BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25887_g5_i1 len=778 path=[7234:0-777]

Length=778
                                                                      Score     E

dbj|BAE79384.1|  unnamed protein product                              60.5    4e-07   Ipomoea batatas [batate]
dbj|BAE79385.1|  unnamed protein product                              60.5    5e-07   Ipomoea batatas [batate]
dbj|BAE79382.1|  unnamed protein product                              60.1    5e-07   Ipomoea batatas [batate]



>dbj|BAE79384.1| unnamed protein product [Ipomoea batatas]
Length=1898

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +1

Query  427   LWGLREGLQLSRENGFQKLQIELDSETVVEVMNENYQQGi*sppsswivssLP---KALS  597
             LWGLREGL L++  GF KL  E DSE VV+V+ ++      +         L    + + 
Sbjct  1786  LWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASILVKDCKLLLDHFQEIK  1845

Query  598   VRCLLIC*GKGTSACGDYLANFEQTATWRTKILEDTPDGMSEILQI*KD*IVVASA  765
             V  +L    +  + C D+LAN  Q+++W T ILE  PD +   LQ  +D I +AS+
Sbjct  1846  VTHIL----REGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQ--RDAIGLASS  1895



>dbj|BAE79385.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +1

Query  427   LWGLREGLQLSRENGFQKLQIELDSETVVEVMNENYQQGi*sppsswivssLP---KALS  597
             LWGLREGL L++  GF KL  E DSE VV+V+ ++      +         L    + + 
Sbjct  1254  LWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASILVKDCKLLLDHFQEIK  1313

Query  598   VRCLLIC*GKGTSACGDYLANFEQTATWRTKILEDTPDGMSEILQI*KD*IVVASA  765
             V  +L    +  + C D+LAN  Q+++W T ILE  PD +   LQ  +D I +AS+
Sbjct  1314  VTHIL----REGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQ--RDAIGLASS  1363



>dbj|BAE79382.1| unnamed protein product [Ipomoea batatas]
Length=1366

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 42/116 (36%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = +1

Query  427   LWGLREGLQLSRENGFQKLQIELDSETVVEVMNENYQQGi*sppsswivssLP---KALS  597
             LWGLREGL L++  GF KL  E DSE VV+V+ ++      +         L    + + 
Sbjct  1254  LWGLREGLLLAKNRGFTKLIAETDSEAVVQVLRKDGPVTPDASILVKDCKLLLDHFQEIK  1313

Query  598   VRCLLIC*GKGTSACGDYLANFEQTATWRTKILEDTPDGMSEILQI*KD*IVVASA  765
             V  +L    +  + C D+LAN  Q+++W T ILE  PD +   LQ  +D I +AS+
Sbjct  1314  VTHIL----REGNQCADFLANLGQSSSWGTTILERPPDDLRIFLQ--RDAIGLASS  1363



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1422033592588