BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25884_g4_i2 len=905 path=[5631:0-483 6115:484-502 24411:503-504
24413:505-521 13299:522-548 22958:549-577 13354:578-578
13355:579-580 11238:581-610 24509:611-620 21850:621-627
13402:628-670 13444:671-672 10407:673-710 12351:711-731
12372:732-768 11093:769-886 11211:887-904]

Length=905
                                                                      Score     E

ref|XP_006365350.1|  PREDICTED: pectinesterase 2-like                   306   2e-98   
ref|XP_009789874.1|  PREDICTED: pectinesterase 1-like                   306   2e-98   
ref|XP_006365351.1|  PREDICTED: pectinesterase 2-like                   303   4e-97   
ref|XP_009626579.1|  PREDICTED: pectinesterase 1-like                   300   3e-96   
emb|CDP19851.1|  unnamed protein product                                296   3e-95   
gb|AHL24653.1|  Fra e 11.01 allergen                                    297   6e-95   
ref|XP_004239982.1|  PREDICTED: pectinesterase 1-like                   297   7e-95   
emb|CDP13860.1|  unnamed protein product                                295   4e-94   
emb|CDX98975.1|  BnaC09g48600D                                          295   5e-94   
ref|XP_009125688.1|  PREDICTED: pectinesterase PPME1-like               294   7e-94   
ref|XP_004239981.2|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    293   9e-94   
ref|XP_009122341.1|  PREDICTED: pectinesterase PPME1                    293   1e-93   
emb|CDX70037.1|  BnaA10g23860D                                          293   1e-93   
gb|ADH82125.1|  pectinesterase                                          292   3e-93   
emb|CDY14046.1|  BnaC02g01630D                                          292   5e-93   
emb|CDP21978.1|  unnamed protein product                                288   1e-92   
gb|KFK25126.1|  hypothetical protein AALP_AA8G069500                    284   7e-90   
ref|XP_007218171.1|  hypothetical protein PRUPE_ppa007533mg             283   1e-89   
ref|XP_010087095.1|  Pectinesterase PPME1                               283   2e-89   
ref|XP_010491358.1|  PREDICTED: pectinesterase PPME1-like               282   3e-89   
ref|XP_006289810.1|  hypothetical protein CARUB_v10003415mg             281   5e-89   
ref|XP_010423212.1|  PREDICTED: pectinesterase PPME1-like               281   6e-89   
ref|XP_002871269.1|  ATPPME1                                            281   6e-89   
ref|NP_177152.2|  pectinesterase PPME1                                  281   7e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452707.1|  PREDICTED: pectinesterase PPME1                    281   8e-89   
ref|XP_008234142.1|  PREDICTED: putative pectinesterase 63              280   3e-88   
ref|XP_006399225.1|  hypothetical protein EUTSA_v10013901mg             279   4e-88   
sp|B2VPR8.1|AL11B_OLEEU  RecName: Full=Pectinesterase 2; AltName:...    279   5e-88   Olea europaea
sp|D8VPP5.1|AL11A_OLEEU  RecName: Full=Pectinesterase 1; AltName:...    279   6e-88   
ref|XP_008244214.1|  PREDICTED: putative pectinesterase 63              278   9e-88   
ref|NP_568181.1|  putative pectinesterase 48                            278   1e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394480.1|  hypothetical protein EUTSA_v10004453mg             277   3e-87   
gb|AAX11261.1|  pectin methylesterase allergenic protein                276   3e-87   Kali turgidum [common saltwort]
gb|AAX11262.1|  pectin methylesterase allergenic protein                276   3e-87   Kali turgidum [common saltwort]
ref|XP_008234143.1|  PREDICTED: putative pectinesterase 63              276   6e-87   
gb|ACO34813.1|  Sal k 1 pollen allergen                                 275   7e-87   Kali turgidum [common saltwort]
gb|AAM65347.1|  pectin methyl-esterase-like protein                     275   1e-86   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52566.1|AC010675_14  putative pectin methylesterase; 8433-9798    275   1e-86   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87930.1|  pectin methyl-esterase-like protein                    274   2e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122340.1|  PREDICTED: probable pectinesterase 49              275   2e-86   
ref|XP_010667524.1|  PREDICTED: pectinesterase 2-like                   275   2e-86   
ref|XP_007215602.1|  hypothetical protein PRUPE_ppa007761mg             275   3e-86   
ref|XP_008228727.1|  PREDICTED: pectinesterase PPME1-like               274   3e-86   
ref|XP_009362793.1|  PREDICTED: putative pectinesterase 63              275   3e-86   
gb|KEH30561.1|  pectinesterase-like protein                             274   6e-86   
ref|XP_010546117.1|  PREDICTED: pectinesterase PPME1-like isoform X2    273   6e-86   
ref|XP_010546425.1|  PREDICTED: pectinesterase PPME1-like               273   7e-86   
ref|XP_008219199.1|  PREDICTED: pectinesterase PPME1-like               274   8e-86   
ref|XP_010546116.1|  PREDICTED: pectinesterase PPME1-like isoform X1    273   1e-85   
ref|XP_008229317.1|  PREDICTED: putative pectinesterase 63              273   1e-85   
dbj|BAB09012.1|  pectin methylesterase-like protein                     273   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207766.1|  hypothetical protein PRUPE_ppa026550mg             273   1e-85   
ref|XP_007216116.1|  hypothetical protein PRUPE_ppa018812mg             273   1e-85   
ref|XP_007222175.1|  hypothetical protein PRUPE_ppa007766mg             272   2e-85   
ref|XP_009363888.1|  PREDICTED: putative pectinesterase 63              272   3e-85   
ref|XP_009136508.1|  PREDICTED: putative pectinesterase 63 isofor...    272   3e-85   
ref|XP_007206641.1|  hypothetical protein PRUPE_ppa021246mg             272   3e-85   
ref|XP_011014352.1|  PREDICTED: pectinesterase PPME1-like               271   4e-85   
ref|XP_002318199.2|  hypothetical protein POPTR_0012s11460g             271   4e-85   Populus trichocarpa [western balsam poplar]
ref|XP_007207707.1|  hypothetical protein PRUPE_ppa025119mg             271   6e-85   
ref|XP_002318197.1|  hypothetical protein POPTR_0012s12720g             271   7e-85   Populus trichocarpa [western balsam poplar]
ref|XP_007038213.1|  Pectinesterase, putative isoform 1                 271   1e-84   
ref|XP_009362807.1|  PREDICTED: putative pectinesterase 63              271   1e-84   
ref|XP_010457627.1|  PREDICTED: putative pectinesterase 63              269   3e-84   
ref|XP_008338559.1|  PREDICTED: putative pectinesterase 63              270   3e-84   
ref|XP_006572810.1|  PREDICTED: uncharacterized protein LOC100306...    267   7e-84   
ref|XP_003518804.1|  PREDICTED: pectinesterase PPME1                    268   8e-84   
ref|XP_008376964.1|  PREDICTED: probable pectinesterase 48              266   1e-83   
gb|KFK27921.1|  hypothetical protein AALP_AA8G447400                    268   1e-83   
ref|XP_010523329.1|  PREDICTED: pectinesterase PPME1-like               268   1e-83   
gb|KHN29928.1|  Pectinesterase PPME1-like protein                       268   1e-83   
ref|XP_006381893.1|  hypothetical protein POPTR_0006s20010g             268   1e-83   
ref|XP_011033438.1|  PREDICTED: pectinesterase PPME1-like               267   3e-83   
ref|XP_006572809.1|  PREDICTED: uncharacterized protein LOC100306...    266   4e-83   
ref|XP_003517875.1|  PREDICTED: pectinesterase PPME1                    266   4e-83   
ref|XP_010038407.1|  PREDICTED: putative pectinesterase 63              267   4e-83   
ref|XP_011040323.1|  PREDICTED: pectinesterase PPME1-like               266   4e-83   
ref|XP_002309337.2|  hypothetical protein POPTR_0006s20000g             266   5e-83   Populus trichocarpa [western balsam poplar]
ref|XP_004513231.1|  PREDICTED: pectinesterase 1-like                   266   6e-83   
emb|CDY23044.1|  BnaC07g31430D                                          269   6e-83   
gb|KFK25128.1|  hypothetical protein AALP_AA8G069700                    266   8e-83   
ref|XP_003516497.1|  PREDICTED: pectinesterase PPME1                    265   1e-82   
gb|AAT99258.1|  pectin-methyltransferase precursor                      265   1e-82   
ref|XP_011076542.1|  PREDICTED: pectinesterase 1-like                   265   1e-82   
ref|XP_011076543.1|  PREDICTED: pectinesterase 1-like                   265   1e-82   
ref|XP_002277202.1|  PREDICTED: putative pectinesterase 63              265   2e-82   Vitis vinifera
ref|XP_008234141.1|  PREDICTED: putative pectinesterase 63              265   2e-82   
ref|XP_010452709.1|  PREDICTED: probable pectinesterase 49              264   3e-82   
gb|KEH17536.1|  pectinesterase-like protein                             264   4e-82   
ref|XP_006485036.1|  PREDICTED: pectinesterase PPME1-like               264   6e-82   
ref|XP_006437032.1|  hypothetical protein CICLE_v10031872mg             263   7e-82   
ref|XP_006399226.1|  hypothetical protein EUTSA_v10013913mg             263   8e-82   
ref|XP_003634032.1|  PREDICTED: putative pectinesterase 63              263   9e-82   
ref|XP_004287800.1|  PREDICTED: probable pectinesterase 48-like         263   2e-81   
ref|XP_010491360.1|  PREDICTED: probable pectinesterase 49              262   2e-81   
ref|XP_003517889.1|  PREDICTED: pectinesterase PPME1-like               262   2e-81   
ref|XP_010523318.1|  PREDICTED: pectinesterase PPME1-like               262   2e-81   
ref|XP_010666418.1|  PREDICTED: pectinesterase 1-like                   262   3e-81   
ref|XP_007038214.1|  Pectinesterase isoform 2                           260   3e-81   
ref|XP_010423211.1|  PREDICTED: probable pectinesterase 49              261   3e-81   
emb|CDX81050.1|  BnaC03g03040D                                          261   4e-81   
ref|XP_002321778.1|  hypothetical protein POPTR_0015s12220g             261   5e-81   Populus trichocarpa [western balsam poplar]
gb|KDO57708.1|  hypothetical protein CISIN_1g039631mg                   261   5e-81   
ref|XP_010666417.1|  PREDICTED: putative pectinesterase 63              261   5e-81   
ref|XP_006286828.1|  hypothetical protein CARUB_v10003776mg             261   5e-81   
ref|XP_002530224.1|  Pectinesterase U1 precursor, putative              260   1e-80   Ricinus communis
ref|XP_009130989.1|  PREDICTED: probable pectinesterase 50              259   2e-80   
ref|XP_006289803.1|  hypothetical protein CARUB_v10003407mg             259   4e-80   
ref|XP_009363892.1|  PREDICTED: probable pectinesterase 48              258   4e-80   
ref|XP_010452708.1|  PREDICTED: probable pectinesterase 50              257   1e-79   
ref|XP_004516439.1|  PREDICTED: pectinesterase PPME1-like               258   1e-79   
ref|XP_002871271.1|  pectinesterase family protein                      256   3e-79   
ref|XP_010491359.1|  PREDICTED: probable pectinesterase 50              256   3e-79   
ref|XP_011076539.1|  PREDICTED: pectinesterase 1-like                   263   4e-79   
ref|XP_002511045.1|  Pectinesterase-1 precursor, putative               256   6e-79   Ricinus communis
ref|NP_196360.1|  putative pectinesterase 50                            255   7e-79   Arabidopsis thaliana [mouse-ear cress]
gb|KHG24685.1|  Pectinesterase PPME1 -like protein                      255   9e-79   
ref|XP_010666416.1|  PREDICTED: pectinesterase 2-like                   255   1e-78   
gb|KFK25127.1|  hypothetical protein AALP_AA8G069600                    254   2e-78   
ref|XP_010423208.1|  PREDICTED: probable pectinesterase 50 isofor...    254   2e-78   
gb|KEH38558.1|  pectinesterase-like protein                             254   3e-78   
ref|XP_008449624.1|  PREDICTED: pectinesterase PPME1-like               254   3e-78   
emb|CDY14045.1|  BnaC02g01620D                                          253   6e-78   
ref|XP_009125689.1|  PREDICTED: probable pectinesterase 50              253   9e-78   
ref|XP_002277388.2|  PREDICTED: putative pectinesterase 63              253   2e-77   Vitis vinifera
ref|XP_002866448.1|  pectinesterase family protein                      251   3e-77   
ref|XP_008449623.1|  PREDICTED: putative pectinesterase 63              251   5e-77   
ref|XP_010662219.1|  PREDICTED: putative pectinesterase 63              251   6e-77   
ref|NP_200976.1|  putative pectinesterase 63                            249   1e-76   Arabidopsis thaliana [mouse-ear cress]
gb|EPS69429.1|  hypothetical protein M569_05334                         248   1e-76   
emb|CAN78808.1|  hypothetical protein VITISV_030725                     249   2e-76   Vitis vinifera
ref|NP_196359.1|  putative pectinesterase 49                            249   2e-76   Arabidopsis thaliana [mouse-ear cress]
emb|CBI38549.3|  unnamed protein product                                250   3e-76   
emb|CDY02121.1|  BnaA03g40460D                                          247   3e-76   
ref|XP_002511044.1|  Pectinesterase-3 precursor, putative               248   5e-76   Ricinus communis
ref|XP_002511043.1|  Pectinesterase-1 precursor, putative               248   6e-76   Ricinus communis
ref|XP_007153340.1|  hypothetical protein PHAVU_003G027000g             248   7e-76   
ref|XP_004174112.1|  PREDICTED: pectinesterase PPME1-like               246   8e-76   
ref|XP_007204487.1|  hypothetical protein PRUPE_ppa019696mg             248   8e-76   
ref|XP_007204919.1|  hypothetical protein PRUPE_ppa020130mg             247   8e-76   
emb|CAN66682.1|  hypothetical protein VITISV_005088                     248   9e-76   Vitis vinifera
ref|XP_007204920.1|  hypothetical protein PRUPE_ppa026195mg             246   9e-76   
ref|XP_007038215.1|  Pectin lyase-like superfamily protein, putat...    245   1e-75   
ref|XP_009136509.1|  PREDICTED: putative pectinesterase 63 isofor...    246   1e-75   
ref|XP_004156059.1|  PREDICTED: pectinesterase PPME1-like               247   1e-75   
ref|XP_002871270.1|  pectinesterase family protein                      247   2e-75   
ref|NP_001234964.1|  uncharacterized protein LOC100306177 precursor     243   2e-75   
ref|XP_004174171.1|  PREDICTED: probable pectinesterase 49-like         243   5e-75   
ref|XP_004140274.1|  PREDICTED: probable pectinesterase 48-like         245   7e-75   
ref|XP_004140272.1|  PREDICTED: pectinesterase PPME1-like               245   7e-75   
ref|XP_004169214.1|  PREDICTED: probable pectinesterase 48-like         245   8e-75   
ref|XP_006280767.1|  hypothetical protein CARUB_v10026738mg             243   2e-74   
gb|KGN48071.1|  hypothetical protein Csa_6G428040                       243   2e-74   
ref|XP_002511042.1|  Pectinesterase-1 precursor, putative               243   5e-74   Ricinus communis
ref|XP_010109161.1|  Pectinesterase PPME1                               242   9e-74   
ref|XP_010252431.1|  PREDICTED: putative pectinesterase 63              242   1e-73   
gb|KGN48072.1|  hypothetical protein Csa_6G428290                       242   1e-73   
ref|XP_004140273.1|  PREDICTED: pectinesterase PPME1-like               242   1e-73   
ref|XP_010109162.1|  putative pectinesterase 50                         241   2e-73   
gb|EYU20154.1|  hypothetical protein MIMGU_mgv1a008641mg                242   2e-73   
ref|XP_007038216.1|  Pectin lyase-like superfamily protein, putat...    238   4e-73   
ref|XP_007219211.1|  hypothetical protein PRUPE_ppa017319mg             236   1e-72   
gb|KHN28380.1|  Putative pectinesterase 48                              237   2e-72   
ref|XP_008242288.1|  PREDICTED: putative pectinesterase 63              234   1e-70   
gb|KDP39968.1|  hypothetical protein JCGZ_03499                         234   1e-70   
gb|KDP39971.1|  hypothetical protein JCGZ_03502                         237   7e-70   
gb|KHG22980.1|  Pectinesterase PPME1 -like protein                      232   1e-69   
gb|KDP39969.1|  hypothetical protein JCGZ_03500                         232   3e-69   
ref|XP_010483849.1|  PREDICTED: putative pectinesterase 63              228   4e-69   
ref|XP_002277518.1|  PREDICTED: putative pectinesterase 63 isofor...    230   1e-68   Vitis vinifera
emb|CBI27759.3|  unnamed protein product                                229   2e-68   
gb|KDP22496.1|  hypothetical protein JCGZ_26327                         236   2e-68   
ref|XP_008338574.1|  PREDICTED: pectinesterase PPME1-like               224   3e-68   
ref|XP_007202075.1|  hypothetical protein PRUPE_ppa005976mg             230   3e-68   
ref|XP_009123158.1|  PREDICTED: probable pectinesterase 49              226   3e-68   
ref|XP_004289004.1|  PREDICTED: pectinesterase PPME1-like               228   6e-68   
gb|ACU13228.1|  unknown                                                 221   2e-67   Glycine max [soybeans]
gb|KHN15646.1|  Putative pectinesterase 63                              223   4e-67   
ref|XP_008391732.1|  PREDICTED: putative pectinesterase 63              225   4e-67   
ref|XP_010656088.1|  PREDICTED: putative pectinesterase 63 isofor...    225   7e-67   
ref|XP_009343360.1|  PREDICTED: putative pectinesterase 63              224   9e-67   
ref|XP_009348902.1|  PREDICTED: putative pectinesterase 63 isofor...    223   1e-66   
gb|KHN47850.1|  Putative pectinesterase 63                              221   4e-66   
ref|XP_009348900.1|  PREDICTED: putative pectinesterase 63 isofor...    222   5e-66   
ref|XP_006381567.1|  hypothetical protein POPTR_0006s13930g             221   3e-65   
ref|XP_008344163.1|  PREDICTED: putative pectinesterase 63              219   3e-65   
ref|XP_011016271.1|  PREDICTED: putative pectinesterase 63              219   9e-65   
ref|XP_011039979.1|  PREDICTED: putative pectinesterase 63              219   9e-65   
ref|XP_004140271.1|  PREDICTED: pectinesterase PPME1-like               218   2e-64   
ref|XP_004144054.1|  PREDICTED: probable pectinesterase 50-like         218   4e-64   
ref|XP_008450966.1|  PREDICTED: putative pectinesterase 63              218   4e-64   
gb|KDP33954.1|  hypothetical protein JCGZ_07525                         218   5e-64   
ref|XP_006452876.1|  hypothetical protein CICLE_v10010655mg             217   5e-64   
gb|ACU18534.1|  unknown                                                 212   7e-64   Glycine max [soybeans]
ref|XP_006474682.1|  PREDICTED: putative pectinesterase 63-like         217   7e-64   
gb|KDO73799.1|  hypothetical protein CISIN_1g047018mg                   216   1e-63   
ref|XP_010259713.1|  PREDICTED: pectinesterase PPME1-like               215   2e-63   
ref|XP_010259712.1|  PREDICTED: pectinesterase PPME1-like               209   3e-61   
emb|CDY48409.1|  BnaAnng09780D                                          203   2e-59   
ref|XP_002516214.1|  Pectinesterase-3 precursor, putative               206   2e-59   Ricinus communis
ref|XP_010243601.1|  PREDICTED: pectinesterase PPME1-like               204   3e-59   
ref|XP_007219703.1|  hypothetical protein PRUPE_ppa024066mg             202   1e-58   
ref|XP_007154546.1|  hypothetical protein PHAVU_003G127700g             199   2e-57   
ref|XP_009402033.1|  PREDICTED: putative pectinesterase 63              198   2e-56   
ref|XP_006843862.1|  hypothetical protein AMTR_s00007p00264370          196   4e-56   
ref|XP_011076540.1|  PREDICTED: pectinesterase 2-like                   190   2e-55   
ref|XP_003541318.1|  PREDICTED: putative pectinesterase 63-like         194   2e-55   
ref|XP_003609956.1|  Pectinesterase                                     188   3e-53   
gb|KHN07870.1|  Putative pectinesterase 63                              186   2e-52   
ref|XP_007145123.1|  hypothetical protein PHAVU_007G212000g             177   8e-49   
ref|XP_001769271.1|  predicted protein                                  177   9e-49   
gb|KEH25488.1|  pectinesterase                                          176   1e-48   
ref|XP_001769817.1|  predicted protein                                  174   1e-47   
ref|XP_004495886.1|  PREDICTED: probable pectinesterase 53-like         174   1e-47   
gb|KHG12918.1|  putative pectinesterase 53 -like protein                172   1e-46   
ref|XP_010276489.1|  PREDICTED: probable pectinesterase 53 isofor...    171   1e-46   
ref|XP_009414379.1|  PREDICTED: probable pectinesterase 53 isofor...    171   2e-46   
ref|XP_009414378.1|  PREDICTED: probable pectinesterase 53 isofor...    171   2e-46   
ref|XP_003524409.1|  PREDICTED: probable pectinesterase 53-like         170   5e-46   
ref|XP_010276487.1|  PREDICTED: probable pectinesterase 53 isofor...    171   6e-46   
ref|XP_010276488.1|  PREDICTED: probable pectinesterase 53 isofor...    170   6e-46   
ref|XP_003530551.1|  PREDICTED: probable pectinesterase 53-like i...    170   8e-46   
ref|XP_003632380.2|  PREDICTED: probable pectinesterase 53              170   8e-46   
gb|EMT14071.1|  Putative pectinesterase 68                              169   1e-45   
emb|CBI27989.3|  unnamed protein product                                167   1e-45   
ref|XP_010240218.1|  PREDICTED: probable pectinesterase 68              168   1e-45   
ref|XP_010679463.1|  PREDICTED: probable pectinesterase 53              168   3e-45   
ref|XP_007051206.1|  Pectinesterase                                     169   3e-45   
ref|XP_008669043.1|  PREDICTED: probable pectinesterase 68              167   4e-45   
emb|CAN63186.1|  hypothetical protein VITISV_037092                     168   4e-45   Vitis vinifera
ref|XP_010271483.1|  PREDICTED: probable pectinesterase 53              168   4e-45   
ref|XP_010656255.1|  PREDICTED: probable pectinesterase 53              167   5e-45   
ref|XP_010262227.1|  PREDICTED: putative pectinesterase 63              166   1e-44   
ref|XP_006349162.1|  PREDICTED: probable pectinesterase 53-like         167   1e-44   
ref|XP_004976450.1|  PREDICTED: probable pectinesterase 68-like         166   1e-44   
ref|XP_008673062.1|  PREDICTED: pectinesterase isoform X1               166   2e-44   
ref|XP_007046753.1|  Pectin lyase-like superfamily protein isoform 1    166   2e-44   
ref|XP_004969916.1|  PREDICTED: probable pectinesterase 53-like         166   2e-44   
emb|CAD41229.2|  OSJNBa0010H02.16                                       164   4e-44   Oryza sativa Japonica Group [Japonica rice]
gb|KDP28296.1|  hypothetical protein JCGZ_14067                         165   4e-44   
ref|XP_006477195.1|  PREDICTED: probable pectinesterase 68-like         165   4e-44   
gb|KDO61446.1|  hypothetical protein CISIN_1g018249mg                   165   5e-44   
ref|XP_006440314.1|  hypothetical protein CICLE_v10020787mg             164   6e-44   
ref|XP_006371972.1|  hypothetical protein POPTR_0018s06820g             166   6e-44   
