ I A WCIQ  P DRPSM  V++MLE  
Sbjct  328   YFPSWIYGQFHRGEDIELGEVTDGEKIIVRKMIITACWCIQVPPNDRPSMSKVLEMLETN  387

Query  1544  GDDLVLPSSPF  1512
              + L +P  PF
Sbjct  388   VELLQMPPKPF  398



>gb|KCW52337.1| hypothetical protein EUGRSUZ_J01754, partial [Eucalyptus grandis]
Length=337

 Score =   435 bits (1118),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 203/327 (62%), Positives = 259/327 (79%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P   +FLI KY+RRHL++   IE FL A NN  PIRYSY +IK +T+ FK KLGEGG+GS
Sbjct  2     PLVAIFLIYKYKRRHLAMDMNIEEFLEAHNNFSPIRYSYSNIKKITRNFKHKLGEGGYGS  61

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSGS+VA+KI+ +  +  QDFI+E+ S+GRIHHVN+V+L+G+C E SK ALVYD
Sbjct  62    VYKGTLRSGSEVAIKILKQSNTRSQDFISEMASIGRIHHVNVVQLIGFCFEGSKQALVYD  121

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
              M NGSLDK+I        L++Q+ +EI +GVARGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  122   LMSNGSLDKHIFAEESDKFLDYQKIYEIALGVARGIEYLHQGCDVQILHFDIKPHNILLD  181

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PK+SDFGLAKL+PT+ SIV+LT ARGT+GY+APEL+ + IG +S+KADVYSFGMLL
Sbjct  182   KNFTPKVSDFGLAKLYPTNHSIVSLTTARGTLGYMAPELLYKNIGRVSYKADVYSFGMLL  241

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      + SS+ Y P W+Y+ +N+GK ++M    E+E+++ KKMTIV LWCI
Sbjct  242   MEMAGRKRNLDEHAEHSSQIYLPEWVYDQLNEGKCVKMEGVVEEERKVIKKMTIVALWCI  301

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             Q+SP  RPSMS+V+EMLEGD++ LQMP
Sbjct  302   QLSPDHRPSMSKVLEMLEGDIDNLQMP  328


 Score =   321 bits (822),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 222/312 (71%), Gaps = 4/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLE +    P RYS+++IKKIT     +LGEGGYG VYKG + S   VA+K+L  S    
Sbjct  26    FLEAHNNFSPIRYSYSNIKKITRNFKHKLGEGGYGSVYKGTLRSGSEVAIKILKQSNTRS  85

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+E+  IG+IHHVNVV+L+G+C +G ++ALVY+ + N SL+K+IF+ ES    L ++
Sbjct  86    QDFISEMASIGRIHHVNVVQLIGFCFEGSKQALVYDLMSNGSLDKHIFAEESDKF-LDYQ  144

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             KI EIALG+A+GIEYLHQGCD QILHFDIKP NILLD N  PK+ DFGLAKL     S V
Sbjct  145   KIYEIALGVARGIEYLHQGCDVQILHFDIKPHNILLDKNFTPKVSDFGLAKLYPTNHSIV  204

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++T ARGT+GY+APE++ +N G+VS+K+DVYSFGMLL+EM G ++N +  E  + S Q  
Sbjct  205   SLTTARGTLGYMAPELLYKNIGRVSYKADVYSFGMLLMEMAGRKRNLD--EHAEHSSQ-I  261

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
               PEWVY+ LN G  +++    +++  + KK+ I+ALWCIQ  P  RPSM  V++MLE +
Sbjct  262   YLPEWVYDQLNEGKCVKMEGVVEEERKVIKKMTIVALWCIQLSPDHRPSMSKVLEMLEGD  321

Query  1544  GDDLVLPSSPFA  1509
              D+L +P  P  
Sbjct  322   IDNLQMPPKPLT  333



>ref|XP_003634911.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=585

 Score =   444 bits (1142),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 223/314 (71%), Positives = 265/314 (84%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ADIK+ITNQ  ++LG+GGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  251   FLEDYEALKPSRYSYADIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQGNG  310

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EE INEV  +G IHHVN+VRLVG+CADGF+RAL+YEYLPNESLEK+IFS + KN +LSWK
Sbjct  311   EELINEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSLSWK  370

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCD++ILHFDIKP NILLDHN NPK+ DFGLAKLCSKE+SAV
Sbjct  371   KLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFNPKVSDFGLAKLCSKEQSAV  430

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV+SRNFG VS+KS+VYSFGMLLLEMVGGRKN +       S  + 
Sbjct  431   SMTIARGTIGYIAPEVLSRNFGNVSYKSNVYSFGMLLLEMVGGRKNIDVNV---ESTSQV  487

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL+ G EL IRIEE  D  IAKKLAI+ L CIQW P+D PSMK VVQMLE  
Sbjct  488   YFPEWIYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDHPSMKIVVQMLE-G  546

Query  1544  GDDLVLPSSPFAGS  1503
             G  L +P +PFA +
Sbjct  547   GGKLTMPPNPFAST  560


 Score =   332 bits (852),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/323 (52%), Positives = 229/323 (71%), Gaps = 10/323 (3%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL     VAVKI++  +
Sbjct  248   VKRFLEDYEALKPSRYSYADIKRITNQFKDKLGQGGYGTVYKGKLSHEVFVAVKILNNSQ  307

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++ INEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I ++      L
Sbjct  308   GNGEELINEVATMGTIHHVNIVRLVGFCADGFKRALIYEYLPNESLEKFIFSRDVKNYSL  367

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PK+SDFGLAKL   ++
Sbjct  368   SWKKLQEIAIGIAKGIEYLHQGCDKRILHFDIKPHNILLDHNFNPKVSDFGLAKLCSKEQ  427

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGTIGY+APE+++R  G +S+K++VYSFGMLL+EM+G  +   V  +  S  
Sbjct  428   SAVSMTIARGTIGYIAPEVLSRNFGNVSYKSNVYSFGMLLLEMVGGRKNIDVNVESTSQV  487

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN ++ G+ + +  E++ +  I KK+ IVGL CIQ  P+  PSM  VV+MLEG 
Sbjct  488   YFPEWIYNHLDIGEELYIRIEEKGDVEIAKKLAIVGLSCIQWFPMDHPSMKIVVQMLEGG  547

Query  1065  VELL--------QMPTDTFLSEP  1109
              +L           PT T LS+P
Sbjct  548   GKLTMPPNPFASTTPTKTNLSKP  570



>ref|XP_010646997.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=590

 Score =   444 bits (1141),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 222/314 (71%), Positives = 263/314 (84%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY A++P+RYS+ D+K+IT+Q  ++LG+GGYG VYKG++S E+ VAVK+LN+S+GNG
Sbjct  266   FLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQGNG  325

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVN+VRLVG+CAD F+RAL+YEYLPNESLEK+IFS   KN +LSWK
Sbjct  326   EEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSLSWK  385

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+QEIA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  386   KLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  445

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT  RGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN +    +  S  + 
Sbjct  446   SMTVIRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDV---SVESSSQV  502

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              F EW+YNHL+ G EL IRIEE+ D  I KKLAI+ L CIQW P+DRPSM  VVQMLE  
Sbjct  503   YFLEWIYNHLDIGEELHIRIEEERDVEIVKKLAIVGLSCIQWCPMDRPSMNIVVQMLE-G  561

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P +PFA +
Sbjct  562   GDKLTMPPNPFAST  575


 Score =   337 bits (864),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 228/313 (73%), Gaps = 3/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             ++ FL     L P RYSY  +K +T  FK+KLG+GG+G+VYKGKL     VAVKI++  +
Sbjct  263   VKKFLEDYEALKPSRYSYVDVKRITSQFKDKLGQGGYGTVYKGKLSDEVFVAVKILNNSQ  322

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEV +MG IHHVNIVRLVG+CA+  K AL+Y+++PN SL+K+I      +  L
Sbjct  323   GNGEEFINEVATMGTIHHVNIVRLVGFCADRFKRALIYEYLPNESLEKFIFSKVVKNYSL  382

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  EI +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++
Sbjct  383   SWKKLQEIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQ  442

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +   V+ +  S  
Sbjct  443   SAVSMTVIRGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDVSVESSSQV  502

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YF  WIYN ++ G+ + +  E+E +  I KK+ IVGL CIQ  P+ RPSM+ VV+MLEG 
Sbjct  503   YFLEWIYNHLDIGEELHIRIEEERDVEIVKKLAIVGLSCIQWCPMDRPSMNIVVQMLEGG  562

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  563   -DKLTMPPNPFAS  574



>ref|XP_009782477.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=608

 Score =   444 bits (1142),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 229/320 (72%), Positives = 266/320 (83%), Gaps = 8/320 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDY+A+RPTRYS+ADIKKIT+  +E+LGEG YG VYKG++S EI VAVKVL DSKG G
Sbjct  274   FLEDYKAIRPTRYSYADIKKITDGFNEKLGEGSYGTVYKGKLSREIYVAVKVLRDSKGKG  333

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIF----STESKNVA  2097
             EEFINE+G IG+IHHVNVVRLVG+CADGFRRAL+YEYLPN+SLE++I     ST S +V 
Sbjct  334   EEFINEIGTIGRIHHVNVVRLVGFCADGFRRALIYEYLPNDSLERFILPMSSSTNSVSV-  392

Query  2096  LSWKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKE  1917
             +SW K+Q IALG A+GIEYLHQGC+QQILHFDIKP NILLDHN+NPKICDFGLAKLCSKE
Sbjct  393   ISWNKLQHIALGTARGIEYLHQGCNQQILHFDIKPQNILLDHNLNPKICDFGLAKLCSKE  452

Query  1916  KSAVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTS  1737
             KSAVTMTAARGT+GYIAPEV+SRNFGKVSHKSD+YSFGMLLLEMVGGR   N+K  T+  
Sbjct  453   KSAVTMTAARGTIGYIAPEVLSRNFGKVSHKSDIYSFGMLLLEMVGGRIKSNSK--TNNH  510

Query  1736  QQEGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQM  1557
              +  S  EW+Y  L +G EL+IRIEE+ D  I +KLAI+ LWCIQW P DRPS+K VVQM
Sbjct  511   NKISSL-EWIYGDLEKGEELKIRIEEEGDGTIVRKLAIVGLWCIQWHPNDRPSIKEVVQM  569

Query  1556  LEREGDDLVLPSSPFAGSQM  1497
             LE +G  L L  +PF  + M
Sbjct  570   LEGDGSHLNLSPNPFMATNM  589


 Score =   333 bits (855),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 222/316 (70%), Gaps = 5/316 (2%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL     + P RYSY  IK +T  F EKLGEG +G+VYKGKL     VAVK++   K
Sbjct  271   LEKFLEDYKAIRPTRYSYADIKKITDGFNEKLGEGSYGTVYKGKLSREIYVAVKVLRDSK  330

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI----NQGAYA  518
               G++FINE+G++GRIHHVN+VRLVG+CA+  + AL+Y+++PN SL+++I    +     
Sbjct  331   GKGEEFINEIGTIGRIHHVNVVRLVGFCADGFRRALIYEYLPNDSLERFILPMSSSTNSV  390

Query  519   SLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFP  698
             S+++W +   I +G ARGIEYLH+GC+ QILHFDIKP NILLD N  PKI DFGLAKL  
Sbjct  391   SVISWNKLQHIALGTARGIEYLHQGCNQQILHFDIKPQNILLDHNLNPKICDFGLAKLCS  450

Query  699   TDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDES  878
              +KS VT+TAARGTIGY+APE+++R  G +SHK+D+YSFGMLL+EM+G      ++ +  
Sbjct  451   KEKSAVTMTAARGTIGYIAPEVLSRNFGKVSHKSDIYSFGMLLLEMVGGRIKSNSKTNNH  510

Query  879   SKYFP-SWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEML  1055
             +K     WIY D+ KG+ +++  E+E +  I +K+ IVGLWCIQ  P  RPS+  VV+ML
Sbjct  511   NKISSLEWIYGDLEKGEELKIRIEEEGDGTIVRKLAIVGLWCIQWHPNDRPSIKEVVQML  570

Query  1056  EGDVELLQMPTDTFLS  1103
             EGD   L +  + F++
Sbjct  571   EGDGSHLNLSPNPFMA  586



>ref|XP_008245712.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=680

 Score =   446 bits (1148),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 213/336 (63%), Positives = 265/336 (79%), Gaps = 5/336 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P     LI K+RRRHLS++E IE+FL ++NNL PIRYSY  IK M + FK+KLGEGG+GS
Sbjct  307   PLVTALLIYKWRRRHLSMYENIEDFLRSNNNLMPIRYSYSDIKKMARGFKDKLGEGGYGS  366

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ K K+NGQDFINEV ++GRI HVN+VRL+G+C E SK ALVYD
Sbjct  367   VYKAKLRSGRLVAIKMLGKSKTNGQDFINEVATIGRIRHVNVVRLIGFCVEGSKRALVYD  426

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KYI        L+ Q+ FEI +GVARGI+YLH+GCD+QILHFDIKPHNILLD
Sbjct  427   FMPNGSLEKYIFSQQGDVSLSCQKIFEIALGVARGIKYLHQGCDMQILHFDIKPHNILLD  486

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF P++SDFGLAKL+P D SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  487   ENFTPRVSDFGLAKLYPLDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLL  546

Query  828   MEMLGLNRTPVTEQDESSK----YFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVG  992
             MEM G  +      ++SS+    YFP+W+ + +NKGK IE+G++  E+EK+I KKM +VG
Sbjct  547   MEMAGRRKNLNAGIEQSSQLSQIYFPTWVSDQLNKGKDIEIGDDATEEEKKIVKKMMMVG  606

Query  993   LWCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             LWCIQM P  RP M++VVEMLEGD+E L +P   FL
Sbjct  607   LWCIQMKPSERPPMNKVVEMLEGDIESLPLPPRPFL  642


 Score =   344 bits (882),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 230/316 (73%), Gaps = 2/316 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL     + P RYS++DIKK+     ++LGEGGYG VYK ++ S  LVA+K+L  SK NG
Sbjct  331   FLRSNNNLMPIRYSYSDIKKMARGFKDKLGEGGYGSVYKAKLRSGRLVAIKMLGKSKTNG  390

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+I HVNVVRL+G+C +G +RALVY+++PN SLEKYIFS +  +V+LS +
Sbjct  391   QDFINEVATIGRIRHVNVVRLIGFCVEGSKRALVYDFMPNGSLEKYIFSQQG-DVSLSCQ  449

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             KI EIALG+A+GI+YLHQGCD QILHFDIKP NILLD N  P++ DFGLAKL   + S V
Sbjct  450   KIFEIALGVARGIKYLHQGCDMQILHFDIKPHNILLDENFTPRVSDFGLAKLYPLDNSIV  509

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGYIAPE+  +N G VS+K+DVYSFGMLL+EM G RKN NA     +   + 
Sbjct  510   SLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNAGIEQSSQLSQI  569

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP WV + LN+G +++I     ++++ I KK+ ++ LWCIQ +P +RP M  VV+MLE 
Sbjct  570   YFPTWVSDQLNKGKDIEIGDDATEEEKKIVKKMMMVGLWCIQMKPSERPPMNKVVEMLEG  629

Query  1547  EGDDLVLPSSPFAGSQ  1500
             + + L LP  PF   Q
Sbjct  630   DIESLPLPPRPFLHPQ  645



>ref|XP_010662564.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=605

 Score =   444 bits (1142),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 217/312 (70%), Positives = 264/312 (85%), Gaps = 3/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+ADIKKITN   ++LG+GGYG VYKG++S+E+ VAVK+L+D KGNG
Sbjct  270   FLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSNEVFVAVKILDDFKGNG  329

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             E+FINEVG +  IHHVNVVRL+G+CADG++RAL+YE+LPNESL+K+IFS    N +L W 
Sbjct  330   EDFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPNESLDKFIFSAFGNNYSLGWH  389

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIAKGIEYLHQGCDQ+ILH DIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  390   KLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  449

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPE++SRNFG VS KSDVYSFGMLL+EMVGGRKN +A   T  +  + 
Sbjct  450   SMTAARGTMGYIAPEMLSRNFGNVSSKSDVYSFGMLLIEMVGGRKNIDA---TVENISQA  506

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL++  E+ IRIE++ D  I KKL+II LWCIQW P+DRPSMK VV MLE E
Sbjct  507   YFPEWLYNHLDQEQEVHIRIEDESDIKITKKLSIIGLWCIQWYPIDRPSMKIVVGMLEGE  566

Query  1544  GDDLVLPSSPFA  1509
               +LV+P +PF 
Sbjct  567   EGNLVMPPNPFT  578


 Score =   352 bits (902),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 237/331 (72%), Gaps = 7/331 (2%)
 Frame = +3

Query  120   VFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKG  299
             V+   K +R H      I+ FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKG
Sbjct  253   VYCSNKLKREHRI---NIQKFLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKG  309

Query  300   KLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPN  479
             KL +   VAVKI+   K NG+DFINEVG+M  IHHVN+VRL+G+CA+  K AL+Y+F+PN
Sbjct  310   KLSNEVFVAVKILDDFKGNGEDFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPN  369

Query  480   GSLDKYINQGAYAS--LLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDEN  653
              SLDK+I   A+ +   L W +  +I +G+A+GIEYLH+GCD +ILH DIKPHNILLD N
Sbjct  370   ESLDKFIFS-AFGNNYSLGWHKLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHN  428

Query  654   FIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLME  833
             F PKISDFGLAKL   ++S V++TAARGT+GY+APE+++R  G +S K+DVYSFGMLL+E
Sbjct  429   FNPKISDFGLAKLCSKEQSAVSMTAARGTMGYIAPEMLSRNFGNVSSKSDVYSFGMLLIE  488

Query  834   MLGLNRT-PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQM  1010
             M+G  +    T ++ S  YFP W+YN +++ + + +  EDE + +ITKK++I+GLWCIQ 
Sbjct  489   MVGGRKNIDATVENISQAYFPEWLYNHLDQEQEVHIRIEDESDIKITKKLSIIGLWCIQW  548

Query  1011  SPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
              PI RPSM  VV MLEG+   L MP + F S
Sbjct  549   YPIDRPSMKIVVGMLEGEEGNLVMPPNPFTS  579



>ref|XP_007029389.1| Receptor-like protein kinase [Theobroma cacao]
 gb|EOY09891.1| Receptor-like protein kinase [Theobroma cacao]
Length=599

 Score =   444 bits (1141),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 210/331 (63%), Positives = 261/331 (79%), Gaps = 1/331 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  I FLI K+RRRHLS+F+ +E+FL + NNL PI+YS+  IK MT  FK KLGEGG+GS
Sbjct  266   PLVIAFLIYKWRRRHLSMFDMVEDFLQSQNNLTPIKYSFSEIKKMTNGFKNKLGEGGYGS  325

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG  VAVKI+ K K NGQ+FINEV ++GRIHHVN+V+L+G+CAE SK ALVY+
Sbjct  326   VYKGKLRSGCMVAVKILGKSKCNGQEFINEVATIGRIHHVNVVQLIGFCAERSKRALVYE  385

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FM NGSL+KYI     ++ L+ ++ +EI +GVARGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  386   FMANGSLEKYIFSNESSTSLSCKKMYEISIGVARGIEYLHKGCDMQILHFDIKPHNILLD  445

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLAKL+P + S+V  TAARGT+GY+APEL  + IG IS+KADVYSFGMLL
Sbjct  446   ENFTPKVSDFGLAKLYPIEDSMVPQTAARGTMGYMAPELFYKNIGGISYKADVYSFGMLL  505

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  +      + SS+ YFPSW+++ +  GK IE+GE  ++EK I KKM IV LWCI
Sbjct  506   MEMVGRRKNLNAFAEHSSQIYFPSWVFDQLTLGKEIEIGEITDEEKEIVKKMVIVSLWCI  565

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             QM P  RPSM++VVEML+ + E LQMP   F
Sbjct  566   QMKPSNRPSMNKVVEMLQNEAECLQMPPAPF  596


 Score =   352 bits (903),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 234/311 (75%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P +YSF++IKK+TN    +LGEGGYG VYKG++ S  +VAVK+L  SK NG
Sbjct  290   FLQSQNNLTPIKYSFSEIKKMTNGFKNKLGEGGYGSVYKGKLRSGCMVAVKILGKSKCNG  349

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVV+L+G+CA+  +RALVYE++ N SLEKYIFS ES + +LS K
Sbjct  350   QEFINEVATIGRIHHVNVVQLIGFCAERSKRALVYEFMANGSLEKYIFSNES-STSLSCK  408

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI++G+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLAKL   E S V
Sbjct  409   KMYEISIGVARGIEYLHKGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPIEDSMV  468

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
               TAARGTMGY+APE+  +N G +S+K+DVYSFGMLL+EMVG RKN NA     +SQ   
Sbjct  469   PQTAARGTMGYMAPELFYKNIGGISYKADVYSFGMLLMEMVGRRKNLNAF-AEHSSQI--  525

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WV++ L  G E++I    D+++ I KK+ I++LWCIQ +P +RPSM  VV+ML+ E
Sbjct  526   YFPSWVFDQLTLGKEIEIGEITDEEKEIVKKMVIVSLWCIQMKPSNRPSMNKVVEMLQNE  585

Query  1544  GDDLVLPSSPF  1512
              + L +P +PF
Sbjct  586   AECLQMPPAPF  596



>ref|XP_010662821.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase RKF3 [Vitis vinifera]
Length=794

 Score =   450 bits (1157),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 270/315 (86%), Gaps = 9/315 (3%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RY++ DIKKITNQ  ++LGEGGYGIVYKG++S+E+LVAVK+LN+SKGNG
Sbjct  460   FLEDYRALKPSRYTYIDIKKITNQFKDKLGEGGYGIVYKGKLSNEVLVAVKILNNSKGNG  519

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHHVNVVRLVG+CA+G +RAL+YE+ PNESLEK+IFS   KN +L WK
Sbjct  520   EEFINEVGTMGRIHHVNVVRLVGFCAEGSKRALIYEFQPNESLEKFIFSEAVKNHSLGWK  579

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q IA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAK+CSKE+S V
Sbjct  580   KLQGIAVGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKVCSKEQSRV  639

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMVGGRKN       D S +  
Sbjct  640   SMTTARGTMGYIAPEVLSRNFGSVSYKSDVYSFGMLLLEMVGGRKNI------DVSVENA  693

Query  1724  S---FPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQML  1554
             S   FPEWVYNHLN+G E+ IRIEE+ D  IAKKL I+ LWCIQW P++RPSMK VVQML
Sbjct  694   SQVYFPEWVYNHLNQGEEIHIRIEEERDFEIAKKLTIVGLWCIQWCPINRPSMKDVVQML  753

Query  1553  EREGDDLVLPSSPFA  1509
             E E +++ +P +PFA
Sbjct  754   EEERNNVTIPPNPFA  768


 Score =   353 bits (907),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 233/311 (75%), Gaps = 2/311 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RY+Y  IK +T  FK+KLGEGG+G VYKGKL +   VAVKI++  K
Sbjct  457   IEKFLEDYRALKPSRYTYIDIKKITNQFKDKLGEGGYGIVYKGKLSNEVLVAVKILNNSK  516

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              NG++FINEVG+MGRIHHVN+VRLVG+CAE SK AL+Y+F PN SL+K+I ++      L
Sbjct  517   GNGEEFINEVGTMGRIHHVNVVRLVGFCAEGSKRALIYEFQPNESLEKFIFSEAVKNHSL  576

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++   I VG+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAK+   ++
Sbjct  577   GWKKLQGIAVGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKVCSKEQ  636

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             S V++T ARGT+GY+APE+++R  G++S+K+DVYSFGMLL+EM+G  +   V+ ++ S  
Sbjct  637   SRVSMTTARGTMGYIAPEVLSRNFGSVSYKSDVYSFGMLLLEMVGGRKNIDVSVENASQV  696

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN +N+G+ I +  E+E +  I KK+TIVGLWCIQ  PI RPSM  VV+MLE +
Sbjct  697   YFPEWVYNHLNQGEEIHIRIEEERDFEIAKKLTIVGLWCIQWCPINRPSMKDVVQMLEEE  756

Query  1065  VELLQMPTDTF  1097
                + +P + F
Sbjct  757   RNNVTIPPNPF  767



>ref|XP_008378068.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=365

 Score =   434 bits (1117),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 256/332 (77%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC IV LI K+++RHLS++  IE FL + NNL PIRYSY  IK MT  F++KLGEGG+GS
Sbjct  15    PCVIVLLIYKWKKRHLSMYVLIEEFLQSHNNLMPIRYSYSDIKKMTTGFRDKLGEGGYGS  74

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG  V +K++ K K+NGQDFINEVG++GRIHHVN+V+L+GYC E SK ALVY+
Sbjct  75    VYKGKLRSGRFVGIKMLGKSKANGQDFINEVGTIGRIHHVNVVQLIGYCVEGSKRALVYE  134

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FM NGSLD++I        L+ +R FEI +GVARGI+YLH+GCD+QILHFDIKPHNILLD
Sbjct  135   FMSNGSLDRHIFSKEGPVSLSCKRAFEISLGVARGIDYLHQGCDMQILHFDIKPHNILLD  194

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +N++PK+SDFGLA+L P D S +TLTAARGTIGY+APEL  + IG +S+KAD+YSFGMLL
Sbjct  195   DNYVPKVSDFGLARLCPVDDSSLTLTAARGTIGYIAPELFYKNIGGVSNKADIYSFGMLL  254

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             ME+ G  +        S  YFPSW+Y+  ++G  IE     E+E  ITKKM IV LWCIQ
Sbjct  255   MEIAGKRKNLNVAAHSSQIYFPSWVYDQFSEGNDIESEGATEEENEITKKMLIVALWCIQ  314

Query  1008  MSPIPRP-SMSRVVEMLEGDVELLQMPTDTFL  1100
             M P  RP SM++VVEMLEG++E L+MP   FL
Sbjct  315   MKPSDRPTSMNKVVEMLEGEIECLEMPPKPFL  346


 Score =   338 bits (868),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/316 (55%), Positives = 232/316 (73%), Gaps = 6/316 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  + P RYS++DIKK+T    ++LGEGGYG VYKG++ S   V +K+L  SK NG
Sbjct  39    FLQSHNNLMPIRYSYSDIKKMTTGFRDKLGEGGYGSVYKGKLRSGRFVGIKMLGKSKANG  98

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEVG IG+IHHVNVV+L+GYC +G +RALVYE++ N SL+++IFS E   V+LS K
Sbjct  99    QDFINEVGTIGRIHHVNVVQLIGYCVEGSKRALVYEFMSNGSLDRHIFSKEGP-VSLSCK  157

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EI+LG+A+GI+YLHQGCD QILHFDIKP NILLD N  PK+ DFGLA+LC  + S++
Sbjct  158   RAFEISLGVARGIDYLHQGCDMQILHFDIKPHNILLDDNYVPKVSDFGLARLCPVDDSSL  217

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GYIAPE+  +N G VS+K+D+YSFGMLL+E+ G RKN N      +SQ   
Sbjct  218   TLTAARGTIGYIAPELFYKNIGGVSNKADIYSFGMLLMEIAGKRKNLNV--AAHSSQI--  273

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRP-SMKAVVQMLER  1548
              FP WVY+  + G +++     +++  I KK+ I+ALWCIQ +P DRP SM  VV+MLE 
Sbjct  274   YFPSWVYDQFSEGNDIESEGATEEENEITKKMLIVALWCIQMKPSDRPTSMNKVVEMLEG  333

Query  1547  EGDDLVLPSSPFAGSQ  1500
             E + L +P  PF   Q
Sbjct  334   EIECLEMPPKPFLYPQ  349



>ref|XP_011001896.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Populus euphratica]
Length=595

 Score =   443 bits (1139),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P RY++ADIK+IT++  ++LG+G YG V+KG++S EI VAVK+LN+S GNG
Sbjct  260   FLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFKGKLSDEIFVAVKILNNSTGNG  319

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +GKIHHVNV+RLVGYCADGFRRALVY+YLPNESLEK++ S   +  +LSW+
Sbjct  320   EEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGETSSLSWE  379

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++Q+IALG+AKGIEYLHQGCDQ+ILHFDIKP NILLD + NPKI DFGLAKLCSK++SAV
Sbjct  380   RLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDHFNPKISDFGLAKLCSKDQSAV  439

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS+KSDVYSFGM+LLEMVGGRK  + K   + S Q  
Sbjct  440   SMTTARGTMGYIAPEVFSRNFGLVSYKSDVYSFGMVLLEMVGGRKTIDDK--LENSNQI-  496

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW YN L++G EL+IRIE++ D  IAKKL ++ LWCIQW PVDRPSM  VVQMLE E
Sbjct  497   YFPEWAYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWCIQWHPVDRPSMNTVVQMLEGE  556

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SPFA +
Sbjct  557   GDKLTVPPSPFASA  570


 Score =   357 bits (917),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 238/320 (74%), Gaps = 2/320 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IENFL     L P RY+Y  IK +T  FK+KLG+G +G+V+KGKL     VAVKI++   
Sbjct  257   IENFLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFKGKLSDEIFVAVKILNNST  316

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASLL  527
              NG++FINEV +MG+IHHVN++RLVGYCA+  + ALVYD++PN SL+K+++ +    S L
Sbjct  317   GNGEEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGETSSL  376

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W+R  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD++F PKISDFGLAKL   D+
Sbjct  377   SWERLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDHFNPKISDFGLAKLCSKDQ  436

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S V++T ARGT+GY+APE+ +R  G +S+K+DVYSFGM+L+EM+G  +T   + + S++ 
Sbjct  437   SAVSMTTARGTMGYIAPEVFSRNFGLVSYKSDVYSFGMVLLEMVGGRKTIDDKLENSNQI  496

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W YN ++KG+ + +  E E + +I KK+T+VGLWCIQ  P+ RPSM+ VV+MLEG+
Sbjct  497   YFPEWAYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWCIQWHPVDRPSMNTVVQMLEGE  556

Query  1065  VELLQMPTDTFLSEPIMEVH  1124
              + L +P   F S     +H
Sbjct  557   GDKLTVPPSPFASAGPGRMH  576



>ref|XP_010662993.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=606

 Score =   443 bits (1139),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 267/314 (85%), Gaps = 7/314 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+ADIKKIT+Q    LG+GGYG VYKG++S+E+LVAVK+LN+ +GNG
Sbjct  277   FLEDYRALKPSRYSYADIKKITDQFKYILGQGGYGTVYKGKLSNEVLVAVKILNNFRGNG  336

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINE+  +G+IHHVNVVRLVG+CADG RRAL++E+LPN+SL K+IFS +    +L W+
Sbjct  337   EEFINEMATMGRIHHVNVVRLVGFCADGMRRALIFEFLPNDSLNKFIFSAKH---SLVWE  393

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIAKG+EYLHQGC+Q+ILHFDIKP NILLDHN NPKI DFGLAKLCSK++SAV
Sbjct  394   KLQDIAIGIAKGMEYLHQGCEQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKDQSAV  453

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV+SRNFG VS+KSDVYSFGMLLLEMV GRKN    + T  +  + 
Sbjct  454   SMTIARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVSGRKN---SDVTAENPSQV  510

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHLN+G EL IRI E+ D  IAKKLAI+ LWCIQW PVDRPSMK VVQMLE E
Sbjct  511   YFPEWIYNHLNQGEELHIRIMENRDATIAKKLAIVGLWCIQWYPVDRPSMKLVVQMLEGE  570

Query  1544  GDDLVLPSSPFAGS  1503
              D+L +P +PFA +
Sbjct  571   -DNLTMPPNPFAST  583


 Score =   348 bits (892),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 231/312 (74%), Gaps = 4/312 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  FK  LG+GG+G+VYKGKL +   VAVKI++  +
Sbjct  274   IEKFLEDYRALKPSRYSYADIKKITDQFKYILGQGGYGTVYKGKLSNEVLVAVKILNNFR  333

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASLLN  530
              NG++FINE+ +MGRIHHVN+VRLVG+CA+  + AL+++F+PN SL+K+I    ++  L 
Sbjct  334   GNGEEFINEMATMGRIHHVNVVRLVGFCADGMRRALIFEFLPNDSLNKFIFSAKHS--LV  391

Query  531   WQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDKS  710
             W++  +I +G+A+G+EYLH+GC+ +ILHFDIKPHNILLD NF PKISDFGLAKL   D+S
Sbjct  392   WEKLQDIAIGIAKGMEYLHQGCEQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKDQS  451

Query  711   IVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEML-GLNRTPVTEQDESSKY  887
              V++T ARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+ G   + VT ++ S  Y
Sbjct  452   AVSMTIARGTMGYIAPEVLSRNFGNVSYKSDVYSFGMLLLEMVSGRKNSDVTAENPSQVY  511

Query  888   FPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDV  1067
             FP WIYN +N+G+ + +   +  +  I KK+ IVGLWCIQ  P+ RPSM  VV+MLEG+ 
Sbjct  512   FPEWIYNHLNQGEELHIRIMENRDATIAKKLAIVGLWCIQWYPVDRPSMKLVVQMLEGE-  570

Query  1068  ELLQMPTDTFLS  1103
             + L MP + F S
Sbjct  571   DNLTMPPNPFAS  582



>ref|XP_010662819.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Vitis vinifera]
Length=384

 Score =   435 bits (1118),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 263/328 (80%), Gaps = 4/328 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C +V+LI K+RRRHLS+ + IE FL++  NL PI+YSY  +K MT  FK KLG+GGFGSV
Sbjct  24    CLLVYLIYKFRRRHLSLDDGIEEFLHSHKNLQPIKYSYSELKKMTHNFKNKLGQGGFGSV  83

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRLVG+  + SK ALVYDF
Sbjct  84    YKGKLRSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFYIQGSKWALVYDF  143

Query  471   MPNGSLDKYI--NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             MPNGSLDK++  +QG     L+W+R ++I +GVARGIEYLH+GCD+QILHFDIKPHNILL
Sbjct  144   MPNGSLDKFVFLDQGNNIP-LSWERLYKIALGVARGIEYLHQGCDMQILHFDIKPHNILL  202

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DE+F PK+SDFGLAKL+  D +IV++TAARGT+GY+APEL  + +G +S KADVYSFGML
Sbjct  203   DEDFTPKVSDFGLAKLYSIDDNIVSITAARGTLGYIAPELFYKNLGGVSFKADVYSFGML  262

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  +      + SS+ YFPSWIYN  ++G+ +EMG+  EDEK+  +KM IV LWC
Sbjct  263   LLEMVGKRKNVNAFAEHSSQIYFPSWIYNRYDQGEDMEMGDATEDEKKYVRKMVIVALWC  322

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             IQM P+ RPSMS+ +EMLEG VELL+MP
Sbjct  323   IQMKPMDRPSMSKTLEMLEGAVELLKMP  350


 Score =   336 bits (861),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 232/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL  ++ ++P +YS++++KK+T+    +LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  47    FLHSHKNLQPIKYSYSELKKMTHNFKNKLGQGGFGSVYKGKLRSGRIVAVKMLVMSKANG  106

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+   G + ALVY+++PN SL+K++F  +  N+ LSW+
Sbjct  107   QDFINEVATIGRIHHVNVVRLVGFYIQGSKWALVYDFMPNGSLDKFVFLDQGNNIPLSWE  166

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +IALG+A+GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S + + V
Sbjct  167   RLYKIALGVARGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSIDDNIV  226

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS K+DVYSFGMLLLEMVG RKN NA     +SQ   
Sbjct  227   SITAARGTLGYIAPELFYKNLGGVSFKADVYSFGMLLLEMVGKRKNVNA-FAEHSSQI--  283

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+YN  ++G ++++    +D++   +K+ I+ALWCIQ +P+DRPSM   ++MLE  
Sbjct  284   YFPSWIYNRYDQGEDMEMGDATEDEKKYVRKMVIVALWCIQMKPMDRPSMSKTLEMLEGA  343

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  344   VELLKMPPKP  353



>ref|XP_009772453.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=604

 Score =   442 bits (1138),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 226/314 (72%), Positives = 261/314 (83%), Gaps = 6/314 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA+RPTRY++A+IKKITN   ++LGEG YG+VYKG +S+EI VAVKVLNDS GNG
Sbjct  270   FLEDYRALRPTRYTYAEIKKITNMFHQQLGEGAYGVVYKGTLSNEIHVAVKVLNDSIGNG  329

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKN-VALSW  2088
             EEFINEV  +GKIHH NVVRLVGYCADGFR ALVYEYLPN+SL+K IF   SK+ + L+W
Sbjct  330   EEFINEVAAMGKIHHFNVVRLVGYCADGFRNALVYEYLPNQSLDKLIFPASSKDHITLNW  389

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             KK+ +IA+GIAKG+EYLHQGCDQQILHFDIKP NILLDHN+NPKI DFGLAKLCSKEKS 
Sbjct  390   KKLHDIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKIADFGLAKLCSKEKSG  449

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             VTMT ARGTMGYIAPEV+S NFGK SHKSDVYSFGMLLLEMVGGRKNF+AK     +  +
Sbjct  450   VTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMLLLEMVGGRKNFDAK----ANNSQ  505

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +F EW++  +N G EL+IRIEEDDD  I +KLAII +WCIQW   DRPS+K V QMLE 
Sbjct  506   VNFSEWIHQRVNEGEELKIRIEEDDDIIIVRKLAIIGVWCIQWNATDRPSIKIVTQMLEG  565

Query  1547  EGDDLVLPSSPFAG  1506
             +G +L +P  PF  
Sbjct  566   DGSNLTIP-PPFTA  578


 Score =   323 bits (827),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 216/307 (70%), Gaps = 2/307 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL     L P RY+Y  IK +T  F ++LGEG +G VYKG L +   VAVK+++   
Sbjct  267   VEKFLEDYRALRPTRYTYAEIKKITNMFHQQLGEGAYGVVYKGTLSNEIHVAVKVLNDSI  326

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEV +MG+IHH N+VRLVGYCA+  ++ALVY+++PN SLDK I   +      
Sbjct  327   GNGEEFINEVAAMGKIHHFNVVRLVGYCADGFRNALVYEYLPNQSLDKLIFPASSKDHIT  386

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             LNW++  +I +G+A+G+EYLH+GCD QILHFDIKP NILLD N  PKI+DFGLAKL   +
Sbjct  387   LNWKKLHDIAMGIAKGLEYLHQGCDQQILHFDIKPQNILLDHNLNPKIADFGLAKLCSKE  446