ref|XP_009399936.1|  PREDICTED: probable pectinesterase 68              164   6e-44   
ref|XP_009397881.1|  PREDICTED: probable pectinesterase 68              164   6e-44   
ref|XP_007152966.1|  hypothetical protein PHAVU_004G175200g             165   7e-44   
ref|XP_009406174.1|  PREDICTED: probable pectinesterase 53 isofor...    164   7e-44   
ref|XP_003579301.1|  PREDICTED: putative pectinesterase 63              165   8e-44   
dbj|BAD87905.1|  pectinesterase-like                                    163   8e-44   Oryza sativa Japonica Group [Japonica rice]
gb|KDP46694.1|  hypothetical protein JCGZ_06482                         164   9e-44   
ref|XP_004503496.1|  PREDICTED: probable pectinesterase 53-like         164   1e-43   
gb|KCW58194.1|  hypothetical protein EUGRSUZ_H00909                     164   1e-43   
ref|XP_004961453.1|  PREDICTED: probable pectinesterase 53-like i...    164   1e-43   
ref|XP_004229371.1|  PREDICTED: probable pectinesterase 53              164   1e-43   
ref|XP_002448293.1|  hypothetical protein SORBIDRAFT_06g024730          163   1e-43   Sorghum bicolor [broomcorn]
ref|XP_003567104.1|  PREDICTED: probable pectinesterase 53 isofor...    164   1e-43   
emb|CDY31785.1|  BnaC01g27410D                                          160   2e-43   
ref|XP_006646312.1|  PREDICTED: probable pectinesterase 53-like         163   2e-43   
ref|XP_009406173.1|  PREDICTED: probable pectinesterase 53 isofor...    164   2e-43   
ref|XP_004961452.1|  PREDICTED: probable pectinesterase 53-like i...    165   2e-43   
ref|XP_003559976.2|  PREDICTED: pectinesterase QRT1-like                164   2e-43   
ref|XP_010249481.1|  PREDICTED: probable pectinesterase 53              163   2e-43   
ref|NP_001044216.1|  Os01g0743200                                       163   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232305.1|  PREDICTED: probable pectinesterase 53 isofor...    164   2e-43   
ref|XP_010069754.1|  PREDICTED: probable pectinesterase 53 isofor...    164   2e-43   
ref|XP_010094410.1|  putative pectinesterase 53                         163   2e-43   
ref|XP_011009863.1|  PREDICTED: probable pectinesterase 53              163   2e-43   
ref|XP_007160279.1|  hypothetical protein PHAVU_002G308000g             163   3e-43   
gb|KHN40374.1|  Putative pectinesterase 53                              162   3e-43   
ref|XP_008653334.1|  PREDICTED: pectinesterase QRT1 isoform X1          162   3e-43   
ref|XP_003529058.2|  PREDICTED: probable pectinesterase 53-like         163   3e-43   
gb|KHN14256.1|  Putative pectinesterase 53                              163   3e-43   
ref|XP_008801747.1|  PREDICTED: probable pectinesterase 53              163   4e-43   
ref|XP_001756557.1|  predicted protein                                  160   4e-43   
emb|CDY68784.1|  BnaCnng60500D                                          160   4e-43   
ref|XP_010915098.1|  PREDICTED: probable pectinesterase 53 isofor...    162   4e-43   
gb|EEC79546.1|  hypothetical protein OsI_20666                          163   4e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001056077.1|  Os05g0521600                                       163   4e-43   Oryza sativa Japonica Group [Japonica rice]
gb|KEH27219.1|  pectinesterase                                          162   5e-43   
ref|XP_002320279.2|  hypothetical protein POPTR_0014s11240g             162   5e-43   
ref|XP_002531506.1|  Pectinesterase-2 precursor, putative               162   6e-43   
ref|XP_006653657.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    161   6e-43   
ref|XP_010915080.1|  PREDICTED: probable pectinesterase 53 isofor...    162   6e-43   
ref|XP_008238527.1|  PREDICTED: probable pectinesterase 68              162   6e-43   
ref|XP_007210707.1|  hypothetical protein PRUPE_ppa024139mg             160   8e-43   
ref|XP_003516527.2|  PREDICTED: probable pectinesterase 53-like         161   1e-42   
gb|AFK35509.1|  unknown                                                 161   1e-42   
ref|XP_006400534.1|  hypothetical protein EUTSA_v10013810mg             161   1e-42   
emb|CDP09966.1|  unnamed protein product                                161   1e-42   
ref|XP_003591360.1|  Pectinesterase                                     160   1e-42   
gb|KEH21331.1|  pectinesterase                                          160   1e-42   
ref|XP_011093645.1|  PREDICTED: probable pectinesterase 53 isofor...    161   1e-42   
ref|XP_008649911.1|  PREDICTED: probable pectinesterase 53              162   2e-42   
ref|XP_002962215.1|  hypothetical protein SELMODRAFT_165098             160   2e-42   
ref|XP_009787978.1|  PREDICTED: probable pectinesterase 53 isofor...    161   2e-42   
ref|XP_002463165.1|  hypothetical protein SORBIDRAFT_02g038910          159   2e-42   
ref|XP_002961718.1|  hypothetical protein SELMODRAFT_76693              159   2e-42   
ref|XP_002965129.1|  hypothetical protein SELMODRAFT_167160             160   2e-42   
ref|XP_006353578.1|  PREDICTED: probable pectinesterase 53-like         160   2e-42   
ref|XP_009802490.1|  PREDICTED: probable pectinesterase 53              160   2e-42   
ref|XP_009120862.1|  PREDICTED: probable pectinesterase 53              160   2e-42   
ref|XP_006853729.1|  hypothetical protein AMTR_s00056p00166920          160   2e-42   
ref|XP_002443368.1|  hypothetical protein SORBIDRAFT_08g018360          161   3e-42   
ref|XP_004959820.1|  PREDICTED: pectinesterase QRT1-like                159   3e-42   
ref|XP_010454257.1|  PREDICTED: probable pectinesterase 53              160   3e-42   
ref|XP_008786957.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    159   3e-42   
ref|XP_010493050.1|  PREDICTED: probable pectinesterase 53              160   3e-42   
gb|KCW58195.1|  hypothetical protein EUGRSUZ_H00909                     159   3e-42   
ref|XP_011078244.1|  PREDICTED: probable pectinesterase 53              160   3e-42   
ref|XP_003538735.1|  PREDICTED: probable pectinesterase 68-like         159   4e-42   
ref|XP_010914653.1|  PREDICTED: probable pectinesterase 53              160   4e-42   
ref|XP_004251642.1|  PREDICTED: probable pectinesterase 53              160   4e-42   
ref|XP_003630703.1|  Pectinesterase                                     160   4e-42   
ref|XP_011040796.1|  PREDICTED: probable pectinesterase 53              160   4e-42   
ref|XP_004513038.1|  PREDICTED: probable pectinesterase 53-like         160   4e-42   
ref|XP_008657240.1|  PREDICTED: probable pectinesterase 53              160   4e-42   
ref|XP_006654665.1|  PREDICTED: probable pectinesterase 53-like         160   5e-42   
ref|XP_011025911.1|  PREDICTED: probable pectinesterase 53              159   5e-42   
ref|XP_009599854.1|  PREDICTED: probable pectinesterase 53              159   5e-42   
ref|XP_002964788.1|  hypothetical protein SELMODRAFT_83442              158   5e-42   
ref|XP_002871903.1|  pectinesterase family protein                      160   5e-42   
ref|XP_008656475.1|  PREDICTED: probable pectinesterase 53 isofor...    160   5e-42   
ref|XP_002310842.1|  hypothetical protein POPTR_0007s13780g             158   7e-42   
ref|XP_006475590.1|  PREDICTED: probable pectinesterase 53-like i...    158   7e-42   
ref|XP_006380792.1|  hypothetical protein POPTR_0007s13780g             158   7e-42   
ref|XP_010420786.1|  PREDICTED: probable pectinesterase 53 isofor...    159   8e-42   
ref|XP_008804057.1|  PREDICTED: probable pectinesterase 53              159   9e-42   
ref|NP_001167796.1|  pectinesterase precursor                           159   1e-41   
ref|NP_197474.1|  probable pectinesterase 53                            159   1e-41   
ref|XP_006287923.1|  hypothetical protein CARUB_v10001159mg             159   1e-41   
ref|XP_006444558.1|  hypothetical protein CICLE_v10024027mg             159   1e-41   
ref|XP_010267113.1|  PREDICTED: probable pectinesterase 53              159   1e-41   
gb|KHN42698.1|  Putative pectinesterase 68                              158   1e-41   
ref|XP_010688346.1|  PREDICTED: probable pectinesterase 53              159   1e-41   
ref|XP_006451320.1|  hypothetical protein CICLE_v10010616mg             158   1e-41   
ref|XP_010069753.1|  PREDICTED: probable pectinesterase 53 isofor...    159   1e-41   
ref|XP_009591684.1|  PREDICTED: probable pectinesterase 53              159   1e-41   
ref|XP_001769270.1|  predicted protein                                  159   1e-41   
ref|XP_010915089.1|  PREDICTED: probable pectinesterase 53 isofor...    158   1e-41   
ref|XP_006475589.1|  PREDICTED: probable pectinesterase 53-like i...    158   1e-41   
emb|CDX77772.1|  BnaC07g20260D                                          157   1e-41   
ref|NP_199561.1|  pectin methylesterase 5                               158   2e-41   
ref|XP_006425546.1|  hypothetical protein CICLE_v10027321mg             158   2e-41   
gb|AFK39158.1|  unknown                                                 158   2e-41   
gb|EMT24197.1|  Pectinesterase QRT1                                     158   2e-41   
ref|XP_006387630.1|  hypothetical protein POPTR_0746s00200g             156   2e-41   
ref|XP_010915072.1|  PREDICTED: probable pectinesterase 53 isofor...    158   2e-41   
ref|XP_004511684.1|  PREDICTED: probable pectinesterase 68-like         158   2e-41   
ref|XP_003517421.1|  PREDICTED: probable pectinesterase 68              157   2e-41   
ref|XP_002440102.1|  hypothetical protein SORBIDRAFT_09g026060          159   2e-41   
gb|ABR18283.1|  unknown                                                 157   2e-41   
gb|ABD64977.1|  pectinesterase family protein                           157   3e-41   
ref|XP_010316821.1|  PREDICTED: probable pectinesterase 53              157   3e-41   
ref|NP_001067039.1|  Os12g0563700                                       158   3e-41   
gb|KGN66185.1|  hypothetical protein Csa_1G575010                       158   3e-41   
ref|XP_004158420.1|  PREDICTED: probable pectinesterase 53-like         158   3e-41   
gb|EMS68573.1|  Pectinesterase QRT1                                     157   3e-41   
ref|XP_004964049.1|  PREDICTED: probable pectinesterase 53-like         158   3e-41   
ref|XP_008450789.1|  PREDICTED: probable pectinesterase 53              157   4e-41   
gb|KCW71970.1|  hypothetical protein EUGRSUZ_E00425                     157   4e-41   
ref|XP_002458469.1|  hypothetical protein SORBIDRAFT_03g034250          157   4e-41   
ref|XP_006849276.1|  hypothetical protein AMTR_s00027p00247950          155   5e-41   
ref|XP_009101416.1|  PREDICTED: probable pectinesterase 68              157   5e-41   
ref|XP_004135808.1|  PREDICTED: probable pectinesterase 53-like         157   5e-41   
ref|XP_004287482.1|  PREDICTED: probable pectinesterase 53-like         157   5e-41   
ref|XP_006340937.1|  PREDICTED: probable pectinesterase 53-like         156   5e-41   
ref|XP_011093643.1|  PREDICTED: probable pectinesterase 53 isofor...    157   6e-41   
ref|XP_003611307.1|  Pectinesterase                                     156   7e-41   
ref|XP_002863340.1|  pectinesterase family protein                      156   7e-41   
ref|XP_006280682.1|  hypothetical protein CARUB_v10026646mg             156   8e-41   
ref|XP_008373764.1|  PREDICTED: probable pectinesterase 68              156   8e-41   
emb|CDY59290.1|  BnaA06g39970D                                          156   8e-41   
ref|XP_006492456.1|  PREDICTED: probable pectinesterase 53-like         156   9e-41   
ref|XP_003566023.2|  PREDICTED: probable pectinesterase 53              155   9e-41   
ref|XP_010055495.1|  PREDICTED: probable pectinesterase 68              157   9e-41   
gb|KDO86885.1|  hypothetical protein CISIN_1g0398871mg                  151   9e-41   
ref|XP_001777108.1|  predicted protein                                  154   9e-41   
ref|XP_001763134.1|  predicted protein                                  154   1e-40   
ref|XP_010919565.1|  PREDICTED: probable pectinesterase 68              155   1e-40   
ref|XP_010481313.1|  PREDICTED: probable pectinesterase 68              155   1e-40   
ref|XP_010110876.1|  putative pectinesterase 53                         156   1e-40   
gb|KDP33787.1|  hypothetical protein JCGZ_07358                         156   1e-40   
gb|EYU46841.1|  hypothetical protein MIMGU_mgv1a019910mg                155   1e-40   
ref|XP_010535938.1|  PREDICTED: probable pectinesterase 53              155   2e-40   
ref|XP_009126386.1|  PREDICTED: probable pectinesterase 53              155   2e-40   
gb|KDP39870.1|  hypothetical protein JCGZ_03401                         155   2e-40   
ref|XP_010264302.1|  PREDICTED: probable pectinesterase 68              155   2e-40   
gb|KHG28421.1|  putative pectinesterase 53 -like protein                155   2e-40   
gb|AFW82525.1|  hypothetical protein ZEAMMB73_386621                    155   2e-40   
ref|XP_007204399.1|  hypothetical protein PRUPE_ppa007112mg             155   2e-40   
ref|XP_008242479.1|  PREDICTED: probable pectinesterase 53              155   2e-40   
gb|EYU33537.1|  hypothetical protein MIMGU_mgv1a008469mg                155   2e-40   
gb|EEC69509.1|  hypothetical protein OsI_38743                          156   2e-40   
ref|XP_010534682.1|  PREDICTED: probable pectinesterase 15              154   2e-40   
emb|CDY42290.1|  BnaC02g08960D                                          155   3e-40   
ref|XP_010530051.1|  PREDICTED: probable pectinesterase 68              155   3e-40   
ref|XP_009402793.1|  PREDICTED: probable pectinesterase 53              155   3e-40   
ref|XP_009128975.1|  PREDICTED: probable pectinesterase 68 isofor...    154   3e-40   
gb|ABG46325.1|  putative pectin methylesterase                          154   3e-40   
gb|EYU30697.1|  hypothetical protein MIMGU_mgv1a024695mg                154   3e-40   
ref|XP_010679844.1|  PREDICTED: probable pectinesterase 53              155   3e-40   
gb|ABD65006.1|  pectinesterase family protein                           154   4e-40   
ref|XP_006398447.1|  hypothetical protein EUTSA_v10000935mg             154   4e-40   
ref|XP_011070218.1|  PREDICTED: probable pectinesterase 68              153   4e-40   
ref|XP_008656474.1|  PREDICTED: probable pectinesterase 53 isofor...    155   4e-40   
ref|XP_007157353.1|  hypothetical protein PHAVU_002G063100g             154   4e-40   
ref|XP_010683975.1|  PREDICTED: probable pectinesterase 15 isofor...    155   5e-40   
ref|XP_004172449.1|  PREDICTED: probable pectinesterase 53-like         154   5e-40   
ref|XP_008660472.1|  PREDICTED: putative pectinesterase 63              155   5e-40   
ref|XP_007013014.1|  Pectin lyase-like superfamily protein isoform 4    153   5e-40   
ref|XP_008465244.1|  PREDICTED: probable pectinesterase 53              154   5e-40   
ref|XP_007013012.1|  Pectin lyase-like superfamily protein isoform 2    153   5e-40   
gb|AES75113.2|  pectinesterase                                          150   5e-40   
gb|KHG28220.1|  putative pectinesterase 53 -like protein                154   6e-40   
ref|XP_002962216.1|  hypothetical protein SELMODRAFT_76951              154   6e-40   
emb|CDY69057.1|  BnaCnng61650D                                          154   6e-40   
ref|XP_009128974.1|  PREDICTED: probable pectinesterase 68 isofor...    154   6e-40   
emb|CDY44939.1|  BnaA02g04440D                                          155   7e-40   
ref|XP_004146488.1|  PREDICTED: probable pectinesterase 53-like         154   7e-40   
ref|XP_003631899.2|  PREDICTED: probable pectinesterase 53              154   7e-40   
gb|ABK27127.1|  unknown                                                 153   8e-40   
ref|XP_010113388.1|  putative pectinesterase 53                         153   8e-40   
ref|XP_007013013.1|  Pectin lyase-like superfamily protein isoform 3    153   9e-40   
ref|XP_009352561.1|  PREDICTED: probable pectinesterase 53              154   9e-40   
ref|XP_002514210.1|  Pectinesterase PPE8B precursor, putative           154   9e-40   
ref|XP_010098841.1|  putative pectinesterase 15                         154   9e-40   
emb|CDP03246.1|  unnamed protein product                                152   1e-39   
gb|KFK31368.1|  hypothetical protein AALP_AA6G103300                    153   1e-39   
ref|XP_010049610.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    154   1e-39   
ref|XP_002968924.1|  hypothetical protein SELMODRAFT_65663              151   1e-39   
emb|CBI31927.3|  unnamed protein product                                152   1e-39   
ref|XP_008352338.1|  PREDICTED: probable pectinesterase 53              153   1e-39   
ref|XP_007013011.1|  Pectin lyase-like superfamily protein isoform 1    153   1e-39   
ref|XP_006838145.1|  hypothetical protein AMTR_s00106p00092510          152   1e-39   
ref|XP_002266321.3|  PREDICTED: probable pectinesterase 68              153   1e-39   
ref|XP_008387348.1|  PREDICTED: probable pectinesterase 53              153   1e-39   
ref|XP_010258939.1|  PREDICTED: probable pectinesterase 68 isofor...    152   2e-39   
ref|XP_002303355.2|  hypothetical protein POPTR_0003s07460g             152   2e-39   
gb|KHG03314.1|  putative pectinesterase 8 -like protein                 152   2e-39   
ref|XP_011031878.1|  PREDICTED: probable pectinesterase 68              152   2e-39   
ref|XP_007039841.1|  Pectin lyase-like superfamily protein              152   3e-39   
ref|XP_010522833.1|  PREDICTED: probable pectinesterase 53              152   4e-39   
ref|XP_008337605.1|  PREDICTED: probable pectinesterase 53              152   4e-39   
ref|XP_004152402.1|  PREDICTED: probable pectinesterase 68-like         151   4e-39   
dbj|BAB09076.1|  pectin methylesterase-like                             151   5e-39   
ref|XP_002965130.1|  hypothetical protein SELMODRAFT_83276              151   5e-39   
ref|XP_004164282.1|  PREDICTED: probable pectinesterase 68-like         150   5e-39   
ref|XP_009599614.1|  PREDICTED: probable pectinesterase 68              149   7e-39   
gb|EYU27258.1|  hypothetical protein MIMGU_mgv1a025960mg                149   1e-38   
ref|XP_009143563.1|  PREDICTED: probable pectinesterase 15              151   1e-38   
ref|XP_007155657.1|  hypothetical protein PHAVU_003G220500g             150   1e-38   
ref|XP_010037120.1|  PREDICTED: probable pectinesterase 15              150   1e-38   
ref|NP_001060235.1|  Os07g0607400                                       149   2e-38   
ref|XP_002521065.1|  Pectinesterase-1 precursor, putative               150   2e-38   
gb|KHG26932.1|  putative pectinesterase 53 -like protein                150   2e-38   
ref|XP_002974192.1|  hypothetical protein SELMODRAFT_101090             149   2e-38   
ref|XP_007219903.1|  hypothetical protein PRUPE_ppb015196mg             145   2e-38   
gb|KHF97904.1|  Pectinesterase PPME1                                    145   2e-38   
gb|EPS73183.1|  pectinesterase                                          149   2e-38   
ref|XP_001778325.1|  predicted protein                                  150   2e-38   
ref|XP_001752210.1|  predicted protein                                  150   2e-38   
ref|XP_001775877.1|  predicted protein                                  147   2e-38   
gb|EPS63895.1|  pectinesterase                                          148   3e-38   
gb|KFK36544.1|  hypothetical protein AALP_AA4G137600                    148   3e-38   
ref|XP_010935867.1|  PREDICTED: putative pectinesterase 14              150   4e-38   
gb|KHN26987.1|  Putative pectinesterase 53                              149   4e-38   
ref|XP_009406172.1|  PREDICTED: probable pectinesterase 53 isofor...    149   4e-38   
ref|XP_008461405.1|  PREDICTED: probable pectinesterase 53              149   5e-38   
gb|EMT04970.1|  Putative pectinesterase 53                              150   5e-38   
ref|XP_011100946.1|  PREDICTED: probable pectinesterase 53              149   5e-38   
ref|XP_003618895.1|  Pectinesterase                                     149   5e-38   
gb|EYU27262.1|  hypothetical protein MIMGU_mgv1a011822mg                146   5e-38   
gb|KDP42780.1|  hypothetical protein JCGZ_00479                         149   6e-38   
ref|XP_008437714.1|  PREDICTED: probable pectinesterase 68              148   1e-37   
ref|XP_010260644.1|  PREDICTED: probable pectinesterase 8               148   1e-37   
ref|XP_001764345.1|  predicted protein                                  147   1e-37   
ref|XP_006429777.1|  hypothetical protein CICLE_v10011953mg             148   1e-37   
gb|EMT17971.1|  Putative pectinesterase 53                              145   1e-37   
ref|XP_002975044.1|  hypothetical protein SELMODRAFT_102829             146   1e-37   
ref|XP_006294320.1|  hypothetical protein CARUB_v10023328mg             147   1e-37   
ref|XP_008653773.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    149   1e-37   
gb|KHN09819.1|  Putative pectinesterase 68                              147   1e-37   
ref|XP_003550907.1|  PREDICTED: probable pectinesterase 68              147   2e-37   
ref|XP_011079515.1|  PREDICTED: probable pectinesterase 53              147   2e-37   
emb|CDX75019.1|  BnaA05g07650D                                          148   2e-37   
ref|XP_004169876.1|  PREDICTED: probable pectinesterase 53-like         147   2e-37   
ref|XP_006294321.1|  hypothetical protein CARUB_v10023328mg             148   2e-37   
ref|XP_003621294.1|  Pectinesterase                                     146   2e-37   
emb|CDP01931.1|  unnamed protein product                                147   2e-37   
emb|CDY33182.1|  BnaC04g08570D                                          147   2e-37   
gb|EYU24077.1|  hypothetical protein MIMGU_mgv1a008262mg                147   2e-37   
ref|XP_010516895.1|  PREDICTED: probable pectinesterase 15              147   3e-37   
ref|XP_004136146.1|  PREDICTED: probable pectinesterase 53-like         147   3e-37   
ref|XP_010695152.1|  PREDICTED: probable pectinesterase 68              147   3e-37   
ref|XP_001760885.1|  predicted protein                                  144   3e-37   
ref|XP_001762576.1|  predicted protein                                  145   4e-37   
ref|XP_008787556.1|  PREDICTED: putative pectinesterase 14              147   4e-37   
ref|XP_001758971.1|  predicted protein                                  145   4e-37   
gb|KCW82317.1|  hypothetical protein EUGRSUZ_C03721                     145   4e-37   



>ref|XP_006365350.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=367

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/281 (55%), Positives = 195/281 (69%), Gaps = 8/281 (3%)
 Frame = +2

Query  71   TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
            T+  L  +++ +L+F P  V   DT+PIPA+KSQ+ SWF A+V+PL + +  +DPALV A
Sbjct  6    TIFALETIVLTILLFIPR-VFSDDTIPIPADKSQLNSWFEANVKPLDARKDTLDPALVAA  64

Query  251  EAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
            EA    +KV     G FKT+ EAVK+IP  N +R II+I GG Y E+VKI+ ++PFVTLY
Sbjct  65   EANKTIIKVRTDGSGDFKTLTEAVKSIPEGNKRRVIIWIGGGNYTEKVKIERNKPFVTLY  124

Query  425  GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALT  601
            GDPKN P ++   TA Q   + SAT+ V S+YF AVNIN  N+APRP GK +  QA AL 
Sbjct  125  GDPKNVPNIIFHGTAKQYTIVESATVIVESEYFSAVNINFVNTAPRPDGKMELAQAAALR  184

Query  602  ISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGD  781
              G+KA+ YNCK +GFQDT CD+  KHF+KDCYIEGTVDF FG+ KSI LNTE HV PGD
Sbjct  185  TGGDKASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSIYLNTEAHVIPGD  244

Query  782  TMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             MAMVTAH R +   D+G SFV C ITG+ +     A LGR
Sbjct  245  PMAMVTAHARDAENVDSGYSFVHCTITGTGN----TAYLGR  281



>ref|XP_009789874.1| PREDICTED: pectinesterase 1-like [Nicotiana sylvestris]
Length=367

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/282 (54%), Positives = 196/282 (70%), Gaps = 8/282 (3%)
 Frame = +2

Query  68   ETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVK  247
             T+  +  +++ +L+F P  V   D+VPIPA+KSQ++SWF  +V+PL + +  +DPALV 
Sbjct  5    NTIFAVEAIVITILLFIPR-VFSDDSVPIPADKSQIKSWFETNVKPLDARKDTLDPALVA  63

Query  248  AEAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTL  421
            AEA    +KV     G+FKT+ +A+ +IP  N +R II I GG Y E+VKID  +PF+TL
Sbjct  64   AEANKTIIKVRADGSGEFKTLTDAINSIPQGNKRRVIISIGGGNYTEKVKIDRYKPFITL  123

Query  422  YGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVAL  598
            YGDPKN P ++   TA   GT+ SAT+ V S+YF AVNIN  NSAPRP GK +  QA AL
Sbjct  124  YGDPKNVPNIIFNGTAKDYGTVDSATVVVESEYFSAVNINFVNSAPRPDGKRELAQAAAL  183

Query  599  TISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPG  778
               G+KA+ YNCK YGFQDT CD+  KHF+KDCYIEGTVDF FG+ KS+ LNTE+HV PG
Sbjct  184  RTGGDKASLYNCKMYGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTEMHVIPG  243

Query  779  DTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            D MAM+TAH R +   D+G SFV C ITG+     K A+LGR
Sbjct  244  DPMAMITAHARGAGNVDSGYSFVHCMITGT----GKTALLGR  281



>ref|XP_006365351.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=368

 Score =   303 bits (775),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/281 (54%), Positives = 192/281 (68%), Gaps = 7/281 (2%)
 Frame = +2

Query  71   TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
            T+ ++  +I+  L F   GV   D VPIPA+KSQ+ SWF A+V+PL + +  +DPALV A
Sbjct  6    TIFVVETIIITFLFFNIIGVFSDDLVPIPADKSQLNSWFEANVKPLDARKDTLDPALVAA  65

Query  251  EAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
            EA    +KV     G FKTI EAVK+IP  N +R II+I GG Y E++KI+  +PFVT Y
Sbjct  66   EANKTIIKVRTDGSGDFKTITEAVKSIPEGNKRRVIIWIGGGNYTEKIKIERTKPFVTFY  125

Query  425  GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQ-QAVALT  601
            GD KN P ++   TA +  T+ SAT+ V S+YF AVNIN  N+APRP GK D+ QA AL 
Sbjct  126  GDSKNVPNIIFHGTAKEYTTVDSATVIVESEYFNAVNINFVNTAPRPDGKSDKAQAAALR  185

Query  602  ISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGD  781
              G+KA+ YNCK +GFQDT CD+  KHF+KDCYIEGTVDF FG+ KS+ LNTE HV PGD
Sbjct  186  TGGDKASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTETHVIPGD  245

Query  782  TMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             MAMVTAH R +   D+G SFV C ITG+ +     A LGR
Sbjct  246  PMAMVTAHARAAENFDSGFSFVHCMITGTGN----TAYLGR  282



>ref|XP_009626579.1| PREDICTED: pectinesterase 1-like [Nicotiana tomentosiformis]
Length=367

 Score =   300 bits (769),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/281 (53%), Positives = 194/281 (69%), Gaps = 8/281 (3%)
 Frame = +2

Query  71   TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
            T+  +  +++ +++F P  V   D+VPIPA+KSQ+ SWF  +V+PL + +  +DPALV A
Sbjct  6    TIFAVEAIVITIVLFIPR-VFSDDSVPIPADKSQINSWFETNVKPLDARKDTLDPALVAA  64

Query  251  EAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
            EA    +KV     G+FKT+ +A+ +IP  N +R II I GG Y E+VKI+  +PF+TLY
Sbjct  65   EANKTTIKVRADGSGEFKTLTDAINSIPQGNKRRVIISIGGGNYTEKVKIERYKPFITLY  124

Query  425  GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALT  601
            GDPKN P ++   TA   GT+ SAT+ V S+YF AVNIN  NSAPRP GK +  QA AL 
Sbjct  125  GDPKNVPNIIFNGTAKDYGTVDSATVVVESEYFTAVNINFVNSAPRPDGKRELAQAAALR  184

Query  602  ISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGD  781
              G+KA+ YNCK YGFQDT CD+  KHF+KDCYIEGTVDF FG+ KS+ LNTE+HV PGD
Sbjct  185  TGGDKASLYNCKMYGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTEMHVIPGD  244

Query  782  TMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             MAM+TAH R +   D+G SFV C ITG+ +     A LGR
Sbjct  245  PMAMITAHARGAGNVDSGYSFVHCMITGTGN----TAFLGR  281



>emb|CDP19851.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/278 (54%), Positives = 191/278 (69%), Gaps = 8/278 (3%)
 Frame = +2

Query  80   LLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            L   ++   L+F P  V+  DTVP PA+K+Q+ SWF  +VQPL S +  +DPALV AEA 
Sbjct  3    LNKAILFSTLLFIPL-VLSDDTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALVAAEAN  61

Query  260  P--VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
            P  + LK    G+FKTI +A+ +IP  NT R II +  G Y E++KI+ ++PF+T+ GDP
Sbjct  62   PRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFITIIGDP  121

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISG  610
             + PTLV   TAA+ GT+ SATL V SDYF A N+ + NSAPRP+G     QA+A+ I G
Sbjct  122  NHMPTLVFGGTAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALAVRIGG  181

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            +KA+FYNCKF GFQDTLCD+  KH +KDCYIEGTVDF FG+ KSI LN ELHV PGD  A
Sbjct  182  DKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIPGDRQA  241

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             +TA  R +  EDTG SFV C++TG+     + A LGR
Sbjct  242  WITAQARHTDAEDTGYSFVHCKVTGT----GRTAYLGR  275



>gb|AHL24653.1| Fra e 11.01 allergen [Fraxinus excelsior]
Length=368

 Score =   297 bits (760),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 189/278 (68%), Gaps = 9/278 (3%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            L  VIV + + C   V   D VPIPA+ +Q+ SWF   V+PL + +  +DPALV AE+ P
Sbjct  11   LETVIVSI-ILCMPIVFSDDRVPIPADSAQINSWFDGIVRPLSARKATLDPALVTAESEP  69