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             KS VT+T ARGT+GY+APE+++   G  SHK+DVYSFGMLL+EM+G  +    + + S  
Sbjct  447   KSGVTMTEARGTMGYIAPEVLSSNFGKASHKSDVYSFGMLLLEMVGGRKNFDAKANNSQV  506

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
              F  WI+  +N+G+ +++  E++D+  I +K+ I+G+WCIQ +   RPS+  V +MLEGD
Sbjct  507   NFSEWIHQRVNEGEELKIRIEEDDDIIIVRKLAIIGVWCIQWNATDRPSIKIVTQMLEGD  566

Query  1065  VELLQMP  1085
                L +P
Sbjct  567   GSNLTIP  573



>ref|XP_010662306.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=384

 Score =   434 bits (1117),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 206/328 (63%), Positives = 261/328 (80%), Gaps = 3/328 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+RRRHLS+ + IE FL    NL PIRYSY H+K +T  F+ KLG+GGFGSV
Sbjct  19    CLFGYLIYKFRRRHLSLDDDIEEFLQNHKNLQPIRYSYSHLKKITNNFRNKLGQGGFGSV  78

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKG L+SG  VAVK++   K+NGQDFINE+ ++GRIHHVNIV+LVG+C E SK AL+YDF
Sbjct  79    YKGILQSGRIVAVKVLVMSKANGQDFINEIATIGRIHHVNIVQLVGFCVEGSKWALIYDF  138

Query  471   MPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK+I  +G     L+W R ++I +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  139   MPNGSLDKFIFLKGEKHIPLSWDRLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  198

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ T++S+V+LTAARGT+GY+APEL  + +G +S+KADVYSFGMLL
Sbjct  199   EDFTPKVSDFGLAKLYSTNESVVSLTAARGTLGYIAPELFYKNVGHVSYKADVYSFGMLL  258

Query  828   MEMLGLNR--TPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             MEM+G  R  +   E+D S  +FPSWIY+ I +G+ +EMG+  EDEK+   KM IV LWC
Sbjct  259   MEMVGKQRHFSRHQEEDLSELFFPSWIYDRIEQGEDMEMGDVTEDEKKYIWKMVIVALWC  318

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             +QM P+ RPSMS+ ++MLEGDVELLQ+P
Sbjct  319   VQMKPMDRPSMSKALDMLEGDVELLQLP  346


 Score =   340 bits (873),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 233/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL++++ ++P RYS++ +KKITN    +LG+GG+G VYKG + S  +VAVKVL  SK NG
Sbjct  42    FLQNHKNLQPIRYSYSHLKKITNNFRNKLGQGGFGSVYKGILQSGRIVAVKVLVMSKANG  101

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINE+  IG+IHHVN+V+LVG+C +G + AL+Y+++PN SL+K+IF    K++ LSW 
Sbjct  102   QDFINEIATIGRIHHVNIVQLVGFCVEGSKWALIYDFMPNGSLDKFIFLKGEKHIPLSWD  161

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +IALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S  +S V
Sbjct  162   RLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTNESVV  221

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG +++F+  +  D S  E 
Sbjct  222   SLTAARGTLGYIAPELFYKNVGHVSYKADVYSFGMLLMEMVGKQRHFSRHQEEDLS--EL  279

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ + +G ++++    +D++    K+ I+ALWC+Q +P+DRPSM   + MLE +
Sbjct  280   FFPSWIYDRIEQGEDMEMGDVTEDEKKYIWKMVIVALWCVQMKPMDRPSMSKALDMLEGD  339

Query  1544  GDDLVLPSSP  1515
              + L LP  P
Sbjct  340   VELLQLPPKP  349



>gb|EYU40244.1| hypothetical protein MIMGU_mgv1a019217mg, partial [Erythranthe 
guttata]
Length=510

 Score =   439 bits (1129),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/314 (67%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DYRA++P+R+S++DI +IT+Q  ++LGEGGYG+VYKG++++EI VAVKVLN+SKGNG
Sbjct  196   FLQDYRALKPSRFSYSDITRITHQFRDKLGEGGYGVVYKGKLNNEIDVAVKVLNNSKGNG  255

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRLVG+CADGFRRALVYE+L N+SLEK IF   SK ++L W+
Sbjct  256   EEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFLRNDSLEKIIFQAGSKKISLDWE  315

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIA+GIEYLH+GCDQQILHFDIKP N+LLDHN NPKICDFGLAKLCSKE+SAV
Sbjct  316   KLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDHNFNPKICDFGLAKLCSKEQSAV  375

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   ++    +    
Sbjct  376   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN---EDRNVNNTSPV  432

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+I+ LWCIQW P DRPSMK VVQMLE +
Sbjct  433   YFPQWIYNHINAEDNPMWEQIDEEGNSIARKLSIVGLWCIQWCPTDRPSMKVVVQMLEGD  492

Query  1544  GDDLVLPSSPFAGS  1503
               DL +P +PF  +
Sbjct  493   NGDLTMPPNPFPAT  506


 Score =   346 bits (888),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/330 (53%), Positives = 231/330 (70%), Gaps = 3/330 (1%)
 Frame = +3

Query  114   AIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVY  293
             A+V   I++R    +  + +E FL     L P R+SY  I  +T  F++KLGEGG+G VY
Sbjct  175   ALVHQYIRFRTGRENQIK-VEKFLQDYRALKPSRFSYSDITRITHQFRDKLGEGGYGVVY  233

Query  294   KGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFM  473
             KGKL +  DVAVK+++  K NG++F+NEV ++GRIHHVNIVRLVG+CA+  + ALVY+F+
Sbjct  234   KGKLNNEIDVAVKVLNNSKGNGEEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFL  293

Query  474   PNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
              N SL+K I Q     + L+W++  +I +G+ARGIEYLH GCD QILHFDIKP N+LLD 
Sbjct  294   RNDSLEKIIFQAGSKKISLDWEKLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDH  353

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NF PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+
Sbjct  354   NFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLL  413

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      + +S  YFP WIYN IN        + DE+   I +K++IVGLWCIQ
Sbjct  414   EMVGGRKNEDRNVNNTSPVYFPQWIYNHINAEDNPMWEQIDEEGNSIARKLSIVGLWCIQ  473

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
               P  RPSM  VV+MLEGD   L MP + F
Sbjct  474   WCPTDRPSMKVVVQMLEGDNGDLTMPPNPF  503



>ref|XP_010662994.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Vitis 
vinifera]
Length=688

 Score =   445 bits (1145),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 210/331 (63%), Positives = 263/331 (79%), Gaps = 1/331 (0%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   FLI K++RRHLS+ + +E FL + NNL PIRYSY  IK MT  F++KLG+GGFGSV
Sbjct  325   CLCAFLIYKFQRRHLSMDDTLEEFLQSHNNLQPIRYSYSEIKKMTNNFQDKLGQGGFGSV  384

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   KSNGQDFINEV ++GRIHHVN+VRLVG+C E SK+ALVYDF
Sbjct  385   YKGKLRSGQIVAVKMLVVSKSNGQDFINEVATIGRIHHVNVVRLVGFCTEKSKYALVYDF  444

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             M NGSLDKY+      S+ L+W+R + I +GVA GIEYLHRGC++QILHFDIKPHNILLD
Sbjct  445   MANGSLDKYVFLERENSIPLSWERLYNIALGVAHGIEYLHRGCEMQILHFDIKPHNILLD  504

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLAKL+ +D++ VTLTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  505   ENFTPKVSDFGLAKLYSSDQNAVTLTAARGTLGYIAPELFYKNIGDVSYKADVYSFGMLL  564

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             MEM+G  +      ++S  +FPSWIY+ I++G+ +EMGE  E+EK+  +K+ IV LWC+Q
Sbjct  565   MEMMGKRKYMNARAEKSEIFFPSWIYDRIDRGEDMEMGEATEEEKKYIRKIIIVALWCVQ  624

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             M P  RPSMS+ +EMLE +VELLQMP+   L
Sbjct  625   MKPTNRPSMSKALEMLESEVELLQMPSKPTL  655


 Score =   343 bits (881),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 236/315 (75%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  ++P RYS+++IKK+TN   ++LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  348   FLQSHNNLQPIRYSYSEIKKMTNNFQDKLGQGGFGSVYKGKLRSGQIVAVKMLVVSKSNG  407

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+C +  + ALVY+++ N SL+KY+F     ++ LSW+
Sbjct  408   QDFINEVATIGRIHHVNVVRLVGFCTEKSKYALVYDFMANGSLDKYVFLERENSIPLSWE  467

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++  IALG+A GIEYLH+GC+ QILHFDIKP NILLD N  PK+ DFGLAKL S +++AV
Sbjct  468   RLYNIALGVAHGIEYLHRGCEMQILHFDIKPHNILLDENFTPKVSDFGLAKLYSSDQNAV  527

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EM+G RK  NA+      + E 
Sbjct  528   TLTAARGTLGYIAPELFYKNIGDVSYKADVYSFGMLLMEMMGKRKYMNAR----AEKSEI  583

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ ++RG ++++    ++++   +K+ I+ALWC+Q +P +RPSM   ++MLE E
Sbjct  584   FFPSWIYDRIDRGEDMEMGEATEEEKKYIRKIIIVALWCVQMKPTNRPSMSKALEMLESE  643

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +PS P   S+
Sbjct  644   VELLQMPSKPTLHSK  658



>gb|KDP22153.1| hypothetical protein JCGZ_25984 [Jatropha curcas]
Length=595

 Score =   442 bits (1136),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 265/314 (84%), Gaps = 7/314 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++PTRYSFAD+K+ITNQ  ++LG+G YG V+KG++S+EI VA+K+LN+S GNG
Sbjct  264   FLEDYRALKPTRYSFADLKRITNQFKDKLGQGSYGTVFKGKISNEIYVAIKILNNSIGNG  323

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHHVNVVRLVG+CADGF+RALVYE+LPNESLEK+IFS++     L W+
Sbjct  324   EEFINEVGTMGRIHHVNVVRLVGFCADGFKRALVYEFLPNESLEKFIFSSK----FLGWE  379

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K++EIALGIA+GIEYLHQGCDQ+ILHFDIKP NILLD N NPK+ DFGLAKLCS  +S+V
Sbjct  380   KLEEIALGIARGIEYLHQGCDQRILHFDIKPHNILLDDNFNPKVSDFGLAKLCSLGQSSV  439

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV SRNFG VS+KSDVYSFGM+L EMVGGRKN +A    D+   + 
Sbjct  440   SMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMVLFEMVGGRKNIDANAENDS---QV  496

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YN L +G EL+IR EE  D  IAKKL  +ALWCIQW PVDRPS+K VVQMLE E
Sbjct  497   FFPEWIYNQLEKGEELRIRNEEQGDSKIAKKLTTVALWCIQWYPVDRPSIKRVVQMLEGE  556

Query  1544  GDDLVLPSSPFAGS  1503
              +++ +P +PFA +
Sbjct  557   RENIPMPPNPFASA  570


 Score =   355 bits (912),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/314 (53%), Positives = 232/314 (74%), Gaps = 4/314 (1%)
 Frame = +3

Query  165   EPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSK  344
             E +E FL     L P RYS+  +K +T  FK+KLG+G +G+V+KGK+ +   VA+KI++ 
Sbjct  259   EYLEKFLEDYRALKPTRYSFADLKRITNQFKDKLGQGSYGTVFKGKISNEIYVAIKILNN  318

Query  345   PKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL  524
                NG++FINEVG+MGRIHHVN+VRLVG+CA+  K ALVY+F+PN SL+K+I    +   
Sbjct  319   SIGNGEEFINEVGTMGRIHHVNVVRLVGFCADGFKRALVYEFLPNESLEKFIFSSKF---  375

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L W++  EI +G+ARGIEYLH+GCD +ILHFDIKPHNILLD+NF PK+SDFGLAKL    
Sbjct  376   LGWEKLEEIALGIARGIEYLHQGCDQRILHFDIKPHNILLDDNFNPKVSDFGLAKLCSLG  435

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESS  881
             +S V++TAARGT+GY+APE+ +R  G +S+K+DVYSFGM+L EM+G  +      +++S 
Sbjct  436   QSSVSMTAARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMVLFEMVGGRKNIDANAENDSQ  495

Query  882   KYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEG  1061
              +FP WIYN + KG+ + +  E++ + +I KK+T V LWCIQ  P+ RPS+ RVV+MLEG
Sbjct  496   VFFPEWIYNQLEKGEELRIRNEEQGDSKIAKKLTTVALWCIQWYPVDRPSIKRVVQMLEG  555

Query  1062  DVELLQMPTDTFLS  1103
             + E + MP + F S
Sbjct  556   ERENIPMPPNPFAS  569



>ref|XP_008376288.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Malus 
domestica]
Length=424

 Score =   436 bits (1120),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 210/339 (62%), Positives = 257/339 (76%), Gaps = 1/339 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P    FLI  ++RRHLS++  IE FL+ + N  PIRYSY +IK M+  FKEKLGEGG+GS
Sbjct  64    PFVTAFLIYTWKRRHLSMYNSIEEFLHGEKNFVPIRYSYSNIKKMSNKFKEKLGEGGYGS  123

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             V+K +LRSG   A+K++ KPK NGQDFI+EV ++GRIHHVN+V+LVGYC E SKHALVYD
Sbjct  124   VFKARLRSGRFAAIKMLDKPKGNGQDFISEVNTIGRIHHVNVVQLVGYCVEGSKHALVYD  183

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FM NGSLDKYI     +  L+ +  +EI +GVARGI+YLH GCD+QILHFDIKPHNILLD
Sbjct  184   FMLNGSLDKYIYCKEGSIPLSCKTTYEISLGVARGIKYLHEGCDMQILHFDIKPHNILLD  243

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+P D SIV+LTAARGT+GY+APEL  + IG +S KADVYSFGMLL
Sbjct  244   ENFVPKISDFGLAKLYPVDNSIVSLTAARGTMGYMAPELFYKNIGGVSFKADVYSFGMLL  303

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM    +      + SS+ YFPSW+YN  N+GK  E+GE  E+EK + +KM I  LWCI
Sbjct  304   MEMASRRKNLNALAEHSSQLYFPSWVYNQYNEGKDFEVGEVLEEEKSLIRKMIITALWCI  363

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV  1121
             Q+ P  RPSM  V++MLEGDVELL+MP +  L    M V
Sbjct  364   QLKPSDRPSMKEVLQMLEGDVELLRMPPEPLLYPQEMPV  402


 Score =   330 bits (847),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 226/315 (72%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL   +   P RYS+++IKK++N+  E+LGEGGYG V+K R+ S    A+K+L+  KGNG
Sbjct  88    FLHGEKNFVPIRYSYSNIKKMSNKFKEKLGEGGYGSVFKARLRSGRFAAIKMLDKPKGNG  147

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG+IHHVNVV+LVGYC +G + ALVY+++ N SL+KYI+  E  ++ LS K
Sbjct  148   QDFISEVNTIGRIHHVNVVQLVGYCVEGSKHALVYDFMLNGSLDKYIYCKEG-SIPLSCK  206

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
                EI+LG+A+GI+YLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL   + S V
Sbjct  207   TTYEISLGVARGIKYLHEGCDMQILHFDIKPHNILLDENFVPKISDFGLAKLYPVDNSIV  266

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGY+APE+  +N G VS K+DVYSFGMLL+EM   RKN NA     +SQ   
Sbjct  267   SLTAARGTMGYMAPELFYKNIGGVSFKADVYSFGMLLMEMASRRKNLNAL-AEHSSQL--  323

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVYN  N G + ++    ++++++ +K+ I ALWCIQ +P DRPSMK V+QMLE +
Sbjct  324   YFPSWVYNQYNEGKDFEVGEVLEEEKSLIRKMIITALWCIQLKPSDRPSMKEVLQMLEGD  383

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  P    Q
Sbjct  384   VELLRMPPEPLLYPQ  398



>ref|XP_011001895.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Populus euphratica]
Length=604

 Score =   442 bits (1137),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P RY++ADIK+IT++  ++LG+G YG V+KG++S EI VAVK+LN+S GNG
Sbjct  269   FLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFKGKLSDEIFVAVKILNNSTGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +GKIHHVNV+RLVGYCADGFRRALVY+YLPNESLEK++ S   +  +LSW+
Sbjct  329   EEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGETSSLSWE  388

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++Q+IALG+AKGIEYLHQGCDQ+ILHFDIKP NILLD + NPKI DFGLAKLCSK++SAV
Sbjct  389   RLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDHFNPKISDFGLAKLCSKDQSAV  448

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS+KSDVYSFGM+LLEMVGGRK  + K   + S Q  
Sbjct  449   SMTTARGTMGYIAPEVFSRNFGLVSYKSDVYSFGMVLLEMVGGRKTIDDK--LENSNQI-  505

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW YN L++G EL+IRIE++ D  IAKKL ++ LWCIQW PVDRPSM  VVQMLE E
Sbjct  506   YFPEWAYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWCIQWHPVDRPSMNTVVQMLEGE  565

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SPFA +
Sbjct  566   GDKLTVPPSPFASA  579


 Score =   357 bits (917),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 238/320 (74%), Gaps = 2/320 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IENFL     L P RY+Y  IK +T  FK+KLG+G +G+V+KGKL     VAVKI++   
Sbjct  266   IENFLADYKALKPARYTYADIKRITDEFKDKLGQGAYGTVFKGKLSDEIFVAVKILNNST  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASLL  527
              NG++FINEV +MG+IHHVN++RLVGYCA+  + ALVYD++PN SL+K+++ +    S L
Sbjct  326   GNGEEFINEVATMGKIHHVNVIRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGETSSL  385

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W+R  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD++F PKISDFGLAKL   D+
Sbjct  386   SWERLQDIALGMAKGIEYLHQGCDQRILHFDIKPHNILLDDHFNPKISDFGLAKLCSKDQ  445

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S V++T ARGT+GY+APE+ +R  G +S+K+DVYSFGM+L+EM+G  +T   + + S++ 
Sbjct  446   SAVSMTTARGTMGYIAPEVFSRNFGLVSYKSDVYSFGMVLLEMVGGRKTIDDKLENSNQI  505

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W YN ++KG+ + +  E E + +I KK+T+VGLWCIQ  P+ RPSM+ VV+MLEG+
Sbjct  506   YFPEWAYNSLDKGEELRIRIEKEGDAQIAKKLTLVGLWCIQWHPVDRPSMNTVVQMLEGE  565

Query  1065  VELLQMPTDTFLSEPIMEVH  1124
              + L +P   F S     +H
Sbjct  566   GDKLTVPPSPFASAGPGRMH  585



>ref|XP_007029390.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY09892.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=595

 Score =   442 bits (1136),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 215/311 (69%), Positives = 264/311 (85%), Gaps = 3/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             F+EDY+A++PTRYS+ADIK+ITNQ  E LG+G YG V+KG++S+EILVAVKVLN++KGNG
Sbjct  248   FMEDYKALKPTRYSYADIKRITNQFKEELGQGSYGTVFKGKLSNEILVAVKVLNETKGNG  307

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG IGKIHH+NVVRLVG+CADGFRRALVYE+LPN SL+K+I S +SK + L W+
Sbjct  308   EEFINEVGTIGKIHHINVVRLVGFCADGFRRALVYEFLPNGSLQKFIASADSKTLFLGWE  367

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q IALG+AKG+EYLH+GCDQ+ILHFDIKP NILLDHN NPKICDFGL+K+CSK++SAV
Sbjct  368   KLQGIALGVAKGLEYLHRGCDQRILHFDIKPHNILLDHNFNPKICDFGLSKMCSKDQSAV  427

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGT+GYIAPEV SRNFG VS+KSDVYSFGMLLLEMVGG+KN +   G D +  E 
Sbjct  428   SMTTARGTIGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKNID---GKDDNAVEA  484

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              +P+W++N L  G +L+I IE ++   IAKKLA + LWCIQW PVDRPSM+ VVQMLE +
Sbjct  485   YYPDWIHNLLEDGEDLRIPIEGEESSKIAKKLATVGLWCIQWHPVDRPSMEVVVQMLEGK  544

Query  1544  GDDLVLPSSPF  1512
              D L +P + F
Sbjct  545   EDHLKIPPNSF  555


 Score =   347 bits (890),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 228/311 (73%), Gaps = 2/311 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             I+ F+     L P RYSY  IK +T  FKE+LG+G +G+V+KGKL +   VAVK++++ K
Sbjct  245   IKRFMEDYKALKPTRYSYADIKRITNQFKEELGQGSYGTVFKGKLSNEILVAVKVLNETK  304

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++FINEVG++G+IHH+N+VRLVG+CA+  + ALVY+F+PNGSL K+I      +L L
Sbjct  305   GNGEEFINEVGTIGKIHHINVVRLVGFCADGFRRALVYEFLPNGSLQKFIASADSKTLFL  364

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++   I +GVA+G+EYLHRGCD +ILHFDIKPHNILLD NF PKI DFGL+K+   D+
Sbjct  365   GWEKLQGIALGVAKGLEYLHRGCDQRILHFDIKPHNILLDHNFNPKICDFGLSKMCSKDQ  424

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDES-SK  884
             S V++T ARGTIGY+APE+ +R  G +S+K+DVYSFGMLL+EM+G  +    + D +   
Sbjct  425   SAVSMTTARGTIGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGKKNIDGKDDNAVEA  484

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             Y+P WI+N +  G+ + +  E E+  +I KK+  VGLWCIQ  P+ RPSM  VV+MLEG 
Sbjct  485   YYPDWIHNLLEDGEDLRIPIEGEESSKIAKKLATVGLWCIQWHPVDRPSMEVVVQMLEGK  544

Query  1065  VELLQMPTDTF  1097
              + L++P ++F
Sbjct  545   EDHLKIPPNSF  555



>gb|EYU21051.1| hypothetical protein MIMGU_mgv1a022486mg, partial [Erythranthe 
guttata]
Length=511

 Score =   439 bits (1128),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/321 (65%), Positives = 256/321 (80%), Gaps = 11/321 (3%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P   V LIIK+R+RHLS+F  IE FL ++ +L  IRYSY  I+ MT+ F+EKLGEGG+GS
Sbjct  190   PSLFVLLIIKFRKRHLSLFSTIEAFLQSNTSLTTIRYSYSDIRKMTRGFREKLGEGGYGS  249

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK+++K ++NGQ+FINEV ++GRIHHVN+V+LVGYCAE SK ALVYD
Sbjct  250   VYKGKLRSGHDVAVKLLNKTRANGQEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYD  309

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KY+     ++ L+  RKFEI VGVARGIEYLH GC+IQILHFDIKPH+ILLD
Sbjct  310   FMPNGSLEKYLFSKETSNWLSLARKFEIAVGVARGIEYLHIGCNIQILHFDIKPHSILLD  369

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PKISDFGLAK + T+ + VTLTA RGTIGY+APEL+NR IG +S+KADVYSFGMLL
Sbjct  370   DNFTPKISDFGLAKSYSTENTAVTLTAVRGTIGYIAPELMNRSIGRVSYKADVYSFGMLL  429

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDE-----------DEKRITK  974
             MEMLGLNR      ++SS+YFP WIY+ +N+G  IE+G  D+           + +++ +
Sbjct  430   MEMLGLNRGTRHNDNKSSQYFPYWIYDHLNEGNDIEIGNADKNDYDDDDDDDDNARKMRR  489

Query  975   KMTIVGLWCIQMSPIPRPSMS  1037
             KMTIVGLWCIQMSP  RPSMS
Sbjct  490   KMTIVGLWCIQMSPTDRPSMS  510


 Score =   316 bits (810),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 164/301 (54%), Positives = 219/301 (73%), Gaps = 16/301 (5%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+   ++   RYS++DI+K+T    E+LGEGGYG VYKG++ S   VAVK+LN ++ NG
Sbjct  214   FLQSNTSLTTIRYSYSDIRKMTRGFREKLGEGGYGSVYKGKLRSGHDVAVKLLNKTRANG  273

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVV+LVGYCA+  +RALVY+++PN SLEKY+FS E+ N  LS  
Sbjct  274   QEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYDFMPNGSLEKYLFSKETSN-WLSLA  332

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIA+G+A+GIEYLH GC+ QILHFDIKP +ILLD N  PKI DFGLAK  S E +AV
Sbjct  333   RKFEIAVGVARGIEYLHIGCNIQILHFDIKPHSILLDDNFTPKISDFGLAKSYSTENTAV  392

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GYIAPE+++R+ G+VS+K+DVYSFGMLL+EM+G   N   +   + S Q  
Sbjct  393   TLTAVRGTIGYIAPELMNRSIGRVSYKADVYSFGMLLMEMLG--LNRGTRHNDNKSSQY-  449

Query  1724  SFPEWVYNHLNRGGELQI-----------RieedddeaiakklaiiaLWCIQWQPVDRPS  1578
              FP W+Y+HLN G +++I             ++D+   + +K+ I+ LWCIQ  P DRPS
Sbjct  450   -FPYWIYDHLNEGNDIEIGNADKNDYDDDDDDDDNARKMRRKMTIVGLWCIQMSPTDRPS  508

Query  1577  M  1575
             M
Sbjct  509   M  509



>ref|XP_010662989.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Vitis 
vinifera]
 ref|XP_010662990.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Vitis 
vinifera]
Length=664

 Score =   444 bits (1141),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 210/327 (64%), Positives = 262/327 (80%), Gaps = 2/327 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   ++I ++RRRHLS+ + IE+FL    NL PIRYSY  IK +T  FK+KLG+GGFGSV
Sbjct  300   CLSAYVIYRFRRRHLSLDDSIEDFLQNHRNLQPIRYSYSEIKKITNGFKDKLGQGGFGSV  359

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRL+G+C E  K AL+YDF
Sbjct  360   YKGKLRSGCIVAVKMLVMSKTNGQDFINEVATIGRIHHVNVVRLIGFCVEGPKWALIYDF  419

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDKYI      S+ L+W+  ++I +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  420   MPNGSLDKYIFPERKNSVPLSWEILYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  479

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             + F PK+SDFGLAKL+  ++SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  480   KTFAPKVSDFGLAKLYSVNQSIVSLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLL  539

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  R     +D+SS+ YFPSWIY+ INKG+ +EMG+  EDEK+  +KM IV LWCI
Sbjct  540   MEMVGKKRYVNAHKDDSSEMYFPSWIYDRINKGEDMEMGDATEDEKKCVRKMVIVALWCI  599

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P  RPSMS+ +EMLEGD+ELL+MP
Sbjct  600   QMKPTDRPSMSKALEMLEGDIELLKMP  626


 Score =   346 bits (887),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 238/315 (76%), Gaps = 3/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+++R ++P RYS+++IKKITN   ++LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  323   FLQNHRNLQPIRYSYSEIKKITNGFKDKLGQGGFGSVYKGKLRSGCIVAVKMLVMSKTNG  382

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRL+G+C +G + AL+Y+++PN SL+KYIF     +V LSW+
Sbjct  383   QDFINEVATIGRIHHVNVVRLIGFCVEGPKWALIYDFMPNGSLDKYIFPERKNSVPLSWE  442

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
              + +IALG+ +GIEYLHQGCD QILHFDIKP NILLD    PK+ DFGLAKL S  +S V
Sbjct  443   ILYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLDKTFAPKVSDFGLAKLYSVNQSIV  502

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG ++  NA +  D+S  E 
Sbjct  503   SLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLLMEMVGKKRYVNAHK-DDSS--EM  559

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ +N+G ++++    +D++   +K+ I+ALWCIQ +P DRPSM   ++MLE +
Sbjct  560   YFPSWIYDRINKGEDMEMGDATEDEKKCVRKMVIVALWCIQMKPTDRPSMSKALEMLEGD  619

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  P   SQ
Sbjct  620   IELLKMPPKPTLYSQ  634



>ref|XP_010275348.1| PREDICTED: probable receptor-like protein kinase At5g39030, partial 
[Nelumbo nucifera]
Length=357

 Score =   432 bits (1112),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 261/321 (81%), Gaps = 3/321 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE+FL++ NNL PIRYSY  IK MT+ FKEKLG+GG+GSV++GKLRSG  VA+K++ + K
Sbjct  10    IEDFLSSYNNLMPIRYSYSKIKKMTRGFKEKLGQGGYGSVFEGKLRSGHPVAIKMLDQSK  69

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI--NQGAYASL  524
              NGQ+FINEV ++GRIHHVN+V+LVG+C+E SK ALVYDFMPNGSL+KYI   Q     L
Sbjct  70    GNGQEFINEVATIGRIHHVNVVQLVGFCSEGSKRALVYDFMPNGSLEKYIFSPQENSTPL  129

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             ++W++ ++I +GVARGI YLH+GCDI ILHFDIKPHNILLDENFIPKISDFGLAK + TD
Sbjct  130   ISWKQMYDIALGVARGIAYLHQGCDIHILHFDIKPHNILLDENFIPKISDFGLAKFYSTD  189

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK  884
             +SIV+LTAARGT+GY+APELV + IG +S+KADVYSFGMLLMEM G  +     ++ SS+
Sbjct  190   ESIVSLTAARGTMGYIAPELVYKNIGNVSYKADVYSFGMLLMEMAGRRKNINAFEEHSSQ  249

Query  885   -YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEG  1061
              YFPSW+Y+ +++G+ +E+ +  E+EK I KK  +V LWCIQM+P+ RPSMS+V+EMLE 
Sbjct  250   IYFPSWVYDQLHEGRNLEIRDVTEEEKEIAKKFVVVALWCIQMNPMDRPSMSKVIEMLES  309

Query  1062  DVELLQMPTDTFLSEPIMEVH  1124
             +VELLQMP   FL  P M V+
Sbjct  310   NVELLQMPPKPFLYPPDMPVN  330


 Score =   360 bits (923),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 180/312 (58%), Positives = 235/312 (75%), Gaps = 4/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL  Y  + P RYS++ IKK+T    E+LG+GGYG V++G++ S   VA+K+L+ SKGNG
Sbjct  13    FLSSYNNLMPIRYSYSKIKKMTRGFKEKLGQGGYGSVFEGKLRSGHPVAIKMLDQSKGNG  72

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVAL-SW  2088
             +EFINEV  IG+IHHVNVV+LVG+C++G +RALVY+++PN SLEKYIFS +  +  L SW
Sbjct  73    QEFINEVATIGRIHHVNVVQLVGFCSEGSKRALVYDFMPNGSLEKYIFSPQENSTPLISW  132

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             K++ +IALG+A+GI YLHQGCD  ILHFDIKP NILLD N  PKI DFGLAK  S ++S 
Sbjct  133   KQMYDIALGVARGIAYLHQGCDIHILHFDIKPHNILLDENFIPKISDFGLAKFYSTDESI  192

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             V++TAARGTMGYIAPE+V +N G VS+K+DVYSFGMLL+EM G RKN NA E   +   +
Sbjct  193   VSLTAARGTMGYIAPELVYKNIGNVSYKADVYSFGMLLMEMAGRRKNINAFEEHSS---Q  249

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FP WVY+ L+ G  L+IR   ++++ IAKK  ++ALWCIQ  P+DRPSM  V++MLE 
Sbjct  250   IYFPSWVYDQLHEGRNLEIRDVTEEEKEIAKKFVVVALWCIQMNPMDRPSMSKVIEMLES  309

Query  1547  EGDDLVLPSSPF  1512
               + L +P  PF
Sbjct  310   NVELLQMPPKPF  321



>gb|EYU37100.1| hypothetical protein MIMGU_mgv1a023511mg [Erythranthe guttata]
Length=589

 Score =   441 bits (1134),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 210/314 (67%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DYRA++P+R+S++DI +IT+Q  ++LGEG YG+VYKG++++EI VAVKVLN+SKGNG
Sbjct  260   FLQDYRALKPSRFSYSDITRITHQFRDKLGEGCYGVVYKGKLNNEIDVAVKVLNNSKGNG  319

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRLVG+CADGFRRALVYE+LPN+SLEK IF   SK ++L W+
Sbjct  320   EEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFLPNDSLEKIIFQAGSKKISLDWE  379

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIA+GIEYLH+GCDQQILHFDIKP N+LLDHN NPKICDFGLAKLCSKE+SAV
Sbjct  380   KLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDHNFNPKICDFGLAKLCSKEQSAV  439

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   ++    +    
Sbjct  440   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN---EDRNVNNNSPV  496

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+I+ LWCIQW P DRPSMK VVQMLE +
Sbjct  497   YFPQWIYNHINAEDNPMWAQIDEEGNSIARKLSIVGLWCIQWSPTDRPSMKVVVQMLEGD  556

Query  1544  GDDLVLPSSPFAGS  1503
               DL +P +PF  +
Sbjct  557   NGDLTMPPNPFPAT  570


 Score =   350 bits (899),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 177/331 (53%), Positives = 231/331 (70%), Gaps = 4/331 (1%)
 Frame = +3

Query  117   IVFLIIKYRRRHLSVFEPI--ENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             +V L+ +Y R       PI  E FL     L P R+SY  I  +T  F++KLGEG +G V
Sbjct  237   LVALVHQYIRFRTGRDNPIKIEKFLQDYRALKPSRFSYSDITRITHQFRDKLGEGCYGVV  296

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKL +  DVAVK+++  K NG++F+NEV ++GRIHHVNIVRLVG+CA+  + ALVY+F
Sbjct  297   YKGKLNNEIDVAVKVLNNSKGNGEEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEF  356

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             +PN SL+K I Q     + L+W++  +I +G+ARGIEYLH GCD QILHFDIKP N+LLD
Sbjct  357   LPNDSLEKIIFQAGSKKISLDWEKLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLD  416

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
              NF PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL
Sbjct  417   HNFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLL  476

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             +EM+G  +      + +S  YFP WIYN IN        + DE+   I +K++IVGLWCI
Sbjct  477   LEMVGGRKNEDRNVNNNSPVYFPQWIYNHINAEDNPMWAQIDEEGNSIARKLSIVGLWCI  536

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             Q SP  RPSM  VV+MLEGD   L MP + F
Sbjct  537   QWSPTDRPSMKVVVQMLEGDNGDLTMPPNPF  567



>ref|XP_010662316.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=391

 Score =   434 bits (1115),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 206/328 (63%), Positives = 261/328 (80%), Gaps = 3/328 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+RRRHLS+ + IE FL    NL PIRYSY H+K +T  F+ KLG+GGFGSV
Sbjct  26    CLFGYLIYKFRRRHLSLDDDIEEFLQNHKNLQPIRYSYSHLKKITNNFRNKLGQGGFGSV  85

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKG L+SG  VAVK++   K+NGQDFINE+ ++GRIHHVNIV+LVG+C E SK AL+YDF
Sbjct  86    YKGILQSGRIVAVKVLVMSKANGQDFINEIATIGRIHHVNIVQLVGFCVEGSKWALIYDF  145

Query  471   MPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK+I  +G     L+W R ++I +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  146   MPNGSLDKFIFLKGEKHIPLSWDRLYKIELGVGRGIEYLHQGCDMQILHFDIKPHNILLD  205

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ T++S+V+LTAARGT+GY+APEL  + +G +S+KADVYSFGMLL
Sbjct  206   EDFTPKVSDFGLAKLYSTNESVVSLTAARGTLGYIAPELFYKNVGHVSYKADVYSFGMLL  265

Query  828   MEMLGLNR--TPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             MEM+G  R  +   E+D S  +FPSWIY+ I +G+ +EMG+  EDEK+   KM IV LWC
Sbjct  266   MEMVGKQRHFSRHQEEDLSELFFPSWIYDRIEQGEDMEMGDVTEDEKKYIWKMVIVALWC  325

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             +QM P+ RPSMS+ ++MLEGDVELLQ+P
Sbjct  326   VQMKPMDRPSMSKALDMLEGDVELLQLP  353


 Score =   338 bits (868),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 232/310 (75%), Gaps = 2/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL++++ ++P RYS++ +KKITN    +LG+GG+G VYKG + S  +VAVKVL  SK NG
Sbjct  49    FLQNHKNLQPIRYSYSHLKKITNNFRNKLGQGGFGSVYKGILQSGRIVAVKVLVMSKANG  108

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINE+  IG+IHHVN+V+LVG+C +G + AL+Y+++PN SL+K+IF    K++ LSW 
Sbjct  109   QDFINEIATIGRIHHVNIVQLVGFCVEGSKWALIYDFMPNGSLDKFIFLKGEKHIPLSWD  168

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +I LG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S  +S V
Sbjct  169   RLYKIELGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTNESVV  228

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG +++F+  +  D S  E 
Sbjct  229   SLTAARGTLGYIAPELFYKNVGHVSYKADVYSFGMLLMEMVGKQRHFSRHQEEDLS--EL  286

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ + +G ++++    +D++    K+ I+ALWC+Q +P+DRPSM   + MLE +
Sbjct  287   FFPSWIYDRIEQGEDMEMGDVTEDEKKYIWKMVIVALWCVQMKPMDRPSMSKALDMLEGD  346

Query  1544  GDDLVLPSSP  1515
              + L LP  P
Sbjct  347   VELLQLPPKP  356



>gb|EYU21057.1| hypothetical protein MIMGU_mgv1a024072mg [Erythranthe guttata]
Length=600

 Score =   441 bits (1135),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 215/314 (68%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P+R+S++DIK+IT Q +E+LGEGGYGIVYKG++++EI VAVKVLN+S GNG
Sbjct  271   FLRDYKALKPSRFSYSDIKRITRQFNEKLGEGGYGIVYKGKLNNEIDVAVKVLNNSNGNG  330

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRL+G+CADGFRRALVYE+LPN SLEK IF   S  + L W+
Sbjct  331   EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRINLDWE  390

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALG+AKGIEYLH+GCDQQILHFDIKP N+LLDHN+NPKICDFGLAKLCSKE+SAV
Sbjct  391   KLKDIALGVAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLNPKICDFGLAKLCSKEQSAV  450

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEVVSR FG+VS+KSDVYSFGMLLLEMVGGRKN   +   +TSQ   
Sbjct  451   TMTAARGTMGYIAPEVVSRTFGRVSYKSDVYSFGMLLLEMVGGRKN-EDRNVNNTSQV--  507

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+I+ LWCIQW P D PSMK VVQMLE E
Sbjct  508   YFPQWIYNHINVEDNPMWAPIDEERNSIARKLSIVGLWCIQWCPTDHPSMKVVVQMLEGE  567

Query  1544  GDDLVLPSSPFAGS  1503
              DDL +P +PF  +
Sbjct  568   CDDLTMPPNPFPAT  581


 Score =   347 bits (889),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 175/330 (53%), Positives = 232/330 (70%), Gaps = 7/330 (2%)
 Frame = +3

Query  120   VFLIIKYR--RRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVY  293
             V+L I+ R  R + ++   I  FL     L P R+SY  IK +T+ F EKLGEGG+G VY
Sbjct  252   VYLYIRVRIYRENQTM---IGKFLRDYKALKPSRFSYSDIKRITRQFNEKLGEGGYGIVY  308

Query  294   KGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFM  473
             KGKL +  DVAVK+++    NG++F+NEV ++GRIHHVNIVRL+G+CA+  + ALVY+F+
Sbjct  309   KGKLNNEIDVAVKVLNNSNGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFL  368

Query  474   PNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             PNGSL+K I Q     + L+W++  +I +GVA+GIEYLH GCD QILHFDIKP N+LLD 
Sbjct  369   PNGSLEKSIFQAGSNRINLDWEKLKDIALGVAKGIEYLHEGCDQQILHFDIKPQNVLLDH  428

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             N  PKI DFGLAKL   ++S VT+TAARGT+GY+APE+V+R  G +S+K+DVYSFGMLL+
Sbjct  429   NLNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVVSRTFGRVSYKSDVYSFGMLLL  488

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      + +S+ YFP WIYN IN          DE+   I +K++IVGLWCIQ
Sbjct  489   EMVGGRKNEDRNVNNTSQVYFPQWIYNHINVEDNPMWAPIDEERNSIARKLSIVGLWCIQ  548

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
               P   PSM  VV+MLEG+ + L MP + F
Sbjct  549   WCPTDHPSMKVVVQMLEGECDDLTMPPNPF  578



>gb|EYU21073.1| hypothetical protein MIMGU_mgv1a003869mg [Erythranthe guttata]
Length=559

 Score =   440 bits (1131),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 210/314 (67%), Positives = 262/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DYRA++P+R+S++DI +IT+Q   +LGEG YG+VYKG++++EI VAVKVLN+SKGNG
Sbjct  225   FLQDYRALKPSRFSYSDITRITHQFRNKLGEGCYGVVYKGKLNNEIDVAVKVLNNSKGNG  284

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRLVG+CADGFRRALVYE+LPN+SLEK IF   SK ++L W+
Sbjct  285   EEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFLPNDSLEKIIFQAGSKKISLDWE  344

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIA+GIEYLH+GCDQQILHFDIKP N+LLDHN NPKICDFGLAKLCSKE+SAV
Sbjct  345   KLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDHNFNPKICDFGLAKLCSKEQSAV  404

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   ++    +    
Sbjct  405   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN---EDRNVNNTSPV  461

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+I+ LWCIQW P DRPSMK VVQMLE +
Sbjct  462   YFPQWIYNHINAEDNPMWAQMDEEGNSIARKLSIVGLWCIQWCPTDRPSMKVVVQMLEGD  521

Query  1544  GDDLVLPSSPFAGS  1503
               DL +P +PF  +
Sbjct  522   NGDLTMPPNPFPAT  535


 Score =   351 bits (900),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 175/330 (53%), Positives = 231/330 (70%), Gaps = 3/330 (1%)
 Frame = +3

Query  114   AIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVY  293
             A+V+  I++R    +  + IE FL     L P R+SY  I  +T  F+ KLGEG +G VY
Sbjct  204   ALVYQYIRFRTGRENQIK-IEKFLQDYRALKPSRFSYSDITRITHQFRNKLGEGCYGVVY  262

Query  294   KGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFM  473
             KGKL +  DVAVK+++  K NG++F+NEV ++GRIHHVNIVRLVG+CA+  + ALVY+F+
Sbjct  263   KGKLNNEIDVAVKVLNNSKGNGEEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFL  322

Query  474   PNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             PN SL+K I Q     + L+W++  +I +G+ARGIEYLH GCD QILHFDIKP N+LLD 
Sbjct  323   PNDSLEKIIFQAGSKKISLDWEKLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDH  382

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NF PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+
Sbjct  383   NFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLL  442

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      + +S  YFP WIYN IN        + DE+   I +K++IVGLWCIQ
Sbjct  443   EMVGGRKNEDRNVNNTSPVYFPQWIYNHINAEDNPMWAQMDEEGNSIARKLSIVGLWCIQ  502

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
               P  RPSM  VV+MLEGD   L MP + F
Sbjct  503   WCPTDRPSMKVVVQMLEGDNGDLTMPPNPF  532



>ref|XP_006348219.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Solanum tuberosum]
Length=376

 Score =   433 bits (1113),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 260/318 (82%), Gaps = 6/318 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DY+A+RPTRYS+ADIKKIT+  +E+LGEG YG VYKGR+SSEI VAVKVL DSKG G
Sbjct  52    FLDDYKAIRPTRYSYADIKKITDDFNEKLGEGSYGTVYKGRLSSEIYVAVKVLRDSKGKG  111

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVA---L  2094
             EEFINE+G IG+IHHVNVVRLVG+CAD FRRAL+YEYLPN+SLE++I    S   +   +
Sbjct  112   EEFINEIGTIGRIHHVNVVRLVGFCADEFRRALIYEYLPNDSLERFILPVSSSPGSVSLI  171

Query  2093  SWKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEK  1914
             SW K+Q IALG A+GIEYLHQGCDQQILHFDIKP NILLDHN+NPKICDFGLAKLC KEK
Sbjct  172   SWNKLQHIALGTARGIEYLHQGCDQQILHFDIKPQNILLDHNLNPKICDFGLAKLCYKEK  231

Query  1913  SAVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQ  1734
             S VTMTAARGT+GYIAPEV+SRNFGKVSHKSD+YSFG+LLLEMVGGR   ++K  T+   
Sbjct  232   SVVTMTAARGTIGYIAPEVLSRNFGKVSHKSDIYSFGILLLEMVGGRIKMDSK--TNNHS  289

Query  1733  QEGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQML  1554
             +  S  EW+Y +L +G EL+IRIEE+ D  I +KLAI+ LWCI W P+DRPS+K V QML
Sbjct  290   KVNSL-EWIYGYLEKGEELKIRIEEEGDGTIVRKLAIVELWCILWHPIDRPSIKEVTQML  348

Query  1553  EREGDDLVLPSSPFAGSQ  1500
             E +G  L L  +PF  + 
Sbjct  349   EGDGSHLNLYPNPFMANN  366


 Score =   326 bits (835),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/316 (51%), Positives = 222/316 (70%), Gaps = 5/316 (2%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             +E FL+    + P RYSY  IK +T  F EKLGEG +G+VYKG+L S   VAVK++   K
Sbjct  49    LEKFLDDYKAIRPTRYSYADIKKITDDFNEKLGEGSYGTVYKGRLSSEIYVAVKVLRDSK  108

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI----NQGAYA  518
               G++FINE+G++GRIHHVN+VRLVG+CA+  + AL+Y+++PN SL+++I    +     
Sbjct  109   GKGEEFINEIGTIGRIHHVNVVRLVGFCADEFRRALIYEYLPNDSLERFILPVSSSPGSV  168

Query  519   SLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFP  698
             SL++W +   I +G ARGIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL  
Sbjct  169   SLISWNKLQHIALGTARGIEYLHQGCDQQILHFDIKPQNILLDHNLNPKICDFGLAKLCY  228

Query  699   TDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDES  878
              +KS+VT+TAARGTIGY+APE+++R  G +SHK+D+YSFG+LL+EM+G      ++ +  
Sbjct  229   KEKSVVTMTAARGTIGYIAPEVLSRNFGKVSHKSDIYSFGILLLEMVGGRIKMDSKTNNH  288

Query  879   SKYFP-SWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEML  1055
             SK     WIY  + KG+ +++  E+E +  I +K+ IV LWCI   PI RPS+  V +ML
Sbjct  289   SKVNSLEWIYGYLEKGEELKIRIEEEGDGTIVRKLAIVELWCILWHPIDRPSIKEVTQML  348

Query  1056  EGDVELLQMPTDTFLS  1103
             EGD   L +  + F++
Sbjct  349   EGDGSHLNLYPNPFMA  364



>gb|EYU32405.1| hypothetical protein MIMGU_mgv1a019405mg, partial [Erythranthe 
guttata]
Length=502

 Score =   437 bits (1125),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 265/314 (84%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++ +R+S+ DIK+IT+Q SE+LGEGGYGIVYKG++++EI VAVKVLN+S GNG
Sbjct  174   FLRDYKALKLSRFSYLDIKRITHQFSEKLGEGGYGIVYKGKLNNEIDVAVKVLNNSNGNG  233

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVNVVRL+G+ ADGFRRALVYE+LPN SLEK IF   S  + L W+
Sbjct  234   EEFVNEVSTIGRIHHVNVVRLLGFYADGFRRALVYEFLPNGSLEKSIFQEGSNRITLDWE  293

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLH+GCDQQILHFDIKP N+LLDHN+NPKICDFGLAKLCSKE+SAV
Sbjct  294   KLQDIALGIAKGIEYLHEGCDQQILHFDIKPQNVLLDHNLNPKICDFGLAKLCSKEQSAV  353

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   +   +TSQ   
Sbjct  354   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN-EDRNVNNTSQV--  410

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N   +  +  + ++  +IA+KL+I+ LWCIQW P DRPSMKAVVQMLE E
Sbjct  411   YFPQWIYNHIN-AEDNPLWAKNEEGNSIARKLSIVGLWCIQWCPTDRPSMKAVVQMLEGE  469

Query  1544  GDDLVLPSSPFAGS  1503
              DDL +P +PF  +
Sbjct  470   CDDLTMPPNPFPAT  483


 Score =   335 bits (860),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/297 (55%), Positives = 220/297 (74%), Gaps = 3/297 (1%)
 Frame = +3

Query  213   RYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMG  392
             R+SY  IK +T  F EKLGEGG+G VYKGKL +  DVAVK+++    NG++F+NEV ++G
Sbjct  185   RFSYLDIKRITHQFSEKLGEGGYGIVYKGKLNNEIDVAVKVLNNSNGNGEEFVNEVSTIG  244

Query  393   RIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQ-GAYASLLNWQRKFEIVVGVAR  569
             RIHHVN+VRL+G+ A+  + ALVY+F+PNGSL+K I Q G+    L+W++  +I +G+A+
Sbjct  245   RIHHVNVVRLLGFYADGFRRALVYEFLPNGSLEKSIFQEGSNRITLDWEKLQDIALGIAK  304

Query  570   GIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGY  749
             GIEYLH GCD QILHFDIKP N+LLD N  PKI DFGLAKL   ++S VT+TAARGT+GY
Sbjct  305   GIEYLHEGCDQQILHFDIKPQNVLLDHNLNPKICDFGLAKLCSKEQSAVTMTAARGTMGY  364

Query  750   VAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGK  926
             +APE+++R  G +S+K+DVYSFGMLL+EM+G  +      + +S+ YFP WIYN IN  +
Sbjct  365   IAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKNEDRNVNNTSQVYFPQWIYNHIN-AE  423

Query  927   AIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
                +  ++E+   I +K++IVGLWCIQ  P  RPSM  VV+MLEG+ + L MP + F
Sbjct  424   DNPLWAKNEEGNSIARKLSIVGLWCIQWCPTDRPSMKAVVQMLEGECDDLTMPPNPF  480



>gb|EYU29477.1| hypothetical protein MIMGU_mgv1a003032mg [Erythranthe guttata]
Length=613

 Score =   441 bits (1135),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/314 (68%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DYRA++P+R+S++DI +IT+Q   +LGEGGYG+VYKG++++EI VAVKVLN+SKGNG
Sbjct  259   FLHDYRALKPSRFSYSDITRITHQFHYKLGEGGYGVVYKGKLNNEIDVAVKVLNNSKGNG  318

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVNVVRLVG+CADGF+RALVYE+LPN+SLEK IF   SK ++L W+
Sbjct  319   EEFVNEVSTIGRIHHVNVVRLVGFCADGFQRALVYEFLPNDSLEKIIFQAGSKKISLDWE  378

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIA+GIEYLH+GCDQQILHFDIKP NILLDHN NPKICDFGLAKLCSKE+SAV
Sbjct  379   KLKDIALGIARGIEYLHEGCDQQILHFDIKPQNILLDHNFNPKICDFGLAKLCSKEQSAV  438

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   ++    +    
Sbjct  439   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN---EDRNVNNTSPV  495

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+++ LWCIQW P DRPSMKAVVQMLE +
Sbjct  496   YFPQWIYNHINAEDNPTWAQIDEEGNSIARKLSMVGLWCIQWCPTDRPSMKAVVQMLEGD  555

Query  1544  GDDLVLPSSPFAGS  1503
               DL +P +PF  +
Sbjct  556   NGDLTMPPNPFPAT  569


 Score =   349 bits (895),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 222/311 (71%), Gaps = 2/311 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL+    L P R+SY  I  +T  F  KLGEGG+G VYKGKL +  DVAVK+++  K
Sbjct  256   IEKFLHDYRALKPSRFSYSDITRITHQFHYKLGEGGYGVVYKGKLNNEIDVAVKVLNNSK  315

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASL-L  527
              NG++F+NEV ++GRIHHVN+VRLVG+CA+  + ALVY+F+PN SL+K I Q     + L
Sbjct  316   GNGEEFVNEVSTIGRIHHVNVVRLVGFCADGFQRALVYEFLPNDSLEKIIFQAGSKKISL  375

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  +I +G+ARGIEYLH GCD QILHFDIKP NILLD NF PKI DFGLAKL   ++
Sbjct  376   DWEKLKDIALGIARGIEYLHEGCDQQILHFDIKPQNILLDHNFNPKICDFGLAKLCSKEQ  435

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +      + +S  
Sbjct  436   SAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKNEDRNVNNTSPV  495

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN IN        + DE+   I +K+++VGLWCIQ  P  RPSM  VV+MLEGD
Sbjct  496   YFPQWIYNHINAEDNPTWAQIDEEGNSIARKLSMVGLWCIQWCPTDRPSMKAVVQMLEGD  555

Query  1065  VELLQMPTDTF  1097
                L MP + F
Sbjct  556   NGDLTMPPNPF  566



>ref|XP_003635630.2| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=375

 Score =   433 bits (1113),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 202/327 (62%), Positives = 262/327 (80%), Gaps = 2/327 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+RRRHLS+ + IE FL+   NL PI+Y+Y  IK MT  FK KLG+GGFGSV
Sbjct  15    CLFAYLIYKFRRRHLSLDDDIEEFLHNYQNLRPIKYTYSDIKKMTYNFKHKLGQGGFGSV  74

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRLVG+C + SK AL+YD+
Sbjct  75    YKGKLRSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCIQRSKWALIYDY  134

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK++      ++ L+W+R ++I +GV RGI+YLH+GCD+QILHFDIKPHNILLD
Sbjct  135   MPNGSLDKFVFLDQENNIPLSWERLYKIALGVGRGIKYLHQGCDMQILHFDIKPHNILLD  194

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+SIV++TAARGT+GY+APEL  + IG +S KADVYSFGMLL
Sbjct  195   EDFTPKVSDFGLAKLYSTDESIVSVTAARGTLGYIAPELFYKNIGGVSFKADVYSFGMLL  254

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             +EM+G  +      + SS+ YFPSWIY+  ++G+ +EMG+  EDEK+  +KM IV LWC+
Sbjct  255   LEMVGKRKNVNAFAEHSSQIYFPSWIYDRYDQGEDMEMGDATEDEKKYVRKMVIVALWCV  314

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P+ RPSMS+ +EMLEG++ELL+MP
Sbjct  315   QMKPVDRPSMSKTLEMLEGEIELLKMP  341


 Score =   343 bits (880),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 233/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL +Y+ +RP +Y+++DIKK+T     +LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  38    FLHNYQNLRPIKYTYSDIKKMTYNFKHKLGQGGFGSVYKGKLRSGRIVAVKMLVMSKANG  97

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+C    + AL+Y+Y+PN SL+K++F  +  N+ LSW+
Sbjct  98    QDFINEVATIGRIHHVNVVRLVGFCIQRSKWALIYDYMPNGSLDKFVFLDQENNIPLSWE  157

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +IALG+ +GI+YLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  158   RLYKIALGVGRGIKYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESIV  217

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS K+DVYSFGMLLLEMVG RKN NA     +SQ   
Sbjct  218   SVTAARGTLGYIAPELFYKNIGGVSFKADVYSFGMLLLEMVGKRKNVNA-FAEHSSQI--  274

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++G ++++    +D++   +K+ I+ALWC+Q +PVDRPSM   ++MLE E
Sbjct  275   YFPSWIYDRYDQGEDMEMGDATEDEKKYVRKMVIVALWCVQMKPVDRPSMSKTLEMLEGE  334

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  335   IELLKMPPKP  344



>ref|XP_010662971.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X1 [Vitis vinifera]
Length=688

 Score =   444 bits (1141),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/339 (63%), Positives = 266/339 (78%), Gaps = 2/339 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C I +LI K+RRRHLS+ + IE FL    NL PIRYSY  IK MT  FK  LG+GGFGSV
Sbjct  323   CLIAYLIYKFRRRHLSLDDSIEEFLQKHKNLQPIRYSYSEIKKMTDNFKTSLGKGGFGSV  382

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKL+SGS VAVK+++  K+NG+DFINEV ++GRIHH+N+VRL+G+CA  SK AL+YDF
Sbjct  383   YKGKLQSGSIVAVKVLATSKANGEDFINEVATIGRIHHMNVVRLIGFCANGSKWALIYDF  442

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDKYI      S+ L+W+  ++I +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  443   MPNGSLDKYIFLKRENSVYLSWEMLYKIALGIARGIEYLHRGCDMQILHFDIKPHNILLD  502

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+SIV+LTAARGT+GY+APEL  + IG IS+KADVYSFGMLL
Sbjct  503   EDFTPKVSDFGLAKLYSTDESIVSLTAARGTLGYIAPELFYKNIGGISYKADVYSFGMLL  562

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  +      + SS+ YFPSW+++  ++G+ +EMG+  EDEK+  KKM +V LWCI
Sbjct  563   MEMVGRRKNVQAFAEHSSQIYFPSWVHDKYDRGENMEMGDATEDEKKSVKKMVLVALWCI  622

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV  1121
             Q+ P  RPSM + +EMLEG+VELLQMP    LS   M +
Sbjct  623   QLKPTDRPSMGKALEMLEGEVELLQMPPKPTLSYEEMSI  661


 Score =   342 bits (876),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 233/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ ++ ++P RYS+++IKK+T+     LG+GG+G VYKG++ S  +VAVKVL  SK NG
Sbjct  346   FLQKHKNLQPIRYSYSEIKKMTDNFKTSLGKGGFGSVYKGKLQSGSIVAVKVLATSKANG  405

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             E+FINEV  IG+IHH+NVVRL+G+CA+G + AL+Y+++PN SL+KYIF     +V LSW+
Sbjct  406   EDFINEVATIGRIHHMNVVRLIGFCANGSKWALIYDFMPNGSLDKYIFLKRENSVYLSWE  465

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
              + +IALGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  466   MLYKIALGIARGIEYLHRGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESIV  525

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G +S+K+DVYSFGMLL+EMVG RKN  A     +SQ   
Sbjct  526   SLTAARGTLGYIAPELFYKNIGGISYKADVYSFGMLLMEMVGRRKNVQAF-AEHSSQI--  582

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WV++  +RG  +++    +D++   KK+ ++ALWCIQ +P DRPSM   ++MLE E
Sbjct  583   YFPSWVHDKYDRGENMEMGDATEDEKKSVKKMVLVALWCIQLKPTDRPSMGKALEMLEGE  642

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  643   VELLQMPPKP  652



>ref|XP_010662972.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like isoform X2 [Vitis vinifera]
Length=678

 Score =   443 bits (1140),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/339 (63%), Positives = 266/339 (78%), Gaps = 2/339 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C I +LI K+RRRHLS+ + IE FL    NL PIRYSY  IK MT  FK  LG+GGFGSV
Sbjct  313   CLIAYLIYKFRRRHLSLDDSIEEFLQKHKNLQPIRYSYSEIKKMTDNFKTSLGKGGFGSV  372

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKL+SGS VAVK+++  K+NG+DFINEV ++GRIHH+N+VRL+G+CA  SK AL+YDF
Sbjct  373   YKGKLQSGSIVAVKVLATSKANGEDFINEVATIGRIHHMNVVRLIGFCANGSKWALIYDF  432

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDKYI      S+ L+W+  ++I +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  433   MPNGSLDKYIFLKRENSVYLSWEMLYKIALGIARGIEYLHRGCDMQILHFDIKPHNILLD  492

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+SIV+LTAARGT+GY+APEL  + IG IS+KADVYSFGMLL
Sbjct  493   EDFTPKVSDFGLAKLYSTDESIVSLTAARGTLGYIAPELFYKNIGGISYKADVYSFGMLL  552

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  +      + SS+ YFPSW+++  ++G+ +EMG+  EDEK+  KKM +V LWCI
Sbjct  553   MEMVGRRKNVQAFAEHSSQIYFPSWVHDKYDRGENMEMGDATEDEKKSVKKMVLVALWCI  612

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV  1121
             Q+ P  RPSM + +EMLEG+VELLQMP    LS   M +
Sbjct  613   QLKPTDRPSMGKALEMLEGEVELLQMPPKPTLSYEEMSI  651


 Score =   342 bits (876),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 233/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ ++ ++P RYS+++IKK+T+     LG+GG+G VYKG++ S  +VAVKVL  SK NG
Sbjct  336   FLQKHKNLQPIRYSYSEIKKMTDNFKTSLGKGGFGSVYKGKLQSGSIVAVKVLATSKANG  395

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             E+FINEV  IG+IHH+NVVRL+G+CA+G + AL+Y+++PN SL+KYIF     +V LSW+
Sbjct  396   EDFINEVATIGRIHHMNVVRLIGFCANGSKWALIYDFMPNGSLDKYIFLKRENSVYLSWE  455

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
              + +IALGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  456   MLYKIALGIARGIEYLHRGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESIV  515

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G +S+K+DVYSFGMLL+EMVG RKN  A     +SQ   
Sbjct  516   SLTAARGTLGYIAPELFYKNIGGISYKADVYSFGMLLMEMVGRRKNVQAF-AEHSSQI--  572

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WV++  +RG  +++    +D++   KK+ ++ALWCIQ +P DRPSM   ++MLE E
Sbjct  573   YFPSWVHDKYDRGENMEMGDATEDEKKSVKKMVLVALWCIQLKPTDRPSMGKALEMLEGE  632

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  633   VELLQMPPKP  642



>ref|XP_007039001.1| Kinase, putative [Theobroma cacao]
 gb|EOY23502.1| Kinase, putative [Theobroma cacao]
Length=636

 Score =   442 bits (1136),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/334 (63%), Positives = 263/334 (79%), Gaps = 4/334 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC  +F++ K+RRRHLS+++ +E FL + NNL P+RYSY  +K MT  F+ KLGEGG+G 
Sbjct  281   PCVTLFVVHKWRRRHLSMYDTVEEFLQSHNNLMPVRYSYSDVKKMTDGFRVKLGEGGYGY  340

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG   A+K++SK K++GQDFINEV ++GRIHHVN+V+L+G+CA+ SK ALVYD
Sbjct  341   VYKGKLRSGRIAAIKMLSKSKADGQDFINEVATIGRIHHVNVVQLIGFCAKGSKRALVYD  400

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI      + L+W++ +EI VGVA GIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  401   FMPNGSLDKYIFSPERCTTLSWKKTYEIAVGVAHGIEYLHRGCDMQILHFDIKPHNILLD  460

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENFIPKISDFGLAKL+  D SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  461   ENFIPKISDFGLAKLYAVDDSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLL  520

Query  828   MEMLGL--NRTPVTEQDESSKYFPSWIYNDINKGKAI-EMGEEDEDEKRITKKMTIVGLW  998
             +EM+G   N  P+ E   S  YFP ++Y  I +G  + E+G+  E++K + KKM+IV LW
Sbjct  521   LEMIGRRKNLDPLAEH-SSEIYFPFYVYGQIIEGNNVNEVGDATEEDKEMIKKMSIVALW  579

Query  999   CIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             CIQM P  RPSMS+VVEMLEG +E LQ+P    L
Sbjct  580   CIQMKPSDRPSMSKVVEMLEGGLESLQVPPKPLL  613


 Score =   333 bits (855),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 229/312 (73%), Gaps = 5/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  + P RYS++D+KK+T+    +LGEGGYG VYKG++ S  + A+K+L+ SK +G
Sbjct  305   FLQSHNNLMPVRYSYSDVKKMTDGFRVKLGEGGYGYVYKGKLRSGRIAAIKMLSKSKADG  364

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+G+CA G +RALVY+++PN SL+KYIFS E +   LSWK
Sbjct  365   QDFINEVATIGRIHHVNVVQLIGFCAKGSKRALVYDFMPNGSLDKYIFSPE-RCTTLSWK  423

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K  EIA+G+A GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL + + S V
Sbjct  424   KTYEIAVGVAHGIEYLHRGCDMQILHFDIKPHNILLDENFIPKISDFGLAKLYAVDDSIV  483

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGYIAPE+  +N G VS+K+DVYSFGMLLLEM+G RKN +          E 
Sbjct  484   SLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLLEMIGRRKNLDP---LAEHSSEI  540

Query  1724  SFPEWVYNHLNRGGEL-QIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP +VY  +  G  + ++    ++D+ + KK++I+ALWCIQ +P DRPSM  VV+MLE 
Sbjct  541   YFPFYVYGQIIEGNNVNEVGDATEEDKEMIKKMSIVALWCIQMKPSDRPSMSKVVEMLEG  600

Query  1547  EGDDLVLPSSPF  1512
               + L +P  P 
Sbjct  601   GLESLQVPPKPL  612



>ref|XP_008234877.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=382

 Score =   432 bits (1112),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/331 (61%), Positives = 260/331 (79%), Gaps = 4/331 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC    LI K+RRRHLS+++ IE FL ++ NL P+RYSY  IK MT+ FKEKLGEGG+G+
Sbjct  45    PCLAALLIYKWRRRHLSMYDNIEEFLQSNCNLMPVRYSYSDIKKMTRGFKEKLGEGGYGT  104

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VAVK++ K K+NGQ+FINEV ++GRIHHVN+V+L+G+  ++SK AL+YD
Sbjct  105   VYKAKLRSGHFVAVKMLGKSKANGQEFINEVATIGRIHHVNVVQLIGFSVDSSKRALIYD  164

Query  468   FMPNGSLDKYINQGAYASL---LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNI  638
             FM NGSL+KYI   + + +   L++++ F+I +GVARGIEYLHRGCD+QILHFDIKPHNI
Sbjct  165   FMANGSLEKYIFSQSRSGVLISLSYEKMFQIALGVARGIEYLHRGCDMQILHFDIKPHNI  224

Query  639   LLDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFG  818
             LLDENF PK+SDFGLA+L P D SIV+L AARGTIGY+APEL  + IG +S+KADVYSFG
Sbjct  225   LLDENFTPKVSDFGLARLCPLDNSIVSLIAARGTIGYIAPELFYKNIGGVSYKADVYSFG  284

Query  819   MLLMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGL  995
             MLLME  G  +      + SS+ YFP+W+Y+ +++G  I MG+  E+E +I +KM IV L
Sbjct  285   MLLMETAGRRKNLNASIEHSSQIYFPTWVYDQLSEGNDINMGDATEEENKIIRKMIIVAL  344

Query  996   WCIQMSPIPRPSMSRVVEMLEGDVELLQMPT  1088
             WCIQM P  RPSM +VVEMLEG+++ LQ P+
Sbjct  345   WCIQMKPSERPSMDKVVEMLEGEIKSLQNPS  375


 Score =   333 bits (853),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 223/310 (72%), Gaps = 5/310 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS++DIKK+T    E+LGEGGYG VYK ++ S   VAVK+L  SK NG
Sbjct  69    FLQSNCNLMPVRYSYSDIKKMTRGFKEKLGEGGYGTVYKAKLRSGHFVAVKMLGKSKANG  128

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNV--ALS  2091
             +EFINEV  IG+IHHVNVV+L+G+  D  +RAL+Y+++ N SLEKYIFS     V  +LS
Sbjct  129   QEFINEVATIGRIHHVNVVQLIGFSVDSSKRALIYDFMANGSLEKYIFSQSRSGVLISLS  188

Query  2090  WKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKS  1911
             ++K+ +IALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+LC  + S
Sbjct  189   YEKMFQIALGVARGIEYLHRGCDMQILHFDIKPHNILLDENFTPKVSDFGLARLCPLDNS  248

Query  1910  AVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQ  1731
              V++ AARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+E  G RKN NA   +     
Sbjct  249   IVSLIAARGTIGYIAPELFYKNIGGVSYKADVYSFGMLLMETAGRRKNLNA---SIEHSS  305

Query  1730  EGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
             +  FP WVY+ L+ G ++ +    +++  I +K+ I+ALWCIQ +P +RPSM  VV+MLE
Sbjct  306   QIYFPTWVYDQLSEGNDINMGDATEEENKIIRKMIIVALWCIQMKPSERPSMDKVVEMLE  365

Query  1550  REGDDLVLPS  1521
              E   L  PS
Sbjct  366   GEIKSLQNPS  375



>ref|XP_007022133.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13658.1| PR5-like receptor kinase [Theobroma cacao]
Length=674

 Score =   443 bits (1139),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 210/330 (64%), Positives = 259/330 (78%), Gaps = 1/330 (0%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C I  +  K+RRRHLS+ + IE FL + N+L PIRYSY+ IK MT++F++KLGEGG+GSV
Sbjct  310   CLIALVTYKWRRRHLSMDDTIEEFLQSQNDLIPIRYSYREIKRMTRSFRDKLGEGGYGSV  369

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             +KGKLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+ +L+G+C E SK ALVYDF
Sbjct  370   FKGKLRSGHLVAIKLLGKSKANGQDFINEVATIGRIHHVNVAKLIGFCVEGSKQALVYDF  429

Query  471   MPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             M NGSLD+ I        LNWQ+ F+I +GVARGIEYLH+GCD+QILHFDIKPHNILLDE
Sbjct  430   MSNGSLDRIIFAEENKITLNWQKMFDIALGVARGIEYLHQGCDMQILHFDIKPHNILLDE  489

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NF+PK+SDFGLAKL+  D SIV+LTAARGTIGY+APELV + IG IS+KADVYSFGMLLM
Sbjct  490   NFVPKVSDFGLAKLYSVDDSIVSLTAARGTIGYIAPELVYKNIGGISNKADVYSFGMLLM  549

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      D  S+ YFPSWIY  +++ + IE+GE  + EK I +KM I   WCIQ
Sbjct  550   EMVGKRKNLNAFADHLSQIYFPSWIYGQLHQEEDIELGEVTDGEKIIVRKMIITACWCIQ  609

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             + P  RPSMS+V+EMLE DVELLQMP   F
Sbjct  610   LPPNDRPSMSKVLEMLETDVELLQMPPKPF  639


 Score =   333 bits (853),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 229/311 (74%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS+ +IK++T    ++LGEGGYG V+KG++ S  LVA+K+L  SK NG
Sbjct  333   FLQSQNDLIPIRYSYREIKRMTRSFRDKLGEGGYGSVFKGKLRSGHLVAIKLLGKSKANG  392

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNV +L+G+C +G ++ALVY+++ N SL++ IF+ E+K + L+W+
Sbjct  393   QDFINEVATIGRIHHVNVAKLIGFCVEGSKQALVYDFMSNGSLDRIIFAEENK-ITLNWQ  451

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IALG+A+GIEYLHQGCD QILHFDIKP NILLD N  PK+ DFGLAKL S + S V
Sbjct  452   KMFDIALGVARGIEYLHQGCDMQILHFDIKPHNILLDENFVPKVSDFGLAKLYSVDDSIV  511

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+V +N G +S+K+DVYSFGMLL+EMVG RKN NA         + 
Sbjct  512   SLTAARGTIGYIAPELVYKNIGGISNKADVYSFGMLLMEMVGKRKNLNAFAD---HLSQI  568

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y  L++  ++++    D ++ I +K+ I A WCIQ  P DRPSM  V++MLE +
Sbjct  569   YFPSWIYGQLHQEEDIELGEVTDGEKIIVRKMIITACWCIQLPPNDRPSMSKVLEMLETD  628

Query  1544  GDDLVLPSSPF  1512
              + L +P  PF
Sbjct  629   VELLQMPPKPF  639



>ref|XP_002322014.2| hypothetical protein POPTR_0015s01990g [Populus trichocarpa]
 gb|EEF06141.2| hypothetical protein POPTR_0015s01990g [Populus trichocarpa]
Length=604

 Score =   440 bits (1132),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 260/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P RY++ADIK+ITN   E+LG+G YG V+KG++S+EI VAVK+LN+S GNG
Sbjct  269   FLADYKALKPARYTYADIKRITNDFKEKLGQGAYGTVFKGKLSNEIFVAVKILNNSTGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +G+IHHVN+VRLVGYCADGFRRALVY+YLPNESLEK++ S   K   LSW+
Sbjct  329   EEFVNEVGTMGRIHHVNIVRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGKTCPLSWE  388

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLD N +PKI DFGLAKLCSK++SAV
Sbjct  389   KLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDDNFSPKISDFGLAKLCSKDQSAV  448

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS KSDVYS+GM+LLEMVGGRK  + +    T   + 
Sbjct  449   SMTTARGTMGYIAPEVFSRNFGNVSSKSDVYSYGMVLLEMVGGRKIVDNEVENHT---QI  505

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L+ G EL IRIE++ D  IAKKL I+ LWCIQW PV+RPSM  VVQMLE E
Sbjct  506   YFPEWVYNSLDNGEELIIRIEKEGDAQIAKKLTIVGLWCIQWHPVERPSMNTVVQMLEGE  565

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SPF+ +
Sbjct  566   GDKLTMPPSPFSSA  579


 Score =   356 bits (914),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/313 (54%), Positives = 233/313 (74%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RY+Y  IK +T  FKEKLG+G +G+V+KGKL +   VAVKI++   
Sbjct  266   IEFFLADYKALKPARYTYADIKRITNDFKEKLGQGAYGTVFKGKLSNEIFVAVKILNNST  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASLL  527
              NG++F+NEVG+MGRIHHVNIVRLVGYCA+  + ALVYD++PN SL+K+++ +      L
Sbjct  326   GNGEEFVNEVGTMGRIHHVNIVRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGKTCPL  385

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   D+
Sbjct  386   SWEKLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDDNFSPKISDFGLAKLCSKDQ  445

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTE-QDESSK  884
             S V++T ARGT+GY+APE+ +R  G +S K+DVYS+GM+L+EM+G  +    E ++ +  
Sbjct  446   SAVSMTTARGTMGYIAPEVFSRNFGNVSSKSDVYSYGMVLLEMVGGRKIVDNEVENHTQI  505

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++ G+ + +  E E + +I KK+TIVGLWCIQ  P+ RPSM+ VV+MLEG+
Sbjct  506   YFPEWVYNSLDNGEELIIRIEKEGDAQIAKKLTIVGLWCIQWHPVERPSMNTVVQMLEGE  565

Query  1065  VELLQMPTDTFLS  1103
              + L MP   F S
Sbjct  566   GDKLTMPPSPFSS  578



>gb|KCW59546.1| hypothetical protein EUGRSUZ_H02301 [Eucalyptus grandis]
Length=406

 Score =   433 bits (1113),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 205/332 (62%), Positives = 264/332 (80%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FLI+K+ RRH +    IE FL A NN FPIRYSY  IK +T+ FK KLGEGG+G 
Sbjct  29    PCVLIFLILKWMRRHQATDANIEEFLRAHNNFFPIRYSYSDIKRITQNFKCKLGEGGYGF  88

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VY+G LRSG++VAVKI++K KSNGQDFI+EV ++GRIHHVN+V+LVG+C E SK ALVYD
Sbjct  89    VYRGILRSGNEVAVKILNKSKSNGQDFISEVATIGRIHHVNVVQLVGFCFEYSKQALVYD  148

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I+       L++++ ++I +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  149   FMPNGSLDKHISYKDGDDPLDYKKMYDISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  208

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ++F PK+SDFGLA+L+PTD+SIV+LTAARGT+GY+APEL  + IG IS+KADVYSFGMLL
Sbjct  209   QSFTPKVSDFGLARLYPTDRSIVSLTAARGTLGYMAPELFYKDIGGISYKADVYSFGMLL  268

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      + SS+ YFP W+Y+ ++K K +EM +  E+E+  T+KM IV LWCI
Sbjct  269   MEMAGRRRNLNAHAERSSQIYFPLWVYDQLSKEKELEMVDVIEEERETTRKMIIVALWCI  328

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+SP  RPSM +V++MLEGD++ LQ+     L
Sbjct  329   QLSPNDRPSMRKVLDMLEGDMDKLQLSPKPLL  360


 Score =   320 bits (819),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL  +    P RYS++DIK+IT     +LGEGGYG VY+G + S   VAVK+LN SK NG
Sbjct  53    FLRAHNNFFPIRYSYSDIKRITQNFKCKLGEGGYGFVYRGILRSGNEVAVKILNKSKSNG  112

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG+IHHVNVV+LVG+C +  ++ALVY+++PN SL+K+I S +  +  L +K
Sbjct  113   QDFISEVATIGRIHHVNVVQLVGFCFEYSKQALVYDFMPNGSLDKHI-SYKDGDDPLDYK  171

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +I+LGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLA+L   ++S V
Sbjct  172   KMYDISLGIARGIEYLHRGCDMQILHFDIKPHNILLDQSFTPKVSDFGLARLYPTDRSIV  231

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  ++ G +S+K+DVYSFGMLL+EM G R+N NA     +SQ   
Sbjct  232   SLTAARGTLGYMAPELFYKDIGGISYKADVYSFGMLLMEMAGRRRNLNA-HAERSSQI--  288

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L++  EL++    +++    +K+ I+ALWCIQ  P DRPSM+ V+ MLE +
Sbjct  289   YFPLWVYDQLSKEKELEMVDVIEEERETTRKMIIVALWCIQLSPNDRPSMRKVLDMLEGD  348

Query  1544  GDDLVLPSSPF  1512
              D L L   P 
Sbjct  349   MDKLQLSPKPL  359



>ref|XP_008245839.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Prunus 
mume]
Length=645

 Score =   442 bits (1136),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 212/333 (64%), Positives = 261/333 (78%), Gaps = 2/333 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I  LI K++RRHLS++  IE FL + NNL PIRYSY  I+ MTK FKEKLGEGG+GS
Sbjct  273   PCLIALLIYKFKRRHLSMYGNIEEFLQSHNNLMPIRYSYSDIRKMTKGFKEKLGEGGYGS  332