Query  263  --VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DP  433
              + LK    G FKTI +A+KTIP  NTKR I+ +A G Y E+VKI   +PF+T YG DP
Sbjct  70   KVIKLKSDGSGDFKTINDAIKTIPDGNTKRVILSLAPGNYKEKVKIGMYKPFITFYGEDP  129

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISG  610
             N P LV   TA +  T+ SATL V SDYF AVN+ + NSAPRP GK +  QA AL I G
Sbjct  130  NNMPVLVFGGTAKEYDTVESATLIVESDYFNAVNLKIVNSAPRPDGKREGAQAAALRIGG  189

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            +K++FYN K YG+QDTLCD+  KHFYKDCYIEGTVDF FG  KS+ LNTELHV PGD +A
Sbjct  190  DKSSFYNVKLYGYQDTLCDDRGKHFYKDCYIEGTVDFIFGSGKSLYLNTELHVIPGDQLA  249

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            M+TA  RK+  EDTG SFV C++TG+      VA LGR
Sbjct  250  MITAQARKTDSEDTGYSFVHCKVTGTGG----VAYLGR  283



>ref|XP_004239982.1| PREDICTED: pectinesterase 1-like [Solanum lycopersicum]
Length=368

 Score =   297 bits (760),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 190/281 (68%), Gaps = 7/281 (2%)
 Frame = +2

Query  71   TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
            T+ ++  +I+  L+     V   D VPIPA+KSQ+ SWF A+V+PL + +  +DPALV A
Sbjct  6    TIFVVETIIITFLLLNIIEVFSDDLVPIPADKSQLNSWFEANVKPLDARKDTLDPALVAA  65

Query  251  EAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
            EA    +KV     G FKTI EAVK+IP  N KR II+I  G Y E++KI+  +PFVTLY
Sbjct  66   EANKTIIKVRTYGSGDFKTITEAVKSIPEGNKKRVIIWIGSGNYTEKIKIERTKPFVTLY  125

Query  425  GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQ-QAVALT  601
            GDPKN P ++   TA +  T+ SAT+ V S+YF AVNIN  N+APRP GK D+ QA AL 
Sbjct  126  GDPKNVPNIIFHGTAQEYTTVDSATVIVESEYFSAVNINFVNTAPRPDGKSDKAQAAALR  185

Query  602  ISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGD  781
              G+KA+ YNCK +GFQDT CD+  KHF+KDCYIEGTVDF FG+ KS+ LNTE HV PGD
Sbjct  186  TGGDKASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTETHVIPGD  245

Query  782  TMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             MAMVTA  R     D+G SFV C ITG+ +     A LGR
Sbjct  246  PMAMVTAQARAVENFDSGFSFVHCMITGTGN----TAYLGR  282



>emb|CDP13860.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 193/283 (68%), Gaps = 8/283 (3%)
 Frame = +2

Query  65   METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
            M  + L   ++   L+F P  V+  +TVP PA+K+Q+ SWF  +VQPL S +  +DPALV
Sbjct  1    MGDMALNKAILFSTLLFIPL-VLSDNTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALV  59

Query  245  KAEAAP--VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
             AEA P  + LK    G+FKTI +A+ +IP  NT R II +  G Y E++KI+ ++PF+T
Sbjct  60   AAEANPRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFIT  119

Query  419  LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVA  595
            + GDP + PTLV   TAA+ GT+ SATL V SDYF A N+ + NSAPRP+G     QA+A
Sbjct  120  IIGDPNHMPTLVFGGTAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALA  179

Query  596  LTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFP  775
            + I G+KA+FYNCKF GFQDTLCD+  KH +KDCYIEGTVDF FG+ KSI LN ELHV P
Sbjct  180  VRIGGDKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIP  239

Query  776  GDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            GD  A +TA  R +  EDTG SFV C++TG+     + A LGR
Sbjct  240  GDRQAWITAQARHTDAEDTGYSFVHCKVTGT----GRTAYLGR  278



>emb|CDX98975.1| BnaC09g48600D [Brassica napus]
Length=365

 Score =   295 bits (754),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/266 (55%), Positives = 191/266 (72%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  V+VF    V+  D  PIP  K QVE WF A+V PL + RKG+DPALV AEA P
Sbjct  6    VSILLALVVVFVTPMVLADDATPIPEAKVQVEQWFEANVAPLPA-RKGLDPALVAAEAEP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+FKT+ +A+K++PA NTKR II IA G+Y E+V ID ++PF+TL GDPK 
Sbjct  65   RTITVDPKGGEFKTLMDAIKSVPAENTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPKA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNK  616
             P +    TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGNK
Sbjct  125  MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIIVKNTAPAPDGKAKGAQALSMRISGNK  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++
Sbjct  185  AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVV-GDGIRVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITGSAD  874
            TAH  KS  E +G SFV C++TG  +
Sbjct  244  TAHAGKSKEEKSGYSFVHCKVTGVGE  269



>ref|XP_009125688.1| PREDICTED: pectinesterase PPME1-like [Brassica rapa]
 gb|AGX13881.1| pectin methylesterase [Brassica rapa subsp. chinensis]
 emb|CDY55179.1| BnaAnng13700D [Brassica napus]
Length=363

 Score =   294 bits (753),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 147/263 (56%), Positives = 190/263 (72%), Gaps = 4/263 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  V+VF    V+  D  PIP  K Q E WF+ +V PL S RKG+DPALV AEA+P
Sbjct  6    VSMLLAMVMVFVTPMVLADDNTPIPEAKPQAEQWFKTNVAPLPS-RKGLDPALVAAEASP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+FKT+ +A+K+IP +NTKR II +A G+Y E+V ID  +PF+TL GDPK 
Sbjct  65   RTINVNPKGGEFKTLTDALKSIPEKNTKRVIIKMAPGEYKEKVTIDKKKPFITLMGDPKA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNK  616
             P L    TAAQ GT+ SA+L +LSDYF+AVNI VKNSAP+P GK    QA+A+ ISGN 
Sbjct  125  MPVLTYDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNN  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKF+GFQDTLCD+   HF+KDCYIEGT DF FG   S+ L+T+LH   GD + ++
Sbjct  185  AAFYNCKFHGFQDTLCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLDTQLHAV-GDGIKVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITG  865
            +AH  KSA E +G SFV C++TG
Sbjct  244  SAHAGKSAEEKSGYSFVHCKVTG  266



>ref|XP_004239981.2| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 1-like, partial 
[Solanum lycopersicum]
Length=358

 Score =   293 bits (751),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 151/274 (55%), Positives = 189/274 (69%), Gaps = 8/274 (3%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            + + +L+F P  V   D VPIPA+KSQ+ S F A+V+PL + +  +DPALV AEA    +
Sbjct  4    IFLIILLFIPR-VFSDDLVPIPADKSQLNSGFEANVKPLDARKDTLDPALVAAEANKTII  62

Query  272  KV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
            KV     G FKT+ EAVK+IP  N +R II+I GG Y E+VKI+ ++PFVTLYGDPKN P
Sbjct  63   KVRTDGSGDFKTLTEAVKSIPEDNKRRVIIWIGGGNYTEKVKIERNKPFVTLYGDPKNVP  122

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAA  622
             ++ + TA Q   + S T+ V S+YF AVNIN  N+APRP GK +  QA AL  +G+KA+
Sbjct  123  NIIFSGTAKQYTIVESGTVIVESEYFSAVNINFVNTAPRPDGKMELAQAAALRTAGDKAS  182

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
             YNCK +GFQDT CD+  KHF+KDCYIEGTVDF FG+ KSI LNTE HV PGD MAMVTA
Sbjct  183  LYNCKMFGFQDTFCDDKGKHFFKDCYIEGTVDFIFGNGKSIYLNTEAHVIPGDPMAMVTA  242

Query  803  HGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            H R     D+G SFV C ITG+ +     A LGR
Sbjct  243  HARDGENVDSGYSFVHCTITGTGN----TAYLGR  272



>ref|XP_009122341.1| PREDICTED: pectinesterase PPME1 [Brassica rapa]
 gb|AGX13882.1| pectin methylesterase [Brassica rapa subsp. chinensis]
Length=365

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/263 (56%), Positives = 190/263 (72%), Gaps = 4/263 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  V+VF    V+  D  PIP  K QVE WF A+V PL + RKG+DPALV AEA P
Sbjct  6    VSILLALVVVFVTPTVLADDATPIPEAKVQVEQWFEANVAPLPA-RKGLDPALVAAEAEP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+FKT+ +A+K++PA NTKR II IA G+Y E+V ID ++PF+TL GDPK 
Sbjct  65   RTITVDPKGGEFKTLMDAIKSVPAANTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPKA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNK  616
             P +    TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN 
Sbjct  125  MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKMKGAQALSMRISGNM  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++
Sbjct  185  AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVV-GDGIRVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITG  865
            TAH  KSA E +G SFV C++TG
Sbjct  244  TAHAGKSADEKSGYSFVHCKVTG  266



>emb|CDX70037.1| BnaA10g23860D [Brassica napus]
Length=365

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/263 (56%), Positives = 190/263 (72%), Gaps = 4/263 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  V+VF    V+  D  PIP  K QVE WF A+V PL + RKG+DPALV AEA P
Sbjct  6    VSILLALVVVFVTPMVLADDATPIPEAKVQVEQWFEANVAPLPA-RKGLDPALVAAEAEP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+FKT+ +A+K++PA NTKR II IA G+Y E+V ID ++PF+TL GDPK 
Sbjct  65   RTITVDPKGGEFKTLMDAIKSVPAANTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPKA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNK  616
             P +    TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN 
Sbjct  125  MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKMKGAQALSMRISGNM  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++
Sbjct  185  AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVV-GDGIRVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITG  865
            TAH  KSA E +G SFV C++TG
Sbjct  244  TAHAGKSADEKSGYSFVHCKVTG  266



>gb|ADH82125.1| pectinesterase [Brassica rapa subsp. pekinensis]
Length=363

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 189/265 (71%), Gaps = 4/265 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  V+VF    V+  D  PIP  K Q E WF+ +V PL S RKG+DPALV AEA+P
Sbjct  6    VSMLLAMVMVFVTPMVLADDNTPIPEAKPQAEQWFKTNVAPLPS-RKGLDPALVAAEASP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+FKT+ +A+K+IP +NTKR II +  G+Y E+V ID  +PF+TL GDPK 
Sbjct  65   RTINVNPKGGEFKTLTDALKSIPEKNTKRVIIKMGPGEYKEKVTIDKKKPFITLMGDPKA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNK  616
             P L    TAAQ GT+ SA+L +LSDYF+AVNI VKNSAP+P GK    QA+A+ ISGN 
Sbjct  125  MPVLTYDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNN  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKF+GFQDTLCD+   HF+KDCYIEGT DF FG   S+ L+T+LH   GD + ++
Sbjct  185  AAFYNCKFHGFQDTLCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLDTQLHAV-GDGIKVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITGSA  871
            +AH  KSA E +G SFV C++TG  
Sbjct  244  SAHAGKSAEEKSGYSFVHCKVTGDG  268



>emb|CDY14046.1| BnaC02g01630D [Brassica napus]
Length=363

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 190/263 (72%), Gaps = 4/263 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  V+VF    V+  D  PIP  K QVE WF+ +V PL S RKG+DPALV AEA+P
Sbjct  6    VSMLLAMVMVFVTPMVLADDNTPIPEAKPQVEQWFKTNVAPLPS-RKGLDPALVAAEASP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+FKT+ +A+K++P +NTKR II +A G+Y E+V +D  +PF+TL GDPK 
Sbjct  65   RTINVNPKGGEFKTLTDALKSVPEKNTKRVIIKMAPGEYKEKVTLDKKKPFITLMGDPKA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNK  616
             P L    TAAQ GT+ SA+L +LSDYF+AVNI VKNSAP+P GK    QA+A+ ISGN 
Sbjct  125  MPVLTFDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNN  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKF+GFQDT+CD+   HF+KDCYIEGT DF FG   S+ L T+LH   GD + ++
Sbjct  185  AAFYNCKFHGFQDTVCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLETQLHAV-GDGIKVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITG  865
            +AH  KSA E +G SFV C++TG
Sbjct  244  SAHAGKSAEEKSGYSFVHCKVTG  266



>emb|CDP21978.1| unnamed protein product, partial [Coffea canephora]
Length=263

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 181/262 (69%), Gaps = 4/262 (2%)
 Frame = +2

Query  80   LLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            L   ++   L+F P  V+  DTVP PA+K+Q+ SWF  +VQPL S +  +DPALV AEA 
Sbjct  3    LNKAILFSTLLFIPL-VLSDDTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALVAAEAN  61

Query  260  P--VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
            P  + LK    G+FKTI +A+ +IP  NT R II +  G Y E++KI+ ++PF+T+ GDP
Sbjct  62   PRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFITIIGDP  121

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISG  610
             N PTLV    AA+ GT+ SATL V SDYF A N+ + NSAPRP+G     QA+A+ I G
Sbjct  122  NNMPTLVFDGNAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALAVRIGG  181

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            +KA+FYNCKF GFQDTLCD+  KH +KDCYIEGTVDF FG+ KSI LN ELHV PGD  A
Sbjct  182  DKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIPGDQQA  241

Query  791  MVTAHGRKSAIEDTGLSFVQCR  856
             +TA  R +  EDTG SFV C+
Sbjct  242  WITAQARHTDAEDTGYSFVHCK  263



>gb|KFK25126.1| hypothetical protein AALP_AA8G069500 [Arabis alpina]
Length=362

 Score =   284 bits (726),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 145/264 (55%), Positives = 186/264 (70%), Gaps = 5/264 (2%)
 Frame = +2

Query  89   VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY  268
            +++  ++VF    V   D  PIPA K  VE WF+  V PL   RKG+DPALV AEAAP  
Sbjct  8    ILLALLVVFVTPMVFADDNAPIPASKPGVEQWFKTHVAPLPQ-RKGLDPALVAAEAAPKT  66

Query  269  LKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP-KNR  442
            + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL G P  N 
Sbjct  67   ITVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLLGQPGANM  126

Query  443  PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKA  619
            P +    TAA+ GT+ SA+L +LSDYFMAVNI VKNSAP P GK    QA+++ ISGN A
Sbjct  127  PVITYDGTAAKYGTVDSASLIILSDYFMAVNIIVKNSAPAPDGKTKGAQALSMRISGNYA  186

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            AFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++T
Sbjct  187  AFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIT  245

Query  800  AHGRKSAIEDTGLSFVQCRITGSA  871
            AH  KSA E +G SFV C++TG+ 
Sbjct  246  AHAGKSAEEKSGYSFVHCKVTGTG  269



>ref|XP_007218171.1| hypothetical protein PRUPE_ppa007533mg [Prunus persica]
 gb|EMJ19370.1| hypothetical protein PRUPE_ppa007533mg [Prunus persica]
Length=364

 Score =   283 bits (725),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 183/263 (70%), Gaps = 3/263 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            + + +++F     +  D  P+PA++SQV +WF  +V+P  + R  +DP L KAEA+   +
Sbjct  7    LTMTLILFTATIAMADDHTPVPADQSQVNTWFNNNVKPYTARRGTLDPTLAKAEASQKVI  66

Query  272  KVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
            KV K G  QFKTI +AV +IPA NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  67   KVMKNGSGQFKTITDAVNSIPAGNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPTNMP  126

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAA  622
            TL  A T+ + GT+ SAT+   SDYF+A N+ +KNS+PRP GK    QAVAL +SGNK+A
Sbjct  127  TLTFAGTSQKYGTVNSATVIAESDYFVAANVIIKNSSPRPDGKRVGAQAVALRVSGNKSA  186

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
             YNCK  GFQDTLCD+   H +KDC+IEGTVDF +G  KS+ LNTELHV   + + ++TA
Sbjct  187  LYNCKLIGFQDTLCDDRGNHLFKDCFIEGTVDFIWGSGKSLYLNTELHVLGDNGLTVITA  246

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
              R SA EDTG SFV C+ITG+ 
Sbjct  247  QARDSASEDTGYSFVHCKITGTG  269



>ref|XP_010087095.1| Pectinesterase PPME1 [Morus notabilis]
 gb|EXB26150.1| Pectinesterase PPME1 [Morus notabilis]
Length=368

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 190/277 (69%), Gaps = 11/277 (4%)
 Frame = +2

Query  89   VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPV-  265
            V++V  L+     V   D V IP +K Q+ SWF  +V+PL S  KG+DPALV AE  P  
Sbjct  10   VLLVVALIATNNIVNADDNVQIPYQKGQLNSWFNGNVRPL-SASKGLDPALVAAETGPAK  68

Query  266  YLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
             +KV K   G FKT+QEA+ ++P+ N+KR II++ GG+Y+E+V ID  +PF+TLYG P N
Sbjct  69   VVKVAKDGSGDFKTVQEAINSVPSGNSKRVIIYVGGGEYHEKVTIDRSKPFITLYGSPTN  128

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNK  616
             PT+  A TAAQ GT+ SATL V SDYF+ VN+ +KNSAPRP G +   QAVAL  SGNK
Sbjct  129  MPTISYAGTAAQYGTVDSATLIVGSDYFVGVNLIIKNSAPRPDGIRKGAQAVALRASGNK  188

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTM-AM  793
            A FY CK  GFQDTLCD+   H +KDCYIEGTVDF FG   S+ LNTELHV    TM ++
Sbjct  189  ATFYKCKLLGFQDTLCDDRGFHLFKDCYIEGTVDFIFGSGTSLYLNTELHVISDPTMESV  248

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            +TA  R+SA + TG SFV C ITG+    AK AVLGR
Sbjct  249  ITAQARQSA-DGTGFSFVHCTITGN----AKDAVLGR  280



>ref|XP_010491358.1| PREDICTED: pectinesterase PPME1-like [Camelina sativa]
Length=361