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRS   VA+KI+ K K+NGQ+FINEV ++GRIHHVN+V+L+GYC E SK ALVY+
Sbjct  333   VYKGKLRSRRLVAIKILGKSKANGQEFINEVATIGRIHHVNVVQLIGYCVEGSKRALVYE  392

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FM NGSLDK+I      S LN+++ FEI +GVARGI+YLHRGC++QI HFDIKPHNILL+
Sbjct  393   FMSNGSLDKHIFSKEGPSTLNYKKAFEISLGVARGIDYLHRGCEMQIFHFDIKPHNILLN  452

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E F+PK+SDFGLA+L P D+S +TLTAARGTIGY+APEL  + IG +S+KAD+YSFGMLL
Sbjct  453   ETFVPKVSDFGLARLCPLDESSLTLTAARGTIGYIAPELFYKNIGGVSNKADIYSFGMLL  512

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             ME+ G  +        SS+ YFPSW+Y+  N+GK IE+ +  E+E +ITKKM IV LWCI
Sbjct  513   MEIAGKRKNLNAIAAHSSQIYFPSWVYDQFNEGKDIEIEDATEEEMKITKKMLIVALWCI  572

Query  1005  QMSPIPRP-SMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RP SMS+VV+MLEG+ E LQMP   FL
Sbjct  573   QMKPSERPTSMSKVVQMLEGETEALQMPPKPFL  605


 Score =   342 bits (878),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 233/316 (74%), Gaps = 5/316 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  + P RYS++DI+K+T    E+LGEGGYG VYKG++ S  LVA+K+L  SK NG
Sbjct  297   FLQSHNNLMPIRYSYSDIRKMTKGFKEKLGEGGYGSVYKGKLRSRRLVAIKILGKSKANG  356

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVV+L+GYC +G +RALVYE++ N SL+K+IFS E  +  L++K
Sbjct  357   QEFINEVATIGRIHHVNVVQLIGYCVEGSKRALVYEFMSNGSLDKHIFSKEGPST-LNYK  415

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K  EI+LG+A+GI+YLH+GC+ QI HFDIKP NILL+    PK+ DFGLA+LC  ++S++
Sbjct  416   KAFEISLGVARGIDYLHRGCEMQIFHFDIKPHNILLNETFVPKVSDFGLARLCPLDESSL  475

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GYIAPE+  +N G VS+K+D+YSFGMLL+E+ G RKN NA     +   + 
Sbjct  476   TLTAARGTIGYIAPELFYKNIGGVSNKADIYSFGMLLMEIAGKRKNLNAIAAHSS---QI  532

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRP-SMKAVVQMLER  1548
              FP WVY+  N G +++I    +++  I KK+ I+ALWCIQ +P +RP SM  VVQMLE 
Sbjct  533   YFPSWVYDQFNEGKDIEIEDATEEEMKITKKMLIVALWCIQMKPSERPTSMSKVVQMLEG  592

Query  1547  EGDDLVLPSSPFAGSQ  1500
             E + L +P  PF   Q
Sbjct  593   ETEALQMPPKPFLYPQ  608



>ref|XP_010662834.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=700

 Score =   443 bits (1140),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 217/313 (69%), Positives = 264/313 (84%), Gaps = 3/313 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+ADIKKITN   ++LG+GGYG VYKG++S+E+ VAVK+L+D KGNG
Sbjct  365   FLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSNEVFVAVKILDDFKGNG  424

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             E+FINEVG +  IHHVNVVRL+G+CADG++RAL+YE+LPNESL+K+IFS    N +L W 
Sbjct  425   EDFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPNESLDKFIFSAFGNNYSLGWH  484

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+I +GIAKGIEYLHQGCDQ+ILH DIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  485   KLQDIVVGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  544

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPE++SRNFG VS KSDVYSFGMLL+EMVGGRKN +A   T  +  + 
Sbjct  545   SMTAARGTMGYIAPEMLSRNFGNVSSKSDVYSFGMLLIEMVGGRKNIDA---TVENTSQA  601

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL++  E+ IRIE++ D  IAKKL+II LWCIQW P+DRPSMK VV MLE E
Sbjct  602   YFPEWLYNHLDQEQEVHIRIEDESDIKIAKKLSIIGLWCIQWYPIDRPSMKIVVGMLEGE  661

Query  1544  GDDLVLPSSPFAG  1506
               +LV+P +PF  
Sbjct  662   EGNLVMPPNPFTS  674


 Score =   353 bits (905),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 175/314 (56%), Positives = 231/314 (74%), Gaps = 4/314 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             I+ FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL +   VAVKI+   K
Sbjct  362   IQKFLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSNEVFVAVKILDDFK  421

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG+DFINEVG+M  IHHVN+VRL+G+CA+  K AL+Y+F+PN SLDK+I   A+ +   
Sbjct  422   GNGEDFINEVGTMSTIHHVNVVRLLGFCADGYKRALIYEFLPNESLDKFI-FSAFGNNYS  480

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L W +  +IVVG+A+GIEYLH+GCD +ILH DIKPHNILLD NF PKISDFGLAKL   +
Sbjct  481   LGWHKLQDIVVGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNFNPKISDFGLAKLCSKE  540

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESS  881
             +S V++TAARGT+GY+APE+++R  G +S K+DVYSFGMLL+EM+G  +    T ++ S 
Sbjct  541   QSAVSMTAARGTMGYIAPEMLSRNFGNVSSKSDVYSFGMLLIEMVGGRKNIDATVENTSQ  600

Query  882   KYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEG  1061
              YFP W+YN +++ + + +  EDE + +I KK++I+GLWCIQ  PI RPSM  VV MLEG
Sbjct  601   AYFPEWLYNHLDQEQEVHIRIEDESDIKIAKKLSIIGLWCIQWYPIDRPSMKIVVGMLEG  660

Query  1062  DVELLQMPTDTFLS  1103
             +   L MP + F S
Sbjct  661   EEGNLVMPPNPFTS  674



>ref|XP_009348961.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=563

 Score =   439 bits (1128),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 207/332 (62%), Positives = 259/332 (78%), Gaps = 2/332 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I  +I K +RRHLS++E IE+FL  +N L P+RYSY  IK M + FK+KLGEGGFGS
Sbjct  180   PCLIALIIYKCKRRHLSMYENIEDFLQ-NNQLMPVRYSYSDIKKMARGFKDKLGEGGFGS  238

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+V+L+G+C E SK ALVYD
Sbjct  239   VYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLIGFCVEGSKRALVYD  298

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I        L+ ++ FEI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  299   FMPNGSLDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLD  358

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PK+SDFGLA+L P D SIV+LTA RGTIGY+APE   + IG +S+KADVYSFGMLL
Sbjct  359   ENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPEFFYKNIGGVSYKADVYSFGMLL  418

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  +      + SS+ YFP+W+++ ++ G  + +G+  E+EK+I KKM +V  WCI
Sbjct  419   MEMAGKRKNLNANIEHSSQIYFPTWVFDQLSGGNDLTIGDATEEEKKIIKKMIVVASWCI  478

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RPSM++VVEMLEG++E LQMP   FL
Sbjct  479   QMKPSDRPSMNKVVEMLEGEIESLQMPPKLFL  510


 Score =   333 bits (853),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 231/317 (73%), Gaps = 7/317 (2%)
 Frame = -1

Query  2441  LEDY---RAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKG  2271
             +ED+     + P RYS++DIKK+     ++LGEGG+G VYK ++ S  LVA+K+L  SK 
Sbjct  201   IEDFLQNNQLMPVRYSYSDIKKMARGFKDKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKA  260

Query  2270  NGEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALS  2091
             NG++FINEV  IG+IHHVNVV+L+G+C +G +RALVY+++PN SL+K+IFS +   ++LS
Sbjct  261   NGQDFINEVATIGRIHHVNVVQLIGFCVEGSKRALVYDFMPNGSLDKHIFSQQGV-ISLS  319

Query  2090  WKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKS  1911
              +K+ EI+LG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+LC  + S
Sbjct  320   CEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLDENFLPKVSDFGLARLCPLDNS  379

Query  1910  AVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQ  1731
              V++TA RGT+GYIAPE   +N G VS+K+DVYSFGMLL+EM G RKN NA    + S Q
Sbjct  380   IVSLTAVRGTIGYIAPEFFYKNIGGVSYKADVYSFGMLLMEMAGKRKNLNAN--IEHSSQ  437

Query  1730  EGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FP WV++ L+ G +L I    ++++ I KK+ ++A WCIQ +P DRPSM  VV+MLE
Sbjct  438   I-YFPTWVFDQLSGGNDLTIGDATEEEKKIIKKMIVVASWCIQMKPSDRPSMNKVVEMLE  496

Query  1550  REGDDLVLPSSPFAGSQ  1500
              E + L +P   F   Q
Sbjct  497   GEIESLQMPPKLFLYPQ  513



>ref|XP_002263061.2| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=399

 Score =   432 bits (1110),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 203/327 (62%), Positives = 259/327 (79%), Gaps = 2/327 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+ RRHLS  + IE FL +  NL PI+YSY +IK MT  F  KLG+GGFGSV
Sbjct  35    CLFAYLIYKFHRRHLSFDDNIEEFLRSHKNLQPIKYSYSNIKKMTNNFANKLGQGGFGSV  94

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRLVG+C + SK AL+YDF
Sbjct  95    YKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCVQGSKWALIYDF  154

Query  471   MPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK+I  +    + L+W+R +++ +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  155   MPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  214

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+S+V+LTAARGT+GY+A EL  + IG +S+KADVYSFGMLL
Sbjct  215   EDFTPKVSDFGLAKLYSTDESMVSLTAARGTLGYIALELFYKNIGGVSYKADVYSFGMLL  274

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             ME +G  +      + SS+ YFPSWIY+  ++G  I++G+  EDEK++ +KM IV LWCI
Sbjct  275   METVGRRKNVNANAEHSSQIYFPSWIYDRYDQGDNIDLGDAIEDEKKLVRKMVIVALWCI  334

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM PI RPSMS+ +EMLEG+VELL++P
Sbjct  335   QMKPINRPSMSKALEMLEGEVELLEIP  361


 Score =   338 bits (866),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 232/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL  ++ ++P +YS+++IKK+TN  + +LG+GG+G VYKG++ S  +VAVKVL  SK NG
Sbjct  58    FLRSHKNLQPIKYSYSNIKKMTNNFANKLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANG  117

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+C  G + AL+Y+++PN SL+K+IF  E  N  LSW+
Sbjct  118   QDFINEVATIGRIHHVNVVRLVGFCVQGSKWALIYDFMPNGSLDKFIFLKEENNTFLSWE  177

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ ++ALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  178   RLYKVALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESMV  237

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIA E+  +N G VS+K+DVYSFGMLL+E VG RKN NA     +SQ   
Sbjct  238   SLTAARGTLGYIALELFYKNIGGVSYKADVYSFGMLLMETVGRRKNVNAN-AEHSSQI--  294

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++G  + +    +D++ + +K+ I+ALWCIQ +P++RPSM   ++MLE E
Sbjct  295   YFPSWIYDRYDQGDNIDLGDAIEDEKKLVRKMVIVALWCIQMKPINRPSMSKALEMLEGE  354

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  355   VELLEIPPKP  364



>ref|XP_007039000.1| Kinase superfamily protein, putative [Theobroma cacao]
 gb|EOY23501.1| Kinase superfamily protein, putative [Theobroma cacao]
Length=573

 Score =   438 bits (1126),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 261/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLED+R+++P+RYS+ADIK+ITNQ  E+LGEG YG V+KG +SSEI VAVK+LN S G+G
Sbjct  238   FLEDHRSLKPSRYSYADIKRITNQFKEKLGEGAYGTVFKGTLSSEIHVAVKILNSSIGDG  297

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINE+G +G+IH VNVVRLVG+CADGFRRALVYE+LPNESLEK IFS++ +  +L W+
Sbjct  298   EEFINEIGTMGRIHRVNVVRLVGFCADGFRRALVYEFLPNESLEKLIFSSDGRQHSLGWE  357

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLD   NPKI DFGLAKLCSK++S V
Sbjct  358   KLLDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDEKFNPKISDFGLAKLCSKDQSIV  417

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV SRNFG VS+KSDVYSFGML+LEMVGGRKN +    T  S  + 
Sbjct  418   SMTAARGTMGYIAPEVYSRNFGNVSYKSDVYSFGMLILEMVGGRKNVDV---TVESASQV  474

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW Y+ LN+G EL IRIEED    IAK+L I+ LWCIQW PV RPSMK VVQMLE E
Sbjct  475   YFPEWAYSRLNQGDELIIRIEEDGHANIAKRLTIVGLWCIQWYPVGRPSMKNVVQMLEGE  534

Query  1544  GDDLVLPSSPFAGS  1503
             GD+L +P +PF  +
Sbjct  535   GDNLSMPPNPFGST  548


 Score =   354 bits (908),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 172/313 (55%), Positives = 229/313 (73%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL    +L P RYSY  IK +T  FKEKLGEG +G+V+KG L S   VAVKI++   
Sbjct  235   IEKFLEDHRSLKPSRYSYADIKRITNQFKEKLGEGAYGTVFKGTLSSEIHVAVKILNSSI  294

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI-NQGAYASLL  527
              +G++FINE+G+MGRIH VN+VRLVG+CA+  + ALVY+F+PN SL+K I +       L
Sbjct  295   GDGEEFINEIGTMGRIHRVNVVRLVGFCADGFRRALVYEFLPNESLEKLIFSSDGRQHSL  354

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLDE F PKISDFGLAKL   D+
Sbjct  355   GWEKLLDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDEKFNPKISDFGLAKLCSKDQ  414

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSK  884
             SIV++TAARGT+GY+APE+ +R  G +S+K+DVYSFGML++EM+G  +   VT +  S  
Sbjct  415   SIVSMTAARGTMGYIAPEVYSRNFGNVSYKSDVYSFGMLILEMVGGRKNVDVTVESASQV  474

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W Y+ +N+G  + +  E++    I K++TIVGLWCIQ  P+ RPSM  VV+MLEG+
Sbjct  475   YFPEWAYSRLNQGDELIIRIEEDGHANIAKRLTIVGLWCIQWYPVGRPSMKNVVQMLEGE  534

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  535   GDNLSMPPNPFGS  547



>ref|XP_010038695.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Eucalyptus 
grandis]
Length=455

 Score =   434 bits (1115),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 208/342 (61%), Positives = 267/342 (78%), Gaps = 3/342 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++ LI K+ RRH ++   IE FL A NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  79    PCVLILLIYKWMRRHRAMDPNIEEFLQARNNFLPIRYSYSDIKKITKNFKYKLGEGGYGS  138

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSG++VAVKI++KPKSNGQDFI+EVG++GRIHHVN+V+LVG+C  +SK ALVYD
Sbjct  139   VYKGILRSGNEVAVKILNKPKSNGQDFISEVGTIGRIHHVNVVQLVGFCFNHSKQALVYD  198

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+K+I      + L++++ +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  199   FMPNGSLEKHIVYKDGENSLDYKKMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  258

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ++  PK+SDFGLA+L+PTD +IVTLTAARGT+GY+APEL  R IG IS+KADVYSFGM+L
Sbjct  259   QSLTPKVSDFGLARLYPTDHNIVTLTAARGTLGYMAPELFYRDIGGISYKADVYSFGMML  318

Query  828   MEMLGLNRT-PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      +D S  YFP W+Y+ + K K ++M E   +E+  T+KM IV LWCI
Sbjct  319   MEMAGRRRNVNANAKDSSQIYFPLWVYDQLGKEKEVDMVEATAEEREKTRKMIIVALWCI  378

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL--SEPIMEVH  1124
             Q++P  RPSMSRV+ MLE +++ LQ+P    L  +EP+ +V+
Sbjct  379   QLNPNDRPSMSRVLNMLEEEIDELQVPPKPLLYPTEPVADVN  420


 Score =   330 bits (846),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RYS++DIKKIT     +LGEGGYG VYKG + S   VAVK+LN  K NG
Sbjct  103   FLQARNNFLPIRYSYSDIKKITKNFKYKLGEGGYGSVYKGILRSGNEVAVKILNKPKSNG  162

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EVG IG+IHHVNVV+LVG+C +  ++ALVY+++PN SLEK+I   + +N +L +K
Sbjct  163   QDFISEVGTIGRIHHVNVVQLVGFCFNHSKQALVYDFMPNGSLEKHIVYKDGEN-SLDYK  221

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD ++ PK+ DFGLA+L   + + V
Sbjct  222   KMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLDQSLTPKVSDFGLARLYPTDHNIV  281

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+  R+ G +S+K+DVYSFGM+L+EM G R+N NA    D+SQ   
Sbjct  282   TLTAARGTLGYMAPELFYRDIGGISYKADVYSFGMMLMEMAGRRRNVNAN-AKDSSQI--  338

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L +  E+ +     ++    +K+ I+ALWCIQ  P DRPSM  V+ MLE E
Sbjct  339   YFPLWVYDQLGKEKEVDMVEATAEEREKTRKMIIVALWCIQLNPNDRPSMSRVLNMLEEE  398

Query  1544  GDDLVLPSSPF  1512
              D+L +P  P 
Sbjct  399   IDELQVPPKPL  409



>ref|XP_009348966.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=563

 Score =   437 bits (1125),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/332 (62%), Positives = 258/332 (78%), Gaps = 2/332 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I  +I K +RRHLS++E IE+FL  +N L P+RYSY  IK M + FK+KLGEGGFGS
Sbjct  180   PCLIALIIYKCKRRHLSMYENIEDFLQ-NNQLMPVRYSYSDIKKMARGFKDKLGEGGFGS  238

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYK KLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+V+LVG+C E SK ALVYD
Sbjct  239   VYKAKLRSGRLVAIKMLGKSKANGQDFINEVATIGRIHHVNVVQLVGFCVEGSKRALVYD  298

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGS DK+I        L+ ++ FEI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  299   FMPNGSFDKHIFSQQGVISLSCEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLD  358

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PK+SDFGLA+L P D SIV+LTA RGTIGY+APE   + IG +S+KADVYSFGMLL
Sbjct  359   ENFLPKVSDFGLARLCPLDNSIVSLTAVRGTIGYIAPEFFYKNIGGVSYKADVYSFGMLL  418

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  +      + SS+ YFP+W+++ ++ G  + +G+  E+EK+I KKM +V  WCI
Sbjct  419   MEMAGKRKNLNANIEHSSQIYFPTWVFDQLSGGNDLTIGDATEEEKKIIKKMIVVASWCI  478

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             QM P  RPSM++VVEMLEG++E LQMP   FL
Sbjct  479   QMKPSDRPSMNKVVEMLEGEIESLQMPPKLFL  510


 Score =   332 bits (850),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 230/317 (73%), Gaps = 7/317 (2%)
 Frame = -1

Query  2441  LEDY---RAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKG  2271
             +ED+     + P RYS++DIKK+     ++LGEGG+G VYK ++ S  LVA+K+L  SK 
Sbjct  201   IEDFLQNNQLMPVRYSYSDIKKMARGFKDKLGEGGFGSVYKAKLRSGRLVAIKMLGKSKA  260

Query  2270  NGEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALS  2091
             NG++FINEV  IG+IHHVNVV+LVG+C +G +RALVY+++PN S +K+IFS +   ++LS
Sbjct  261   NGQDFINEVATIGRIHHVNVVQLVGFCVEGSKRALVYDFMPNGSFDKHIFSQQGV-ISLS  319

Query  2090  WKKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKS  1911
              +K+ EI+LG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+LC  + S
Sbjct  320   CEKMFEISLGVARGIEYLHRGCDMQILHFDIKPHNILLDENFLPKVSDFGLARLCPLDNS  379

Query  1910  AVTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQ  1731
              V++TA RGT+GYIAPE   +N G VS+K+DVYSFGMLL+EM G RKN NA    + S Q
Sbjct  380   IVSLTAVRGTIGYIAPEFFYKNIGGVSYKADVYSFGMLLMEMAGKRKNLNAN--IEHSSQ  437

Query  1730  EGSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
                FP WV++ L+ G +L I    ++++ I KK+ ++A WCIQ +P DRPSM  VV+MLE
Sbjct  438   I-YFPTWVFDQLSGGNDLTIGDATEEEKKIIKKMIVVASWCIQMKPSDRPSMNKVVEMLE  496

Query  1550  REGDDLVLPSSPFAGSQ  1500
              E + L +P   F   Q
Sbjct  497   GEIESLQMPPKLFLYPQ  513



>ref|XP_002324016.2| hypothetical protein POPTR_0017s04140g [Populus trichocarpa]
 gb|EEF04149.2| hypothetical protein POPTR_0017s04140g [Populus trichocarpa]
Length=368

 Score =   430 bits (1106),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 206/331 (62%), Positives = 263/331 (79%), Gaps = 3/331 (1%)
 Frame = +3

Query  120   VFLIIKYRRRHLSVFEPIENFLNA-DNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYK  296
             + L+ K+RR+HLS++E IE FL + DN+L PIRY+Y  IK +T  FK+KLGEGGFGSVYK
Sbjct  1     MLLVYKWRRQHLSMYEDIEKFLQSHDNDLMPIRYTYSEIKKITNGFKDKLGEGGFGSVYK  60

Query  297   GKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMP  476
             GKLRSG   AVK++ K K+NGQDFINEV ++GRIHHVNIV+L+GY  E SK AL+Y+FMP
Sbjct  61    GKLRSGRLAAVKLLGKSKANGQDFINEVATIGRIHHVNIVQLIGYTVEGSKRALIYEFMP  120

Query  477   NGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENF  656
             NGSL+KYI        L+ ++ +EI +GVARGIEYLH+GCD+QILHFDIKPHNILL++ F
Sbjct  121   NGSLEKYIFSRQGCIPLSNEKMYEISLGVARGIEYLHQGCDMQILHFDIKPHNILLNDKF  180

Query  657   IPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEM  836
             +PKISDFGLAKL+PT+ + V+LTAARGT+GY+APEL  + IG +S+KADVYS+GMLLMEM
Sbjct  181   VPKISDFGLAKLYPTNNNTVSLTAARGTMGYMAPELCYKNIGGVSYKADVYSYGMLLMEM  240

Query  837   LGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEED-EDEKRITKKMTIVGLWCIQM  1010
             +G  +        SS+ YFPSW+Y+ +N+GK IE+ E+  E EK+ TKKM IV LWCIQ+
Sbjct  241   VGRRKNLNASASHSSQIYFPSWVYDQVNEGKDIEVQEDVMEHEKKTTKKMIIVALWCIQL  300

Query  1011  SPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
              P+ RPSM +VVEMLE D+E L+MP   FL+
Sbjct  301   KPVDRPSMHKVVEMLESDIESLRMPPKPFLT  331


 Score =   341 bits (874),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 169/303 (56%), Positives = 226/303 (75%), Gaps = 5/303 (2%)
 Frame = -1

Query  2417  PTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNGEEFINEVGI  2238
             P RY++++IKKITN   ++LGEGG+G VYKG++ S  L AVK+L  SK NG++FINEV  
Sbjct  31    PIRYTYSEIKKITNGFKDKLGEGGFGSVYKGKLRSGRLAAVKLLGKSKANGQDFINEVAT  90

Query  2237  IGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWKKIQEIALGI  2058
             IG+IHHVN+V+L+GY  +G +RAL+YE++PN SLEKYIFS +   + LS +K+ EI+LG+
Sbjct  91    IGRIHHVNIVQLIGYTVEGSKRALIYEFMPNGSLEKYIFSRQG-CIPLSNEKMYEISLGV  149

Query  2057  AKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAVTMTAARGTM  1878
             A+GIEYLHQGCD QILHFDIKP NILL+    PKI DFGLAKL     + V++TAARGTM
Sbjct  150   ARGIEYLHQGCDMQILHFDIKPHNILLNDKFVPKISDFGLAKLYPTNNNTVSLTAARGTM  209

Query  1877  GYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEGSFPEWVYNH  1698
             GY+APE+  +N G VS+K+DVYS+GMLL+EMVG RKN NA   + +   +  FP WVY+ 
Sbjct  210   GYMAPELCYKNIGGVSYKADVYSYGMLLMEMVGRRKNLNA---SASHSSQIYFPSWVYDQ  266

Query  1697  LNRGGELQIRieedddeaiakkla-iiaLWCIQWQPVDRPSMKAVVQMLEREGDDLVLPS  1521
             +N G +++++ +  + E    K   I+ALWCIQ +PVDRPSM  VV+MLE + + L +P 
Sbjct  267   VNEGKDIEVQEDVMEHEKKTTKKMIIVALWCIQLKPVDRPSMHKVVEMLESDIESLRMPP  326

Query  1520  SPF  1512
              PF
Sbjct  327   KPF  329



>gb|EYU21041.1| hypothetical protein MIMGU_mgv1a003344mg [Erythranthe guttata]
Length=591

 Score =   438 bits (1127),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 263/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DYRA++P+R+S++DI +IT+Q  ++LGEG YG+VYKG++++EI VAVKVLN+SKGNG
Sbjct  262   FLQDYRALKPSRFSYSDITRITHQFRDKLGEGCYGVVYKGKLNNEIDVAVKVLNNSKGNG  321

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRLVG+CADGFRRALVYE+LPN+SLEK IF   SK ++L W+
Sbjct  322   EEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFLPNDSLEKIIFQAGSKKISLDWE  381

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IA GIA+GIEYLH+GCDQQILHFDIKP N+LLDHN NPKICDFGLAKLCSKE+SAV
Sbjct  382   KLKDIAQGIARGIEYLHEGCDQQILHFDIKPQNVLLDHNFNPKICDFGLAKLCSKEQSAV  441

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   +   +TS    
Sbjct  442   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN-EDRNVNNTSLV--  498

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++  +IA+KL+I+ LWCIQW P DRPSMK VVQMLE +
Sbjct  499   YFPQWIYNHINTEDNPMWAQIDEEGNSIARKLSIVGLWCIQWSPTDRPSMKVVVQMLEGD  558

Query  1544  GDDLVLPSSPFAGS  1503
               DL +P +PF  +
Sbjct  559   NGDLTMPPNPFPAT  572


 Score =   352 bits (902),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 178/330 (54%), Positives = 233/330 (71%), Gaps = 3/330 (1%)
 Frame = +3

Query  114   AIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVY  293
             AIV+  I++R    +  + IE FL     L P R+SY  I  +T  F++KLGEG +G VY
Sbjct  241   AIVYQYIRFRTGRENQIK-IEKFLQDYRALKPSRFSYSDITRITHQFRDKLGEGCYGVVY  299

Query  294   KGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFM  473
             KGKL +  DVAVK+++  K NG++F+NEV ++GRIHHVNIVRLVG+CA+  + ALVY+F+
Sbjct  300   KGKLNNEIDVAVKVLNNSKGNGEEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFL  359

Query  474   PNGSLDKYINQ-GAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             PN SL+K I Q G+    L+W++  +I  G+ARGIEYLH GCD QILHFDIKP N+LLD 
Sbjct  360   PNDSLEKIIFQAGSKKISLDWEKLKDIAQGIARGIEYLHEGCDQQILHFDIKPQNVLLDH  419

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NF PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+
Sbjct  420   NFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLL  479

Query  831   EMLGLNRTPVTEQDESS-KYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      + +S  YFP WIYN IN        + DE+   I +K++IVGLWCIQ
Sbjct  480   EMVGGRKNEDRNVNNTSLVYFPQWIYNHINTEDNPMWAQIDEEGNSIARKLSIVGLWCIQ  539

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
              SP  RPSM  VV+MLEGD   L MP + F
Sbjct  540   WSPTDRPSMKVVVQMLEGDNGDLTMPPNPF  569



>ref|XP_007022122.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13647.1| PR5-like receptor kinase [Theobroma cacao]
Length=633

 Score =   439 bits (1130),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/329 (63%), Positives = 259/329 (79%), Gaps = 1/329 (0%)
 Frame = +3

Query  114   AIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVY  293
              +  +  K+RRRHLSV + IE FL + N+L PIRYSY+ IK MT++F++KLGEGG+GSV+
Sbjct  270   GVTVVTYKWRRRHLSVDDTIEEFLQSQNDLMPIRYSYREIKRMTRSFRDKLGEGGYGSVF  329

Query  294   KGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFM  473
             KGKLRSG  VA+K++   K++GQDFINEV +MGRIHHVN+ +L+G+C E SK ALVYDFM
Sbjct  330   KGKLRSGHFVAIKLLGTSKADGQDFINEVATMGRIHHVNVAKLIGFCVEGSKQALVYDFM  389

Query  474   PNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDEN  653
             PNGSLDK I      ++L+WQ+ F+I +GVARGIEYLH+GCD+QILHFDIKPHNILLDEN
Sbjct  390   PNGSLDKIIFAEENKTILSWQKMFDIALGVARGIEYLHQGCDMQILHFDIKPHNILLDEN  449

Query  654   FIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLME  833
             FIPK+SDFGLAKL+    SIV+LTAARGTIGY+APELV + IGAIS+KADVYSFGMLLME
Sbjct  450   FIPKVSDFGLAKLYSVADSIVSLTAARGTIGYIAPELVYKNIGAISYKADVYSFGMLLME  509

Query  834   MLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQM  1010
             M+G  +      +  S+ YFPSWIY   ++G+  ++GE  + EK I KKM I   WCIQ+
Sbjct  510   MVGRRKNLNAFAEHLSQIYFPSWIYGRFHQGEDFDLGEVTDGEKVIVKKMIITACWCIQV  569

Query  1011  SPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             +P  RPSM +V++MLE DVELLQMP   F
Sbjct  570   TPNDRPSMGKVLQMLETDVELLQMPPKPF  598


 Score =   336 bits (862),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 226/311 (73%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS+ +IK++T    ++LGEGGYG V+KG++ S   VA+K+L  SK +G
Sbjct  292   FLQSQNDLMPIRYSYREIKRMTRSFRDKLGEGGYGSVFKGKLRSGHFVAIKLLGTSKADG  351

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  +G+IHHVNV +L+G+C +G ++ALVY+++PN SL+K IF+ E+K + LSW+
Sbjct  352   QDFINEVATMGRIHHVNVAKLIGFCVEGSKQALVYDFMPNGSLDKIIFAEENKTI-LSWQ  410

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IALG+A+GIEYLHQGCD QILHFDIKP NILLD N  PK+ DFGLAKL S   S V
Sbjct  411   KMFDIALGVARGIEYLHQGCDMQILHFDIKPHNILLDENFIPKVSDFGLAKLYSVADSIV  470

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+V +N G +S+K+DVYSFGMLL+EMVG RKN NA         + 
Sbjct  471   SLTAARGTIGYIAPELVYKNIGAISYKADVYSFGMLLMEMVGRRKNLNAFA---EHLSQI  527

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y   ++G +  +    D ++ I KK+ I A WCIQ  P DRPSM  V+QMLE +
Sbjct  528   YFPSWIYGRFHQGEDFDLGEVTDGEKVIVKKMIITACWCIQVTPNDRPSMGKVLQMLETD  587

Query  1544  GDDLVLPSSPF  1512
              + L +P  PF
Sbjct  588   VELLQMPPKPF  598



>emb|CAN72345.1| hypothetical protein VITISV_041721 [Vitis vinifera]
Length=495

 Score =   434 bits (1116),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/327 (62%), Positives = 262/327 (80%), Gaps = 2/327 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+RRRHLS+ + IE FL+   NL PI+Y+Y  IK MT  FK KLG+GGFGSV
Sbjct  135   CLFAYLIYKFRRRHLSLDDDIEEFLHNYQNLRPIKYTYSDIKKMTYNFKHKLGQGGFGSV  194

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRLVG+C + SK AL+YD+
Sbjct  195   YKGKLRSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCIQRSKWALIYDY  254

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK++      ++ L+W+R ++I +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  255   MPNGSLDKFVFLDQENNIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  314

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+SIV++TAARGT+GY+APEL  + IG +S KADVYSFGMLL
Sbjct  315   EDFTPKVSDFGLAKLYSTDESIVSVTAARGTLGYIAPELFYKNIGGVSFKADVYSFGMLL  374

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             +EM+G  +      + SS+ YFPSWIY+  ++G+ +EMG+  EDEK+  +KM IV LWC+
Sbjct  375   LEMVGKRKNVNAFAEHSSQIYFPSWIYDRYDQGEDMEMGDATEDEKKYVRKMVIVALWCV  434

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P+ RPSMS+ +EMLEG++ELL+MP
Sbjct  435   QMKPVDRPSMSKTLEMLEGEIELLKMP  461


 Score =   344 bits (882),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 233/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL +Y+ +RP +Y+++DIKK+T     +LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  158   FLHNYQNLRPIKYTYSDIKKMTYNFKHKLGQGGFGSVYKGKLRSGRIVAVKMLVMSKANG  217

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+C    + AL+Y+Y+PN SL+K++F  +  N+ LSW+
Sbjct  218   QDFINEVATIGRIHHVNVVRLVGFCIQRSKWALIYDYMPNGSLDKFVFLDQENNIPLSWE  277

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +IALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  278   RLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESIV  337

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS K+DVYSFGMLLLEMVG RKN NA     +SQ   
Sbjct  338   SVTAARGTLGYIAPELFYKNIGGVSFKADVYSFGMLLLEMVGKRKNVNAF-AEHSSQI--  394

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++G ++++    +D++   +K+ I+ALWC+Q +PVDRPSM   ++MLE E
Sbjct  395   YFPSWIYDRYDQGEDMEMGDATEDEKKYVRKMVIVALWCVQMKPVDRPSMSKTLEMLEGE  454

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  455   IELLKMPPKP  464



>ref|XP_007022130.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13655.1| PR5-like receptor kinase [Theobroma cacao]
Length=480

 Score =   433 bits (1114),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/328 (63%), Positives = 253/328 (77%), Gaps = 1/328 (0%)
 Frame = +3

Query  117   IVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYK  296
             I  +  K RRRHLSV + IE FL + NNL PIRYSY  +K MT+ F+EKLGEGG+GSV+K
Sbjct  85    IALVTYKLRRRHLSVDDTIEEFLQSQNNLMPIRYSYYEVKRMTRNFQEKLGEGGYGSVFK  144

Query  297   GKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMP  476
             GKLRSG  VA+K++ K K+NGQDFINEV ++GRIHHVN+ +L+G+C E SK ALVYDFM 
Sbjct  145   GKLRSGHLVAIKLLGKSKANGQDFINEVATIGRIHHVNVAKLIGFCVEGSKQALVYDFMS  204

Query  477   NGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENF  656
             NGSLD+ I        L+WQ+ F+I +GVARGIEYLH+GCD+QILHFDIKPHNILLDENF
Sbjct  205   NGSLDRIIFAEENKISLSWQKMFDIALGVARGIEYLHQGCDMQILHFDIKPHNILLDENF  264

Query  657   IPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEM  836
             IPK+SDFGLAKL+  D SIV+LTAARGTIGY+APELV + IG +S+KADVYSFGMLLMEM
Sbjct  265   IPKVSDFGLAKLYSVDDSIVSLTAARGTIGYIAPELVYKNIGGVSNKADVYSFGMLLMEM  324

Query  837   LGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMS  1013
             +G  +      +  S+ YFP WIY   ++G+ IE+GE  + EK I KKM I   WCI + 
Sbjct  325   VGRRKNLNAFAEHLSQIYFPLWIYGQFHRGEDIELGEVTDGEKIIVKKMVITACWCILVP  384

Query  1014  PIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             P  RPSMS+V+EMLE +VELLQMP   F
Sbjct  385   PNDRPSMSKVLEMLETNVELLQMPPKPF  412


 Score =   337 bits (864),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 228/311 (73%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS+ ++K++T    E+LGEGGYG V+KG++ S  LVA+K+L  SK NG
Sbjct  106   FLQSQNNLMPIRYSYYEVKRMTRNFQEKLGEGGYGSVFKGKLRSGHLVAIKLLGKSKANG  165

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNV +L+G+C +G ++ALVY+++ N SL++ IF+ E+K ++LSW+
Sbjct  166   QDFINEVATIGRIHHVNVAKLIGFCVEGSKQALVYDFMSNGSLDRIIFAEENK-ISLSWQ  224

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IALG+A+GIEYLHQGCD QILHFDIKP NILLD N  PK+ DFGLAKL S + S V
Sbjct  225   KMFDIALGVARGIEYLHQGCDMQILHFDIKPHNILLDENFIPKVSDFGLAKLYSVDDSIV  284

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+V +N G VS+K+DVYSFGMLL+EMVG RKN NA         + 
Sbjct  285   SLTAARGTIGYIAPELVYKNIGGVSNKADVYSFGMLLMEMVGRRKNLNA---FAEHLSQI  341

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y   +RG ++++    D ++ I KK+ I A WCI   P DRPSM  V++MLE  
Sbjct  342   YFPLWIYGQFHRGEDIELGEVTDGEKIIVKKMVITACWCILVPPNDRPSMSKVLEMLETN  401

Query  1544  GDDLVLPSSPF  1512
              + L +P  PF
Sbjct  402   VELLQMPPKPF  412



>ref|XP_010662776.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=605

 Score =   437 bits (1125),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/312 (69%), Positives = 265/312 (85%), Gaps = 7/312 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+ DIK+IT+   E+LGEGGYG VYKG++S+EI VAVK+LN+S GNG
Sbjct  278   FLEDYRALKPSRYSYNDIKRITDGFKEKLGEGGYGTVYKGKLSNEIFVAVKILNNSNGNG  337

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG IG+IHH+NVVRL+G+C+DG RRAL+YE+LPNESLEK+IFS    N +L W+
Sbjct  338   EEFINEVGTIGRIHHINVVRLIGFCSDGCRRALIYEFLPNESLEKFIFS----NHSLGWE  393

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIAKGIEYLHQGCDQ+ILHFDIKP NILLDHN NPKI DFGLAKLCSKE+SAV
Sbjct  394   KLQDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAV  453

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +M+  RGTMGYIAPE++SRNFG VS+KSDVYSFGMLL+EMVGGRKN +    T  +  + 
Sbjct  454   SMSVIRGTMGYIAPEMISRNFGNVSYKSDVYSFGMLLIEMVGGRKNIDT---TVKNTSQV  510

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L++  EL I IEE++D  IAKKL I+ LWCIQW P++RPSMK ++QMLE E
Sbjct  511   YFPEWVYNRLDKREELHIPIEEENDGEIAKKLLIMGLWCIQWCPMNRPSMKFIIQMLEGE  570

Query  1544  GDDLVLPSSPFA  1509
             G++L +P +PF 
Sbjct  571   GNNLSMPPNPFT  582


 Score =   348 bits (893),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 228/309 (74%), Gaps = 4/309 (1%)
 Frame = +3

Query  180   FLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPKSNG  359
             FL     L P RYSY  IK +T  FKEKLGEGG+G+VYKGKL +   VAVKI++    NG
Sbjct  278   FLEDYRALKPSRYSYNDIKRITDGFKEKLGEGGYGTVYKGKLSNEIFVAVKILNNSNGNG  337

Query  360   QDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYASLLNWQR  539
             ++FINEVG++GRIHH+N+VRL+G+C++  + AL+Y+F+PN SL+K+I        L W++
Sbjct  338   EEFINEVGTIGRIHHINVVRLIGFCSDGCRRALIYEFLPNESLEKFIFSNHS---LGWEK  394

Query  540   KFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDKSIVT  719
               +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD NF PKISDFGLAKL   ++S V+
Sbjct  395   LQDIAIGIAKGIEYLHQGCDQRILHFDIKPHNILLDHNFNPKISDFGLAKLCSKEQSAVS  454

Query  720   LTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESSKYFPS  896
             ++  RGT+GY+APE+++R  G +S+K+DVYSFGMLL+EM+G  +    T ++ S  YFP 
Sbjct  455   MSVIRGTMGYIAPEMISRNFGNVSYKSDVYSFGMLLIEMVGGRKNIDTTVKNTSQVYFPE  514

Query  897   WIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDVELL  1076
             W+YN ++K + + +  E+E++  I KK+ I+GLWCIQ  P+ RPSM  +++MLEG+   L
Sbjct  515   WVYNRLDKREELHIPIEEENDGEIAKKLLIMGLWCIQWCPMNRPSMKFIIQMLEGEGNNL  574

Query  1077  QMPTDTFLS  1103
              MP + F S
Sbjct  575   SMPPNPFTS  583



>ref|XP_010662996.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X1 [Vitis vinifera]
Length=673

 Score =   440 bits (1131),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/327 (64%), Positives = 264/327 (81%), Gaps = 2/327 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C +V+LI K++RRHLS+ + IE FL++ NNL  I+YSY  +K MT  FK KLG+GGFGSV
Sbjct  309   CLLVYLIYKFQRRHLSLDDDIEEFLHSHNNLQLIKYSYSEVKKMTHNFKNKLGQGGFGSV  368

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKG+LRSG  VAVK++   K+NGQDF+NEV ++GRIHHVN+VRL+G+C + SK ALVYDF
Sbjct  369   YKGRLRSGHIVAVKMLVMSKANGQDFVNEVATIGRIHHVNVVRLIGFCIQGSKWALVYDF  428

Query  471   MPNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK++      ++ L+W+R ++I +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  429   MPNGSLDKFVFLDRGNNIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  488

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL  TD+SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  489   EDFTPKVSDFGLAKLHSTDESIVSLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLL  548

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             +EM G  +      + SS+ YFPSWIY+  ++G+ +EMG+  EDEK+  +KM IV LWCI
Sbjct  549   LEMAGKRKNVNAFAEHSSQIYFPSWIYDQYDRGEDMEMGDATEDEKKFVRKMVIVALWCI  608

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM PI RPSMS+ +EMLEGDVELLQMP
Sbjct  609   QMKPIDRPSMSKALEMLEGDVELLQMP  635


 Score =   336 bits (861),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 229/310 (74%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL  +  ++  +YS++++KK+T+    +LG+GG+G VYKGR+ S  +VAVK+L  SK NG
Sbjct  332   FLHSHNNLQLIKYSYSEVKKMTHNFKNKLGQGGFGSVYKGRLRSGHIVAVKMLVMSKANG  391

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F+NEV  IG+IHHVNVVRL+G+C  G + ALVY+++PN SL+K++F     N+ LSW+
Sbjct  392   QDFVNEVATIGRIHHVNVVRLIGFCIQGSKWALVYDFMPNGSLDKFVFLDRGNNIPLSWE  451

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +IALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  452   RLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLHSTDESIV  511

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLLLEM G RKN NA         + 
Sbjct  512   SLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLLLEMAGKRKNVNAFA---EHSSQI  568

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  +RG ++++    +D++   +K+ I+ALWCIQ +P+DRPSM   ++MLE +
Sbjct  569   YFPSWIYDQYDRGEDMEMGDATEDEKKFVRKMVIVALWCIQMKPIDRPSMSKALEMLEGD  628

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  629   VELLQMPPKP  638



>ref|XP_007220557.1| hypothetical protein PRUPE_ppa003241mg [Prunus persica]
 gb|EMJ21756.1| hypothetical protein PRUPE_ppa003241mg [Prunus persica]
Length=590

 Score =   437 bits (1124),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 259/315 (82%), Gaps = 6/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DYRA++P+RYS+ADIK+ITN   ++LGEG YG VYKG++SSE+ VA KVLN SKG+G
Sbjct  256   FLDDYRALKPSRYSYADIKRITNDFKDKLGEGAYGTVYKGKLSSELFVAAKVLNSSKGDG  315

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G IHHVNVVRLVG+CADGFRRALVYE+LPN SL+ +I S ++KN  L W 
Sbjct  316   EEFINEVGTMGHIHHVNVVRLVGFCADGFRRALVYEFLPNGSLQDFISSPDNKNSFLGWD  375

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IAL IAKGIEYLHQGCDQ+ILHFDIKP N+LLDHN  PKI DFGLAKLCSK++S V
Sbjct  376   KMQDIALAIAKGIEYLHQGCDQRILHFDIKPHNVLLDHNFTPKISDFGLAKLCSKDQSIV  435

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNF-NAKEGTDTSQQE  1728
             +MT ARGTMGYIAPEV SRNFG VS+KSDVYSFGMLLLEMVGGRKN  +A E T+    E
Sbjct  436   SMTTARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNVGSATENTN----E  491

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               +PEW+YN L  G +L+I I E+ +  I KK AI+ LWCIQW PVDRPSMKAVVQMLE 
Sbjct  492   IYYPEWIYNLLEEGDDLRIHIGEEGEGKIPKKFAIVGLWCIQWHPVDRPSMKAVVQMLEG  551

Query  1547  EGDDLVLPSSPFAGS  1503
              G+ L +P +PFA +
Sbjct  552   -GESLTMPPNPFAST  565


 Score =   350 bits (899),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 226/314 (72%), Gaps = 5/314 (2%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL+    L P RYSY  IK +T  FK+KLGEG +G+VYKGKL S   VA K+++  K
Sbjct  253   IERFLDDYRALKPSRYSYADIKRITNDFKDKLGEGAYGTVYKGKLSSELFVAAKVLNSSK  312

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQ-GAYASLL  527
              +G++FINEVG+MG IHHVN+VRLVG+CA+  + ALVY+F+PNGSL  +I+      S L
Sbjct  313   GDGEEFINEVGTMGHIHHVNVVRLVGFCADGFRRALVYEFLPNGSLQDFISSPDNKNSFL  372

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W +  +I + +A+GIEYLH+GCD +ILHFDIKPHN+LLD NF PKISDFGLAKL   D+
Sbjct  373   GWDKMQDIALAIAKGIEYLHQGCDQRILHFDIKPHNVLLDHNFTPKISDFGLAKLCSKDQ  432

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             SIV++T ARGT+GY+APE+ +R  G +S+K+DVYSFGMLL+EM+G  R  V    E++  
Sbjct  433   SIVSMTTARGTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVG-GRKNVGSATENTNE  491

Query  885   -YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEG  1061
              Y+P WIYN + +G  + +   +E E +I KK  IVGLWCIQ  P+ RPSM  VV+MLEG
Sbjct  492   IYYPEWIYNLLEEGDDLRIHIGEEGEGKIPKKFAIVGLWCIQWHPVDRPSMKAVVQMLEG  551

Query  1062  DVELLQMPTDTFLS  1103
               E L MP + F S
Sbjct  552   G-ESLTMPPNPFAS  564



>ref|XP_010662781.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Vitis 
vinifera]
Length=686

 Score =   440 bits (1132),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 209/327 (64%), Positives = 257/327 (79%), Gaps = 2/327 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+ RRHLS  E IE FL       PIRYSY H+K MT  FK KLG+GGFGSV
Sbjct  322   CLFSYLIFKFHRRHLSSDEDIEEFLQNHKKFRPIRYSYSHLKKMTNNFKNKLGQGGFGSV  381

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHH+N+VRLVG+C E SK AL+YDF
Sbjct  382   YKGKLRSGQIVAVKMLVISKANGQDFINEVATIGRIHHINVVRLVGFCVEGSKWALIYDF  441

Query  471   MPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             M NGSLDK+I  +G  +  L+W+R ++I +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  442   MSNGSLDKFIFLKGEKSIPLSWERLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  501

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  502   EDFTPKVSDFGLAKLYSTDESIVSLTAARGTLGYIAPELFYKNIGHVSYKADVYSFGMLL  561

Query  828   MEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  R     E++ S  +FPSWIY+ I +G  +EMG+  EDEK+  +KM IV LWC+
Sbjct  562   MEMVGKRRHVSAHEENLSEIFFPSWIYDQIEQGGHMEMGDATEDEKKYMRKMIIVALWCV  621

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM PI RPSMS+ + MLEGD+E+LQMP
Sbjct  622   QMKPIDRPSMSKALNMLEGDIEILQMP  648


 Score =   342 bits (878),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 234/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL++++  RP RYS++ +KK+TN    +LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  345   FLQNHKKFRPIRYSYSHLKKMTNNFKNKLGQGGFGSVYKGKLRSGQIVAVKMLVISKANG  404

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHH+NVVRLVG+C +G + AL+Y+++ N SL+K+IF    K++ LSW+
Sbjct  405   QDFINEVATIGRIHHINVVRLVGFCVEGSKWALIYDFMSNGSLDKFIFLKGEKSIPLSWE  464

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +IALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  465   RLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESIV  524

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG R++ +A E    +  E 
Sbjct  525   SLTAARGTLGYIAPELFYKNIGHVSYKADVYSFGMLLMEMVGKRRHVSAHE---ENLSEI  581

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ + +GG +++    +D++   +K+ I+ALWC+Q +P+DRPSM   + MLE +
Sbjct  582   FFPSWIYDQIEQGGHMEMGDATEDEKKYMRKMIIVALWCVQMKPIDRPSMSKALNMLEGD  641

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  642   IEILQMPPKP  651



>gb|KCW47330.1| hypothetical protein EUGRSUZ_K01120 [Eucalyptus grandis]
Length=475

 Score =   432 bits (1112),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 207/341 (61%), Positives = 266/341 (78%), Gaps = 3/341 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++ LI K+ RRH ++   IE FL A NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  80    PCVLILLIYKWMRRHRAMDPNIEEFLQARNNFLPIRYSYSDIKKITKNFKYKLGEGGYGS  139

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSG++VAVKI++KPKSNGQDFI+EVG++GRIHHVN+V+LVG+C  +SK ALVYD
Sbjct  140   VYKGILRSGNEVAVKILNKPKSNGQDFISEVGTIGRIHHVNVVQLVGFCFNHSKQALVYD  199

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+K+I      + L++++ +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  200   FMPNGSLEKHIVYKDGENSLDYKKMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  259

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ++  PK+SDFGLA+L+PTD +IVTLTAARGT+GY+APEL  R IG IS+KADVYSFGM+L
Sbjct  260   QSLTPKVSDFGLARLYPTDHNIVTLTAARGTLGYMAPELFYRDIGGISYKADVYSFGMML  319

Query  828   MEMLGLNRT-PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      +D S  YFP W+Y+ + K K ++M E   +E+  T+KM IV LWCI
Sbjct  320   MEMAGRRRNVNANAKDSSQIYFPLWVYDQLGKEKEVDMVEATAEEREKTRKMIIVALWCI  379

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL--SEPIMEV  1121
             Q++P  RPSMSRV+ MLE +++ LQ+P    L  +EP+ ++
Sbjct  380   QLNPNDRPSMSRVLNMLEEEIDELQVPPKPLLYPTEPVADL  420


 Score =   330 bits (845),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 168/311 (54%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RYS++DIKKIT     +LGEGGYG VYKG + S   VAVK+LN  K NG
Sbjct  104   FLQARNNFLPIRYSYSDIKKITKNFKYKLGEGGYGSVYKGILRSGNEVAVKILNKPKSNG  163

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EVG IG+IHHVNVV+LVG+C +  ++ALVY+++PN SLEK+I   + +N +L +K
Sbjct  164   QDFISEVGTIGRIHHVNVVQLVGFCFNHSKQALVYDFMPNGSLEKHIVYKDGEN-SLDYK  222

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD ++ PK+ DFGLA+L   + + V
Sbjct  223   KMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLDQSLTPKVSDFGLARLYPTDHNIV  282

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+  R+ G +S+K+DVYSFGM+L+EM G R+N NA    D+SQ   
Sbjct  283   TLTAARGTLGYMAPELFYRDIGGISYKADVYSFGMMLMEMAGRRRNVNAN-AKDSSQI--  339

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L +  E+ +     ++    +K+ I+ALWCIQ  P DRPSM  V+ MLE E
Sbjct  340   YFPLWVYDQLGKEKEVDMVEATAEEREKTRKMIIVALWCIQLNPNDRPSMSRVLNMLEEE  399

Query  1544  GDDLVLPSSPF  1512
              D+L +P  P 
Sbjct  400   IDELQVPPKPL  410



>ref|XP_010038694.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Eucalyptus 
grandis]
Length=657

 Score =   439 bits (1129),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 263/332 (79%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++ LI K+ RRH ++   IE FL A NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  280   PCVLILLIYKWMRRHQAMDANIEEFLQAHNNFLPIRYSYSDIKKITKNFKYKLGEGGYGS  339

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSG+++AVKI++KPKSNGQDFI+EV ++GRIHHVN+V+LVG+C + SK ALVYD
Sbjct  340   VYKGMLRSGNEIAVKILNKPKSNGQDFISEVATIGRIHHVNVVQLVGFCFDYSKQALVYD  399

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I        L++++ +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  400   FMPNGSLDKHIVYKDEGDSLDYKKMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  459

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ++F PK+SDFGLA+L+PT+++ VTLTAARGT+GY+APEL  + IG +S+KADVYSFGM+L
Sbjct  460   QSFTPKVSDFGLARLYPTNRNTVTLTAARGTLGYMAPELFYKDIGGVSYKADVYSFGMML  519

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      D+SS+ YFP W+Y+ +NKGK +E  +  ++E+  T+KM I+ LWCI
Sbjct  520   MEMAGRRRNINANVDDSSEIYFPLWVYDQLNKGKEVETVDAIDEERESTRKMIIIALWCI  579

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+SP  RPSMSRV+ MLEG++  LQ+P    L
Sbjct  580   QLSPDDRPSMSRVLNMLEGEINELQLPPKPLL  611


 Score =   330 bits (846),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +    P RYS++DIKKIT     +LGEGGYG VYKG + S   +AVK+LN  K NG
Sbjct  304   FLQAHNNFLPIRYSYSDIKKITKNFKYKLGEGGYGSVYKGMLRSGNEIAVKILNKPKSNG  363

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG+IHHVNVV+LVG+C D  ++ALVY+++PN SL+K+I   +  + +L +K
Sbjct  364   QDFISEVATIGRIHHVNVVQLVGFCFDYSKQALVYDFMPNGSLDKHIVYKDEGD-SLDYK  422

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLA+L    ++ V
Sbjct  423   KMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLDQSFTPKVSDFGLARLYPTNRNTV  482

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+  ++ G VS+K+DVYSFGM+L+EM G R+N NA    D S  E 
Sbjct  483   TLTAARGTLGYMAPELFYKDIGGVSYKADVYSFGMMLMEMAGRRRNINAN--VDDS-SEI  539

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ LN+G E++     D++    +K+ IIALWCIQ  P DRPSM  V+ MLE E
Sbjct  540   YFPLWVYDQLNKGKEVETVDAIDEERESTRKMIIIALWCIQLSPDDRPSMSRVLNMLEGE  599

Query  1544  GDDLVLPSSPF  1512
              ++L LP  P 
Sbjct  600   INELQLPPKPL  610



>gb|KCW89167.1| hypothetical protein EUGRSUZ_A01480 [Eucalyptus grandis]
Length=402

 Score =   430 bits (1105),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 222/316 (70%), Positives = 260/316 (82%), Gaps = 7/316 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY A++PTRYS+ DIK+ITN   E+LG+G YG VYKG++S+EI VAVK+L++S GNG
Sbjct  70    FLHDYEALKPTRYSYNDIKRITNDFEEKLGQGAYGTVYKGKLSNEIFVAVKMLDNSFGNG  129

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESK-NVALSW  2088
             EEFINEV  +G+IHHVNVVR+VG+CADGFRRALVYE+LPNESLEK+IF  E   +  LSW
Sbjct  130   EEFINEVSTMGRIHHVNVVRMVGFCADGFRRALVYEFLPNESLEKFIFQGEDALDPFLSW  189

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             +++ +IALG+AKGIEYLHQGCD +ILHFDIKP NILLD+N NPKI DFGLAKLCSKE+SA
Sbjct  190   ERLHDIALGVAKGIEYLHQGCDHKILHFDIKPHNILLDNNFNPKIADFGLAKLCSKEQSA  249

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             V+MTAARGTMGYIAPEV SRNFG VS KSDVYSFGMLLLEMVGGRKN +     + SQ  
Sbjct  250   VSMTAARGTMGYIAPEVFSRNFGSVSSKSDVYSFGMLLLEMVGGRKNVDVN-AKNMSQM-  307

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FP+WVYNHLN+  EL+IRI ED D  IAKKLAI+ LWCI W P DRP +KAVVQML  
Sbjct  308   -YFPQWVYNHLNKDEELEIRIREDGDRKIAKKLAIVGLWCIHWYPADRPPVKAVVQML--  364

Query  1547  EGDDL-VLPSSPFAGS  1503
             EGD+  V+P +PF  S
Sbjct  365   EGDEYPVMPKNPFVSS  380


 Score =   358 bits (918),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 239/328 (73%), Gaps = 4/328 (1%)
 Frame = +3

Query  129   IIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLR  308
             +I  +RR  +    IE+FL+    L P RYSY  IK +T  F+EKLG+G +G+VYKGKL 
Sbjct  53    VINEKRRDKAFQLKIESFLHDYEALKPTRYSYNDIKRITNDFEEKLGQGAYGTVYKGKLS  112

Query  309   SGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSL  488
             +   VAVK++     NG++FINEV +MGRIHHVN+VR+VG+CA+  + ALVY+F+PN SL
Sbjct  113   NEIFVAVKMLDNSFGNGEEFINEVSTMGRIHHVNVVRMVGFCADGFRRALVYEFLPNESL  172

Query  489   DKYINQG--AYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIP  662
             +K+I QG  A    L+W+R  +I +GVA+GIEYLH+GCD +ILHFDIKPHNILLD NF P
Sbjct  173   EKFIFQGEDALDPFLSWERLHDIALGVAKGIEYLHQGCDHKILHFDIKPHNILLDNNFNP  232

Query  663   KISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLG  842
             KI+DFGLAKL   ++S V++TAARGT+GY+APE+ +R  G++S K+DVYSFGMLL+EM+G
Sbjct  233   KIADFGLAKLCSKEQSAVSMTAARGTMGYIAPEVFSRNFGSVSSKSDVYSFGMLLLEMVG  292

Query  843   LNRT-PVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPI  1019
               +   V  ++ S  YFP W+YN +NK + +E+   ++ +++I KK+ IVGLWCI   P 
Sbjct  293   GRKNVDVNAKNMSQMYFPQWVYNHLNKDEELEIRIREDGDRKIAKKLAIVGLWCIHWYPA  352

Query  1020  PRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
              RP +  VV+MLEGD E   MP + F+S
Sbjct  353   DRPPVKAVVQMLEGD-EYPVMPKNPFVS  379



>ref|XP_010026257.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Eucalyptus 
grandis]
Length=382

 Score =   429 bits (1103),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 203/332 (61%), Positives = 259/332 (78%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FLI+K+ RRH +    IE FL   NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  5     PCVLIFLILKWMRRHQATDANIEEFLQVHNNFLPIRYSYSDIKRLTKNFKCKLGEGGYGS  64

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VY+G LRSG++VAVKI++K KSNGQDF++EV ++GRIHHVN+V+LVG+C + SK ALVYD
Sbjct  65    VYRGILRSGNEVAVKILNKSKSNGQDFMSEVATIGRIHHVNVVQLVGFCFDYSKQALVYD  124

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I+       L++++ +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  125   FMPNGSLDKHISYKDGDDPLDYKKMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  184

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ++F PK+SDFGLA+L+PTD SIV+LT ARGT+GY+APEL  + IG IS+KADVYSFGMLL
Sbjct  185   QSFTPKVSDFGLARLYPTDCSIVSLTVARGTLGYMAPELFYKDIGGISYKADVYSFGMLL  244

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      + SS+ YFP W+Y+ + K K +E  +  E+E+  T+KM IV LWCI
Sbjct  245   MEMAGRRRNINAHAERSSQIYFPLWVYDQLGKEKELERVDVIEEERETTRKMIIVALWCI  304

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+SP  RPSM +V++MLEGD + LQ+P    L
Sbjct  305   QLSPNDRPSMRKVLDMLEGDTDKLQLPPKPLL  336


 Score =   318 bits (816),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 223/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +    P RYS++DIK++T     +LGEGGYG VY+G + S   VAVK+LN SK NG
Sbjct  29    FLQVHNNFLPIRYSYSDIKRLTKNFKCKLGEGGYGSVYRGILRSGNEVAVKILNKSKSNG  88

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F++EV  IG+IHHVNVV+LVG+C D  ++ALVY+++PN SL+K+I S +  +  L +K
Sbjct  89    QDFMSEVATIGRIHHVNVVQLVGFCFDYSKQALVYDFMPNGSLDKHI-SYKDGDDPLDYK  147

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLA+L   + S V
Sbjct  148   KMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLDQSFTPKVSDFGLARLYPTDCSIV  207

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++T ARGT+GY+APE+  ++ G +S+K+DVYSFGMLL+EM G R+N NA     +SQ   
Sbjct  208   SLTVARGTLGYMAPELFYKDIGGISYKADVYSFGMLLMEMAGRRRNINA-HAERSSQI--  264

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L +  EL+     +++    +K+ I+ALWCIQ  P DRPSM+ V+ MLE +
Sbjct  265   YFPLWVYDQLGKEKELERVDVIEEERETTRKMIIVALWCIQLSPNDRPSMRKVLDMLEGD  324

Query  1544  GDDLVLPSSPF  1512
              D L LP  P 
Sbjct  325   TDKLQLPPKPL  335



>emb|CDP12537.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   433 bits (1114),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/333 (62%), Positives = 262/333 (79%), Gaps = 3/333 (1%)
 Frame = +3

Query  120   VFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKG  299
              FL+ + RRRHLS ++ IE+FL A+N+L PIRYSYK IK MTK F+EKLGEGG+G VYKG
Sbjct  130   AFLLYRCRRRHLSRYDTIEDFLQANNSLMPIRYSYKEIKTMTKNFEEKLGEGGYGLVYKG  189

Query  300   KLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPN  479
             KLRSG  VAVK+++K K+NGQ+FINEV ++GRIHHVN+VRLVG+C   SKHALVYD+MPN
Sbjct  190   KLRSGGAVAVKMLNKSKANGQEFINEVATIGRIHHVNVVRLVGFCVTASKHALVYDYMPN  249

Query  480   GSLDKYI-NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENF  656
             GSLDK I +     S L+W++  EI  GVARGIEYLH+GCD+QILHFDIKPHN+LLDENF
Sbjct  250   GSLDKLIFSNCQNGSPLSWKQVCEIAKGVARGIEYLHQGCDMQILHFDIKPHNVLLDENF  309

Query  657   IPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEM  836
             +PK+SDFGLAKL+P  KSI TLTAARGT+GY+APEL  ++IG +S KADVYS+GMLLMEM
Sbjct  310   VPKVSDFGLAKLYPMQKSIATLTAARGTLGYMAPELFYKKIGRVSDKADVYSYGMLLMEM  369

Query  837   LGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWCIQM  1010
              G  R      + SS+ YFPSWIY+  ++G+ +E+G+   E+EK I++++ ++ LWC QM
Sbjct  370   AGRRRNGNGHVEHSSQIYFPSWIYDKFDRGEELEIGDHATEEEKSISRRLILIALWCTQM  429

Query  1011  SPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEP  1109
             +P  RPSM  V+EMLEGD+  L++P       P
Sbjct  430   TPEDRPSMREVLEMLEGDLSGLKLPHRPLFYPP  462


 Score =   337 bits (863),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 171/312 (55%), Positives = 224/312 (72%), Gaps = 4/312 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+   ++ P RYS+ +IK +T    E+LGEGGYG+VYKG++ S   VAVK+LN SK NG
Sbjct  150   FLQANNSLMPIRYSYKEIKTMTKNFEEKLGEGGYGLVYKGKLRSGGAVAVKMLNKSKANG  209

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVVRLVG+C    + ALVY+Y+PN SL+K IFS       LSWK
Sbjct  210   QEFINEVATIGRIHHVNVVRLVGFCVTASKHALVYDYMPNGSLDKLIFSNCQNGSPLSWK  269

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ EIA G+A+GIEYLHQGCD QILHFDIKP N+LLD N  PK+ DFGLAKL   +KS  
Sbjct  270   QVCEIAKGVARGIEYLHQGCDMQILHFDIKPHNVLLDENFVPKVSDFGLAKLYPMQKSIA  329

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+  +  G+VS K+DVYS+GMLL+EM G R+N N   G      + 
Sbjct  330   TLTAARGTLGYMAPELFYKKIGRVSDKADVYSYGMLLMEMAGRRRNGN---GHVEHSSQI  386

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+  +RG EL+I     +++++I+++L +IALWC Q  P DRPSM+ V++MLE 
Sbjct  387   YFPSWIYDKFDRGEELEIGDHATEEEKSISRRLILIALWCTQMTPEDRPSMREVLEMLEG  446

Query  1547  EGDDLVLPSSPF  1512
             +   L LP  P 
Sbjct  447   DLSGLKLPHRPL  458



>ref|XP_004306408.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Fragaria vesca subsp. vesca]
Length=601

 Score =   437 bits (1123),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 264/314 (84%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL++YRA++P+RY++ADIK+IT    E+LG+G YG V+KGR+SSE+LVAVK+LN+S   G
Sbjct  287   FLDEYRALKPSRYTYADIKRITEHFKEKLGQGAYGTVFKGRLSSELLVAVKILNNSNEKG  346

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             E+FINEVG +G+IHHVNVVRL+GYCADGF RALVYE+LPN  L+ ++ S +++N  L W+
Sbjct  347   EDFINEVGTMGQIHHVNVVRLIGYCADGFIRALVYEFLPNGPLQNFLSSADNENSFLGWE  406

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLHQGC+QQILHFDIKP N+LLDH+  PK+ DFGLAKLCSK++S V
Sbjct  407   KLQDIALGIAKGIEYLHQGCEQQILHFDIKPHNVLLDHDFTPKVSDFGLAKLCSKDQSEV  466

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPEV SRNFG VS+K+DVYSFG LLLEMVGGRKNF   E  D+S Q  
Sbjct  467   SMTAARGTMGYIAPEVYSRNFGNVSYKADVYSFGTLLLEMVGGRKNFKVME--DSSSQV-  523

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YN L +G +L+I + ++ +  IA+KLAI+ LWCIQW P+DRPSMK VVQMLE+E
Sbjct  524   YFPEWIYNLLEQGNDLRIHVGDEGNVGIARKLAIVGLWCIQWHPIDRPSMKTVVQMLEKE  583

Query  1544  GDDLVLPSSPFAGS  1503
             GD+L +P +PFA +
Sbjct  584   GDNLTMPPNPFAST  597


 Score =   347 bits (891),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 226/313 (72%), Gaps = 2/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             I+ FL+    L P RY+Y  IK +T+ FKEKLG+G +G+V+KG+L S   VAVKI++   
Sbjct  284   IKIFLDEYRALKPSRYTYADIKRITEHFKEKLGQGAYGTVFKGRLSSELLVAVKILNNSN  343

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYA-SLL  527
               G+DFINEVG+MG+IHHVN+VRL+GYCA+    ALVY+F+PNG L  +++      S L
Sbjct  344   EKGEDFINEVGTMGQIHHVNVVRLIGYCADGFIRALVYEFLPNGPLQNFLSSADNENSFL  403

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+A+GIEYLH+GC+ QILHFDIKPHN+LLD +F PK+SDFGLAKL   D+
Sbjct  404   GWEKLQDIALGIAKGIEYLHQGCEQQILHFDIKPHNVLLDHDFTPKVSDFGLAKLCSKDQ  463

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S V++TAARGT+GY+APE+ +R  G +S+KADVYSFG LL+EM+G  +     +D SS+ 
Sbjct  464   SEVSMTAARGTMGYIAPEVYSRNFGNVSYKADVYSFGTLLLEMVGGRKNFKVMEDSSSQV  523

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP WIYN + +G  + +   DE    I +K+ IVGLWCIQ  PI RPSM  VV+MLE +
Sbjct  524   YFPEWIYNLLEQGNDLRIHVGDEGNVGIARKLAIVGLWCIQWHPIDRPSMKTVVQMLEKE  583

Query  1065  VELLQMPTDTFLS  1103
              + L MP + F S
Sbjct  584   GDNLTMPPNPFAS  596



>ref|XP_008232094.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Prunus mume]
Length=352

 Score =   427 bits (1099),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 206/321 (64%), Positives = 248/321 (77%), Gaps = 1/321 (0%)
 Frame = +3

Query  141   RRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSD  320
             RRRHLS +  IE+FL +D N  PIRYSY  IK MT  FK+KLGEGG+GSV+KGKLRSG  
Sbjct  1     RRRHLSSYSIIEDFLQSDINFLPIRYSYSEIKKMTGKFKDKLGEGGYGSVFKGKLRSGRF  60

Query  321   VAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI  500
             VA+K++ KPK NGQDF +EV ++GRIHHVN+V+LVGYC E    ALVYDFMPN SLDKYI
Sbjct  61    VAIKLLGKPKGNGQDFTSEVATIGRIHHVNVVQLVGYCVEGLNRALVYDFMPNSSLDKYI  120

Query  501   NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFG  680
                     L+ ++ +EI +GVARGIEYLH+GCD+QILHFDIKPHNILLDENF PKISDFG
Sbjct  121   YTKEENMPLSCKKMYEISLGVARGIEYLHQGCDMQILHFDIKPHNILLDENFNPKISDFG  180

Query  681   LAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPV  860
             LAKL+  D SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLLMEM    +   
Sbjct  181   LAKLYSVDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMASRRKNFS  240

Query  861   TEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMS  1037
             +  + SS+ YFP W Y+  NKG  +EMG+ +E+EK+I KKM I  LWCIQM P  RPSM+
Sbjct  241   SMVERSSQTYFPLWAYDQYNKGNDLEMGDFNEEEKKIIKKMVITALWCIQMKPSDRPSMN  300

Query  1038  RVVEMLEGDVELLQMPTDTFL  1100
             +V+EML GDVE L+MP   FL
Sbjct  301   KVIEMLGGDVECLKMPIRPFL  321


 Score =   344 bits (883),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 233/315 (74%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RYS+++IKK+T +  ++LGEGGYG V+KG++ S   VA+K+L   KGNG
Sbjct  14    FLQSDINFLPIRYSYSEIKKMTGKFKDKLGEGGYGSVFKGKLRSGRFVAIKLLGKPKGNG  73

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F +EV  IG+IHHVNVV+LVGYC +G  RALVY+++PN SL+KYI++ E +N+ LS K
Sbjct  74    QDFTSEVATIGRIHHVNVVQLVGYCVEGLNRALVYDFMPNSSLDKYIYTKE-ENMPLSCK  132

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A+GIEYLHQGCD QILHFDIKP NILLD N NPKI DFGLAKL S + S V
Sbjct  133   KMYEISLGVARGIEYLHQGCDMQILHFDIKPHNILLDENFNPKISDFGLAKLYSVDNSIV  192

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGYIAPE+  +N G VS+K+DVYSFGMLL+EM   RKNF++    + S Q  
Sbjct  193   SLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMASRRKNFSSM--VERSSQT-  249

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W Y+  N+G +L++    ++++ I KK+ I ALWCIQ +P DRPSM  V++ML  +
Sbjct  250   YFPLWAYDQYNKGNDLEMGDFNEEEKKIIKKMVITALWCIQMKPSDRPSMNKVIEMLGGD  309

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  310   VECLKMPIRPFLYPQ  324



>ref|XP_011047738.1| PREDICTED: probable receptor-like protein kinase At5g39020, partial 
[Populus euphratica]
Length=373

 Score =   428 bits (1101),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 209/333 (63%), Positives = 255/333 (77%), Gaps = 2/333 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNA-DNNLFPIRYSYKHIKNMTKAFKEKLGEGGFG  284
             PC I  LI K+RRRHLS++  IE FL + D+NL  IRYSY  IK +T  F +KLGEGG+G
Sbjct  5     PCLITLLIYKWRRRHLSMYGNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYG  64

Query  285   SVYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
             SVYKGKLRSG   A+KI+ K K+NGQDFINEV ++GRIHH N+V+L+G+  E SK AL+Y
Sbjct  65    SVYKGKLRSGRFAAIKILRKEKANGQDFINEVATIGRIHHCNVVQLIGFTVEGSKRALIY  124

Query  465   DFMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             DFMPNGSL+KYI     +  L+ Q+ +EI +GVA GIEYLH GCD+QILHFDIKPHNILL
Sbjct  125   DFMPNGSLEKYIFSRQGSIPLSNQKIYEISLGVALGIEYLHEGCDMQILHFDIKPHNILL  184

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DENF PKISDFGLAKL+PT+ SIV+LT ARGTIGY+APEL  + IG +S+KADVYSFGML
Sbjct  185   DENFTPKISDFGLAKLYPTNNSIVSLTMARGTIGYMAPELFYKSIGGVSYKADVYSFGML  244

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             LMEM+G  +   T  + SS+ YFP WIY+ +N+G+ I   +  E EK   KKMTI  LWC
Sbjct  245   LMEMVGRRKNLNTLANHSSQMYFPLWIYDQVNEGRDILEDQATEQEKNTIKKMTIAALWC  304

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             IQ+ PI RPSM RVV+ML+ ++E LQMP   FL
Sbjct  305   IQLKPIDRPSMHRVVQMLQANIESLQMPPKPFL  337


 Score =   328 bits (840),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/304 (54%), Positives = 220/304 (72%), Gaps = 4/304 (1%)
 Frame = -1

Query  2411  RYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNGEEFINEVGIIG  2232
             RYS+++IKKIT+  +++LGEGGYG VYKG++ S    A+K+L   K NG++FINEV  IG
Sbjct  41    RYSYSEIKKITHGFNDKLGEGGYGSVYKGKLRSGRFAAIKILRKEKANGQDFINEVATIG  100

Query  2231  KIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWKKIQEIALGIAK  2052
             +IHH NVV+L+G+  +G +RAL+Y+++PN SLEKYIFS +  ++ LS +KI EI+LG+A 
Sbjct  101   RIHHCNVVQLIGFTVEGSKRALIYDFMPNGSLEKYIFSRQG-SIPLSNQKIYEISLGVAL  159

Query  2051  GIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAVTMTAARGTMGY  1872
             GIEYLH+GCD QILHFDIKP NILLD N  PKI DFGLAKL     S V++T ARGT+GY
Sbjct  160   GIEYLHEGCDMQILHFDIKPHNILLDENFTPKISDFGLAKLYPTNNSIVSLTMARGTIGY  219

Query  1871  IAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEGSFPEWVYNHLN  1692
             +APE+  ++ G VS+K+DVYSFGMLL+EMVG RKN N      +SQ    FP W+Y+ +N
Sbjct  220   MAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNTL-ANHSSQM--YFPLWIYDQVN  276

Query  1691  RGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLEREGDDLVLPSSPF  1512
              G ++      + ++   KK+ I ALWCIQ +P+DRPSM  VVQML+   + L +P  PF
Sbjct  277   EGRDILEDQATEQEKNTIKKMTIAALWCIQLKPIDRPSMHRVVQMLQANIESLQMPPKPF  336

Query  1511  AGSQ  1500
                Q
Sbjct  337   LVPQ  340



>ref|XP_009765438.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=644

 Score =   438 bits (1126),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 262/330 (79%), Gaps = 1/330 (0%)
 Frame = +3

Query  117   IVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYK  296
             I  ++ K+RRRHLS+++ IE+FL   +NL PI+YSY  IK MT  FKEKLGEG +G+V+K
Sbjct  293   IALVVHKWRRRHLSMYQSIEDFLQIQSNLVPIKYSYSEIKKMTNKFKEKLGEGAYGTVFK  352

Query  297   GKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMP  476
             GKLRSG  VAVK+M K  ++GQ+FI+EV ++GRIHHVN+V+L+G+C E SK ALVYDFMP
Sbjct  353   GKLRSGPFVAVKMMHKSMTSGQEFISEVSTIGRIHHVNVVQLIGFCVEGSKRALVYDFMP  412

Query  477   NGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENF  656
             NGSLDKYI Q      L++++ F+I +GV RG+EYLHRGCD+QILHFDIKPHNILLDENF
Sbjct  413   NGSLDKYIFQQEGTISLSYKQMFDISLGVTRGVEYLHRGCDMQILHFDIKPHNILLDENF  472

Query  657   IPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEM  836
              PKISDFGLAKL+PTD SIV+LTAARGT+GY+APEL  + IG IS+KADVYS+GMLLMEM
Sbjct  473   SPKISDFGLAKLYPTDDSIVSLTAARGTMGYMAPELFYKNIGGISYKADVYSYGMLLMEM  532

Query  837   LGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMS  1013
              G  +      D  S+ YFP+W+Y+  N+G  IE+ +  ++E+R+ K+M IV LWCIQM 
Sbjct  533   AGRRKNMNPFDDHLSQIYFPTWVYDQFNEGNDIEIHDTTDEERRMVKRMIIVALWCIQMK  592

Query  1014  PIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             P  RP+M++VVEMLEGD ELLQMP   F++
Sbjct  593   PADRPAMNKVVEMLEGDDELLQMPPRPFIA  622


 Score =   338 bits (867),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 231/311 (74%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P +YS+++IKK+TN+  E+LGEG YG V+KG++ S   VAVK+++ S  +G
Sbjct  314   FLQIQSNLVPIKYSYSEIKKMTNKFKEKLGEGAYGTVFKGKLRSGPFVAVKMMHKSMTSG  373