 Score =   282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 186/266 (70%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  ++VF    V   D  PIP  K QVE WF+A+V PL   RKG+DPALV AEAAP
Sbjct  6    VSILLGLLVVFVSPMVFADDVTPIPEAKPQVEQWFKANVGPLPQ-RKGLDPALVAAEAAP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+F TI  A+K++PA NTKR II IA G Y E+V I+ ++PF+TL G P  
Sbjct  65   RIINVNPKGGEFTTITAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPTA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNK  616
             P +    TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN 
Sbjct  125  MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNY  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++
Sbjct  185  AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITGSAD  874
            TAH  KSA E +G SFV C++TG  +
Sbjct  244  TAHAGKSAEEKSGYSFVHCKVTGVGE  269



>ref|XP_006289810.1| hypothetical protein CARUB_v10003415mg [Capsella rubella]
 gb|EOA22708.1| hypothetical protein CARUB_v10003415mg [Capsella rubella]
Length=361

 Score =   281 bits (720),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 187/265 (71%), Gaps = 4/265 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  ++VF    V   D  PIP  K QVE WF+ +V PL   RKG+DPALV AEAAP
Sbjct  6    VSILLGLLVVFVSPVVFADDVTPIPETKPQVEQWFKTNVAPLAQ-RKGLDPALVAAEAAP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL G P  
Sbjct  65   RTITVNPKGGEFKTLTDALKSVPAGNTKRVIIKMAPGEYREKVTIDKNKPFITLMGQPNA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNK  616
             P +    TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN 
Sbjct  125  MPVISFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNM  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++
Sbjct  185  AAFYNCKFYGFQDTVCDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITGSA  871
             AH  KSA E +G SFV C++TG+ 
Sbjct  244  AAHAGKSAEEKSGYSFVHCKVTGTG  268



>ref|XP_010423212.1| PREDICTED: pectinesterase PPME1-like [Camelina sativa]
Length=361

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 187/266 (70%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  ++VF    V   D  PIP  K QVE WF+A+V PL   RKG+DPALV AEAAP
Sbjct  6    VSILLGLLVVFVSPVVFADDVTPIPEAKPQVEQWFKANVGPLAQ-RKGLDPALVAAEAAP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+F T+  A+K++PA NTKR II IA G Y E+V I+ ++PF+TL G P  
Sbjct  65   RIINVNPKGGEFTTLTAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPTA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNK  616
             P ++   TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN 
Sbjct  125  MPVIIFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNF  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++
Sbjct  185  AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITGSAD  874
            TAH  KSA E +G SFV C++TG  +
Sbjct  244  TAHAGKSAEEKSGYSFVHCKVTGVGE  269



>ref|XP_002871269.1| ATPPME1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47528.1| ATPPME1 [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   281 bits (719),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 187/265 (71%), Gaps = 4/265 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  ++VF    V   D  PIP  K QV  WF+A+V PL   RKG+DPALV AEAAP
Sbjct  6    VSILLGLLVVFVSPVVFADDVTPIPEAKPQVAQWFKANVAPLAQ-RKGLDPALVAAEAAP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL G P  
Sbjct  65   RIINVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAPGEYREKVTIDRNKPFITLMGQPGA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNK  616
             P +    TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN 
Sbjct  125  MPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNF  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++
Sbjct  185  AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITGSA  871
             AH  KSA E +G SFV C++TG+ 
Sbjct  244  AAHAGKSAEEKSGYSFVHCKVTGTG  268



>ref|NP_177152.2| pectinesterase PPME1 [Arabidopsis thaliana]
 sp|Q84WM7.1|PPME1_ARATH RecName: Full=Pectinesterase PPME1; Short=AtPPME1; Short=PE PPME1; 
AltName: Full=Pectin methylesterase 9; Short=AtPME9; AltName: 
Full=Pectin methylesterase PPME1; AltName: Full=Protein 
POLLEN SPECIFIC PME 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22801.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE35001.1| pectinesterase PPME1 [Arabidopsis thaliana]
Length=361

 Score =   281 bits (719),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 186/265 (70%), Gaps = 4/265 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  ++VF    V   D  PIP  K QV  WF A+V PL   RKG+DPALV AEAAP
Sbjct  6    VSILLGLLMVFVTPMVFADDVTPIPEGKPQVAQWFNANVGPLAQ-RKGLDPALVAAEAAP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL G P  
Sbjct  65   RIINVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMGQPNA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNK  616
             P +    TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN 
Sbjct  125  MPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNF  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++
Sbjct  185  AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITGSA  871
             AH  KSA E +G SFV C++TG+ 
Sbjct  244  AAHAGKSAEEKSGYSFVHCKVTGTG  268



>ref|XP_010452707.1| PREDICTED: pectinesterase PPME1 [Camelina sativa]
Length=361

 Score =   281 bits (719),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 186/266 (70%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +++++  ++VF    V   D  PIP  K QVE WF+A+V PL   RKG+DPALV AEAAP
Sbjct  6    VSILLGLLVVFVSPMVFADDVTPIPEAKPQVEQWFKANVGPLAQ-RKGLDPALVAAEAAP  64

Query  263  VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V  KGG+F T+  A+K++PA NTKR II IA G Y E+V I+ ++PF+TL G P  
Sbjct  65   RIINVNPKGGEFTTLTAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPTA  124

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNK  616
             P +    TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN 
Sbjct  125  MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNF  184

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++
Sbjct  185  AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797  TAHGRKSAIEDTGLSFVQCRITGSAD  874
            TAH  KSA E +G SFV C++TG  +
Sbjct  244  TAHAGKSAEEKSGYSFVHCKVTGVGE  269



>ref|XP_008234142.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 173/248 (70%), Gaps = 3/248 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  P+PAE++QV +WF  +V+P    +  +DPAL  AEA    +KV K   GQFKTI +A
Sbjct  30   DDTPVPAEQTQVNTWFNNNVKPYTEQKGTLDPALATAEAGQTIIKVMKDGSGQFKTITDA  89

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR I++I GG+Y E++ I  ++PFVT YG P N PTL    TA + GT+ S
Sbjct  90   INSIPAGNTKRVIVYIGGGEYEEKITIPRNKPFVTFYGSPTNMPTLTFGGTAQKYGTVNS  149

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT+   SDYFMA N+  KNS+PRP GK    QAVAL +SGNK+A YNCK  GFQDTLCD+
Sbjct  150  ATVIAESDYFMAANVIFKNSSPRPDGKAVGAQAVALRVSGNKSALYNCKLIGFQDTLCDD  209

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF+KDC+IEGTVDF +G  KS+ LNTELHV   + + ++TA  R SA +DTG SFV 
Sbjct  210  KGNHFFKDCFIEGTVDFIWGSGKSLYLNTELHVVGDNGLTVITAQARDSASDDTGYSFVH  269

Query  851  CRITGSAD  874
            C+ITG+ +
Sbjct  270  CKITGTGN  277



>ref|XP_006399225.1| hypothetical protein EUTSA_v10013901mg [Eutrema salsugineum]
 gb|ESQ40678.1| hypothetical protein EUTSA_v10013901mg [Eutrema salsugineum]
Length=364

 Score =   279 bits (714),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 178/251 (71%), Gaps = 3/251 (1%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK-GGQFKTI  304
            V+  DT PIP  K QVE WF+ +V PL S +  +DPALV AEA P  + V K GG+F T+
Sbjct  23   VLADDTTPIPEAKPQVEQWFKTNVGPLASRKGTLDPALVAAEAEPRIINVNKKGGEFTTL  82

Query  305  QEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGT  484
             +A+K++PA NTKR II +  G+Y E+V ID ++PF+TL G P   P +    TAA+ GT
Sbjct  83   TDALKSVPAGNTKRVIIKMGPGEYREKVTIDRNKPFITLMGQPNAMPIISFDGTAAKYGT  142

Query  485  IYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTL  661
            + SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGNKAAFYNCKFYGFQDT+
Sbjct  143  VDSASLIILSDYFMAVNIVVKNTAPMPDGKTKGAQALSMRISGNKAAFYNCKFYGFQDTI  202

Query  662  CDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLS  841
            CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++TAH  KSA E +G S
Sbjct  203  CDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVITAHAGKSAEEKSGYS  261

Query  842  FVQCRITGSAD  874
            FV C++TG  +
Sbjct  262  FVHCKVTGDGN  272



>sp|B2VPR8.1|AL11B_OLEEU RecName: Full=Pectinesterase 2; AltName: Full=Pollen allergen 
Ole e 11.0102; Short=Ole e 11-2; AltName: Allergen=Ole e 11.0102; 
Flags: Precursor [Olea europaea]
 gb|AAY88919.1| Ole e 11.0102 allergen precursor [Olea europaea]
Length=364

 Score =   279 bits (714),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 184/278 (66%), Gaps = 11/278 (4%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE--A  256
            +  V++ +L++ P  V+  D  PIPA  +Q+ SWF   +QP+   +  +DPALV AE  A
Sbjct  6    VEAVLLGILLYIPI-VLSDDRAPIPANSAQLNSWFDGIIQPVAVRKATMDPALVTAEGQA  64

Query  257  APVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DP  433
              + LK    G FK+I EA+K+IP  NTKR I+  + G Y+E+VKI   + ++T YG DP
Sbjct  65   KVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSFSPGNYSEKVKIGMYKHYITFYGEDP  124

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISG  610
             N P LV   TAA+ GT+ SATL V S+YF AVN+ + NSAPRP GK    QA AL ISG
Sbjct  125  NNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISG  184

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            +KA+FYN K YGFQDTLCD+  KHFYKDCYIEGTVDF FG  KSI LNTELH  PGD  A
Sbjct  185  DKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPGDQPA  244

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            ++TA  RK+  EDTG  FV CR+TG        A LGR
Sbjct  245  IITAQARKTESEDTGYYFVNCRVTGGG------AFLGR  276



>sp|D8VPP5.1|AL11A_OLEEU RecName: Full=Pectinesterase 1; AltName: Full=Pollen allergen 
Ole e 11.0101; Short=Ole e 11-1; AltName: Allergen=Ole e 11.0101; 
Flags: Precursor [Olea europaea]
 gb|ACZ57582.1| Ole e 11.0101 allergen precursor [Olea europaea]
Length=364

 Score =   279 bits (713),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 147/278 (53%), Positives = 184/278 (66%), Gaps = 11/278 (4%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +  V++ +L++ P  V+  D  PIP+  +Q+ SWF   +QP+   +  +DPALV AE   
Sbjct  6    VEAVLLGILLYIPI-VLSDDRAPIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTAEGQT  64

Query  263  --VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DP  433
              + LK    G FK+I EA+K+IP  NTKR I+ +A G Y+E+VKI   + ++T YG DP
Sbjct  65   KVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFYGEDP  124

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISG  610
             N P LV   TAA+ GT+ SATL V S+YF AVN+ + NSAPRP GK    QA AL ISG
Sbjct  125  NNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISG  184

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            +KA+FYN K YGFQDTLCD+  KHFYKDCYIEGTVDF FG  KSI LNTELH  PGD  A
Sbjct  185  DKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPGDQPA  244

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            ++TA  RK+  EDTG  FV CR+TG        A LGR
Sbjct  245  IITAQARKTDSEDTGYYFVNCRVTGGG------AFLGR  276



>ref|XP_008244214.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   278 bits (712),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 138/271 (51%), Positives = 183/271 (68%), Gaps = 13/271 (5%)
 Frame = +2

Query  71   TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
            T+ LLN +IV          +  D  P+PA++SQV +WF  +V P +  +  +DPALV A
Sbjct  17   TLILLNAIIV----------VADDDAPVPADQSQVNTWFNNNVNPNKERQGKLDPALVTA  66

Query  251  EAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
            E     +KV K   G+FKTI +AV +IPA NTKR I++I GG+YNE++ I  + PFVT Y
Sbjct  67   ELGQTIVKVMKDGSGEFKTITDAVNSIPAENTKRVIVYIGGGEYNEKITIPRNIPFVTFY  126

Query  425  GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALT  601
            G P N PTL+    A + GT+ SAT+   SDYF+A N+ +KNS+P+P GK   +QA+AL 
Sbjct  127  GSPTNMPTLIFGGNAQKYGTVDSATVIAESDYFVAANLIIKNSSPKPDGKRVGEQALALR  186

Query  602  ISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGD  781
            +SGNK+A +NC+  GFQDTLCD+   HF+KDC+IEGTVDF FG  KS+ LNTELHV   +
Sbjct  187  VSGNKSALFNCRVIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNN  246

Query  782  TMAMVTAHGRKSAIEDTGLSFVQCRITGSAD  874
             M ++TA  R SA EDTG SFV C ITG+ +
Sbjct  247  EMTVITAQARDSASEDTGYSFVHCNITGTGN  277



>ref|NP_568181.1| putative pectinesterase 48 [Arabidopsis thaliana]
 sp|Q9LY19.2|PME48_ARATH RecName: Full=Probable pectinesterase 48; Short=PE 48; AltName: 
Full=Pectin methylesterase 48; Short=AtPME48; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED91154.1| putative pectinesterase 48 [Arabidopsis thaliana]
Length=361

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 185/270 (69%), Gaps = 6/270 (2%)
 Frame = +2

Query  74   VRLLNVVIVC--VLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVK  247
            +R  NV I+   +++F    V   D  PIP  K QV  WF   V PL   RKG+DPALV 
Sbjct  1    MRYTNVSILLGMLVIFVSPMVFADDLTPIPEGKPQVVQWFNTHVGPLAQ-RKGLDPALVA  59

Query  248  AEAAPVYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
            AEAAP  + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL 
Sbjct  60   AEAAPRIINVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAHGEYREKVTIDRNKPFITLM  119

Query  425  GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALT  601
            G P   P +    TAA+ GT+ SA+L +LSDYFMAVNI VKN+AP P GK    QA+++ 
Sbjct  120  GQPNAMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMR  179

Query  602  ISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGD  781
            ISGN AAFYNCKFYGFQDT+CD+   HF+KDCY+EGT DF FG   S+ L T+LHV  GD
Sbjct  180  ISGNFAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GD  238

Query  782  TMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
             + ++ AH  KSA E +G SFV C++TG+ 
Sbjct  239  GIRVIAAHAGKSAEEKSGYSFVHCKVTGTG  268



>ref|XP_006394480.1| hypothetical protein EUTSA_v10004453mg [Eutrema salsugineum]
 gb|ESQ31766.1| hypothetical protein EUTSA_v10004453mg [Eutrema salsugineum]
Length=364

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 185/266 (70%), Gaps = 5/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            L V I+ V++  P  V   D  PIP  K ++E WF  +V  L S +  +DPAL+ AEA+P
Sbjct  8    LIVTILLVVITSPI-VSGNDASPIPQNKRRIEQWFNTNVPSLASRKGTLDPALLTAEASP  66

Query  263  VYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV + G+  FKT+ EA+K++PA NT+R II +  G Y E++ ID ++PF+TLYG P 
Sbjct  67   RVIKVKQNGRGHFKTLTEAIKSVPAGNTRRVIIKLGPGVYKEKITIDRNKPFITLYGHPN  126

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGN  613
              P L    TAAQ GT+ SATL VLSDYFMAVNI VKNSAP P GK    QA+++ ISGN
Sbjct  127  AMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKRKGAQALSMRISGN  186

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L T+L+V  GD + +
Sbjct  187  KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLRTQLNVV-GDGLRV  245

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            +TAH  KSA E +G SFV C++TG+ 
Sbjct  246  ITAHAGKSAAEKSGYSFVHCKVTGTG  271



>gb|AAX11261.1| pectin methylesterase allergenic protein [Salsola kali]
Length=339

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 186/257 (72%), Gaps = 10/257 (4%)
 Frame = +2

Query  149  PIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY---LKVGKGGQFKTIQEAVK  319
            PIP   +++ESWF+ +V+P+ S +KG++P++V+AE+  V    ++    G+FKTI +AVK
Sbjct  2    PIPPNPAELESWFQGAVKPV-SEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVK  60

Query  320  TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSA  496
             +   NTKR II I  G+Y E+VKI+   P++TLYG DPKNRPT+  A TAA+ GT+ SA
Sbjct  61   HVKVGNTKRVIITIGPGEYREKVKIEGLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSA  120

Query  497  TLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDNI  673
            TL V SDYF+  N+ V NSAPRP+GK    QA AL ISG++AAFYNCKF GFQDT+CD+ 
Sbjct  121  TLIVESDYFVGANLIVSNSAPRPAGKRKGAQASALRISGDRAAFYNCKFTGFQDTVCDDK  180

Query  674  NKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQC  853
              H +KDCYIEGTVD  FG+A+S+ LNTELHV PGD MAM+TAH RK+A    G SFV C
Sbjct  181  GNHLFKDCYIEGTVDLIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHC  240

Query  854  RITGSADPKAKVAVLGR  904
            ++TG+       A+LGR
Sbjct  241  KVTGTGG----TALLGR  253



>gb|AAX11262.1| pectin methylesterase allergenic protein [Salsola kali]
Length=339

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 186/257 (72%), Gaps = 10/257 (4%)
 Frame = +2

Query  149  PIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY---LKVGKGGQFKTIQEAVK  319
            PIP   +++ESWF+ +V+P+ S +KG++P++V+AE+  V    ++    G+FKTI +AVK
Sbjct  2    PIPPNPAELESWFQGAVKPV-SEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVK  60

Query  320  TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSA  496
             +   NTKR II I  G+Y E+VKI+   P++TLYG DPKNRPT+  A TAA+ GT+ SA
Sbjct  61   HVKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSA  120

Query  497  TLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDNI  673
            TL V SDYF+  N+ V NSAPRP GK    +A AL ISG++AAFYNCKF GFQDT+CD+ 
Sbjct  121  TLIVESDYFVGANLIVSNSAPRPDGKRKGARASALRISGDRAAFYNCKFTGFQDTVCDDK  180

Query  674  NKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQC  853
              H +KDCYIEGTVDF FG+A+S+ LNTELHV PGD MAM+TAH RK+A    G SFV C
Sbjct  181  GNHLFKDCYIEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHC  240

Query  854  RITGSADPKAKVAVLGR  904
            ++TG+       A+LGR
Sbjct  241  KVTGTGG----TALLGR  253



>ref|XP_008234143.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/268 (50%), Positives = 178/268 (66%), Gaps = 4/268 (1%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGV-IPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +N  +   L+     + +  D  P+PA++SQV +WF  +V+P    +  +DPAL  AEA 
Sbjct  10   VNAALTMTLILLTATIAMADDDTPVPADQSQVNTWFNNNVKPYTEQQGTLDPALATAEAG  69