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFI+EV  IG+IHHVNVV+L+G+C +G +RALVY+++PN SL+KYIF  E   ++LS+K
Sbjct  374   QEFISEVSTIGRIHHVNVVQLIGFCVEGSKRALVYDFMPNGSLDKYIFQQEG-TISLSYK  432

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +I+LG+ +G+EYLH+GCD QILHFDIKP NILLD N +PKI DFGLAKL   + S V
Sbjct  433   QMFDISLGVTRGVEYLHRGCDMQILHFDIKPHNILLDENFSPKISDFGLAKLYPTDDSIV  492

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGY+APE+  +N G +S+K+DVYS+GMLL+EM G RKN N     D    + 
Sbjct  493   SLTAARGTMGYMAPELFYKNIGGISYKADVYSYGMLLMEMAGRRKNMNP---FDDHLSQI  549

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+  N G +++I    D++  + K++ I+ALWCIQ +P DRP+M  VV+MLE +
Sbjct  550   YFPTWVYDQFNEGNDIEIHDTTDEERRMVKRMIIVALWCIQMKPADRPAMNKVVEMLEGD  609

Query  1544  GDDLVLPSSPF  1512
              + L +P  PF
Sbjct  610   DELLQMPPRPF  620



>ref|XP_009780293.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=640

 Score =   437 bits (1125),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 203/330 (62%), Positives = 262/330 (79%), Gaps = 1/330 (0%)
 Frame = +3

Query  117   IVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYK  296
             +  ++ ++RRRHLS+++ IE+FL   +NL PI+YSY  IK MT  FKEKLGEG +G+V+K
Sbjct  293   VALIVYRWRRRHLSMYQSIEDFLQIQSNLVPIKYSYSEIKKMTNKFKEKLGEGAYGTVFK  352

Query  297   GKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMP  476
             GKLRSG  VAVKIM K  ++G++FI+EV ++GRIHHVN+V+L+G+C E SK ALVYDFMP
Sbjct  353   GKLRSGPFVAVKIMHKSMTSGEEFISEVSTIGRIHHVNVVQLIGFCVEGSKRALVYDFMP  412

Query  477   NGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENF  656
             N SLDKYI        L++++ FEI +GVARGI+YLHRGCD+QILHFDIKPHNILLDENF
Sbjct  413   NSSLDKYIFPQEGIVSLSYKQMFEISLGVARGIDYLHRGCDMQILHFDIKPHNILLDENF  472

Query  657   IPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEM  836
              P+ISDFGLAKL+PTD SIVTLTAARGT+GY+APEL  + IG +S+KADVYS+GMLLMEM
Sbjct  473   NPRISDFGLAKLYPTDDSIVTLTAARGTVGYMAPELFYKNIGGVSYKADVYSYGMLLMEM  532

Query  837   LGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMS  1013
              G  +      D  S+ YFP+W+Y+  N+G  IEM +  E+++++ KK+  V LWCIQM 
Sbjct  533   AGRRKNMNPFADHLSQIYFPTWVYDQFNEGNDIEMQDASEEDRKMVKKIIFVALWCIQMK  592

Query  1014  PIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             P+ RP+M++VVEMLEGDV+LLQMP   F+S
Sbjct  593   PVDRPAMNKVVEMLEGDVQLLQMPPRPFIS  622


 Score =   341 bits (874),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 167/311 (54%), Positives = 231/311 (74%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P +YS+++IKK+TN+  E+LGEG YG V+KG++ S   VAVK+++ S  +G
Sbjct  314   FLQIQSNLVPIKYSYSEIKKMTNKFKEKLGEGAYGTVFKGKLRSGPFVAVKIMHKSMTSG  373

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFI+EV  IG+IHHVNVV+L+G+C +G +RALVY+++PN SL+KYIF  E   V+LS+K
Sbjct  374   EEFISEVSTIGRIHHVNVVQLIGFCVEGSKRALVYDFMPNSSLDKYIFPQEGI-VSLSYK  432

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ EI+LG+A+GI+YLH+GCD QILHFDIKP NILLD N NP+I DFGLAKL   + S V
Sbjct  433   QMFEISLGVARGIDYLHRGCDMQILHFDIKPHNILLDENFNPRISDFGLAKLYPTDDSIV  492

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+  +N G VS+K+DVYS+GMLL+EM G RKN N          + 
Sbjct  493   TLTAARGTVGYMAPELFYKNIGGVSYKADVYSYGMLLMEMAGRRKNMNPFAD---HLSQI  549

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+  N G +++++   ++D  + KK+  +ALWCIQ +PVDRP+M  VV+MLE +
Sbjct  550   YFPTWVYDQFNEGNDIEMQDASEEDRKMVKKIIFVALWCIQMKPVDRPAMNKVVEMLEGD  609

Query  1544  GDDLVLPSSPF  1512
                L +P  PF
Sbjct  610   VQLLQMPPRPF  620



>ref|XP_010662808.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Vitis 
vinifera]
Length=604

 Score =   436 bits (1122),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 216/313 (69%), Positives = 263/313 (84%), Gaps = 3/313 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLEDYRA++P+RYS+ADIKKITN   ++LG+GGYG VYKG++S+EI VAVK+L+D KGNG
Sbjct  269   FLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSNEIFVAVKILDDFKGNG  328

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEV  +G IHHVNVVRL+G+CADG+++AL+ E+LPNESL+K+IFS    N +L W 
Sbjct  329   EEFINEVRTMGTIHHVNVVRLLGFCADGYKQALICEFLPNESLDKFIFSAFGNNYSLGWH  388

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IA+GIAKGIEYLHQGCDQ+ILH DIKP NILLDHN NPKI DFGLAKLCSKE+S V
Sbjct  389   KLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNFNPKISDFGLAKLCSKEQSLV  448

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MTAARGTMGYIAPE+ SRN+G VS+K+DVYSFGMLL+EMVGGRKN +A   T  +  + 
Sbjct  449   SMTAARGTMGYIAPEMFSRNYGNVSYKADVYSFGMLLIEMVGGRKNIDA---TVENTSQA  505

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YNHL++  E+ IRIEE+ D  IAKKL+II LWCIQW P+DRPSMK VV MLE E
Sbjct  506   YFPEWLYNHLDQEQEVHIRIEEESDIKIAKKLSIIGLWCIQWYPIDRPSMKIVVGMLEGE  565

Query  1544  GDDLVLPSSPFAG  1506
               +LV+P +PF  
Sbjct  566   EGNLVMPPNPFTS  578


 Score =   345 bits (886),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 230/314 (73%), Gaps = 4/314 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             I+ FL     L P RYSY  IK +T  FK+KLG+GG+G+VYKGKL +   VAVKI+   K
Sbjct  266   IQKFLEDYRALKPSRYSYADIKKITNNFKDKLGQGGYGTVYKGKLSNEIFVAVKILDDFK  325

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS--L  524
              NG++FINEV +MG IHHVN+VRL+G+CA+  K AL+ +F+PN SLDK+I   A+ +   
Sbjct  326   GNGEEFINEVRTMGTIHHVNVVRLLGFCADGYKQALICEFLPNESLDKFI-FSAFGNNYS  384

Query  525   LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTD  704
             L W +  +I +G+A+GIEYLH+GCD +ILH DIKPHNILLD NF PKISDFGLAKL   +
Sbjct  385   LGWHKLQDIAIGIAKGIEYLHQGCDQRILHLDIKPHNILLDHNFNPKISDFGLAKLCSKE  444

Query  705   KSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRT-PVTEQDESS  881
             +S+V++TAARGT+GY+APE+ +R  G +S+KADVYSFGMLL+EM+G  +    T ++ S 
Sbjct  445   QSLVSMTAARGTMGYIAPEMFSRNYGNVSYKADVYSFGMLLIEMVGGRKNIDATVENTSQ  504

Query  882   KYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEG  1061
              YFP W+YN +++ + + +  E+E + +I KK++I+GLWCIQ  PI RPSM  VV MLEG
Sbjct  505   AYFPEWLYNHLDQEQEVHIRIEEESDIKIAKKLSIIGLWCIQWYPIDRPSMKIVVGMLEG  564

Query  1062  DVELLQMPTDTFLS  1103
             +   L MP + F S
Sbjct  565   EEGNLVMPPNPFTS  578



>gb|KCW47328.1| hypothetical protein EUGRSUZ_K01118 [Eucalyptus grandis]
Length=685

 Score =   439 bits (1129),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 263/332 (79%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++ LI K+ RRH ++   IE FL A NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  308   PCVLILLIYKWMRRHQAMDANIEEFLQAHNNFLPIRYSYSDIKKITKNFKYKLGEGGYGS  367

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSG+++AVKI++KPKSNGQDFI+EV ++GRIHHVN+V+LVG+C + SK ALVYD
Sbjct  368   VYKGMLRSGNEIAVKILNKPKSNGQDFISEVATIGRIHHVNVVQLVGFCFDYSKQALVYD  427

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I        L++++ +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  428   FMPNGSLDKHIVYKDEGDSLDYKKMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  487

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ++F PK+SDFGLA+L+PT+++ VTLTAARGT+GY+APEL  + IG +S+KADVYSFGM+L
Sbjct  488   QSFTPKVSDFGLARLYPTNRNTVTLTAARGTLGYMAPELFYKDIGGVSYKADVYSFGMML  547

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      D+SS+ YFP W+Y+ +NKGK +E  +  ++E+  T+KM I+ LWCI
Sbjct  548   MEMAGRRRNINANVDDSSEIYFPLWVYDQLNKGKEVETVDAIDEERESTRKMIIIALWCI  607

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+SP  RPSMSRV+ MLEG++  LQ+P    L
Sbjct  608   QLSPDDRPSMSRVLNMLEGEINELQLPPKPLL  639


 Score =   330 bits (845),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +    P RYS++DIKKIT     +LGEGGYG VYKG + S   +AVK+LN  K NG
Sbjct  332   FLQAHNNFLPIRYSYSDIKKITKNFKYKLGEGGYGSVYKGMLRSGNEIAVKILNKPKSNG  391

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG+IHHVNVV+LVG+C D  ++ALVY+++PN SL+K+I   +  + +L +K
Sbjct  392   QDFISEVATIGRIHHVNVVQLVGFCFDYSKQALVYDFMPNGSLDKHIVYKDEGD-SLDYK  450

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLA+L    ++ V
Sbjct  451   KMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLDQSFTPKVSDFGLARLYPTNRNTV  510

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GY+APE+  ++ G VS+K+DVYSFGM+L+EM G R+N NA    D S  E 
Sbjct  511   TLTAARGTLGYMAPELFYKDIGGVSYKADVYSFGMMLMEMAGRRRNINAN--VDDS-SEI  567

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ LN+G E++     D++    +K+ IIALWCIQ  P DRPSM  V+ MLE E
Sbjct  568   YFPLWVYDQLNKGKEVETVDAIDEERESTRKMIIIALWCIQLSPDDRPSMSRVLNMLEGE  627

Query  1544  GDDLVLPSSPF  1512
              ++L LP  P 
Sbjct  628   INELQLPPKPL  638



>ref|XP_004498441.1| PREDICTED: probable receptor-like protein kinase At5g39020-like 
[Cicer arietinum]
Length=430

 Score =   430 bits (1106),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 205/322 (64%), Positives = 252/322 (78%), Gaps = 2/322 (1%)
 Frame = +3

Query  123   FLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGK  302
              LI   RRRH+S++E IE FL   + L PIRYSY+ IKNMT++FK+KLGEGGFGSVYKGK
Sbjct  63    LLIYTCRRRHISIYENIEIFLRG-STLMPIRYSYRQIKNMTRSFKDKLGEGGFGSVYKGK  121

Query  303   LRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNG  482
             L SG  VA+K++ K K NGQDFINEV ++GRIHH N+VRL+G+C + SK ALVY+FMPNG
Sbjct  122   LSSGPFVAIKMLGKSKGNGQDFINEVATIGRIHHTNVVRLIGFCVDGSKRALVYEFMPNG  181

Query  483   SLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIP  662
             SLDKYI+    A  L +++ +EI +GVARGI YLH+GCD+QILHFDIKPHNILLDENFIP
Sbjct  182   SLDKYISSSQDAIFLTYKQMYEISLGVARGITYLHQGCDMQILHFDIKPHNILLDENFIP  241

Query  663   KISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLG  842
             K+SDFGLAKL+P D SIVTLTAARGTIGY+APEL  + IG +S+KADVYSFGMLLMEM  
Sbjct  242   KVSDFGLAKLYPNDNSIVTLTAARGTIGYMAPELFYKNIGGVSYKADVYSFGMLLMEMAS  301

Query  843   LNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPI  1019
               R      D SS+ +FP WIYN + + + I+M E   +EK   KKM I  LWCIQ+ P 
Sbjct  302   KRRNLNPLADRSSQLFFPFWIYNQLIEEREIQMDEITNEEKSNVKKMFITALWCIQLKPC  361

Query  1020  PRPSMSRVVEMLEGDVELLQMP  1085
              RP+M++V+EMLEGD+E ++MP
Sbjct  362   DRPAMNKVIEMLEGDIENIEMP  383


 Score =   335 bits (858),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 165/304 (54%), Positives = 223/304 (73%), Gaps = 4/304 (1%)
 Frame = -1

Query  2426  AVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNGEEFINE  2247
              + P RYS+  IK +T    ++LGEGG+G VYKG++SS   VA+K+L  SKGNG++FINE
Sbjct  87    TLMPIRYSYRQIKNMTRSFKDKLGEGGFGSVYKGKLSSGPFVAIKMLGKSKGNGQDFINE  146

Query  2246  VGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWKKIQEIA  2067
             V  IG+IHH NVVRL+G+C DG +RALVYE++PN SL+KYI S++   + L++K++ EI+
Sbjct  147   VATIGRIHHTNVVRLIGFCVDGSKRALVYEFMPNGSLDKYISSSQDA-IFLTYKQMYEIS  205

Query  2066  LGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAVTMTAAR  1887
             LG+A+GI YLHQGCD QILHFDIKP NILLD N  PK+ DFGLAKL   + S VT+TAAR
Sbjct  206   LGVARGITYLHQGCDMQILHFDIKPHNILLDENFIPKVSDFGLAKLYPNDNSIVTLTAAR  265

Query  1886  GTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEGSFPEWV  1707
             GT+GY+APE+  +N G VS+K+DVYSFGMLL+EM   R+N N     D S Q   FP W+
Sbjct  266   GTIGYMAPELFYKNIGGVSYKADVYSFGMLLMEMASKRRNLNPL--ADRSSQL-FFPFWI  322

Query  1706  YNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLEREGDDLVL  1527
             YN L    E+Q+    +++++  KK+ I ALWCIQ +P DRP+M  V++MLE + +++ +
Sbjct  323   YNQLIEEREIQMDEITNEEKSNVKKMFITALWCIQLKPCDRPAMNKVIEMLEGDIENIEM  382

Query  1526  PSSP  1515
             P  P
Sbjct  383   PPKP  386



>ref|XP_011003874.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Populus euphratica]
Length=613

 Score =   436 bits (1122),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 259/314 (82%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P RY++ADIK+ITN   E+LG+G YG V+KG++S+EI VAVK+LN+S GNG
Sbjct  278   FLADYKALKPARYTYADIKRITNDFKEKLGQGAYGTVFKGKLSNEIFVAVKILNNSTGNG  337

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG +G+IHHVN+VRLVGYCADGFRRALVY+YLPNESLEK++ S   K   LSW+
Sbjct  338   EEFVNEVGTMGRIHHVNIVRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGKTCPLSWE  397

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIAKGIEYLHQGCDQ+ILHFDIKP NILLD N +PKI DFGLAKLCSK++SAV
Sbjct  398   KLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDDNFSPKISDFGLAKLCSKDQSAV  457

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS KSDVYS+GM+LLEMVGGRK  + KE  + +Q   
Sbjct  458   SMTTARGTMGYIAPEVFSRNFGNVSSKSDVYSYGMVLLEMVGGRKTVD-KEVENNTQI--  514

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVYN L+ G EL IRIE++ D  IAKKL I+ LWCIQW PV+RPSM  VVQMLE  
Sbjct  515   YFPGWVYNSLDNGEELIIRIEKEGDAQIAKKLTIVGLWCIQWHPVERPSMTTVVQMLEGG  574

Query  1544  GDDLVLPSSPFAGS  1503
             GD L +P SP + +
Sbjct  575   GDKLTMPPSPLSSA  588


 Score =   360 bits (923),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 233/307 (76%), Gaps = 2/307 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IENFL     L P RY+Y  IK +T  FKEKLG+G +G+V+KGKL +   VAVKI++   
Sbjct  275   IENFLADYKALKPARYTYADIKRITNDFKEKLGQGAYGTVFKGKLSNEIFVAVKILNNST  334

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYIN-QGAYASLL  527
              NG++F+NEVG+MGRIHHVNIVRLVGYCA+  + ALVYD++PN SL+K+++ +      L
Sbjct  335   GNGEEFVNEVGTMGRIHHVNIVRLVGYCADGFRRALVYDYLPNESLEKFVSSEHGKTCPL  394

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
             +W++  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD+NF PKISDFGLAKL   D+
Sbjct  395   SWEKLQDIALGIAKGIEYLHQGCDQRILHFDIKPHNILLDDNFSPKISDFGLAKLCSKDQ  454

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSK-  884
             S V++T ARGT+GY+APE+ +R  G +S K+DVYS+GM+L+EM+G  +T   E + +++ 
Sbjct  455   SAVSMTTARGTMGYIAPEVFSRNFGNVSSKSDVYSYGMVLLEMVGGRKTVDKEVENNTQI  514

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN ++ G+ + +  E E + +I KK+TIVGLWCIQ  P+ RPSM+ VV+MLEG 
Sbjct  515   YFPGWVYNSLDNGEELIIRIEKEGDAQIAKKLTIVGLWCIQWHPVERPSMTTVVQMLEGG  574

Query  1065  VELLQMP  1085
              + L MP
Sbjct  575   GDKLTMP  581



>gb|EYU32415.1| hypothetical protein MIMGU_mgv1a021939mg [Erythranthe guttata]
Length=581

 Score =   435 bits (1119),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 260/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DYRA++P+R+S++DI +IT+Q  ++LGEG YG+VYKG++++EI VAVKVLN+SKGNG
Sbjct  256   FLQDYRALKPSRFSYSDITRITHQFRDKLGEGCYGVVYKGKLNNEIDVAVKVLNNSKGNG  315

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRLVG+CADGFRRALVYE+LPN+SLEK IF   SK ++L W+
Sbjct  316   EEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFLPNDSLEKIIFQAGSKKISLDWE  375

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
              +++IALGIA+GIEYLH+GCDQQILHFDIKP N+LLDHN NPKICDFGLAKLCSKE+SAV
Sbjct  376   TLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDHNFNPKICDFGLAKLCSKEQSAV  435

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+ S KSDVYSFGMLLLEMVGGRKN   ++    +    
Sbjct  436   TMTAARGTMGYIAPEVLSRTFGRGSCKSDVYSFGMLLLEMVGGRKN---EDRIVNNTSPV  492

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          +++   IA+KL+I+ LWCIQW P DRPSMK VVQMLE +
Sbjct  493   YFPQWIYNHINAEDNSMWEQIDEEGSIIARKLSIVGLWCIQWYPTDRPSMKVVVQMLEGD  552

Query  1544  GDDLVLPSSPFAGS  1503
               DL +PS+PF  +
Sbjct  553   NGDLTMPSNPFPAT  566


 Score =   341 bits (874),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 174/330 (53%), Positives = 229/330 (69%), Gaps = 3/330 (1%)
 Frame = +3

Query  114   AIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVY  293
             A+ +  I++R    +  + IE FL     L P R+SY  I  +T  F++KLGEG +G VY
Sbjct  235   ALFYQYIRFRTGRENQIK-IEKFLQDYRALKPSRFSYSDITRITHQFRDKLGEGCYGVVY  293

Query  294   KGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFM  473
             KGKL +  DVAVK+++  K NG++F+NEV ++GRIHHVNIVRLVG+CA+  + ALVY+F+
Sbjct  294   KGKLNNEIDVAVKVLNNSKGNGEEFVNEVSTIGRIHHVNIVRLVGFCADGFRRALVYEFL  353

Query  474   PNGSLDKYINQGAYASL-LNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             PN SL+K I Q     + L+W+   +I +G+ARGIEYLH GCD QILHFDIKP N+LLD 
Sbjct  354   PNDSLEKIIFQAGSKKISLDWETLKDIALGIARGIEYLHEGCDQQILHFDIKPQNVLLDH  413

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NF PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G  S K+DVYSFGMLL+
Sbjct  414   NFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRGSCKSDVYSFGMLLL  473

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      + +S  YFP WIYN IN        + DE+   I +K++IVGLWCIQ
Sbjct  474   EMVGGRKNEDRIVNNTSPVYFPQWIYNHINAEDNSMWEQIDEEGSIIARKLSIVGLWCIQ  533

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
               P  RPSM  VV+MLEGD   L MP++ F
Sbjct  534   WYPTDRPSMKVVVQMLEGDNGDLTMPSNPF  563



>ref|XP_002513567.1| kinase, putative [Ricinus communis]
 gb|EEF48970.1| kinase, putative [Ricinus communis]
Length=601

 Score =   436 bits (1120),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 209/340 (61%), Positives = 261/340 (77%), Gaps = 4/340 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC +VFL+  + RRH+S+++ IE FL + NNL P+RYSY  I+ MT AFK+KLGEGG+GS
Sbjct  236   PCVLVFLVYTWSRRHVSMYDSIEEFLQSQNNLTPVRYSYSDIRKMTSAFKDKLGEGGYGS  295

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             V K KLRSG   AVK++ K K+NGQ+FINEV S+G++HHVN+V+L+G+CAE SK ALVYD
Sbjct  296   VCKAKLRSGRFAAVKMLGKSKANGQEFINEVASIGQVHHVNVVQLIGFCAEGSKRALVYD  355

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKY+      + L+W++  EI +GVARGI+YLHRGC +QILHFDIKPHNILLD
Sbjct  356   FMPNGSLDKYVFSREGNTHLSWKKMHEISLGVARGIDYLHRGCKMQILHFDIKPHNILLD  415

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENFIPK+SDFGLAKL  T  S VTLTAARGTIGY+APEL  + IG +S+KADVYSFGMLL
Sbjct  416   ENFIPKVSDFGLAKLQATSDSTVTLTAARGTIGYIAPELFYKNIGGVSYKADVYSFGMLL  475

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  +    E D SS+ YFP W+YN++  GK +E+    EDE+ + KKM  V LWCI
Sbjct  476   MEMVGKKKNLNAEADHSSQTYFPDWVYNEVIDGK-VEIRNGTEDEEMVAKKMITVALWCI  534

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL--SEPIME  1118
             QM P  RPSM +VVEMLE ++E L +P    L   EP++E
Sbjct  535   QMKPSDRPSMQKVVEMLEDNLESLPLPPKPTLWPEEPLVE  574


 Score =   347 bits (891),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 234/310 (75%), Gaps = 5/310 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS++DI+K+T+   ++LGEGGYG V K ++ S    AVK+L  SK NG
Sbjct  260   FLQSQNNLTPVRYSYSDIRKMTSAFKDKLGEGGYGSVCKAKLRSGRFAAVKMLGKSKANG  319

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG++HHVNVV+L+G+CA+G +RALVY+++PN SL+KY+FS E  N  LSWK
Sbjct  320   QEFINEVASIGQVHHVNVVQLIGFCAEGSKRALVYDFMPNGSLDKYVFSREG-NTHLSWK  378

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A+GI+YLH+GC  QILHFDIKP NILLD N  PK+ DFGLAKL +   S V
Sbjct  379   KMHEISLGVARGIDYLHRGCKMQILHFDIKPHNILLDENFIPKVSDFGLAKLQATSDSTV  438

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG +KN NA E   +SQ   
Sbjct  439   TLTAARGTIGYIAPELFYKNIGGVSYKADVYSFGMLLMEMVGKKKNLNA-EADHSSQT--  495

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+WVYN +   G+++IR   +D+E +AKK+  +ALWCIQ +P DRPSM+ VV+MLE  
Sbjct  496   YFPDWVYNEV-IDGKVEIRNGTEDEEMVAKKMITVALWCIQMKPSDRPSMQKVVEMLEDN  554

Query  1544  GDDLVLPSSP  1515
              + L LP  P
Sbjct  555   LESLPLPPKP  564



>ref|XP_002513565.1| kinase, putative [Ricinus communis]
 gb|EEF48968.1| kinase, putative [Ricinus communis]
Length=662

 Score =   437 bits (1125),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 211/330 (64%), Positives = 262/330 (79%), Gaps = 6/330 (2%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P A VFLI K+R+RHLS+++ IE FL + NN  PIRYSY  I+ MT  FK+KLGEGG+GS
Sbjct  288   PFAFVFLIYKWRKRHLSMYDNIEEFLESQNNFMPIRYSYLDIRKMTNNFKDKLGEGGYGS  347

Query  288   VYKGKLRSGSDVAVKIMSKPKS-NGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
             VYKGKLRSG   AVKI+ K K+ NGQ+F+NEV ++GRIHH+N+VRLVG+C E SK ALVY
Sbjct  348   VYKGKLRSGCLAAVKILGKSKAANGQEFMNEVATIGRIHHINVVRLVGFCFEGSKRALVY  407

Query  465   DFMPNGSLDKYI-NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNIL  641
             +FMPNGSLDKYI  +  YASL +W++ +EI +GVARGIEYLHRGC++QILHFDIKPHNIL
Sbjct  408   EFMPNGSLDKYIFYEEGYASL-SWRKMYEISLGVARGIEYLHRGCEMQILHFDIKPHNIL  466

Query  642   LDENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGM  821
             LDENF P++SDFGLAKL+PT+ + V+LTAARGT+GY+APEL  + IG +S KADVYSFGM
Sbjct  467   LDENFTPRVSDFGLAKLYPTNHNTVSLTAARGTMGYIAPELFYKNIGGVSFKADVYSFGM  526

Query  822   LLMEMLG--LNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGL  995
             LLMEM+G   N  P+ +   S  YFP W+YN ++ GK +E+G+  +DE RI KKM IV L
Sbjct  527   LLMEMIGKRKNWNPLVDPSSSQDYFPFWVYNQMSNGK-VELGDATDDEMRIRKKMIIVAL  585

Query  996   WCIQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             WCIQM P  RP M+RV+ MLE D+E L +P
Sbjct  586   WCIQMKPSSRPPMNRVINMLEEDLESLVLP  615


 Score =   344 bits (882),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 227/311 (73%), Gaps = 5/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKG-N  2268
             FLE      P RYS+ DI+K+TN   ++LGEGGYG VYKG++ S  L AVK+L  SK  N
Sbjct  312   FLESQNNFMPIRYSYLDIRKMTNNFKDKLGEGGYGSVYKGKLRSGCLAAVKILGKSKAAN  371

Query  2267  GEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSW  2088
             G+EF+NEV  IG+IHH+NVVRLVG+C +G +RALVYE++PN SL+KYIF  E    +LSW
Sbjct  372   GQEFMNEVATIGRIHHINVVRLVGFCFEGSKRALVYEFMPNGSLDKYIFYEEGY-ASLSW  430

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             +K+ EI+LG+A+GIEYLH+GC+ QILHFDIKP NILLD N  P++ DFGLAKL     + 
Sbjct  431   RKMYEISLGVARGIEYLHRGCEMQILHFDIKPHNILLDENFTPRVSDFGLAKLYPTNHNT  490

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             V++TAARGTMGYIAPE+  +N G VS K+DVYSFGMLL+EM+G RKN+N     D S  +
Sbjct  491   VSLTAARGTMGYIAPELFYKNIGGVSFKADVYSFGMLLMEMIGKRKNWNPL--VDPSSSQ  548

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FP WVYN ++  G++++    DD+  I KK+ I+ALWCIQ +P  RP M  V+ MLE 
Sbjct  549   DYFPFWVYNQMS-NGKVELGDATDDEMRIRKKMIIVALWCIQMKPSSRPPMNRVINMLEE  607

Query  1547  EGDDLVLPSSP  1515
             + + LVLP  P
Sbjct  608   DLESLVLPPKP  618



>ref|XP_010662663.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=681

 Score =   438 bits (1127),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 208/327 (64%), Positives = 259/327 (79%), Gaps = 2/327 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C + +LI K+RRRHLS  + IE FL    NL PIRYSY H+K MT  FK KLG+GGF SV
Sbjct  317   CLLGYLIYKFRRRHLSADDNIEEFLRTHQNLQPIRYSYSHLKKMTNNFKNKLGQGGFASV  376

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK+++  K+  QDFINEV ++G IHHVN+VRLVG+C E SK AL+YDF
Sbjct  377   YKGKLRSGHIVAVKMLTMSKAKEQDFINEVATIGMIHHVNVVRLVGFCVERSKWALIYDF  436

Query  471   MPNGSLDKYI-NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK+I   G  ++ L+W R ++I +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  437   MPNGSLDKFIFFDGEKSAPLSWDRLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  496

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLAKL+ TD+S+V+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  497   ENFTPKVSDFGLAKLYSTDESVVSLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLL  556

Query  828   MEMLGLNR-TPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             ME++G  R   V E++ S  +FPSWI++ I +G+ IE+G+  ED+ +  KKM IV LWC+
Sbjct  557   MEIVGKRRHVSVHEENLSEIFFPSWIHDKIKQGEDIEIGDAKEDDMKYMKKMVIVALWCV  616

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P  RPSMS+ +EMLEG+VELLQMP
Sbjct  617   QMKPTDRPSMSKALEMLEGEVELLQMP  643


 Score =   326 bits (835),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 226/310 (73%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL  ++ ++P RYS++ +KK+TN    +LG+GG+  VYKG++ S  +VAVK+L  SK   
Sbjct  340   FLRTHQNLQPIRYSYSHLKKMTNNFKNKLGQGGFASVYKGKLRSGHIVAVKMLTMSKAKE  399

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG IHHVNVVRLVG+C +  + AL+Y+++PN SL+K+IF    K+  LSW 
Sbjct  400   QDFINEVATIGMIHHVNVVRLVGFCVERSKWALIYDFMPNGSLDKFIFFDGEKSAPLSWD  459

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +IALG+ +GIEYLHQGCD QILHFDIKP NILLD N  PK+ DFGLAKL S ++S V
Sbjct  460   RLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYSTDESVV  519

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+E+VG R++ +  E    +  E 
Sbjct  520   SLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLLMEIVGKRRHVSVHE---ENLSEI  576

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+++ + +G +++I   ++DD    KK+ I+ALWC+Q +P DRPSM   ++MLE E
Sbjct  577   FFPSWIHDKIKQGEDIEIGDAKEDDMKYMKKMVIVALWCVQMKPTDRPSMSKALEMLEGE  636

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  637   VELLQMPPKP  646



>ref|XP_008232079.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Prunus mume]
Length=651

 Score =   437 bits (1124),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 214/340 (63%), Positives = 262/340 (77%), Gaps = 3/340 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P  I FLI  +R+RH S++  IENFL+ DNN  PIRYSY  IK M+  FK KLGEGGFG 
Sbjct  290   PFVIAFLIYTWRKRHSSMYSTIENFLHDDNNFPPIRYSYLDIKKMSNEFKNKLGEGGFGM  349

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             V+KGKLRSG   A+K++SK K+NG+DFI+EV ++GRIHHVN+V+LVGYC E SK ALVY+
Sbjct  350   VFKGKLRSGHFGAIKMLSKSKANGEDFISEVATIGRIHHVNVVQLVGYCVEGSKRALVYE  409

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FM NGSLDKYI      +LL++++ ++I +GVARGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  410   FMQNGSLDKYIYSKEGNNLLSYKKMYDISLGVARGIEYLHQGCDMQILHFDIKPHNILLD  469

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF+PKISDFGLAKL+PT  SIV LTAARGT+GY+APEL  + IG +SHKADVYSFGMLL
Sbjct  470   ENFVPKISDFGLAKLYPTVNSIVLLTAARGTMGYMAPELFYKNIGGVSHKADVYSFGMLL  529

Query  828   MEMLGLNRTPVTEQDESSK--YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             MEM G  R  +  + E S   YFPSW+Y+   +GK +EM +  E+EK+I KKM I  LWC
Sbjct  530   MEM-GSKRKNLNARAEHSSQIYFPSWVYDQYKEGKELEMEDITEEEKKIVKKMVITALWC  588

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV  1121
             IQM P  RP+M+ V++MLEGDVE L+MP   FL    M V
Sbjct  589   IQMKPSDRPAMNEVIKMLEGDVESLRMPPKPFLCPQEMSV  628


 Score =   345 bits (884),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 228/315 (72%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL D     P RYS+ DIKK++N+   +LGEGG+G+V+KG++ S    A+K+L+ SK NG
Sbjct  314   FLHDDNNFPPIRYSYLDIKKMSNEFKNKLGEGGFGMVFKGKLRSGHFGAIKMLSKSKANG  373

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             E+FI+EV  IG+IHHVNVV+LVGYC +G +RALVYE++ N SL+KYI+S E  N+ LS+K
Sbjct  374   EDFISEVATIGRIHHVNVVQLVGYCVEGSKRALVYEFMQNGSLDKYIYSKEGNNL-LSYK  432

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +I+LG+A+GIEYLHQGCD QILHFDIKP NILLD N  PKI DFGLAKL     S V
Sbjct  433   KMYDISLGVARGIEYLHQGCDMQILHFDIKPHNILLDENFVPKISDFGLAKLYPTVNSIV  492

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              +TAARGTMGY+APE+  +N G VSHK+DVYSFGMLL+EM   RKN NA+        + 
Sbjct  493   LLTAARGTMGYMAPELFYKNIGGVSHKADVYSFGMLLMEMGSKRKNLNARA---EHSSQI  549

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+    G EL++    ++++ I KK+ I ALWCIQ +P DRP+M  V++MLE +
Sbjct  550   YFPSWVYDQYKEGKELEMEDITEEEKKIVKKMVITALWCIQMKPSDRPAMNEVIKMLEGD  609

Query  1544  GDDLVLPSSPFAGSQ  1500
              + L +P  PF   Q
Sbjct  610   VESLRMPPKPFLCPQ  624



>gb|KCW58942.1| hypothetical protein EUGRSUZ_H01564 [Eucalyptus grandis]
Length=406

 Score =   428 bits (1101),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 258/332 (78%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FLI+K+ RRH +    IE FL A NNL PIRYSY  I+ +TK FK KLGEGG+GS
Sbjct  29    PCVLIFLILKWMRRHQATDANIEQFLQAHNNLLPIRYSYSDIRRITKNFKSKLGEGGYGS  88

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VY+G LRSG++VAVKI++KPK NGQDFI+EV ++GRIHHVN+V+LVG+C E SK ALVYD
Sbjct  89    VYRGILRSGNEVAVKILNKPKCNGQDFISEVRTIGRIHHVNVVQLVGFCFEYSKQALVYD  148

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I+       L++++ +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  149   FMPNGSLDKHISYKDGDDPLDYKKMYEISLGIARGIEYLHRGCDVQILHFDIKPHNILLD  208

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
              +F PK+SDFGLA L+PTD+SIV LT ARGT+GY+A EL  + IG IS+KADVYSFGMLL
Sbjct  209   RSFTPKVSDFGLATLYPTDRSIVLLTTARGTLGYMAHELFYKDIGGISYKADVYSFGMLL  268

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      + SS+ YFP W+Y+ ++K   +E  +  E+E+  T+KM IV LWCI
Sbjct  269   MEMAGRRRNINAHAERSSQIYFPLWVYDQLSKENELERVDVIEEERETTRKMIIVALWCI  328

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+SP  RPSM +V+ MLEGD++ LQ+P    L
Sbjct  329   QLSPNDRPSMRKVLNMLEGDMDKLQLPPKPLL  360


 Score =   312 bits (799),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 161/311 (52%), Positives = 222/311 (71%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  + P RYS++DI++IT     +LGEGGYG VY+G + S   VAVK+LN  K NG
Sbjct  53    FLQAHNNLLPIRYSYSDIRRITKNFKSKLGEGGYGSVYRGILRSGNEVAVKILNKPKCNG  112

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG+IHHVNVV+LVG+C +  ++ALVY+++PN SL+K+I S +  +  L +K
Sbjct  113   QDFISEVRTIGRIHHVNVVQLVGFCFEYSKQALVYDFMPNGSLDKHI-SYKDGDDPLDYK  171

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLA L   ++S V
Sbjct  172   KMYEISLGIARGIEYLHRGCDVQILHFDIKPHNILLDRSFTPKVSDFGLATLYPTDRSIV  231

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              +T ARGT+GY+A E+  ++ G +S+K+DVYSFGMLL+EM G R+N NA     +SQ   
Sbjct  232   LLTTARGTLGYMAHELFYKDIGGISYKADVYSFGMLLMEMAGRRRNINA-HAERSSQI--  288

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L++  EL+     +++    +K+ I+ALWCIQ  P DRPSM+ V+ MLE +
Sbjct  289   YFPLWVYDQLSKENELERVDVIEEERETTRKMIIVALWCIQLSPNDRPSMRKVLNMLEGD  348

Query  1544  GDDLVLPSSPF  1512
              D L LP  P 
Sbjct  349   MDKLQLPPKPL  359



>ref|XP_009367880.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Pyrus 
x bretschneideri]
Length=419

 Score =   429 bits (1102),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 249/327 (76%), Gaps = 1/327 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P A VFL+ K+RRRHLS++  IE+FL  D N  PIRYSY  IK MT+ FK+KLGEGG+GS
Sbjct  59    PIAAVFLVYKWRRRHLSMYSTIEDFLQRDKNFVPIRYSYSDIKKMTRRFKDKLGEGGYGS  118

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             V+KGKLRSG  VA+K++ K K+NGQDFI+E+ ++GRI HVN+VRLVGYC E SK ALVY 
Sbjct  119   VFKGKLRSGRFVAIKVLGKSKANGQDFISEIATIGRIRHVNVVRLVGYCVEGSKRALVYV  178

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FM NGSLDKYI     +  L   + +EI +GVA+GIEYLH+GC++QILHFDIKPHNILLD
Sbjct  179   FMANGSLDKYIYSKEGSVPLTIDKMYEISLGVAQGIEYLHQGCEMQILHFDIKPHNILLD  238

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF  K+SDFGLAKL+P D SIVTLTAARGT+GY+A EL  + IG +SHKADVYSFGMLL
Sbjct  239   ENFKAKVSDFGLAKLYPVDNSIVTLTAARGTMGYIALELFYKNIGGVSHKADVYSFGMLL  298

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM    +   T  + SS+ YFP W+Y+  N G  +EM    E+EK + KKM I  LWCI
Sbjct  299   MEMASRRKNLNTRVEHSSQIYFPLWVYDQYNVGNDLEMDNVTEEEKNVIKKMVITALWCI  358

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             QM P  RPSM +++EML GDVE LQMP
Sbjct  359   QMKPTDRPSMHKLIEMLGGDVECLQMP  385


 Score =   325 bits (833),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 224/310 (72%), Gaps = 4/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+  +   P RYS++DIKK+T +  ++LGEGGYG V+KG++ S   VA+KVL  SK NG
Sbjct  83    FLQRDKNFVPIRYSYSDIKKMTRRFKDKLGEGGYGSVFKGKLRSGRFVAIKVLGKSKANG  142

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+E+  IG+I HVNVVRLVGYC +G +RALVY ++ N SL+KYI+S E  +V L+  
Sbjct  143   QDFISEIATIGRIRHVNVVRLVGYCVEGSKRALVYVFMANGSLDKYIYSKEG-SVPLTID  201

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A+GIEYLHQGC+ QILHFDIKP NILLD N   K+ DFGLAKL   + S V
Sbjct  202   KMYEISLGVAQGIEYLHQGCEMQILHFDIKPHNILLDENFKAKVSDFGLAKLYPVDNSIV  261

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGTMGYIA E+  +N G VSHK+DVYSFGMLL+EM   RKN N +   + S Q  
Sbjct  262   TLTAARGTMGYIALELFYKNIGGVSHKADVYSFGMLLMEMASRRKNLNTR--VEHSSQI-  318

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+  N G +L++    ++++ + KK+ I ALWCIQ +P DRPSM  +++ML  +
Sbjct  319   YFPLWVYDQYNVGNDLEMDNVTEEEKNVIKKMVITALWCIQMKPTDRPSMHKLIEMLGGD  378

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  379   VECLQMPPRP  388



>ref|XP_010662566.1| PREDICTED: cysteine-rich receptor-like protein kinase 37 [Vitis 
vinifera]
Length=715

 Score =   439 bits (1129),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 209/338 (62%), Positives = 265/338 (78%), Gaps = 3/338 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+ RRHLS+ + IE FL +  NL PI+YSY  IK MT  F  KLG+GGFGSV
Sbjct  351   CLFAYLIYKFHRRHLSLDDSIEEFLRSQKNLQPIKYSYSDIKKMTHNFANKLGQGGFGSV  410

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRLVG+C + SK AL+YDF
Sbjct  411   YKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCVQGSKWALIYDF  470

Query  471   MPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK+I  +    + L+W+R +++ +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  471   MPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  530

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+S+V+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  531   EDFTPKVSDFGLAKLYSTDESMVSLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLL  590

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  +        SS+ YFPSWIY+  ++G  I++G+  EDEK++ +KM IV LWCI
Sbjct  591   MEMVGRRKNVNANAAHSSQIYFPSWIYDRYDQGDNIDLGDATEDEKKLVRKMVIVALWCI  650

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTD-TFLSEPIM  1115
             QM PI RPSMS+ +EMLEG+VELL+MP   T  SE ++
Sbjct  651   QMKPIDRPSMSKALEMLEGEVELLEMPPKPTLYSEEML  688


 Score =   344 bits (883),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/310 (54%), Positives = 232/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL   + ++P +YS++DIKK+T+  + +LG+GG+G VYKG++ S  +VAVKVL  SK NG
Sbjct  374   FLRSQKNLQPIKYSYSDIKKMTHNFANKLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANG  433

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+C  G + AL+Y+++PN SL+K+IF  E  N  LSW+
Sbjct  434   QDFINEVATIGRIHHVNVVRLVGFCVQGSKWALIYDFMPNGSLDKFIFLKEENNTFLSWE  493

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ ++ALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  494   RLYKVALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESMV  553

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG RKN NA     +   + 
Sbjct  554   SLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLLMEMVGRRKNVNANAAHSS---QI  610

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++G  + +    +D++ + +K+ I+ALWCIQ +P+DRPSM   ++MLE E
Sbjct  611   YFPSWIYDRYDQGDNIDLGDATEDEKKLVRKMVIVALWCIQMKPIDRPSMSKALEMLEGE  670

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  671   VELLEMPPKP  680



>ref|XP_006372927.1| hypothetical protein POPTR_0017s06310g [Populus trichocarpa]
 gb|ERP50724.1| hypothetical protein POPTR_0017s06310g [Populus trichocarpa]
Length=717

 Score =   439 bits (1129),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 201/328 (61%), Positives = 264/328 (80%), Gaps = 2/328 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC I+FLI K+RRRHLSV++ +E FL + NNL P+RYSY  I+ +T+ FK++LG+GGFG+
Sbjct  278   PCVIIFLIYKWRRRHLSVYDTVEQFLQSQNNLMPVRYSYSDIRKITRGFKDELGKGGFGT  337

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG   A+K++ K K+NGQDFINEV ++GRIHH N+V+L+G+CAE SK ALVYD
Sbjct  338   VYKGKLRSGRFAAIKLLGKSKANGQDFINEVATIGRIHHTNVVQLIGFCAEGSKRALVYD  397

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLD ++     +  L+WQ+  +I +GVA GI+YLH GCD+QILHFDIKPHNILLD
Sbjct  398   FMPNGSLDSHLFSQEGSISLSWQKLHQISLGVACGIDYLHLGCDMQILHFDIKPHNILLD  457

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PK+SDFGLA+L+PT+ SI +LTAARGTIGY+APEL  + IG +S+KADVYSFGMLL
Sbjct  458   ENFTPKVSDFGLARLYPTNGSITSLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLL  517

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWC  1001
             +EM G  +      + SS+ Y+P W+++ ++ GKA+E+G++  E+E +I KKM +VGLWC
Sbjct  518   LEMAGKRKNLNALAENSSQIYWPYWVHDQVSDGKAVEIGDDATEEESKIVKKMIVVGLWC  577

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             IQM P+ RP+M  VVEMLEGD+E LQ+P
Sbjct  578   IQMKPMDRPTMKNVVEMLEGDLENLQLP  605


 Score =   327 bits (839),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 230/311 (74%), Gaps = 5/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS++DI+KIT    + LG+GG+G VYKG++ S    A+K+L  SK NG
Sbjct  302   FLQSQNNLMPVRYSYSDIRKITRGFKDELGKGGFGTVYKGKLRSGRFAAIKLLGKSKANG  361

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHH NVV+L+G+CA+G +RALVY+++PN SL+ ++FS E  +++LSW+
Sbjct  362   QDFINEVATIGRIHHTNVVQLIGFCAEGSKRALVYDFMPNGSLDSHLFSQEG-SISLSWQ  420

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +I+LG+A GI+YLH GCD QILHFDIKP NILLD N  PK+ DFGLA+L     S  
Sbjct  421   KLHQISLGVACGIDYLHLGCDMQILHFDIKPHNILLDENFTPKVSDFGLARLYPTNGSIT  480

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  +N G+VS+K+DVYSFGMLLLEM G RKN NA    ++SQ   
Sbjct  481   SLTAARGTIGYMAPELFYKNIGRVSYKADVYSFGMLLLEMAGKRKNLNAL-AENSSQIY-  538

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              +P WV++ ++ G  ++I     +++  I KK+ ++ LWCIQ +P+DRP+MK VV+MLE 
Sbjct  539   -WPYWVHDQVSDGKAVEIGDDATEEESKIVKKMIVVGLWCIQMKPMDRPTMKNVVEMLEG  597

Query  1547  EGDDLVLPSSP  1515
             + ++L LP  P
Sbjct  598   DLENLQLPPKP  608



>ref|XP_008347622.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Malus 
domestica]
Length=604

 Score =   435 bits (1119),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 262/314 (83%), Gaps = 4/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FLE+YRA+RPTRYS+ADIK+ITN+  ++LG+G +G V+KG++SSEI VAVK+LN+SKGNG
Sbjct  270   FLENYRALRPTRYSYADIKRITNKFRDKLGQGTFGTVFKGKLSSEIFVAVKMLNNSKGNG  329

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEFINEVG +G+IHH+NVVRLVGYCADGFRRALVYE+ PN SL+ +I S +SKN  L W+
Sbjct  330   EEFINEVGTLGRIHHINVVRLVGYCADGFRRALVYEFAPNGSLQNFISSADSKNHFLGWE  389

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q I L IAKGIEYLH GCDQ+ILHFDIKP N+LLD N NPKI DFGLAKLCSK++SAV
Sbjct  390   KLQHITLSIAKGIEYLHHGCDQRILHFDIKPHNVLLDDNFNPKISDFGLAKLCSKDQSAV  449

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             +MT ARGTMGYIAPEV SRNFG VS+KSDVYSFGMLLLEMV GRKN      T+ +  + 
Sbjct  450   SMTTARGTMGYIAPEVFSRNFGTVSYKSDVYSFGMLLLEMVAGRKNVQV---TEENTGQV  506

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEWVYN L +G +++I +E ++D  IA KLAI+ LWCIQW PVDRPSMKAVVQMLE E
Sbjct  507   YFPEWVYNLLEQGDDIRIHVEGENDAKIATKLAIVGLWCIQWYPVDRPSMKAVVQMLEGE  566

Query  1544  GDDLVLPSSPFAGS  1503
              D++ LP +PF+ +
Sbjct  567   -DNVKLPPNPFSSA  579


 Score =   354 bits (908),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 228/313 (73%), Gaps = 3/313 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IE FL     L P RYSY  IK +T  F++KLG+G FG+V+KGKL S   VAVK+++  K
Sbjct  267   IEEFLENYRALRPTRYSYADIKRITNKFRDKLGQGTFGTVFKGKLSSEIFVAVKMLNNSK  326

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQG-AYASLL  527
              NG++FINEVG++GRIHH+N+VRLVGYCA+  + ALVY+F PNGSL  +I+   +    L
Sbjct  327   GNGEEFINEVGTLGRIHHINVVRLVGYCADGFRRALVYEFAPNGSLQNFISSADSKNHFL  386

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++   I + +A+GIEYLH GCD +ILHFDIKPHN+LLD+NF PKISDFGLAKL   D+
Sbjct  387   GWEKLQHITLSIAKGIEYLHHGCDQRILHFDIKPHNVLLDDNFNPKISDFGLAKLCSKDQ  446

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEML-GLNRTPVTEQDESSK  884
             S V++T ARGT+GY+APE+ +R  G +S+K+DVYSFGMLL+EM+ G     VTE++    
Sbjct  447   SAVSMTTARGTMGYIAPEVFSRNFGTVSYKSDVYSFGMLLLEMVAGRKNVQVTEENTGQV  506

Query  885   YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGD  1064
             YFP W+YN + +G  I +  E E++ +I  K+ IVGLWCIQ  P+ RPSM  VV+MLEG+
Sbjct  507   YFPEWVYNLLEQGDDIRIHVEGENDAKIATKLAIVGLWCIQWYPVDRPSMKAVVQMLEGE  566

Query  1065  VELLQMPTDTFLS  1103
              + +++P + F S
Sbjct  567   -DNVKLPPNPFSS  578



>emb|CDP12527.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   432 bits (1112),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/325 (63%), Positives = 259/325 (80%), Gaps = 3/325 (1%)
 Frame = +3

Query  120   VFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKG  299
              FL+ ++ RRHLS ++ IE+FL  ++ L PIRYSY+ I+ MTK FKEKLGEGG+G VYKG
Sbjct  163   AFLLYRWHRRHLSRYDTIEDFLQTNSRLMPIRYSYREIRTMTKNFKEKLGEGGYGMVYKG  222

Query  300   KLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPN  479
             KLRSG  VAVK+++K K+NGQ+FINEV ++GRIHHVN+VRLVG+C   SKHALVYD+MPN
Sbjct  223   KLRSGDAVAVKMLNKSKANGQEFINEVATIGRIHHVNVVRLVGFCVTASKHALVYDYMPN  282

Query  480   GSLDKYI-NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENF  656
             GSLDK I +    +S LNW++  EI  GVARGIEYLH+GCD+QILHFDIKPHN+LLDENF
Sbjct  283   GSLDKLIFSDCQNSSPLNWKQICEIAKGVARGIEYLHQGCDMQILHFDIKPHNVLLDENF  342

Query  657   IPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEM  836
             +PK+SDFGLAKL+P  KSI TLTA RGT+GY+APEL  +RIG +S+KADVYS+GMLLMEM
Sbjct  343   VPKVSDFGLAKLYPMQKSIATLTAVRGTLGYMAPELFYKRIGRVSYKADVYSYGMLLMEM  402

Query  837   LGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEE-DEDEKRITKKMTIVGLWCIQM  1010
              G  R      + SS+ YFPSWIY+  ++ + +E+G+   E+EK IT+K+ ++ LWCIQM
Sbjct  403   AGRRRNVDAHAEHSSQIYFPSWIYDKFDQVEEMEIGDHATEEEKTITQKLILIALWCIQM  462

Query  1011  SPIPRPSMSRVVEMLEGDVELLQMP  1085
             +P  RPSM  V+EMLEGD   L++P
Sbjct  463   TPEDRPSMREVLEMLEGDASGLKLP  487


 Score =   333 bits (854),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 169/311 (54%), Positives = 224/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS+ +I+ +T    E+LGEGGYG+VYKG++ S   VAVK+LN SK NG
Sbjct  183   FLQTNSRLMPIRYSYREIRTMTKNFKEKLGEGGYGMVYKGKLRSGDAVAVKMLNKSKANG  242

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVVRLVG+C    + ALVY+Y+PN SL+K IFS    +  L+WK
Sbjct  243   QEFINEVATIGRIHHVNVVRLVGFCVTASKHALVYDYMPNGSLDKLIFSDCQNSSPLNWK  302

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +I EIA G+A+GIEYLHQGCD QILHFDIKP N+LLD N  PK+ DFGLAKL   +KS  
Sbjct  303   QICEIAKGVARGIEYLHQGCDMQILHFDIKPHNVLLDENFVPKVSDFGLAKLYPMQKSIA  362

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+  +  G+VS+K+DVYS+GMLL+EM G R+N +A     +SQ   
Sbjct  363   TLTAVRGTLGYMAPELFYKRIGRVSYKADVYSYGMLLMEMAGRRRNVDA-HAEHSSQI--  419

Query  1724  SFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
              FP W+Y+  ++  E++I     ++++ I +KL +IALWCIQ  P DRPSM+ V++MLE 
Sbjct  420   YFPSWIYDKFDQVEEMEIGDHATEEEKTITQKLILIALWCIQMTPEDRPSMREVLEMLEG  479

Query  1547  EGDDLVLPSSP  1515
             +   L LP  P
Sbjct  480   DASGLKLPPKP  490



>gb|KCW58952.1| hypothetical protein EUGRSUZ_H01578 [Eucalyptus grandis]
Length=457

 Score =   430 bits (1105),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 260/332 (78%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++ LI K+ RRH +    IE FL A NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  80    PCVLILLIFKWMRRHQATDANIEEFLQAHNNFLPIRYSYSDIKRITKNFKCKLGEGGYGS  139

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSG++VAVK+++K KS+GQDFI+EV ++GRIHHVN+V+LVG+C + SK ALVYD
Sbjct  140   VYKGILRSGNEVAVKVLTKSKSDGQDFISEVATIGRIHHVNVVQLVGFCFDYSKQALVYD  199

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I+       L++++ +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  200   FMPNGSLDKHISYKDGDDPLDYKKMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  259

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
              +F PK+SDFGLA+L+PTD+SIV+LTAARGT+GY+APEL  + IG IS+KADVYSFGMLL
Sbjct  260   RSFTPKVSDFGLARLYPTDRSIVSLTAARGTLGYMAPELFYKDIGGISYKADVYSFGMLL  319

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R    + + SS+ YFP W+Y+ + K K +E  +  E+E+  T+KM IV LWCI
Sbjct  320   MEMAGRRRNINAQAERSSQIYFPLWVYDQLAKEKELERVDVIEEERETTRKMIIVALWCI  379

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+SP  RPSM +V++MLEGD+  LQ+P    L
Sbjct  380   QLSPNNRPSMRKVLDMLEGDMNKLQLPPKPLL  411


 Score =   318 bits (814),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +    P RYS++DIK+IT     +LGEGGYG VYKG + S   VAVKVL  SK +G
Sbjct  104   FLQAHNNFLPIRYSYSDIKRITKNFKCKLGEGGYGSVYKGILRSGNEVAVKVLTKSKSDG  163

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG+IHHVNVV+LVG+C D  ++ALVY+++PN SL+K+I S +  +  L +K
Sbjct  164   QDFISEVATIGRIHHVNVVQLVGFCFDYSKQALVYDFMPNGSLDKHI-SYKDGDDPLDYK  222

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLA+L   ++S V
Sbjct  223   KMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLDRSFTPKVSDFGLARLYPTDRSIV  282

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  ++ G +S+K+DVYSFGMLL+EM G R+N NA +   +SQ   
Sbjct  283   SLTAARGTLGYMAPELFYKDIGGISYKADVYSFGMLLMEMAGRRRNINA-QAERSSQI--  339

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L +  EL+     +++    +K+ I+ALWCIQ  P +RPSM+ V+ MLE +
Sbjct  340   YFPLWVYDQLAKEKELERVDVIEEERETTRKMIIVALWCIQLSPNNRPSMRKVLDMLEGD  399

Query  1544  GDDLVLPSSPF  1512
              + L LP  P 
Sbjct  400   MNKLQLPPKPL  410



>ref|XP_010026268.1| PREDICTED: probable receptor-like protein kinase At5g39030 [Eucalyptus 
grandis]
Length=575

 Score =   434 bits (1116),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 260/332 (78%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FLI+K+ RRH +    IE FL A NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  198   PCVLIFLILKWMRRHQATDANIEEFLQAHNNFLPIRYSYSDIKRITKNFKCKLGEGGYGS  257

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VY+G LRSG++VAVKI++KPK NGQDFI+EV ++G IHHVN+V+LVG+C E SK ALVYD
Sbjct  258   VYRGILRSGNEVAVKILNKPKCNGQDFISEVATIGMIHHVNVVQLVGFCFEYSKQALVYD  317

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I+       L++++ +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  318   FMPNGSLDKHISYKDGDDPLDYKKMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  377

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ++F PK+SDFGLA+L+PTD+SIV+LTAARGT+GY+APEL  + IG IS+ ADVYSFGMLL
Sbjct  378   QSFTPKVSDFGLARLYPTDRSIVSLTAARGTLGYMAPELFYKDIGGISYNADVYSFGMLL  437

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      + SS+ YFP W+Y+ + K   +EM +  E+E+  T+KM I+ LWCI
Sbjct  438   MEMAGRRRNLNAHAEHSSQIYFPLWVYDQLGKENELEMVDVIEEERETTRKMIIIALWCI  497

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+SP  RPSM +V+ MLEGD++ LQ+P    L
Sbjct  498   QLSPNDRPSMRKVLNMLEGDMDKLQLPAKPLL  529


 Score =   320 bits (819),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 224/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +    P RYS++DIK+IT     +LGEGGYG VY+G + S   VAVK+LN  K NG
Sbjct  222   FLQAHNNFLPIRYSYSDIKRITKNFKCKLGEGGYGSVYRGILRSGNEVAVKILNKPKCNG  281

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG IHHVNVV+LVG+C +  ++ALVY+++PN SL+K+I S +  +  L +K
Sbjct  282   QDFISEVATIGMIHHVNVVQLVGFCFEYSKQALVYDFMPNGSLDKHI-SYKDGDDPLDYK  340

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLA+L   ++S V
Sbjct  341   KMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLDQSFTPKVSDFGLARLYPTDRSIV  400

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  ++ G +S+ +DVYSFGMLL+EM G R+N NA     +SQ   
Sbjct  401   SLTAARGTLGYMAPELFYKDIGGISYNADVYSFGMLLMEMAGRRRNLNA-HAEHSSQI--  457

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L +  EL++    +++    +K+ IIALWCIQ  P DRPSM+ V+ MLE +
Sbjct  458   YFPLWVYDQLGKENELEMVDVIEEERETTRKMIIIALWCIQLSPNDRPSMRKVLNMLEGD  517

Query  1544  GDDLVLPSSPF  1512
              D L LP+ P 
Sbjct  518   MDKLQLPAKPL  528



>ref|XP_008232089.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Prunus 
mume]
Length=385

 Score =   427 bits (1098),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 214/339 (63%), Positives = 259/339 (76%), Gaps = 1/339 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC IVF+I K+RRRHLS +  IE+FL +D+N  PIRYSY  IK MT  FK+KLGEGG+GS
Sbjct  24    PCLIVFVIYKWRRRHLSSYSIIEDFLQSDSNFLPIRYSYSEIKKMTSKFKKKLGEGGYGS  83

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             V+KGKLRSG  VA+K++ K K NGQDF +EV ++GRIHHVN+V+LVGYC E    ALVYD
Sbjct  84    VFKGKLRSGRFVAIKLLGKAKGNGQDFTSEVATIGRIHHVNVVQLVGYCVEGLNRALVYD  143

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDKYI     +  L+  + +EI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  144   FMPNGSLDKYIYSKEESMPLSCMKMYEISLGVARGIEYLHRGCDMQILHFDIKPHNILLD  203

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ENF PKISDFGLAKL+P D SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  204   ENFNPKISDFGLAKLYPIDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLL  263

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM    +   T  + S++ YFP W Y+  NKG  +EM + +E+EK++ KKM I  LWCI
Sbjct  264   MEMASRRKNWSTMVEHSNQIYFPLWAYDQYNKGNDLEMRDVNEEEKKVIKKMVITALWCI  323

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEPIMEV  1121
             QM P  RPSM++V+EML GD E L+MP   FL    M V
Sbjct  324   QMKPSDRPSMNKVIEMLGGDGESLKMPLRPFLYPQEMHV  362


 Score =   330 bits (846),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 172/315 (55%), Positives = 234/315 (74%), Gaps = 4/315 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+      P RYS+++IKK+T++  ++LGEGGYG V+KG++ S   VA+K+L  +KGNG
Sbjct  48    FLQSDSNFLPIRYSYSEIKKMTSKFKKKLGEGGYGSVFKGKLRSGRFVAIKLLGKAKGNG  107

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++F +EV  IG+IHHVNVV+LVGYC +G  RALVY+++PN SL+KYI+S E +++ LS  
Sbjct  108   QDFTSEVATIGRIHHVNVVQLVGYCVEGLNRALVYDFMPNGSLDKYIYSKE-ESMPLSCM  166

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LG+A+GIEYLH+GCD QILHFDIKP NILLD N NPKI DFGLAKL   + S V
Sbjct  167   KMYEISLGVARGIEYLHRGCDMQILHFDIKPHNILLDENFNPKISDFGLAKLYPIDNSIV  226

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGTMGYIAPE+  +N G VS+K+DVYSFGMLL+EM   RKN++     + S Q  
Sbjct  227   SLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMASRRKNWSTM--VEHSNQI-  283

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W Y+  N+G +L++R   ++++ + KK+ I ALWCIQ +P DRPSM  V++ML  +
Sbjct  284   YFPLWAYDQYNKGNDLEMRDVNEEEKKVIKKMVITALWCIQMKPSDRPSMNKVIEMLGGD  343

Query  1544  GDDLVLPSSPFAGSQ  1500
             G+ L +P  PF   Q
Sbjct  344   GESLKMPLRPFLYPQ  358



>gb|KCW46535.1| hypothetical protein EUGRSUZ_K00368 [Eucalyptus grandis]
Length=373

 Score =   426 bits (1096),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 200/335 (60%), Positives = 262/335 (78%), Gaps = 1/335 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P   +FLI  YRRRHL+  + IE FL A NN  PIRYSY +IK +T+ FK KLGEGG+GS
Sbjct  2     PFVAIFLIYNYRRRHLANDKDIEEFLQAHNNFLPIRYSYSNIKKITRNFKHKLGEGGYGS  61

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSG++VA+KI+ + K++G DFI+EV ++GRIHHVN+V+L+G+C E SK ALVYD
Sbjct  62    VYKGMLRSGNEVAIKILKQSKAHGHDFISEVATIGRIHHVNVVQLIGFCFEGSKQALVYD  121

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
              M NGSLDK+I      S L++++ +EI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  122   LMSNGSLDKHIFIDKGDSFLDYRKIYEIALGVARGIEYLHRGCDMQILHFDIKPHNILLD  181

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PK+SDFGLA+L+PTD SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  182   KNFTPKVSDFGLARLYPTDHSIVSLTAARGTLGYMAPELFYKSIGGVSYKADVYSFGMLL  241

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM    +      + SS+ YFP W+Y+ +N+G+++EM    E+E+++ KKM IV LWCI
Sbjct  242   MEMASRRKNINANAECSSQIYFPLWMYDQVNEGESVEMEAFVEEERKLIKKMIIVALWCI  301

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLSEP  1109
             Q++P  RP M++V+EMLEGD++ L+MP    +  P
Sbjct  302   QLNPNHRPPMNKVLEMLEGDIDELEMPPKPLIYPP  336


 Score =   315 bits (808),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 160/311 (51%), Positives = 221/311 (71%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +    P RYS+++IKKIT     +LGEGGYG VYKG + S   VA+K+L  SK +G
Sbjct  26    FLQAHNNFLPIRYSYSNIKKITRNFKHKLGEGGYGSVYKGMLRSGNEVAIKILKQSKAHG  85

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
              +FI+EV  IG+IHHVNVV+L+G+C +G ++ALVY+ + N SL+K+IF  +  +  L ++
Sbjct  86    HDFISEVATIGRIHHVNVVQLIGFCFEGSKQALVYDLMSNGSLDKHIF-IDKGDSFLDYR  144

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             KI EIALG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+L   + S V
Sbjct  145   KIYEIALGVARGIEYLHRGCDMQILHFDIKPHNILLDKNFTPKVSDFGLARLYPTDHSIV  204

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  ++ G VS+K+DVYSFGMLL+EM   RKN NA    + S Q  
Sbjct  205   SLTAARGTLGYMAPELFYKSIGGVSYKADVYSFGMLLMEMASRRKNINA--NAECSSQI-  261

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+ +N G  +++    +++  + KK+ I+ALWCIQ  P  RP M  V++MLE +
Sbjct  262   YFPLWMYDQVNEGESVEMEAFVEEERKLIKKMIIVALWCIQLNPNHRPPMNKVLEMLEGD  321

Query  1544  GDDLVLPSSPF  1512
              D+L +P  P 
Sbjct  322   IDELEMPPKPL  332



>gb|KDP42829.1| hypothetical protein JCGZ_23771 [Jatropha curcas]
Length=532

 Score =   432 bits (1111),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 219/315 (70%), Positives = 261/315 (83%), Gaps = 6/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DY+A +PTRYS+ADIK+ITNQ  E LGEG YG V++G++S EI VAVKVLN+ KG+G
Sbjct  200   FLDDYKAFKPTRYSYADIKRITNQFKEELGEGAYGTVFRGKLSDEITVAVKVLNNFKGDG  259

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEVG IGKIHHVNVVRLVG+CADGFRRALVYEYLPN+SL+K+I S + KN  L WK
Sbjct  260   EEFVNEVGTIGKIHHVNVVRLVGFCADGFRRALVYEYLPNDSLDKFISSPDDKNHFLGWK  319

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+Q+IALGIA+GIEYLHQGC+Q+ILHFDIKP NILLD+N NPK+ DFGLAKLCSK++S V
Sbjct  320   KLQDIALGIARGIEYLHQGCNQRILHFDIKPHNILLDNNFNPKVSDFGLAKLCSKDQSTV  379

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
              MT ARGT+GYIAPEV SRNFG VS+KSDVYSFGML+LEMV GRK     EG D    + 
Sbjct  380   PMTTARGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVAGRKVI--AEGND---DQI  434

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FPEW+YN L  G +L+   EE++D  IAKKLAI+ LWCIQW PVDRPSMK VVQMLE  
Sbjct  435   YFPEWIYNLLEEGEDLRFEFEEEEDANIAKKLAIVGLWCIQWNPVDRPSMKIVVQMLEG-  493

Query  1544  GDDLVLPSSPFAGSQ  1500
             GD+L +P +PF+ ++
Sbjct  494   GDNLSIPPNPFSSTK  508


 Score =   348 bits (894),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/319 (52%), Positives = 232/319 (73%), Gaps = 3/319 (1%)
 Frame = +3

Query  171   IENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSDVAVKIMSKPK  350
             IENFL+      P RYSY  IK +T  FKE+LGEG +G+V++GKL     VAVK+++  K
Sbjct  197   IENFLDDYKAFKPTRYSYADIKRITNQFKEELGEGAYGTVFRGKLSDEITVAVKVLNNFK  256

Query  351   SNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYINQGAYAS-LL  527
              +G++F+NEVG++G+IHHVN+VRLVG+CA+  + ALVY+++PN SLDK+I+     +  L
Sbjct  257   GDGEEFVNEVGTIGKIHHVNVVRLVGFCADGFRRALVYEYLPNDSLDKFISSPDDKNHFL  316

Query  528   NWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISDFGLAKLFPTDK  707
              W++  +I +G+ARGIEYLH+GC+ +ILHFDIKPHNILLD NF PK+SDFGLAKL   D+
Sbjct  317   GWKKLQDIALGIARGIEYLHQGCNQRILHFDIKPHNILLDNNFNPKVSDFGLAKLCSKDQ  376

Query  708   SIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLGLNRTPVTEQDESSKY  887
             S V +T ARGT+GY+APE+ +R  G +S+K+DVYSFGML++EM+   R  + E ++   Y
Sbjct  377   STVPMTTARGTVGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVA-GRKVIAEGNDDQIY  435

Query  888   FPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRPSMSRVVEMLEGDV  1067
             FP WIYN + +G+ +    E+E++  I KK+ IVGLWCIQ +P+ RPSM  VV+MLEG  
Sbjct  436   FPEWIYNLLEEGEDLRFEFEEEEDANIAKKLAIVGLWCIQWNPVDRPSMKIVVQMLEGG-  494

Query  1068  ELLQMPTDTFLSEPIMEVH  1124
             + L +P + F S   M  +
Sbjct  495   DNLSIPPNPFSSTKPMRTY  513



>ref|XP_010662816.1| PREDICTED: cysteine-rich receptor-like protein kinase 37 [Vitis 
vinifera]
Length=719

 Score =   439 bits (1128),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 209/338 (62%), Positives = 265/338 (78%), Gaps = 3/338 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C   +LI K+ RRHLS+ + IE FL +  NL PI+YSY  IK MT  F  KLG+GGFGSV
Sbjct  355   CLFAYLIYKFHRRHLSLDDSIEEFLRSQKNLQPIKYSYSDIKKMTHNFANKLGQGGFGSV  414

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKLRSG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRLVG+C + SK AL+YDF
Sbjct  415   YKGKLRSGRIVAVKVLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCVQGSKWALIYDF  474

Query  471   MPNGSLDKYIN-QGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             MPNGSLDK+I  +    + L+W+R +++ +GV RGIEYLH+GCD+QILHFDIKPHNILLD
Sbjct  475   MPNGSLDKFIFLKEENNTFLSWERLYKVALGVGRGIEYLHQGCDMQILHFDIKPHNILLD  534

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             E+F PK+SDFGLAKL+ TD+S+V+LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  535   EDFTPKVSDFGLAKLYSTDESMVSLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLL  594

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM+G  +        SS+ YFPSWIY+  ++G  I++G+  EDEK++ +KM IV LWCI
Sbjct  595   MEMVGRRKNVNANAAHSSQIYFPSWIYDRYDQGDNIDLGDATEDEKKLVRKMVIVALWCI  654

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTD-TFLSEPIM  1115
             QM PI RPSMS+ +EMLEG+VELL+MP   T  SE ++
Sbjct  655   QMKPIDRPSMSKALEMLEGEVELLEMPPKPTLYSEEML  692


 Score =   344 bits (882),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/310 (54%), Positives = 232/310 (75%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL   + ++P +YS++DIKK+T+  + +LG+GG+G VYKG++ S  +VAVKVL  SK NG
Sbjct  378   FLRSQKNLQPIKYSYSDIKKMTHNFANKLGQGGFGSVYKGKLRSGRIVAVKVLVMSKANG  437

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+C  G + AL+Y+++PN SL+K+IF  E  N  LSW+
Sbjct  438   QDFINEVATIGRIHHVNVVRLVGFCVQGSKWALIYDFMPNGSLDKFIFLKEENNTFLSWE  497

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ ++ALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S ++S V
Sbjct  498   RLYKVALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTDESMV  557

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS+K+DVYSFGMLL+EMVG RKN NA     +   + 
Sbjct  558   SLTAARGTLGYIAPELFYKNIGGVSYKADVYSFGMLLMEMVGRRKNVNANAAHSS---QI  614

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+  ++G  + +    +D++ + +K+ I+ALWCIQ +P+DRPSM   ++MLE E
Sbjct  615   YFPSWIYDRYDQGDNIDLGDATEDEKKLVRKMVIVALWCIQMKPIDRPSMSKALEMLEGE  674

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  675   VELLEMPPKP  684



>ref|XP_007206753.1| hypothetical protein PRUPE_ppa025186mg, partial [Prunus persica]
 gb|EMJ07952.1| hypothetical protein PRUPE_ppa025186mg, partial [Prunus persica]
Length=612

 Score =   435 bits (1118),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 210/337 (62%), Positives = 262/337 (78%), Gaps = 6/337 (2%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P     LI K+RRRHLS++E IE+FL ++NNL PIRYSY  IK M + FK+KLGEGG+GS
Sbjct  266   PFVTALLIYKWRRRHLSMYENIEDFLQSNNNLMPIRYSYSDIKKMARGFKDKLGEGGYGS  325

Query  288   VYKGKLRSGSDVAVKIMSKPKSN-GQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
             VYK KLRSG  VA+K++ K K+N GQDFINEV ++GRI HVN+VRL+G+C E SK AL+Y
Sbjct  326   VYKAKLRSGHLVAIKMLGKSKTNNGQDFINEVATIGRIRHVNVVRLIGFCVEGSKRALLY  385

Query  465   DFMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             DFM NGSL+KYI        L+  + FEI +GVARGI+YLH+GCD+QILHFDIKPHNILL
Sbjct  386   DFMSNGSLEKYIFSQQGDVSLSCHKIFEIALGVARGIDYLHQGCDMQILHFDIKPHNILL  445

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             +ENF PK+SDFGLAKL+P D SIV+LTAARGT+GY+APEL  + IG +S+KADVYSFGML
Sbjct  446   NENFTPKVSDFGLAKLYPLDNSIVSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGML  505

Query  825   LMEMLGLNRTPVTEQDESSK----YFPSWIYNDINKGKAIEMGEEDED-EKRITKKMTIV  989
             LMEM G  +      ++SS+    YFP+W+ + +  GK IE+G++  D EK+I KKM +V
Sbjct  506   LMEMAGRRKNLNAGIEQSSQFSQIYFPTWVSDQLKAGKDIEIGDDATDEEKKIIKKMMMV  565

Query  990   GLWCIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
              LWCIQM PI RPSM++VVEMLEG++E LQMP   FL
Sbjct  566   ALWCIQMKPIERPSMNKVVEMLEGEIETLQMPPRPFL  602


 Score =   334 bits (857),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 230/317 (73%), Gaps = 3/317 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSK-GN  2268
             FL+    + P RYS++DIKK+     ++LGEGGYG VYK ++ S  LVA+K+L  SK  N
Sbjct  290   FLQSNNNLMPIRYSYSDIKKMARGFKDKLGEGGYGSVYKAKLRSGHLVAIKMLGKSKTNN  349

Query  2267  GEEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSW  2088
             G++FINEV  IG+I HVNVVRL+G+C +G +RAL+Y+++ N SLEKYIFS +  +V+LS 
Sbjct  350   GQDFINEVATIGRIRHVNVVRLIGFCVEGSKRALLYDFMSNGSLEKYIFSQQG-DVSLSC  408

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
              KI EIALG+A+GI+YLHQGCD QILHFDIKP NILL+ N  PK+ DFGLAKL   + S 
Sbjct  409   HKIFEIALGVARGIDYLHQGCDMQILHFDIKPHNILLNENFTPKVSDFGLAKLYPLDNSI  468

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             V++TAARGTMGYIAPE+  +N G VS+K+DVYSFGMLL+EM G RKN NA     +   +
Sbjct  469   VSLTAARGTMGYIAPELFYKNIGGVSYKADVYSFGMLLMEMAGRRKNLNAGIEQSSQFSQ  528

Query  1727  GSFPEWVYNHLNRGGELQI-RieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLE  1551
               FP WV + L  G +++I     D+++ I KK+ ++ALWCIQ +P++RPSM  VV+MLE
Sbjct  529   IYFPTWVSDQLKAGKDIEIGDDATDEEKKIIKKMMMVALWCIQMKPIERPSMNKVVEMLE  588

Query  1550  REGDDLVLPSSPFAGSQ  1500
              E + L +P  PF   Q
Sbjct  589   GEIETLQMPPRPFLYPQ  605



>ref|XP_002323918.2| hypothetical protein POPTR_0017s04200g [Populus trichocarpa]
 gb|EEF04051.2| hypothetical protein POPTR_0017s04200g [Populus trichocarpa]
Length=641

 Score =   436 bits (1121),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 210/335 (63%), Positives = 263/335 (79%), Gaps = 3/335 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNA-DNNLFPIRYSYKHIKNMTKAFKEKLGEGGFG  284
             PC +  LI K+RRRHLS++E IE FL + DN+L PIRY+Y  IK +T  FK+KLGEGGFG
Sbjct  275   PCLLTLLIYKWRRRHLSIYEDIEKFLQSHDNDLMPIRYTYLEIKKITNGFKDKLGEGGFG  334

Query  285   SVYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVY  464
             SVYKGKLRSG   AVK++ K K+NGQDFINEV ++GRIHHVN+V+L+GY  E SK AL+Y
Sbjct  335   SVYKGKLRSGRFAAVKLLGKSKANGQDFINEVATIGRIHHVNVVQLIGYTVEGSKRALIY  394

Query  465   DFMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             +FMPNGSL+KYI     +  L+ ++ +EI + VARGIEYLH+GCD+QILHFDIKPHNILL
Sbjct  395   EFMPNGSLEKYIFSREGSVPLSNEKMYEISLRVARGIEYLHQGCDMQILHFDIKPHNILL  454

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DE F+PKISDFGLAKL+PT  + V LTAARGTIGY+APEL  + IG +S+KADVYS+GML
Sbjct  455   DEKFVPKISDFGLAKLYPTSNNTVPLTAARGTIGYMAPELFYKNIGGVSYKADVYSYGML  514