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
               +KV K   GQFKTI +A+ +IPA NTKR I++I GG+Y E++ I  ++PFVT YG P
Sbjct  70   QTVIKVMKDGSGQFKTITDAINSIPAGNTKRVIVYIGGGEYEEKITIPRNKPFVTFYGSP  129

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISG  610
             N PTL    TA + GT+ SAT+   SDYFMA N+  KNS+PRP GK    QAVAL +SG
Sbjct  130  TNMPTLTFGGTAQKYGTVNSATVIAESDYFMAANVIFKNSSPRPDGKAVGAQAVALRVSG  189

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            NK+A YNCK  GFQDTLCD+   HF+KDC+IEGTVDF +G  KS+ LNT LHV   + + 
Sbjct  190  NKSALYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNTRLHVVGDNGLT  249

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSAD  874
            ++TA  R SA +DTG SFV C ITG+ +
Sbjct  250  VITAQARDSASDDTGYSFVHCSITGTGN  277



>gb|ACO34813.1| Sal k 1 pollen allergen [Salsola kali]
Length=339

 Score =   275 bits (704),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 185/256 (72%), Gaps = 10/256 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY---LKVGKGGQFKTIQEAVKT  322
            IP   +++ESWF+ +V+P+ S +KG++P++V+AE+  V    ++    G+FKTI +AVK 
Sbjct  3    IPPNPAELESWFQGAVKPV-SEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVKH  61

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSAT  499
            +   NTKR II I  G+Y E+VKI+   P++TLYG DPKNRPT+  A TAA+ GT+ SAT
Sbjct  62   VKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSAT  121

Query  500  LYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDNIN  676
            L V SDYF+  N+ V NSAPRP GK    QA AL ISG++AAFYNCKF GFQDT+CD+  
Sbjct  122  LIVESDYFVGANLIVSNSAPRPDGKRKGAQASALRISGDRAAFYNCKFTGFQDTVCDDKG  181

Query  677  KHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCR  856
             H +KDCYIEGTVDF FG+A+S+ LNTELHV PGD MAM+TAH RK+A    G SFV C+
Sbjct  182  NHLFKDCYIEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCK  241

Query  857  ITGSADPKAKVAVLGR  904
            +TG+       A+LGR
Sbjct  242  VTGTGG----TALLGR  253



>gb|AAM65347.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
Length=342

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 179/257 (70%), Gaps = 8/257 (3%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVG-KGGQFKTIQEAV  316
            D  PIP  K QV  WF   V PL   RKG+DPALV AEAAP  + V  KGG+FKT+ +A+
Sbjct  6    DLTPIPEGKPQVVQWFNTHVGPLVQ-RKGLDPALVAAEAAPRIINVNPKGGEFKTLTDAI  64

Query  317  KTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSA  496
            K++PA NTKR II +A G+Y E+V ID ++PF+TL G P   P +    TAA+ GT+ SA
Sbjct  65   KSVPAGNTKRVIIKMAPGEYREKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGTVDSA  124

Query  497  TLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTLCDNI  673
            +L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN AAFYNCKFYGFQDT+CD+ 
Sbjct  125  SLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTICDDT  184

Query  674  NKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQC  853
              HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++ AH  KSA E++G SFV C
Sbjct  185  GNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIAAHAGKSAEENSGYSFVHC  243

Query  854  RITGSADPKAKVAVLGR  904
            ++TG+      V  LGR
Sbjct  244  KVTGTGG----VIYLGR  256



>gb|AAG52566.1|AC010675_14 putative pectin methylesterase; 8433-9798 [Arabidopsis thaliana]
Length=338

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 175/245 (71%), Gaps = 6/245 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFKTIQEAVK  319
            D  PIP  K QV  WF A+V PL   RKG+DPALV AEAAP   ++  GG+FKT+ +A+K
Sbjct  6    DVTPIPEGKPQVAQWFNANVGPLAQ-RKGLDPALVAAEAAP---RIINGGEFKTLTDAIK  61

Query  320  TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSAT  499
            ++PA NTKR II +A G+Y E+V ID ++PF+TL G P   P +    TAA+ GT+ SA+
Sbjct  62   SVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGTVDSAS  121

Query  500  LYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTLCDNIN  676
            L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN AAFYNCKFYGFQDT+CD+  
Sbjct  122  LIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTICDDTG  181

Query  677  KHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCR  856
             HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++ AH  KSA E +G SFV C+
Sbjct  182  NHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIAAHAGKSAEEKSGYSFVHCK  240

Query  857  ITGSA  871
            +TG+ 
Sbjct  241  VTGTG  245



>emb|CAB87930.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
Length=342

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 138/246 (56%), Positives = 174/246 (71%), Gaps = 4/246 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVG-KGGQFKTIQEAV  316
            D  PIP  K QV  WF   V PL   RKG+DPALV AEAAP  + V  KGG+FKT+ +A+
Sbjct  6    DLTPIPEGKPQVVQWFNTHVGPLAQ-RKGLDPALVAAEAAPRIINVNPKGGEFKTLTDAI  64

Query  317  KTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSA  496
            K++PA NTKR II +A G+Y E+V ID ++PF+TL G P   P +    TAA+ GT+ SA
Sbjct  65   KSVPAGNTKRVIIKMAHGEYREKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGTVDSA  124

Query  497  TLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTLCDNI  673
            +L +LSDYFMAVNI VKN+AP P GK    QA+++ ISGN AAFYNCKFYGFQDT+CD+ 
Sbjct  125  SLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTICDDT  184

Query  674  NKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQC  853
              HF+KDCY+EGT DF FG   S+ L T+LHV  GD + ++ AH  KSA E +G SFV C
Sbjct  185  GNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIAAHAGKSAEEKSGYSFVHC  243

Query  854  RITGSA  871
            ++TG+ 
Sbjct  244  KVTGTG  249



>ref|XP_009122340.1| PREDICTED: probable pectinesterase 49 [Brassica rapa]
 emb|CDX70038.1| BnaA10g23870D [Brassica napus]
Length=361

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/260 (52%), Positives = 179/260 (69%), Gaps = 3/260 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            +I  +++F    V+  D  PIP +K+QVE+WF+A+VQP  + R  +DP L  AEA+P  +
Sbjct  8    MIAFLVIFALPAVVADDITPIPEDKAQVEAWFKANVQPYSARRGTLDPVLDAAEASPQII  67

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  GG FKTI EA+K+IP  NTKR II +A G Y+E+V +D  RPFVTL G P    
Sbjct  68   NVNQEGGGDFKTINEAIKSIPIGNTKRVIIKLAPGVYHEKVTVDVGRPFVTLMGKPGAET  127

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    TA++ GT+ SATL + + YF+A N++VKN+AP P      QA+A+ I+G+KAAF
Sbjct  128  NLTFDGTASKFGTMESATLIIWAKYFVAANLHVKNTAPMPKAGTQGQALAMRINGDKAAF  187

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            YNC+FYGFQDTLCD+I  HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TAH
Sbjct  188  YNCRFYGFQDTLCDDIGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  246

Query  806  GRKSAIEDTGLSFVQCRITG  865
             R+S  +  G SFV C+ITG
Sbjct  247  NRQSENQQNGYSFVHCKITG  266



>ref|XP_010667524.1| PREDICTED: pectinesterase 2-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/279 (51%), Positives = 190/279 (68%), Gaps = 10/279 (4%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            LN+ + C L+      I   TV IPA  ++VE WF++ V+P+ + +  ++P+++ AE   
Sbjct  5    LNIALACFLIVNIAFTINAQTV-IPANAAEVERWFQSVVKPISAAKGTLEPSVIAAEDGG  63

Query  263  VY---LKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-D  430
            V    ++    G+FKTI +AVK +   N KR II I  G+Y E++KI+  + ++T YG D
Sbjct  64   VETLDVRQDGKGKFKTISDAVKHVKVGNKKRVIIKIGPGEYREKIKIERFQSYITFYGTD  123

Query  431  PKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTIS  607
            PKNRPT+  A TAAQ GT+ SATL V SDYF+A NI + NSAPRP GK    QA A+ IS
Sbjct  124  PKNRPTITFAGTAAQYGTVDSATLIVESDYFVAANIIISNSAPRPDGKKKGAQAAAIRIS  183

Query  608  GNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTM  787
            G+++AFYNCKF GFQDT+CD+  KHF+KDCYIEGTVDF FG+A+S+ LNTELHV PGD  
Sbjct  184  GDRSAFYNCKFVGFQDTVCDDKGKHFFKDCYIEGTVDFIFGEARSLYLNTELHVIPGDRE  243

Query  788  AMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            AM+ AH RK+   + G SFV C++TG+       AVLGR
Sbjct  244  AMIVAHARKNQDGEGGYSFVHCKVTGTGGH----AVLGR  278



>ref|XP_007215602.1| hypothetical protein PRUPE_ppa007761mg [Prunus persica]
 gb|EMJ16801.1| hypothetical protein PRUPE_ppa007761mg [Prunus persica]
Length=356

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 171/248 (69%), Gaps = 3/248 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  P+PA++SQV +WF  +V+P    +  +DPAL  AEA    +KV K   GQFKTI +A
Sbjct  15   DDTPVPADQSQVNTWFNNNVKPYTERQGTLDPALATAEAGQTVIKVMKDGSGQFKTITDA  74

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR I++I  G+Y E++ I  ++PFVT YG P N PTL    TA + GT+ S
Sbjct  75   INSIPADNTKRVIVYIGEGEYEEKITIPRNKPFVTFYGSPTNMPTLTFTGTAQKYGTVNS  134

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT+ V SDYFMA N+ +KNS+PRP GK    QAVAL +SGNK+A YNCK  GFQDTLCD+
Sbjct  135  ATVIVESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNKSALYNCKLIGFQDTLCDD  194

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF+KDC+IEGTVDF +G  KS+ LN ELHV   + + ++TA  R SA +DTG SF  
Sbjct  195  KGNHFFKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVITAQARDSASDDTGYSFAH  254

Query  851  CRITGSAD  874
            C ITG+ +
Sbjct  255  CNITGTGN  262



>ref|XP_008228727.1| PREDICTED: pectinesterase PPME1-like [Prunus mume]
Length=353

 Score =   274 bits (701),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 180/274 (66%), Gaps = 6/274 (2%)
 Frame = +2

Query  62   CMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPAL  241
            C++    L V ++ +        +  D  P+PA+ SQV +WF  +V   +  +  +D AL
Sbjct  7    CLDVHAALTVTLILLTATI---AVADDDTPVPADHSQVNTWFNNNVNSYKEQQGMLDHAL  63

Query  242  VKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFV  415
            V AE     +KV K   G+FKTI + + +IPA NTKR I++I GG+YNE++ I  + PFV
Sbjct  64   VTAEVGQTIVKVMKDGSGEFKTITDVINSIPADNTKRVIMYIGGGEYNEKITIPRNIPFV  123

Query  416  TLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAV  592
            T YG P N PTL  A T  + GT+ SAT+   SDYF+A N+ +KNS+PRP GK   +QA+
Sbjct  124  TFYGSPTNMPTLTFAGTTQKYGTVDSATVIAESDYFVAANLIIKNSSPRPDGKKVGEQAL  183

Query  593  ALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVF  772
            AL +SGNK+A +NCK  GFQDTLCD+   HF+KDC+IEGTVDF FG  KS+ LNTELHV 
Sbjct  184  ALRVSGNKSALFNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVL  243

Query  773  PGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSAD  874
              + M ++TA  R SA+EDTG SFV C ITG+ +
Sbjct  244  GNNEMTVITAQARDSALEDTGYSFVHCNITGTGN  277



>ref|XP_009362793.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=363

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 172/247 (70%), Gaps = 3/247 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKTIQEA  313
            D  P+PA  SQV +WF  +V+P    +K +DPA+V AEA    +KV + G+  FKT+ +A
Sbjct  22   DNTPVPAALSQVNTWFNNNVKPYTQRQKTLDPAVVTAEAGQKVIKVMQDGKGNFKTVTDA  81

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR I++I  G+Y E++ I  ++PFVTLYG P N P L    TA + GT+ S
Sbjct  82   INSIPAGNTKRVIVYIGTGEYKEKITIPRNKPFVTLYGSPTNMPILTFDGTAQKYGTVNS  141

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT+   SDYF+A N+N+KNS+PRP GK    QAVAL +SGNKAA YNCK +GFQDTLCD+
Sbjct  142  ATIIAESDYFVAANLNIKNSSPRPDGKRVGAQAVALRVSGNKAALYNCKLFGFQDTLCDD  201

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               H +KDCYIEGTVDF +G  KS+ LNTELHV   + + ++TA  R S  EDTG SFV 
Sbjct  202  RGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDNGITVITAQARDSDSEDTGYSFVH  261

Query  851  CRITGSA  871
            C+ITG+ 
Sbjct  262  CKITGTG  268



>gb|KEH30561.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   274 bits (700),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 138/266 (52%), Positives = 179/266 (67%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +N+ I+ VL+F   GV+  DT+PIPAEK+Q++SWF ++V PL+  +  +DPALV AEA  
Sbjct  10   INIAII-VLLFTVKGVLSDDTIPIPAEKTQLDSWFNSNVGPLEQRKSALDPALVTAEAGA  68

Query  263  VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV +   G FKTI +A+ +IP  NTKR I+ I GG YNE++KI+  +PFVTLYG P 
Sbjct  69   KVIKVMQDGSGDFKTITDAINSIPTGNTKRVIVSIGGGNYNEKIKIERTKPFVTLYGTPA  128

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGN  613
            N P L    TA Q GT+ SATL V SDYF+A N+ + NSAPRP GK    QAVAL ISG+
Sbjct  129  NMPNLTYGGTAKQYGTVDSATLIVESDYFVAANMLISNSAPRPDGKSAGAQAVALRISGD  188

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNCKF GFQDT+CD+ + HF+KDC I+GTVDF FG   S+   +EL         +
Sbjct  189  KAAFYNCKFLGFQDTICDDRHNHFFKDCLIQGTVDFIFGSGTSLYFKSELRALGDAGPTV  248

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            + A  RKS  +    SFV C +TG+ 
Sbjct  249  IVAQARKSVSDADLYSFVHCDVTGTG  274



>ref|XP_010546117.1| PREDICTED: pectinesterase PPME1-like isoform X2 [Tarenaya hassleriana]
Length=348

 Score =   273 bits (698),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 178/251 (71%), Gaps = 3/251 (1%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG-QFKTI  304
            V+  D  PIP  + QV+ WF  +V+ L   +  +DPAL  AEA P+ + V KGG QF+T+
Sbjct  7    VLASDATPIPEARGQVDQWFATNVKALSQRKGTLDPALEAAEAKPLVITVNKGGGQFRTL  66

Query  305  QEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGT  484
             EA+++IPA N++R II +  G+Y E+V ID ++PF+TL G+PK+ P +    TAA+ GT
Sbjct  67   TEALRSIPAGNSRRVIIRMGPGEYREKVTIDRNKPFITLLGNPKSMPVITFDGTAAKYGT  126

Query  485  IYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTL  661
            + SATL VLSDYFMA+N+ VKN+AP P GK    QA+A+ ISGNKAAFYNCKFYG+QDT+
Sbjct  127  VDSATLIVLSDYFMAINVIVKNTAPAPDGKTKGAQALAMRISGNKAAFYNCKFYGYQDTV  186

Query  662  CDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLS  841
            CD+   HF+KDCYIEGT DF FG   S+ L T+LHV  GD + ++TA   KS  + +G S
Sbjct  187  CDDTGSHFFKDCYIEGTFDFIFGSGTSLYLRTQLHVV-GDGIRVITAQAGKSTADQSGYS  245

Query  842  FVQCRITGSAD  874
            FV CR+TG+ +
Sbjct  246  FVHCRVTGTGE  256



>ref|XP_010546425.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=362

 Score =   273 bits (699),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/251 (55%), Positives = 178/251 (71%), Gaps = 4/251 (2%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKT  301
            V+  D+ PIP ++++VE WF+A+V PL      +DPALV AEAAP  + V K G   FKT
Sbjct  20   VLAGDSTPIPEDRAEVEEWFKANVAPLAHRNATLDPALVAAEAAPRVITVSKNGDGDFKT  79

Query  302  IQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG  481
            ++ A+K+IP  N +R II +  G+Y E+V ID ++PF+TLYG P   P L    TAA+ G
Sbjct  80   LKAAIKSIPKGNQERVIIKMGPGEYREKVTIDRNKPFITLYGRPDAMPVLTYHGTAAKYG  139

Query  482  TIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDT  658
            T+ SA+L VLSDYFMAVNI +KNSAP P GK    QA+A+ ISGNKAAFYNC+F+GFQDT
Sbjct  140  TVDSASLIVLSDYFMAVNIILKNSAPMPDGKMKGAQALAMRISGNKAAFYNCEFHGFQDT  199

Query  659  LCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGL  838
            LCD+I  HF+KDCYIEGT DF FG   SI LNT+L+V  G+ M ++TA   K+  + +G 
Sbjct  200  LCDDIGYHFFKDCYIEGTFDFIFGSGTSIYLNTQLNVV-GNGMRVITAQAGKTIADPSGY  258

Query  839  SFVQCRITGSA  871
            SFV CR+TG+ 
Sbjct  259  SFVHCRVTGTG  269



>ref|XP_008219199.1| PREDICTED: pectinesterase PPME1-like [Prunus mume]
Length=374

 Score =   274 bits (700),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/248 (53%), Positives = 172/248 (69%), Gaps = 3/248 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  P+PA++ QV +WF  +V+P    +  +DPAL  AEA    +KV K   GQFKTI +A
Sbjct  33   DDTPVPADQPQVNTWFNNNVKPYTERQGTLDPALATAEAGQTVIKVMKDGSGQFKTITDA  92

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR I++I  G+Y E++ I  ++PFVT +G P N PTL  A TA + GT+ S
Sbjct  93   INSIPADNTKRVIVYIGEGEYEEKITIPRNKPFVTFFGSPTNMPTLTFAGTAQKYGTVNS  152

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT+   SDYFMA N+ +KNS+PRP GK    QAVAL +SGNK+A YNCK  GFQDTLCD+
Sbjct  153  ATVIAESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNKSALYNCKLIGFQDTLCDD  212

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF+KDC+IEGTVDF +G  KS+ LN ELHV   + + ++TA  R SA +DTG SFV 
Sbjct  213  KGNHFFKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVITAQARDSASDDTGYSFVH  272