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEED-EDEKRITKKMTIVGLW  998
             LMEM+G  +      + SS+ YFPSW+Y+ +++GK IE+ E+  E EK+ TKKM IV LW
Sbjct  515   LMEMIGKRKNLNAFANHSSQIYFPSWVYDQVSEGKDIEVQEDAMEHEKKTTKKMIIVALW  574

Query  999   CIQMSPIPRPSMSRVVEMLEGDVELLQMPTDTFLS  1103
             CIQ+ P+ RPSM +V+EMLE DVE LQMP   F +
Sbjct  575   CIQLKPVDRPSMHKVIEMLESDVESLQMPPKPFFT  609


 Score =   332 bits (851),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 167/305 (55%), Positives = 225/305 (74%), Gaps = 5/305 (2%)
 Frame = -1

Query  2423  VRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNGEEFINEV  2244
             + P RY++ +IKKITN   ++LGEGG+G VYKG++ S    AVK+L  SK NG++FINEV
Sbjct  307   LMPIRYTYLEIKKITNGFKDKLGEGGFGSVYKGKLRSGRFAAVKLLGKSKANGQDFINEV  366

Query  2243  GIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWKKIQEIAL  2064
               IG+IHHVNVV+L+GY  +G +RAL+YE++PN SLEKYIFS E  +V LS +K+ EI+L
Sbjct  367   ATIGRIHHVNVVQLIGYTVEGSKRALIYEFMPNGSLEKYIFSREG-SVPLSNEKMYEISL  425

Query  2063  GIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAVTMTAARG  1884
              +A+GIEYLHQGCD QILHFDIKP NILLD    PKI DFGLAKL     + V +TAARG
Sbjct  426   RVARGIEYLHQGCDMQILHFDIKPHNILLDEKFVPKISDFGLAKLYPTSNNTVPLTAARG  485

Query  1883  TMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEGSFPEWVY  1704
             T+GY+APE+  +N G VS+K+DVYS+GMLL+EM+G RKN NA     +   +  FP WVY
Sbjct  486   TIGYMAPELFYKNIGGVSYKADVYSYGMLLMEMIGKRKNLNAFANHSS---QIYFPSWVY  542

Query  1703  NHLNRGGELQIRi-eedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLEREGDDLVL  1527
             + ++ G +++++    + ++   KK+ I+ALWCIQ +PVDRPSM  V++MLE + + L +
Sbjct  543   DQVSEGKDIEVQEDAMEHEKKTTKKMIIVALWCIQLKPVDRPSMHKVIEMLESDVESLQM  602

Query  1526  PSSPF  1512
             P  PF
Sbjct  603   PPKPF  607



>gb|KDP42825.1| hypothetical protein JCGZ_23767 [Jatropha curcas]
Length=617

 Score =   435 bits (1118),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 215/313 (69%), Positives = 261/313 (83%), Gaps = 3/313 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+DY++++PTRYS+ADIK++TNQ  E LG+G YG V+KG++S EILVAVK+LN+S GNG
Sbjct  280   FLDDYKSLKPTRYSYADIKRVTNQFKEELGQGAYGTVFKGKLSDEILVAVKLLNNSTGNG  339

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVA-LSW  2088
             EEF++EV  IGKIHHVNVVRL+G+CADGF RALVYEYLPN+SL+KYI S ++ N   L W
Sbjct  340   EEFVDEVATIGKIHHVNVVRLIGFCADGFIRALVYEYLPNDSLQKYITSADNSNKNFLGW  399

Query  2087  KKIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSA  1908
             K++Q+I LGIAKGIEYLHQGCDQ+ILHFDIKP NILLDH+ NPK+ DFGLAK C+K++SA
Sbjct  400   KRLQDITLGIAKGIEYLHQGCDQRILHFDIKPHNILLDHDFNPKVSDFGLAKFCAKDQSA  459

Query  1907  VTMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQE  1728
             V+MT ARGT+GYIAPEV SRNFG VS+KSDVYSFGML+LEMVGGRKN  A E  D  Q  
Sbjct  460   VSMTTARGTIGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVGGRKNVEATEEGDDEQI-  518

Query  1727  GSFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLER  1548
               FPEW+YN L  G +L+  IEE+ D  IAKKLA++ LWCIQW PVDRPSMK VV MLE 
Sbjct  519   -YFPEWIYNLLEEGDDLRFEIEEEGDTKIAKKLAVVGLWCIQWNPVDRPSMKVVVHMLEG  577

Query  1547  EGDDLVLPSSPFA  1509
             EG++L +P +PF+
Sbjct  578   EGENLPVPPNPFS  590


 Score =   347 bits (890),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/325 (51%), Positives = 229/325 (70%), Gaps = 4/325 (1%)
 Frame = +3

Query  141   RRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVYKGKLRSGSD  320
             ++R       IE FL+   +L P RYSY  IK +T  FKE+LG+G +G+V+KGKL     
Sbjct  267   KKRDREYQSKIEKFLDDYKSLKPTRYSYADIKRVTNQFKEELGQGAYGTVFKGKLSDEIL  326

Query  321   VAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFMPNGSLDKYI  500
             VAVK+++    NG++F++EV ++G+IHHVN+VRL+G+CA+    ALVY+++PN SL KYI
Sbjct  327   VAVKLLNNSTGNGEEFVDEVATIGKIHHVNVVRLIGFCADGFIRALVYEYLPNDSLQKYI  386

Query  501   NQG--AYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDENFIPKISD  674
                  +  + L W+R  +I +G+A+GIEYLH+GCD +ILHFDIKPHNILLD +F PK+SD
Sbjct  387   TSADNSNKNFLGWKRLQDITLGIAKGIEYLHQGCDQRILHFDIKPHNILLDHDFNPKVSD  446

Query  675   FGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLMEMLG--LN  848
             FGLAK    D+S V++T ARGTIGY+APE+ +R  G +S+K+DVYSFGML++EM+G   N
Sbjct  447   FGLAKFCAKDQSAVSMTTARGTIGYIAPEVFSRNFGNVSYKSDVYSFGMLVLEMVGGRKN  506

Query  849   RTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQMSPIPRP  1028
                  E D+   YFP WIYN + +G  +    E+E + +I KK+ +VGLWCIQ +P+ RP
Sbjct  507   VEATEEGDDEQIYFPEWIYNLLEEGDDLRFEIEEEGDTKIAKKLAVVGLWCIQWNPVDRP  566

Query  1029  SMSRVVEMLEGDVELLQMPTDTFLS  1103
             SM  VV MLEG+ E L +P + F S
Sbjct  567   SMKVVVHMLEGEGENLPVPPNPFSS  591



>ref|XP_009370622.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Pyrus 
x bretschneideri]
Length=672

 Score =   437 bits (1123),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 210/341 (62%), Positives = 263/341 (77%), Gaps = 4/341 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC IV LI K++RRHLS++  IE FL + NNL PIRYSY  IK MT+ FK+KLGEGG+GS
Sbjct  300   PCVIVLLIYKWKRRHLSMYVLIEEFLQSHNNLTPIRYSYSDIKKMTRGFKDKLGEGGYGS  359

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG  VA+K++ K K+NGQDFINEVG++GRIHHVN+V+L+GYCAE SK ALVY+
Sbjct  360   VYKGKLRSGRFVAIKMLGKSKANGQDFINEVGTIGRIHHVNVVQLIGYCAEGSKRALVYE  419

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FM NGSLDK+I        L  +R FEI +GVARGI+YLH+GCD++ILHFDIKPHNILL+
Sbjct  420   FMSNGSLDKHIFPKEGLISLRCKRAFEISLGVARGIDYLHQGCDMKILHFDIKPHNILLN  479

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +N++PK+SDFGLA+L P D S +TLTAARGTIGY+APEL  + IG +S+KAD+YSFGMLL
Sbjct  480   DNYVPKVSDFGLARLCPADDSSLTLTAARGTIGYIAPELFYKNIGGVSNKADIYSFGMLL  539

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             ME+ G  +        S  YFPSW+Y+  ++G  IE     E+E  ITKKM IV LWCIQ
Sbjct  540   MEIAGKRKNLNVAAHSSQIYFPSWVYDQFSEGNDIESEGATEEENEITKKMLIVALWCIQ  599

Query  1008  MSPIPRP-SMSRVVEMLEGDVELLQMPTDTFL---SEPIME  1118
             M P  RP SM++VVEMLEG++E L+MP   FL    +P+++
Sbjct  600   MKPSDRPASMNKVVEMLEGEIECLEMPPKPFLYPQEKPVLD  640


 Score =   335 bits (859),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/316 (53%), Positives = 230/316 (73%), Gaps = 6/316 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  + P RYS++DIKK+T    ++LGEGGYG VYKG++ S   VA+K+L  SK NG
Sbjct  324   FLQSHNNLTPIRYSYSDIKKMTRGFKDKLGEGGYGSVYKGKLRSGRFVAIKMLGKSKANG  383

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEVG IG+IHHVNVV+L+GYCA+G +RALVYE++ N SL+K+IF  E   ++L  K
Sbjct  384   QDFINEVGTIGRIHHVNVVQLIGYCAEGSKRALVYEFMSNGSLDKHIFPKEGL-ISLRCK  442

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EI+LG+A+GI+YLHQGCD +ILHFDIKP NILL+ N  PK+ DFGLA+LC  + S++
Sbjct  443   RAFEISLGVARGIDYLHQGCDMKILHFDIKPHNILLNDNYVPKVSDFGLARLCPADDSSL  502

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TAARGT+GYIAPE+  +N G VS+K+D+YSFGMLL+E+ G RKN N          + 
Sbjct  503   TLTAARGTIGYIAPELFYKNIGGVSNKADIYSFGMLLMEIAGKRKNLNVA----AHSSQI  558

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRP-SMKAVVQMLER  1548
              FP WVY+  + G +++     +++  I KK+ I+ALWCIQ +P DRP SM  VV+MLE 
Sbjct  559   YFPSWVYDQFSEGNDIESEGATEEENEITKKMLIVALWCIQMKPSDRPASMNKVVEMLEG  618

Query  1547  EGDDLVLPSSPFAGSQ  1500
             E + L +P  PF   Q
Sbjct  619   EIECLEMPPKPFLYPQ  634



>ref|XP_002272131.3| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Vitis vinifera]
Length=667

 Score =   436 bits (1122),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 209/328 (64%), Positives = 264/328 (80%), Gaps = 4/328 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C +V+LI K+RRRHLS+ + IE FL++  NL PI+YSY  +K MT  FK KLG+GGFGSV
Sbjct  307   CLLVYLIYKFRRRHLSLDDGIEEFLHSHKNLQPIKYSYSELKKMTHNFKNKLGQGGFGSV  366

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             YKGKL+SG  VAVK++   K+NGQDFINEV ++GRIHHVN+VRLVG+C + SK ALVYDF
Sbjct  367   YKGKLQSGRIVAVKMLVMSKANGQDFINEVATIGRIHHVNVVRLVGFCIQRSKWALVYDF  426

Query  471   MPNGSLDKYI--NQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILL  644
             M NGSLDK++  +QG     LNW+R ++I +GV RGIEYLH+GCD+QILHFDIKPHNILL
Sbjct  427   MSNGSLDKFVFLDQGNNIP-LNWERLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILL  485

Query  645   DENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGML  824
             DE+F PK+SDFGLAKL+ T+ SIV++TAARGT+GY+APEL  + IG +S KADVYSFGML
Sbjct  486   DEDFTPKVSDFGLAKLYSTNDSIVSITAARGTLGYIAPELFYKNIGGVSFKADVYSFGML  545

Query  825   LMEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWC  1001
             L+EM+G  +   T  + SS+ YF SWIYN+ ++ + +EMG+  EDEKR  +KM IV LWC
Sbjct  546   LLEMVGKRKNVNTFAEHSSQMYFTSWIYNNYDQEEDMEMGDATEDEKRYVRKMVIVALWC  605

Query  1002  IQMSPIPRPSMSRVVEMLEGDVELLQMP  1085
             IQM P+ RPSMS+ +EMLEG+VELL+MP
Sbjct  606   IQMKPVDRPSMSQALEMLEGEVELLKMP  633


 Score =   327 bits (839),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 228/310 (74%), Gaps = 3/310 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL  ++ ++P +YS++++KK+T+    +LG+GG+G VYKG++ S  +VAVK+L  SK NG
Sbjct  330   FLHSHKNLQPIKYSYSELKKMTHNFKNKLGQGGFGSVYKGKLQSGRIVAVKMLVMSKANG  389

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVVRLVG+C    + ALVY+++ N SL+K++F  +  N+ L+W+
Sbjct  390   QDFINEVATIGRIHHVNVVRLVGFCIQRSKWALVYDFMSNGSLDKFVFLDQGNNIPLNWE  449

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             ++ +IALG+ +GIEYLHQGCD QILHFDIKP NILLD +  PK+ DFGLAKL S   S V
Sbjct  450   RLYKIALGVGRGIEYLHQGCDMQILHFDIKPHNILLDEDFTPKVSDFGLAKLYSTNDSIV  509

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+  +N G VS K+DVYSFGMLLLEMVG RKN N      +SQ   
Sbjct  510   SITAARGTLGYIAPELFYKNIGGVSFKADVYSFGMLLLEMVGKRKNVNTF-AEHSSQM--  566

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              F  W+YN+ ++  ++++    +D++   +K+ I+ALWCIQ +PVDRPSM   ++MLE E
Sbjct  567   YFTSWIYNNYDQEEDMEMGDATEDEKRYVRKMVIVALWCIQMKPVDRPSMSQALEMLEGE  626

Query  1544  GDDLVLPSSP  1515
              + L +P  P
Sbjct  627   VELLKMPPKP  636



>ref|XP_010026263.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Eucalyptus 
grandis]
Length=496

 Score =   431 bits (1107),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 204/332 (61%), Positives = 260/332 (78%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++ LI K+ RRH +    IE FL A NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  119   PCVLILLIFKWMRRHQATDANIEEFLQAHNNFLPIRYSYSDIKRITKNFKCKLGEGGYGS  178

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSG++VAVK+++K KS+GQDFI+EV ++GRIHHVN+V+LVG+C + SK ALVYD
Sbjct  179   VYKGILRSGNEVAVKVLTKSKSDGQDFISEVATIGRIHHVNVVQLVGFCFDYSKQALVYD  238

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I+       L++++ +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  239   FMPNGSLDKHISYKDGDDPLDYKKMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  298

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
              +F PK+SDFGLA+L+PTD+SIV+LTAARGT+GY+APEL  + IG IS+KADVYSFGMLL
Sbjct  299   RSFTPKVSDFGLARLYPTDRSIVSLTAARGTLGYMAPELFYKDIGGISYKADVYSFGMLL  358

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R    + + SS+ YFP W+Y+ + K K +E  +  E+E+  T+KM IV LWCI
Sbjct  359   MEMAGRRRNINAQAERSSQIYFPLWVYDQLAKEKELERVDVIEEERETTRKMIIVALWCI  418

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+SP  RPSM +V++MLEGD+  LQ+P    L
Sbjct  419   QLSPNNRPSMRKVLDMLEGDMNKLQLPPKPLL  450


 Score =   318 bits (814),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 225/311 (72%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +    P RYS++DIK+IT     +LGEGGYG VYKG + S   VAVKVL  SK +G
Sbjct  143   FLQAHNNFLPIRYSYSDIKRITKNFKCKLGEGGYGSVYKGILRSGNEVAVKVLTKSKSDG  202

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG+IHHVNVV+LVG+C D  ++ALVY+++PN SL+K+I S +  +  L +K
Sbjct  203   QDFISEVATIGRIHHVNVVQLVGFCFDYSKQALVYDFMPNGSLDKHI-SYKDGDDPLDYK  261

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLA+L   ++S V
Sbjct  262   KMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLDRSFTPKVSDFGLARLYPTDRSIV  321

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  ++ G +S+K+DVYSFGMLL+EM G R+N NA +   +SQ   
Sbjct  322   SLTAARGTLGYMAPELFYKDIGGISYKADVYSFGMLLMEMAGRRRNINA-QAERSSQI--  378

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L +  EL+     +++    +K+ I+ALWCIQ  P +RPSM+ V+ MLE +
Sbjct  379   YFPLWVYDQLAKEKELERVDVIEEERETTRKMIIVALWCIQLSPNNRPSMRKVLDMLEGD  438

Query  1544  GDDLVLPSSPF  1512
              + L LP  P 
Sbjct  439   MNKLQLPPKPL  449



>gb|KCW46515.1| hypothetical protein EUGRSUZ_K00342 [Eucalyptus grandis]
Length=444

 Score =   428 bits (1101),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 258/332 (78%), Gaps = 2/332 (1%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FL+ K+ RRH ++   IE FL A NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  68    PCVLIFLVYKWMRRHQAMDGKIEEFLQAHNNFLPIRYSYSDIKKITKNFKHKLGEGGYGS  127

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKG LRSG++VAVKI++KPKSNGQDFI+EV ++GRIHHVN+V LVG+C  NSK ALVYD
Sbjct  128   VYKGILRSGNEVAVKILNKPKSNGQDFISEVATIGRIHHVNVVELVGFCFNNSKQALVYD  187

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FM NGSLDK+I      + L++Q+ +EI +GVARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  188   FMSNGSLDKHIFSKDDDNSLDYQKIYEISLGVARGIEYLHRGCDMQILHFDIKPHNILLD  247

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PK+SDFGLA+L+P D SI++LTAARGT+GY+APEL  + IG +S+KADVYSFGMLL
Sbjct  248   KNFTPKVSDFGLARLYPMDHSIISLTAARGTLGYMAPELFYKDIGGVSYKADVYSFGMLL  307

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM    +      + SS+ YFP W+Y+ +++   IE+ EE E +  I +KM IV LWCI
Sbjct  308   MEMASRRKNAKANVERSSQIYFPLWVYDQLSRKNEIEI-EEVEWDMEIMRKMVIVALWCI  366

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+ P  RPSMSRV+ MLEGD++ LQ+P    L
Sbjct  367   QLIPNDRPSMSRVLNMLEGDIDKLQLPPKPLL  398


 Score =   323 bits (828),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 171/311 (55%), Positives = 224/311 (72%), Gaps = 5/311 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +    P RYS++DIKKIT     +LGEGGYG VYKG + S   VAVK+LN  K NG
Sbjct  92    FLQAHNNFLPIRYSYSDIKKITKNFKHKLGEGGYGSVYKGILRSGNEVAVKILNKPKSNG  151

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG+IHHVNVV LVG+C +  ++ALVY+++ N SL+K+IFS +  N +L ++
Sbjct  152   QDFISEVATIGRIHHVNVVELVGFCFNNSKQALVYDFMSNGSLDKHIFSKDDDN-SLDYQ  210

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             KI EI+LG+A+GIEYLH+GCD QILHFDIKP NILLD N  PK+ DFGLA+L   + S +
Sbjct  211   KIYEISLGVARGIEYLHRGCDMQILHFDIKPHNILLDKNFTPKVSDFGLARLYPMDHSII  270

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  ++ G VS+K+DVYSFGMLL+EM   RK  NAK   + S Q  
Sbjct  271   SLTAARGTLGYMAPELFYKDIGGVSYKADVYSFGMLLMEMASRRK--NAKANVERSSQI-  327

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L+R  E++I  E + D  I +K+ I+ALWCIQ  P DRPSM  V+ MLE +
Sbjct  328   YFPLWVYDQLSRKNEIEIE-EVEWDMEIMRKMVIVALWCIQLIPNDRPSMSRVLNMLEGD  386

Query  1544  GDDLVLPSSPF  1512
              D L LP  P 
Sbjct  387   IDKLQLPPKPL  397



>gb|EYU21049.1| hypothetical protein MIMGU_mgv1a017815mg [Erythranthe guttata]
Length=573

 Score =   432 bits (1112),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 261/314 (83%), Gaps = 3/314 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL DY+A++P+R+S++DIK+IT+Q +++LGEGGYGIVYKG++++EI+VAVKVLN+S GNG
Sbjct  244   FLRDYKALKPSRFSYSDIKRITHQFNDKLGEGGYGIVYKGKLNNEIVVAVKVLNNSNGNG  303

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             EEF+NEV  IG+IHHVN+VRL+G+CADGFRRALVYE+LPN SLEK IF   S  + L W+
Sbjct  304   EEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFLPNGSLEKSIFQAGSNRITLDWE  363

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+++IALGIAKGI+YLH+GCDQQILHFDIKP N+LLDHN NPKICDFGLAKLCSKE+SAV
Sbjct  364   KLKDIALGIAKGIKYLHEGCDQQILHFDIKPQNVLLDHNFNPKICDFGLAKLCSKEQSAV  423

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             TMTAARGTMGYIAPEV+SR FG+VS+KSDVYSFGMLLLEMVGGRKN   ++    +    
Sbjct  424   TMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLLEMVGGRKN---EDRNVNNTSPV  480

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP+W+YNH+N          ++   +IA+KL+I+ LWCIQW   +RPSMK VVQMLE E
Sbjct  481   YFPQWIYNHINAEDNPMWAQIDEQGNSIARKLSIVGLWCIQWCLTNRPSMKDVVQMLEGE  540

Query  1544  GDDLVLPSSPFAGS  1503
              +DL +P +PF  +
Sbjct  541   FNDLTMPPNPFPAT  554


 Score =   338 bits (868),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 172/330 (52%), Positives = 228/330 (69%), Gaps = 3/330 (1%)
 Frame = +3

Query  114   AIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSVY  293
             A V+L I+ R    +    I  FL     L P R+SY  IK +T  F +KLGEGG+G VY
Sbjct  223   AFVYLYIRVRTYQENR-TMIGKFLRDYKALKPSRFSYSDIKRITHQFNDKLGEGGYGIVY  281

Query  294   KGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDFM  473
             KGKL +   VAVK+++    NG++F+NEV ++GRIHHVNIVRL+G+CA+  + ALVY+F+
Sbjct  282   KGKLNNEIVVAVKVLNNSNGNGEEFVNEVSTIGRIHHVNIVRLLGFCADGFRRALVYEFL  341

Query  474   PNGSLDKYINQ-GAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             PNGSL+K I Q G+    L+W++  +I +G+A+GI+YLH GCD QILHFDIKP N+LLD 
Sbjct  342   PNGSLEKSIFQAGSNRITLDWEKLKDIALGIAKGIKYLHEGCDQQILHFDIKPQNVLLDH  401

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NF PKI DFGLAKL   ++S VT+TAARGT+GY+APE+++R  G +S+K+DVYSFGMLL+
Sbjct  402   NFNPKICDFGLAKLCSKEQSAVTMTAARGTMGYIAPEVLSRTFGRVSYKSDVYSFGMLLL  461

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      + +S  YFP WIYN IN        + DE    I +K++IVGLWCIQ
Sbjct  462   EMVGGRKNEDRNVNNTSPVYFPQWIYNHINAEDNPMWAQIDEQGNSIARKLSIVGLWCIQ  521

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
                  RPSM  VV+MLEG+   L MP + F
Sbjct  522   WCLTNRPSMKDVVQMLEGEFNDLTMPPNPF  551



>gb|KCW88167.1| hypothetical protein EUGRSUZ_A00554, partial [Eucalyptus grandis]
Length=366

 Score =   425 bits (1093),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 202/332 (61%), Positives = 258/332 (78%), Gaps = 1/332 (0%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             PC ++FLI+K+ RRH +    IE FL A NN  PIRYSY  IK +TK FK KLGEGG+GS
Sbjct  31    PCVLIFLILKWMRRHQATDANIEQFLQAHNNFLPIRYSYSDIKKITKNFKCKLGEGGYGS  90

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VY+G LRSG++VA+KI++K KSNGQDFI+EV ++GRIHHVN+V+LVG+C E SK ALVYD
Sbjct  91    VYRGILRSGNEVAIKILNKSKSNGQDFISEVATIGRIHHVNVVQLVGFCFEYSKQALVYD  150

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSLDK+I+       L+++  +EI +G+ARGIEYLHRGCD+QILHFDIKPHNILLD
Sbjct  151   FMPNGSLDKHISYKDGDDPLDYKNMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLD  210

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             ++F PK+SDFGLA+L+PT++SIV+LTA RGT+GY+APEL  + IG IS K DVYSFGMLL
Sbjct  211   QSFTPKVSDFGLARLYPTNRSIVSLTATRGTLGYMAPELFYKDIGGISFKTDVYSFGMLL  270

Query  828   MEMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCI  1004
             MEM G  R      + SS+ YFP W+Y+ + K K +E  +  E+E+ I +KM IV LWCI
Sbjct  271   MEMAGRRRNINAHVERSSQIYFPLWVYDQLGKDKELERVDVIEEEREIARKMIIVALWCI  330

Query  1005  QMSPIPRPSMSRVVEMLEGDVELLQMPTDTFL  1100
             Q+SP  RP M +V++MLEGD++ LQ+P    L
Sbjct  331   QLSPNDRPPMRKVLDMLEGDMDKLQLPPKPLL  362


 Score =   315 bits (806),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 222/311 (71%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +    P RYS++DIKKIT     +LGEGGYG VY+G + S   VA+K+LN SK NG
Sbjct  55    FLQAHNNFLPIRYSYSDIKKITKNFKCKLGEGGYGSVYRGILRSGNEVAIKILNKSKSNG  114

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FI+EV  IG+IHHVNVV+LVG+C +  ++ALVY+++PN SL+K+I S +  +  L +K
Sbjct  115   QDFISEVATIGRIHHVNVVQLVGFCFEYSKQALVYDFMPNGSLDKHI-SYKDGDDPLDYK  173

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
              + EI+LGIA+GIEYLH+GCD QILHFDIKP NILLD +  PK+ DFGLA+L    +S V
Sbjct  174   NMYEISLGIARGIEYLHRGCDMQILHFDIKPHNILLDQSFTPKVSDFGLARLYPTNRSIV  233

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TA RGT+GY+APE+  ++ G +S K+DVYSFGMLL+EM G R+N NA    + S Q  
Sbjct  234   SLTATRGTLGYMAPELFYKDIGGISFKTDVYSFGMLLMEMAGRRRNINAH--VERSSQI-  290

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP WVY+ L +  EL+     +++  IA+K+ I+ALWCIQ  P DRP M+ V+ MLE +
Sbjct  291   YFPLWVYDQLGKDKELERVDVIEEEREIARKMIIVALWCIQLSPNDRPPMRKVLDMLEGD  350

Query  1544  GDDLVLPSSPF  1512
              D L LP  P 
Sbjct  351   MDKLQLPPKPL  361



>ref|XP_007021970.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13495.1| PR5-like receptor kinase [Theobroma cacao]
Length=622

 Score =   434 bits (1117),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 205/326 (63%), Positives = 256/326 (79%), Gaps = 2/326 (1%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C I  +I K R+RHLS+ + IENFL + NNL PIRYSY  IK MT  FK KLG+GG+GSV
Sbjct  288   CLIALVIQKLRKRHLSMDDEIENFLQSHNNLMPIRYSYFEIKRMTDGFKNKLGQGGYGSV  347

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             +KGKLRSG  VA+K+++K K+NGQDFINEV ++GRIHHVN+V+L+G+C + SK ALVYDF
Sbjct  348   FKGKLRSGQLVAIKLLNKSKANGQDFINEVATIGRIHHVNVVKLIGFCVKGSKQALVYDF  407

Query  471   MPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             M NGSLDK I     ++ L+WQ+ FEI +GVARGIEYLHRGC++QILHFDIKPHNILLDE
Sbjct  408   MQNGSLDKIIFSTE-SNTLSWQKMFEIALGVARGIEYLHRGCEMQILHFDIKPHNILLDE  466

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NF PK+SDFGLAKL+  D  IV+LTAARGT+GY+APEL  + IG IS+KADVYSFGM+LM
Sbjct  467   NFTPKVSDFGLAKLYSVDDDIVSLTAARGTLGYMAPELFYKNIGGISYKADVYSFGMMLM  526

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             E++G  +      + SS+ YFPSWIY+   +G  IE+G+  E+E +I +KM IV  WC Q
Sbjct  527   EIVGRRKNLNASAEYSSQIYFPSWIYDRFEEGDIIELGDVTENENKIMRKMVIVAFWCTQ  586

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMP  1085
             M P  RPSMS+ +EMLE +VELL+MP
Sbjct  587   MRPTDRPSMSKALEMLESEVELLEMP  612


 Score =   333 bits (854),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/315 (52%), Positives = 230/315 (73%), Gaps = 6/315 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+ +  + P RYS+ +IK++T+    +LG+GGYG V+KG++ S  LVA+K+LN SK NG
Sbjct  311   FLQSHNNLMPIRYSYFEIKRMTDGFKNKLGQGGYGSVFKGKLRSGQLVAIKLLNKSKANG  370

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHHVNVV+L+G+C  G ++ALVY+++ N SL+K IFSTES    LSW+
Sbjct  371   QDFINEVATIGRIHHVNVVKLIGFCVKGSKQALVYDFMQNGSLDKIIFSTESN--TLSWQ  428

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ EIALG+A+GIEYLH+GC+ QILHFDIKP NILLD N  PK+ DFGLAKL S +   V
Sbjct  429   KMFEIALGVARGIEYLHRGCEMQILHFDIKPHNILLDENFTPKVSDFGLAKLYSVDDDIV  488

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GY+APE+  +N G +S+K+DVYSFGM+L+E+VG RKN NA     +   + 
Sbjct  489   SLTAARGTLGYMAPELFYKNIGGISYKADVYSFGMMLMEIVGRRKNLNASAEYSS---QI  545

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y+    G  +++    +++  I +K+ I+A WC Q +P DRPSM   ++MLE E
Sbjct  546   YFPSWIYDRFEEGDIIELGDVTENENKIMRKMVIVAFWCTQMRPTDRPSMSKALEMLESE  605

Query  1544  GDDLVLPSSP-FAGS  1503
              + L +P  P F+G+
Sbjct  606   VELLEMPPKPSFSGN  620



>ref|XP_007022126.1| PR5-like receptor kinase [Theobroma cacao]
 gb|EOY13651.1| PR5-like receptor kinase [Theobroma cacao]
Length=597

 Score =   433 bits (1114),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 204/330 (62%), Positives = 256/330 (78%), Gaps = 1/330 (0%)
 Frame = +3

Query  111   CAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGSV  290
             C I  +  K+R+RHL V + IE FL   ++L PIRYSY+ IK MT++F++KLGEGG+GSV
Sbjct  20    CLIALVTYKWRKRHLCVDDTIEEFLQKQSDLIPIRYSYREIKRMTRSFRDKLGEGGYGSV  79

Query  291   YKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYDF  470
             +KGKLRSG  VA+K++ K K+NGQDFINEV ++GRIHH N+ +L+G+C E SK ALVYDF
Sbjct  80    FKGKLRSGHLVAIKLLGKSKANGQDFINEVATIGRIHHFNVAKLIGFCVEGSKQALVYDF  139

Query  471   MPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLDE  650
             MPNGSLDK I      + L+WQ+ F+I +GVARGIEYLH GC++QILHFDIKPHNILLDE
Sbjct  140   MPNGSLDKIIFTEENETTLSWQKMFDIALGVARGIEYLHHGCNMQILHFDIKPHNILLDE  199

Query  651   NFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLLM  830
             NF+PK+SDFGLAKL+  D SIV+LTAARGTIGY+APELV + IG IS KADVYSFGMLLM
Sbjct  200   NFVPKVSDFGLAKLYSVDDSIVSLTAARGTIGYIAPELVYKSIGGISFKADVYSFGMLLM  259

Query  831   EMLGLNRTPVTEQDESSK-YFPSWIYNDINKGKAIEMGEEDEDEKRITKKMTIVGLWCIQ  1007
             EM+G  +      +  S+ YFPSWIY   ++G+ I+ G+  + EK I +KM I   WCIQ
Sbjct  260   EMVGRRKNLNAFAEHLSQIYFPSWIYGRFHQGENIKFGDVTDGEKIIVRKMIITAFWCIQ  319

Query  1008  MSPIPRPSMSRVVEMLEGDVELLQMPTDTF  1097
             ++P  RPSMS+V+EMLE D+ELLQMP   F
Sbjct  320   VTPSVRPSMSKVLEMLETDIELLQMPPKPF  349


 Score =   324 bits (831),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 221/311 (71%), Gaps = 4/311 (1%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+    + P RYS+ +IK++T    ++LGEGGYG V+KG++ S  LVA+K+L  SK NG
Sbjct  43    FLQKQSDLIPIRYSYREIKRMTRSFRDKLGEGGYGSVFKGKLRSGHLVAIKLLGKSKANG  102

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             ++FINEV  IG+IHH NV +L+G+C +G ++ALVY+++PN SL+K IF TE     LSW+
Sbjct  103   QDFINEVATIGRIHHFNVAKLIGFCVEGSKQALVYDFMPNGSLDKIIF-TEENETTLSWQ  161

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             K+ +IALG+A+GIEYLH GC+ QILHFDIKP NILLD N  PK+ DFGLAKL S + S V
Sbjct  162   KMFDIALGVARGIEYLHHGCNMQILHFDIKPHNILLDENFVPKVSDFGLAKLYSVDDSIV  221

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             ++TAARGT+GYIAPE+V ++ G +S K+DVYSFGMLL+EMVG RKN NA         + 
Sbjct  222   SLTAARGTIGYIAPELVYKSIGGISFKADVYSFGMLLMEMVGRRKNLNAFA---EHLSQI  278

Query  1724  SFPEWVYNHLNRGGELQIRieedddeaiakklaiiaLWCIQWQPVDRPSMKAVVQMLERE  1545
              FP W+Y   ++G  ++     D ++ I +K+ I A WCIQ  P  RPSM  V++MLE +
Sbjct  279   YFPSWIYGRFHQGENIKFGDVTDGEKIIVRKMIITAFWCIQVTPSVRPSMSKVLEMLETD  338

Query  1544  GDDLVLPSSPF  1512
              + L +P  PF
Sbjct  339   IELLQMPPKPF  349



>gb|EYU21065.1| hypothetical protein MIMGU_mgv1a022786mg [Erythranthe guttata]
Length=349

 Score =   424 bits (1090),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 204/315 (65%), Positives = 251/315 (80%), Gaps = 11/315 (3%)
 Frame = +3

Query  108   PCAIVFLIIKYRRRHLSVFEPIENFLNADNNLFPIRYSYKHIKNMTKAFKEKLGEGGFGS  287
             P   V LIIK+R+RHLS+F  IE FL ++ +L  IRYSY  I+ MT+ F+EKLGEGG GS
Sbjct  22    PSLFVLLIIKFRKRHLSLFSTIEAFLQSNTSLTTIRYSYSDIRKMTRGFREKLGEGGCGS  81

Query  288   VYKGKLRSGSDVAVKIMSKPKSNGQDFINEVGSMGRIHHVNIVRLVGYCAENSKHALVYD  467
             VYKGKLRSG DVAVK+++K ++NGQ+FINEV ++GRIHHVN+V+LVGYCAE SK ALVYD
Sbjct  82    VYKGKLRSGHDVAVKLLNKTRANGQEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYD  141

Query  468   FMPNGSLDKYINQGAYASLLNWQRKFEIVVGVARGIEYLHRGCDIQILHFDIKPHNILLD  647
             FMPNGSL+KY+     ++ L+  RKFEI +GVARGIEYLH GC+IQILHFDIKPHNILLD
Sbjct  142   FMPNGSLEKYLFSKETSNWLSLVRKFEIAIGVARGIEYLHIGCNIQILHFDIKPHNILLD  201

Query  648   ENFIPKISDFGLAKLFPTDKSIVTLTAARGTIGYVAPELVNRRIGAISHKADVYSFGMLL  827
             +NF PKISDFGLAK + T+ + VTLTA RGTIGYVAPEL+NR IG +S+KADVYSFGMLL
Sbjct  202   DNFTPKISDFGLAKSYSTENTTVTLTAVRGTIGYVAPELMNRSIGRVSYKADVYSFGMLL  261

Query  828   MEMLGLNRTPVTEQDESSKYFPSWIYNDINKGKAIEMG-----------EEDEDEKRITK  974
             MEMLGLNR      ++SS+YFP WIY+ +N+G  IE+G            +D++ +++ +
Sbjct  262   MEMLGLNRCTRHNDNKSSQYFPYWIYDHLNEGNDIEIGNADKNDYDDDDNDDDNARKMRR  321

Query  975   KMTIVGLWCIQMSPI  1019
             KMTIVGLWCIQMS I
Sbjct  322   KMTIVGLWCIQMSLI  336


 Score =   301 bits (772),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 196/258 (76%), Gaps = 5/258 (2%)
 Frame = -1

Query  2444  FLEDYRAVRPTRYSFADIKKITNQLSERLGEGGYGIVYKGRVSSEILVAVKVLNDSKGNG  2265
             FL+   ++   RYS++DI+K+T    E+LGEGG G VYKG++ S   VAVK+LN ++ NG
Sbjct  46    FLQSNTSLTTIRYSYSDIRKMTRGFREKLGEGGCGSVYKGKLRSGHDVAVKLLNKTRANG  105

Query  2264  EEFINEVGIIGKIHHVNVVRLVGYCADGFRRALVYEYLPNESLEKYIFSTESKNVALSWK  2085
             +EFINEV  IG+IHHVNVV+LVGYCA+  +RALVY+++PN SLEKY+FS E+ N  LS  
Sbjct  106   QEFINEVATIGRIHHVNVVKLVGYCAERSKRALVYDFMPNGSLEKYLFSKETSN-WLSLV  164

Query  2084  KIQEIALGIAKGIEYLHQGCDQQILHFDIKPSNILLDHNMNPKICDFGLAKLCSKEKSAV  1905
             +  EIA+G+A+GIEYLH GC+ QILHFDIKP NILLD N  PKI DFGLAK  S E + V
Sbjct  165   RKFEIAIGVARGIEYLHIGCNIQILHFDIKPHNILLDDNFTPKISDFGLAKSYSTENTTV  224

Query  1904  TMTAARGTMGYIAPEVVSRNFGKVSHKSDVYSFGMLLLEMVGGRKNFNAKEGTDTSQQEG  1725
             T+TA RGT+GY+APE+++R+ G+VS+K+DVYSFGMLL+EM+G   N   +   + S Q  
Sbjct  225   TLTAVRGTIGYVAPELMNRSIGRVSYKADVYSFGMLLMEMLG--LNRCTRHNDNKSSQY-  281

Query  1724  SFPEWVYNHLNRGGELQI  1671
              FP W+Y+HLN G +++I
Sbjct  282   -FPYWIYDHLNEGNDIEI  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7787192020864