Query  851  CRITGSAD  874
            C+ITG+ +
Sbjct  273  CKITGTGN  280



>ref|XP_010546116.1| PREDICTED: pectinesterase PPME1-like isoform X1 [Tarenaya hassleriana]
Length=363

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/251 (53%), Positives = 178/251 (71%), Gaps = 3/251 (1%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG-QFKTI  304
            V+  D  PIP  + QV+ WF  +V+ L   +  +DPAL  AEA P+ + V KGG QF+T+
Sbjct  22   VLASDATPIPEARGQVDQWFATNVKALSQRKGTLDPALEAAEAKPLVITVNKGGGQFRTL  81

Query  305  QEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGT  484
             EA+++IPA N++R II +  G+Y E+V ID ++PF+TL G+PK+ P +    TAA+ GT
Sbjct  82   TEALRSIPAGNSRRVIIRMGPGEYREKVTIDRNKPFITLLGNPKSMPVITFDGTAAKYGT  141

Query  485  IYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTL  661
            + SATL VLSDYFMA+N+ VKN+AP P GK    QA+A+ ISGNKAAFYNCKFYG+QDT+
Sbjct  142  VDSATLIVLSDYFMAINVIVKNTAPAPDGKTKGAQALAMRISGNKAAFYNCKFYGYQDTV  201

Query  662  CDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLS  841
            CD+   HF+KDCYIEGT DF FG   S+ L T+LHV  GD + ++TA   KS  + +G S
Sbjct  202  CDDTGSHFFKDCYIEGTFDFIFGSGTSLYLRTQLHVV-GDGIRVITAQAGKSTADQSGYS  260

Query  842  FVQCRITGSAD  874
            FV CR+TG+ +
Sbjct  261  FVHCRVTGTGE  271



>ref|XP_008229317.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=375

 Score =   273 bits (699),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 177/261 (68%), Gaps = 5/261 (2%)
 Frame = +2

Query  95   IVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLK  274
            I+  ++         D+ PIPA+ SQV SWF  +V+PL   +  +D ALV AE  P  +K
Sbjct  16   IIITILLAANTTAADDSTPIPADGSQVGSWFDNNVKPLAECKGELDAALVTAEDGPKLIK  75

Query  275  VGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPT  448
            V K   G FKT+ +A+ +IP RNTKR +++I GG YNE++ I  ++PFVTLYG PKN PT
Sbjct  76   VMKDGSGNFKTLTDAINSIPERNTKRVVVYIGGGVYNEKINIPQNKPFVTLYGSPKNMPT  135

Query  449  LVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAF  625
            L+   TA + GT+YS TL V SDYF A NI V NSAP P G +   QAVAL ISG+KAAF
Sbjct  136  LMFDGTAEKYGTVYSGTLIVESDYFRAANIIVTNSAPEPDGIRSGAQAVALQISGDKAAF  195

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            YNCKF GFQDTL D    HF+KDCYIEGTVDF FG  KS+ LNTE+HV   + + ++TA 
Sbjct  196  YNCKFIGFQDTLYDYKGLHFFKDCYIEGTVDFIFGKGKSLYLNTEIHVIEHN-ITVITAQ  254

Query  806  GRKSAIEDTGLSFVQCRITGS  868
             R  A+ED G SFV C+ITG+
Sbjct  255  QR-DALEDNGFSFVHCKITGT  274



>dbj|BAB09012.1| pectin methylesterase-like protein [Arabidopsis thaliana]
Length=364

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/275 (52%), Positives = 181/275 (66%), Gaps = 10/275 (4%)
 Frame = +2

Query  56   EYCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDP  235
             Y    V +L VVI   +VF        D  PIP  K ++E WF  +V  L S +   DP
Sbjct  4    NYVSLIVTILLVVITSPVVFGN------DAAPIPENKGRIEQWFNTNVPSLASRKSTSDP  57

Query  236  ALVKAEAAPVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRP  409
            AL+ AEA P  +KV + G+  FKTI EA+ ++ A NT+R II I  G Y E+V ID  +P
Sbjct  58   ALLTAEAKPRIIKVKQNGRGHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRSKP  117

Query  410  FVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQ  586
            F+TLYG P   P L    TAAQ GT+ SATL VLSDYFMAVNI +KNSAP P GK    Q
Sbjct  118  FITLYGHPNAMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIILKNSAPMPDGKRKGAQ  177

Query  587  AVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELH  766
            A+++ ISGNKAAFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L T+L+
Sbjct  178  ALSMRISGNKAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLN  237

Query  767  VFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            V  GD + ++TAH  KSA E +G SFV C++TG+ 
Sbjct  238  VV-GDGIRVITAHAGKSAAEKSGYSFVHCKVTGTG  271



>ref|XP_007207766.1| hypothetical protein PRUPE_ppa026550mg [Prunus persica]
 gb|EMJ08965.1| hypothetical protein PRUPE_ppa026550mg [Prunus persica]
Length=371

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 181/264 (69%), Gaps = 3/264 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            +IV +++      +  D  P+PA+ SQV +WF  +V+  +  +  +DPALV AE     +
Sbjct  14   LIVTLILLTAAIAVANDDTPVPADYSQVNTWFNNNVKSYKERQGTLDPALVTAEVGQTVV  73

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
            KV K   G+FKTI +AV +IPA NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  74   KVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPTNMP  133

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAA  622
            TL  ++ A + GT+ SAT+   SDYF+AVN+ +KNS+P+P+     QQA+AL +SG K+A
Sbjct  134  TLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSVGQQALALRVSGTKSA  193

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
             +NC+  GFQDTLCD+   HF+KDC+IEGTVDF FG  KS+ LNTELHV   + M ++TA
Sbjct  194  LFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGDNEMTVITA  253

Query  803  HGRKSAIEDTGLSFVQCRITGSAD  874
              R SA EDTG SFV C ITG+ +
Sbjct  254  QARDSASEDTGYSFVHCNITGTGN  277



>ref|XP_007216116.1| hypothetical protein PRUPE_ppa018812mg [Prunus persica]
 gb|EMJ17315.1| hypothetical protein PRUPE_ppa018812mg [Prunus persica]
Length=375

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/258 (55%), Positives = 177/258 (69%), Gaps = 7/258 (3%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D+ PIP++ SQV SWF  +V+PL   +  +D ALV AE  P  +KV K   G FKT+ +A
Sbjct  31   DSTPIPSDGSQVGSWFDNNVKPLAERKGALDAALVTAEDGPKLIKVMKDGSGNFKTLTDA  90

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP RNTKR +++I GG YNE++ I  ++PFVTLYG PKN PTL+   TA + GT+YS
Sbjct  91   INSIPERNTKRVVVYIGGGVYNEKINIPQNKPFVTLYGSPKNMPTLMFDGTAEKYGTVYS  150

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
             TL V SDYF A NI V NSAP P G +   QAVAL ISG+KAAFYNCKF GFQDTL D 
Sbjct  151  GTLIVESDYFRAANIIVTNSAPEPDGIRSGAQAVALQISGDKAAFYNCKFIGFQDTLYDY  210

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF+KDCYIEGTVDF FG  KS+ LNTE+HV   + + ++TA  R  A+ED G SFV 
Sbjct  211  KGLHFFKDCYIEGTVDFIFGKGKSLYLNTEIHVLERN-ITVITAQQR-DALEDNGFSFVH  268

Query  851  CRITGSADPKAKVAVLGR  904
            C+ITG+     +   LGR
Sbjct  269  CKITGTT--YVRSTYLGR  284



>ref|XP_007222175.1| hypothetical protein PRUPE_ppa007766mg [Prunus persica]
 ref|XP_007224100.1| hypothetical protein PRUPE_ppa015611mg [Prunus persica]
 gb|EMJ23374.1| hypothetical protein PRUPE_ppa007766mg [Prunus persica]
 gb|EMJ25299.1| hypothetical protein PRUPE_ppa015611mg [Prunus persica]
Length=356

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 170/248 (69%), Gaps = 3/248 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  PIPA + QV +WF  +V+P    +  +DPAL  AEA    +KV K   GQFKTI +A
Sbjct  15   DDTPIPANQPQVNTWFNNNVKPYTERQGTLDPALATAEAGQTVIKVMKDGSGQFKTITDA  74

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR I++I  GKY E++ I  ++PFVT +G P N PTL  A TA + GT+ S
Sbjct  75   INSIPADNTKRVIVYIGEGKYEEKITIPRNKPFVTFFGSPTNMPTLTFAGTAQKYGTVNS  134

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT+ V SDYFMA N+ +KNS+PRP GK    QAVAL +SGNK+A YNCK  GFQDT CD+
Sbjct  135  ATVIVESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNKSALYNCKLIGFQDTFCDD  194

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF KDC+IEGTVDF +G  KS+ LN ELHV   + + ++TA  R S+ +DTG SFV 
Sbjct  195  KGNHFLKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVITAQARDSSSDDTGYSFVH  254

Query  851  CRITGSAD  874
            C+ITG+ +
Sbjct  255  CKITGTGN  262



>ref|XP_009363888.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=363

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 169/245 (69%), Gaps = 3/245 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKTIQEA  313
            D  PIP++ SQ+ +WF  +V+P    +  +DPA+V AEA    +KV + G+  FKTI +A
Sbjct  22   DNAPIPSDHSQINTWFNNNVKPYTERQSTLDPAIVTAEAGQTVIKVMQDGKGDFKTITDA  81

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR I+ I GG+YNE++ I  ++PFVTLYG P N P L    TA + GT+ S
Sbjct  82   INSIPAGNTKRVIVHIGGGEYNEKITIPRNKPFVTLYGSPTNMPNLTFDGTAQKYGTVNS  141

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT+   SDYF+A+N+ +KNS+PRP GK    QAVAL +SGN +A YNCK  GFQDTLCD+
Sbjct  142  ATVIAESDYFIAINLLIKNSSPRPDGKRVGAQAVALRVSGNNSALYNCKLVGFQDTLCDD  201

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               H +KDCYIEGTVDF +G  KS+ LNTELHV     + ++TA  R SA EDTG SFV 
Sbjct  202  RGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVITAQARDSASEDTGYSFVH  261

Query  851  CRITG  865
            C +TG
Sbjct  262  CNVTG  266



>ref|XP_009136508.1| PREDICTED: putative pectinesterase 63 isoform X1 [Brassica rapa]
Length=364

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/266 (52%), Positives = 184/266 (69%), Gaps = 5/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            L + I+ V++  P  V   D  PIP  K+++E WF  +V  L S +  +DPAL+ AEA P
Sbjct  8    LILTILLVVITWPV-VYGNDATPIPQNKNRIEQWFNNNVPSLASRKDTLDPALLTAEATP  66

Query  263  VYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV + G+  FKT+ EA+ ++P  N +R II +  G+Y E+V ID ++PF+TLYGDP 
Sbjct  67   RVIKVRQNGRGDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPN  126

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGN  613
              P L    TAA+ GT+ SATL VLSDYFMA+NI VKNSAP P GK    QA+++ ISGN
Sbjct  127  AMPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGN  186

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L+T+L+V  GD + +
Sbjct  187  KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRV  245

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            +TAH  KS  E +G SFV C++TG+ 
Sbjct  246  ITAHAGKSTEEKSGYSFVHCKVTGTG  271



>ref|XP_007206641.1| hypothetical protein PRUPE_ppa021246mg [Prunus persica]
 ref|XP_007206849.1| hypothetical protein PRUPE_ppa027083mg [Prunus persica]
 gb|EMJ07840.1| hypothetical protein PRUPE_ppa021246mg [Prunus persica]
 gb|EMJ08048.1| hypothetical protein PRUPE_ppa027083mg [Prunus persica]
Length=371

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 181/264 (69%), Gaps = 3/264 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            +IV +++      +  D  P+PA+ SQV +WF  +V+  +  +  +DPALV AE     +
Sbjct  14   LIVTLILLTATIAVANDDTPVPADYSQVNTWFNNNVKSYKERQGTLDPALVTAEVGQTVV  73

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
            KV K   G+FKTI +AV +IPA NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  74   KVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPTNMP  133

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAA  622
            TL  ++ A + GT+ SAT+   SDYF+AVN+ +KNS+P+P+     QQA+AL +SG K+A
Sbjct  134  TLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSVGQQALALRVSGTKSA  193

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
             +NC+  GFQDTLCD+   HF+KDC+IEGTVDF FG  KS+ LNTELHV   + M ++TA
Sbjct  194  LFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGDNEMTVITA  253

Query  803  HGRKSAIEDTGLSFVQCRITGSAD  874
              R SA EDTG SFV C ITG+ +
Sbjct  254  QARDSASEDTGYSFVHCNITGTGN  277



>ref|XP_011014352.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=364

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 179/258 (69%), Gaps = 6/258 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  PIPA+ S + +WF+ +V+PL   +  +DPAL  AEA P  +KV +   G+FKT+++A
Sbjct  25   DKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALEAAEAKPRTIKVRQDGSGEFKTLKDA  84

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP  NT+R I+ I  G+Y E++KI+  +PFVT  G P N+PTL    TA + GT+YS
Sbjct  85   INSIPTGNTERVIVDIGPGEYIEKLKIERGKPFVTFLGSPSNKPTLSFDGTAKEYGTVYS  144

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL   +DYF+A NI +KNSAPRP+G+   +QAVAL ISG+K+AFYNC+  GFQDTLCD+
Sbjct  145  ATLEAEADYFVAANIIIKNSAPRPNGELKGEQAVALRISGDKSAFYNCRLLGFQDTLCDD  204

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
              +H +KDCYIEGTVD+ FG  KS+ L TELHV   +    +TAH R S  EDTG SFV 
Sbjct  205  KGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGEENGNFITAHARNSEAEDTGFSFVH  264

Query  851  CRITGSADPKAKVAVLGR  904
            C++ G+    AK A LGR
Sbjct  265  CKVDGTG---AKGAYLGR  279



>ref|XP_002318199.2| hypothetical protein POPTR_0012s11460g [Populus trichocarpa]
 gb|EEE96419.2| hypothetical protein POPTR_0012s11460g [Populus trichocarpa]
Length=364

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/283 (49%), Positives = 187/283 (66%), Gaps = 7/283 (2%)
 Frame = +2

Query  65   METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
            M ++  +   I  +L+     V   D  PIPA+ S + +WF+ +V+PL   +  +DPAL 
Sbjct  1    MGSIAAIQCAITAILLVSTT-VSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALE  59

Query  245  KAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
             AEA P  +KV +   G+FKT+++A+ +IP  NT+R I+ I  G+Y E++KI+  +PFVT
Sbjct  60   AAEAKPRTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERSKPFVT  119

Query  419  LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVA  595
              G P N+PTL    TA + GT+YSATL   +DYF+A NI  KNSAPRP+G+   +QAVA
Sbjct  120  FLGSPSNKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIFKNSAPRPNGELKGEQAVA  179

Query  596  LTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFP  775
            L ISG+K+AFYNC+  GFQDTLCD+  +H +KDCYIEGTVD+ FG  KS+ L TELHV  
Sbjct  180  LRISGDKSAFYNCRLIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIG  239

Query  776  GDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             +    +TAH R S  EDTG SFV C++ G+    AK A LGR
Sbjct  240  DENGNFITAHARNSEAEDTGFSFVHCKVDGTG---AKGAYLGR  279



>ref|XP_007207707.1| hypothetical protein PRUPE_ppa025119mg [Prunus persica]
 gb|EMJ08906.1| hypothetical protein PRUPE_ppa025119mg [Prunus persica]
Length=371

 Score =   271 bits (693),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 181/264 (69%), Gaps = 3/264 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            +IV +++      +  D  P+PA+ SQV +WF  +V+  +  +  +DPALV AE     +
Sbjct  14   LIVTLILLTAIIAVANDDTPVPADYSQVNTWFNNNVKSYKERQGTLDPALVTAEVGQTVV  73

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
            KV K   G+FKTI +AV +IPA NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  74   KVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPTNMP  133

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAA  622
            TL  ++ A + GT+ SAT+   SDYF+AVN+ +KNS+P+P+     QQA+AL +SG K+A
Sbjct  134  TLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSVGQQALALRVSGTKSA  193

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
             +NC+  GFQDTLCD+   HF+KDC+IEGTVDF FG  KS+ LNTELHV   + M ++TA
Sbjct  194  LFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGDNEMTVITA  253

Query  803  HGRKSAIEDTGLSFVQCRITGSAD  874
              R SA EDTG SFV C ITG+ +
Sbjct  254  QARDSASEDTGYSFVHCNITGTGN  277



>ref|XP_002318197.1| hypothetical protein POPTR_0012s12720g [Populus trichocarpa]
 gb|EEE96417.1| hypothetical protein POPTR_0012s12720g [Populus trichocarpa]
Length=364

 Score =   271 bits (692),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 178/258 (69%), Gaps = 6/258 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  PIPA+ S + +WF+ +V+PL   +  +DPAL  AEA P  +KV +   G+FKT+++A
Sbjct  25   DKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALEAAEAKPRTIKVRQDGSGEFKTLKDA  84

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP  NT+R I+ I  G+Y E++KI+  +PFVT  G P N+PTL    TA + GT+YS
Sbjct  85   INSIPTGNTERVIVDIGPGEYIEKLKIERSKPFVTFLGSPSNKPTLSFDGTAKEYGTVYS  144

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL   +DYF+A NI  KNSAPRP+G+   +QAVAL ISG+K+AFYNC+  GFQDTLCD+
Sbjct  145  ATLEAEADYFVAANIIFKNSAPRPNGELKGEQAVALRISGDKSAFYNCRLIGFQDTLCDD  204

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
              +H +KDCYIEGTVD+ FG  KS+ L TELHV   +    +TAH R S  EDTG SFV 
Sbjct  205  KGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDENGNFITAHARNSEAEDTGFSFVH  264

Query  851  CRITGSADPKAKVAVLGR  904
            C++ G+    AK A LGR
Sbjct  265  CKVDGTG---AKGAYLGR  279



>ref|XP_007038213.1| Pectinesterase, putative isoform 1 [Theobroma cacao]
 gb|EOY22714.1| Pectinesterase, putative isoform 1 [Theobroma cacao]
Length=368

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/277 (51%), Positives = 185/277 (67%), Gaps = 8/277 (3%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +   I  +LV  P  V+  ++ PIP +KSQ+++WF A+++P  +    +DPAL KAE A 
Sbjct  11   VGAAICTILVLAPV-VLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAA  69

Query  263  VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV K   G F TI +A+ ++P+ NTKR II I GG Y E+++ID  +PF+T YGDP+
Sbjct  70   HIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPR  129

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGN  613
            N P L    TA Q GT+ SATL V SDYF+A NI ++N+APRP G     QAV+L ISG+
Sbjct  130  NMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGD  189

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNCK  GFQDTLCD+   HF+KDCYI GTVDF FG  KS+ LNT L+V     + +
Sbjct  190  KAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLNTVLYVDGQKGVTV  249

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            +TA  R+S+ E+TG SFV C +TG+A      A LGR
Sbjct  250  ITAQARESSSENTGYSFVHCTVTGTASG----AYLGR  282



>ref|XP_009362807.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=368

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/276 (50%), Positives = 185/276 (67%), Gaps = 6/276 (2%)
 Frame = +2

Query  86   NVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPV  265
            +++I+ +++      I  DT+PIP++ SQV SWF  +V+     +  +DPALV AE AP 
Sbjct  13   SLMIITIILTSSTAAIADDTIPIPSDSSQVASWFDNNVKTYNVRKSTLDPALVAAEHAPQ  72

Query  266  YLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
             + V +  GG FKTI +A+ +IPA NTKR  ++I GG YNE++ I  ++PFVTLYG PK+
Sbjct  73   VINVMQDGGGNFKTITDAINSIPAGNTKRVFVYIKGGVYNEKITIPHNKPFVTLYGSPKS  132

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNK  616
             P +    TA + GT+YS TL V SDYF AVN+ + NSAP P G +   QAVAL ISGNK
Sbjct  133  MPNITFDGTAQKYGTVYSGTLIVESDYFKAVNLVIINSAPEPDGIREGAQAVALQISGNK  192

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAFYNCK  G+QDTL D    H +KDC+I+GTVDF FG  KS+ LNTE+HV   + + ++
Sbjct  193  AAFYNCKMIGYQDTLYDYKGLHLFKDCFIQGTVDFIFGKGKSLYLNTEIHVVERN-LTVI  251

Query  797  TAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            TA  R SA ED+G SFV C+ITG+    A+   LGR
Sbjct  252  TAQQRDSASEDSGFSFVHCKITGTT--YARRTYLGR  285



>ref|XP_010457627.1| PREDICTED: putative pectinesterase 63 [Camelina sativa]
Length=365

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 179/269 (67%), Gaps = 10/269 (4%)
 Frame = +2

Query  74   VRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE  253
            V  L VVI   +VF        D  PIP  K  +E WF  +V  L S +  +DPAL+ AE
Sbjct  10   VTSLLVVITSPVVFAN------DAAPIPQNKGGIEQWFNTNVPSLASRKSTLDPALLAAE  63

Query  254  AAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG  427
            A P  +KV + G  QFKTI EA+K++ A NT R II +  G Y E+V ID ++PF+TLYG
Sbjct  64   AKPRIIKVEQNGRGQFKTITEAIKSVQAGNTGRVIIKVGPGVYKEKVTIDRNKPFITLYG  123

Query  428  DPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTI  604
             P   P L    TA + GT+ SATL VLSDYFMA+NI VKNSAP P GK    QA+++ I
Sbjct  124  HPNAMPVLTYDGTALRYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKMKGAQALSMRI  183

Query  605  SGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDT  784
            SGNKAAFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L T+L+V  GD 
Sbjct  184  SGNKAAFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDG  242

Query  785  MAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            + ++TAH  K+A E TG +FV C++TG+ 
Sbjct  243  IRVITAHAGKTAQEKTGYTFVHCKVTGTG  271



>ref|XP_008338559.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=370

 Score =   270 bits (689),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 180/273 (66%), Gaps = 7/273 (3%)
 Frame = +2

Query  62   CMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPAL  241
            CM    +++  ++  ++      +  D  P+PA  SQV +WF  +V+P    +K +DPA+
Sbjct  7    CM----VVHAALIMTILLSATIAMADDNTPVPAALSQVNTWFNNNVKPYTQRQKTLDPAV  62

Query  242  VKAEAAPVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFV  415
            V AEA    +KV + G+  FKT+ +A+ +IPA NTKR I++I  G+Y E++ I  ++PFV
Sbjct  63   VTAEAGQKVIKVMQDGKGNFKTVTDAINSIPAGNTKRVIVYIGSGEYKEKITIPRNKPFV  122

Query  416  TLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAV  592
            TLYG P N P L    TA + GT+ SAT+   SDYF+A N+ +KNS+PRP GK    QAV
Sbjct  123  TLYGSPTNMPILTFDGTAQKYGTVNSATVIAESDYFVAANLIIKNSSPRPDGKRVGAQAV  182

Query  593  ALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVF  772
            AL +SGNKAA YNCK +GFQDTLCD+   H +KDCYIEGTVDF +G  KS+ LN ELHV 
Sbjct  183  ALRVSGNKAALYNCKLFGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNXELHVL  242

Query  773  PGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
              + + ++TA  R S  EDTG SFV C+ITG+ 
Sbjct  243  GDNGITVITAQARDSDSEDTGYSFVHCKITGTG  275



>ref|XP_006572810.1| PREDICTED: uncharacterized protein LOC100306177 isoform X2 [Glycine 
max]
Length=328

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 170/247 (69%), Gaps = 3/247 (1%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKT  301
            V+  DTVPIPA K+Q+  W+  +V PL   +  VDPALV AE     +KV +   G+FKT
Sbjct  24   VLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAKVVKVMQDGSGEFKT  83

Query  302  IQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG  481
            I +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    TA Q G
Sbjct  84   ITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGTAQQYG  143

Query  482  TIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDT  658
            T+ SATL V SDYF+A NI + N+APRP  K P  QAVAL ISG+KAAFYNCK YGFQDT
Sbjct  144  TVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMYGFQDT  203

Query  659  LCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGL  838
            +CD+ N+HF+KDC I+GT+D+ FG  KS+ ++TEL     + + ++ A  RKS  ED   
Sbjct  204  ICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVIVAQARKSETEDNAY  263

Query  839  SFVQCRI  859
            SFV C +
Sbjct  264  SFVHCDV  270



>ref|XP_003518804.1| PREDICTED: pectinesterase PPME1 [Glycine max]
Length=369

 Score =   268 bits (686),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 172/248 (69%), Gaps = 3/248 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            DTVPIPA K+Q+ +WF  +V PL   +  +DPALV AE     +KV +   G+FKTI +A
Sbjct  28   DTVPIPAHKAQLGTWFSTNVGPLDQRKSTMDPALVAAEEGAKVVKVMQDGSGEFKTITDA  87

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP+ NTKR I++I  G YNE++KI+  +PF+TLYG P+  P L    TA + GT+ S
Sbjct  88   INSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPFITLYGVPEKMPNLTFGGTALKYGTVDS  147

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL V SDYF+A NI + NSAPRP GK    QAVAL ISG+KAAFYNCKF+GFQDT+CD+
Sbjct  148  ATLIVESDYFVAANIIISNSAPRPDGKIQGGQAVALRISGDKAAFYNCKFFGFQDTICDD  207

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
             N+HF+KDC I+GT+D+ FG  KS+ L+TEL       + ++ A  RKS  ED   SFV 
Sbjct  208  RNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRTLGDTGITVIVAQARKSPTEDNAYSFVH  267

Query  851  CRITGSAD  874
            C +TG+ +
Sbjct  268  CDVTGTGN  275



>ref|XP_008376964.1| PREDICTED: probable pectinesterase 48 [Malus domestica]
Length=316

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/245 (52%), Positives = 166/245 (68%), Gaps = 3/245 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKTIQEA  313
            D  PIP++ SQ+ +WF  + +P    +  +DPA+V AEA    +KV + G+  FKT+ +A
Sbjct  29   DNTPIPSDHSQINTWFDNNXKPYTERQSTLDPAVVTAEAGQTVIKVMQDGKGDFKTVTDA  88

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR I+   GG+YNE++ I  ++PFVTLYG P N P L    TA + GT+ S
Sbjct  89   INSIPAGNTKRVIVHXGGGEYNEKIXIPRNKPFVTLYGSPXNMPNLTFDGTAQKYGTVNS  148

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT+   SDYF+A N+ +KNS+PRP GK    QAVAL +SGN +A YNCK  GFQDTLCD+
Sbjct  149  ATVIAESDYFVAANLLIKNSSPRPDGKRVGAQAVALRVSGNNSALYNCKLVGFQDTLCDD  208

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               H +KDCYIEGTVDF +G  KS+ LNTELHV     + ++TA  R SA EDTG SFV 
Sbjct  209  RGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVITAQARDSASEDTGYSFVH  268

Query  851  CRITG  865
            C ITG
Sbjct  269  CNITG  273



>gb|KFK27921.1| hypothetical protein AALP_AA8G447400 [Arabis alpina]
Length=364

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 136/264 (52%), Positives = 179/264 (68%), Gaps = 4/264 (2%)
 Frame = +2

Query  89   VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY  268
            +VI  ++V     V   D  PIP  K  +E WF+ +V  L S +  +D AL+ AE AP  
Sbjct  9    IVIALLVVVTSPVVFGNDASPIPENKFGIEQWFKTNVPSLASRKGTLDQALLIAETAPRV  68

Query  269  LKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
            +KV K G+  FKTI EA+K++   NT+R II I  G Y E++ ID ++PF+TLYG P   
Sbjct  69   IKVKKNGRGHFKTITEAIKSVREGNTRRVIIKIGPGVYKEKITIDRNKPFITLYGHPNAM  128

Query  443  PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKA  619
            P L    TA Q GT+ SATL V+SDYFMAVNI VKNSAP P GK    QA+++ ISGNKA
Sbjct  129  PVLTYDGTALQYGTVDSATLIVMSDYFMAVNIIVKNSAPMPDGKMKGAQALSMRISGNKA  188

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            AFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L+T+LHV  GD + ++T
Sbjct  189  AFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLHVV-GDGIRVIT  247

Query  800  AHGRKSAIEDTGLSFVQCRITGSA  871
            AH  K+ +E++G +FV C +TG+ 
Sbjct  248  AHAGKATVENSGYTFVHCTVTGTG  271



>ref|XP_010523329.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=362

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 171/247 (69%), Gaps = 4/247 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  PIP  K+Q++ WFRA+V PL   +  +DPALV AEAAP  ++V K  GG FKT+  A
Sbjct  24   DATPIPQNKAQLQQWFRANVAPLAQRKGSLDPALVAAEAAPRVIRVNKNGGGDFKTLNAA  83

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR II +  G+Y E+V ID ++PFVTLYG P   P L    TAA+ GT+ S
Sbjct  84   INSIPAGNTKRVIIKLGPGEYREKVTIDRNKPFVTLYGQPNAMPVLTYDGTAAKYGTVDS  143

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT  VLSDYFMAVN+  KNSAP P G+    QA+A  +SGNKAAFYNCKFYG+QDT+CD+
Sbjct  144  ATFIVLSDYFMAVNVIFKNSAPMPDGRMKGAQALAARVSGNKAAFYNCKFYGYQDTVCDD  203

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
            I  HF+KDCYIEGT DF FG   S+ LNT+L+V  G+ + ++TA   KS  + +G  F  
Sbjct  204  IGNHFFKDCYIEGTFDFIFGSGTSLYLNTQLNVV-GNGIRVITAEAGKSVSDPSGYVFAH  262

Query  851  CRITGSA  871
             R+TG+ 
Sbjct  263  SRVTGTG  269



>gb|KHN29928.1| Pectinesterase PPME1-like protein [Glycine soja]
Length=369

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 172/248 (69%), Gaps = 3/248 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            DTVPIPA K+Q+ +WF  +V PL   +  +DPALV AE     +KV +   G+FKTI +A
Sbjct  28   DTVPIPANKAQLGTWFSTNVGPLDQRKSTMDPALVAAEEGAKVVKVMQDGSGEFKTITDA  87

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP+ NTKR I++I  G YNE++KI+  +PF+TLYG P+  P L    TA + GT+ S
Sbjct  88   INSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPFITLYGVPEKMPNLTFGGTALKYGTVDS  147

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL V SDYF+A NI + NSAPRP GK    QAVAL ISG+KAAFYNCKF+GFQDT+CD+
Sbjct  148  ATLIVESDYFVAANIIISNSAPRPDGKIQGGQAVALRISGDKAAFYNCKFFGFQDTICDD  207

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
             N+HF+KDC I+GT+D+ FG  KS+ L+TEL       + ++ A  RKS  ED   SFV 
Sbjct  208  RNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRTLGDTGITVIVAQARKSPTEDNAYSFVH  267

Query  851  CRITGSAD  874
            C +TG+ +
Sbjct  268  CDVTGTGN  275



>ref|XP_006381893.1| hypothetical protein POPTR_0006s20010g [Populus trichocarpa]
 gb|ERP59690.1| hypothetical protein POPTR_0006s20010g [Populus trichocarpa]
Length=365

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 177/258 (69%), Gaps = 6/258 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  PIPA+ S +  WF+ +V+PL + +  +DPAL+ AEA P  +KV K   G+FKT+++A
Sbjct  26   DKSPIPADPSSLNKWFQDNVRPLANRKGTIDPALMAAEAKPRTIKVRKDGSGEFKTLKDA  85

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP  N +R I+ I  G+Y E++KI+  +PFVT  G P N PTL    TA + GT+YS
Sbjct  86   INSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGSPSNMPTLSFDGTARKYGTVYS  145

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL   +DYF+A NI +KNSAPRP G+   +QAVAL ISG+K+AFYNC+F GFQDTLCD+
Sbjct  146  ATLEAEADYFVAANIIIKNSAPRPKGQLKGEQAVALRISGDKSAFYNCRFIGFQDTLCDD  205

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
              +H +KDCYIEGTVD+ FG  KS+ L TELHV   +    +TAH R +  E+TG SFV 
Sbjct  206  KGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDEKGNFITAHARNNEAENTGFSFVH  265

Query  851  CRITGSADPKAKVAVLGR  904
            C++ G+     K A LGR
Sbjct  266  CKVDGTG---TKRAYLGR  280



>ref|XP_011033438.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=377

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/272 (49%), Positives = 179/272 (66%), Gaps = 6/272 (2%)
 Frame = +2

Query  98   VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
            +  ++     V   D  PIPA+ S +  WF+ +V+PL   +  +DPAL+ AEA P  +KV
Sbjct  24   ITAILLVSATVSSDDKSPIPADPSSLNKWFQDNVRPLADRKGTIDPALLAAEAKPRTIKV  83

Query  278  GK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
             K   G+FKT+++A+ +IP  N +R I+ I  G+Y E++KI+  +PFVT  G P N PTL
Sbjct  84   RKDGSGEFKTLKDAINSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGSPGNMPTL  143

Query  452  VAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFY  628
                TA Q GT+YSATL   +DYF+A NI +KNSAPRP G+   +QAVAL ISG+K+AFY
Sbjct  144  SFDGTARQYGTVYSATLEAEADYFVAANIIIKNSAPRPQGQLKGEQAVALRISGDKSAFY  203

Query  629  NCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHG  808
            NC+F GFQDTLCD+  +H +KDCYIEGTVD+ FG  KS+ L TEL V   +    +TAH 
Sbjct  204  NCRFIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELRVIGDEKGNFITAHA  263

Query  809  RKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            R +  EDTG SFV C++ G+     K A LGR
Sbjct  264  RNNEAEDTGFSFVHCKVDGTG---TKRAYLGR  292



>ref|XP_006572809.1| PREDICTED: uncharacterized protein LOC100306177 isoform X1 [Glycine 
max]
Length=369

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 170/247 (69%), Gaps = 3/247 (1%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKT  301
            V+  DTVPIPA K+Q+  W+  +V PL   +  VDPALV AE     +KV +   G+FKT
Sbjct  24   VLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAKVVKVMQDGSGEFKT  83

Query  302  IQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG  481
            I +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    TA Q G
Sbjct  84   ITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGTAQQYG  143

Query  482  TIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDT  658
            T+ SATL V SDYF+A NI + N+APRP  K P  QAVAL ISG+KAAFYNCK YGFQDT
Sbjct  144  TVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMYGFQDT  203

Query  659  LCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGL  838
            +CD+ N+HF+KDC I+GT+D+ FG  KS+ ++TEL     + + ++ A  RKS  ED   
Sbjct  204  ICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVIVAQARKSETEDNAY  263

Query  839  SFVQCRI  859
            SFV C +
Sbjct  264  SFVHCDV  270



>ref|XP_003517875.1| PREDICTED: pectinesterase PPME1 [Glycine max]
 gb|KHN04070.1| Pectinesterase PPME1 [Glycine soja]
 gb|KHN32883.1| Pectinesterase PPME1 [Glycine soja]
 gb|KHN44801.1| Pectinesterase PPME1 [Glycine soja]
Length=369

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 170/247 (69%), Gaps = 3/247 (1%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKT  301
            V+  DTVPIPA K+Q+  W+  +V PL   +  VDPALV AE     +KV +   G+FKT
Sbjct  24   VLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAKVVKVMQDGSGEFKT  83

Query  302  IQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG  481
            I +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    TA Q G
Sbjct  84   ITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGTAQQYG  143

Query  482  TIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDT  658
            T+ SATL V SDYF+A NI + N+APRP  K P  QAVAL ISG+KAAFYNCK YGFQDT
Sbjct  144  TVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMYGFQDT  203

Query  659  LCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGL  838
            +CD+ N+HF+KDC I+GT+D+ FG  KS+ ++TEL     + + ++ A  RKS  ED   
Sbjct  204  ICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVIVAQARKSETEDNAY  263

Query  839  SFVQCRI  859
            SFV C +
Sbjct  264  SFVHCDV  270



>ref|XP_010038407.1| PREDICTED: putative pectinesterase 63 [Eucalyptus grandis]
 gb|KCW46225.1| hypothetical protein EUGRSUZ_K00113 [Eucalyptus grandis]
Length=372

 Score =   267 bits (682),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 178/268 (66%), Gaps = 4/268 (1%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            L + I+ +L+      +  D +PIPA+KSQV +WF+ +VQ  ++ +  +DP L  AEA P
Sbjct  13   LAIAILSLLIALAQIAVSDDKIPIPADKSQVNAWFQQNVQAFEARKGTLDPNLEAAEAIP  72

Query  263  ---VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
               + +     G FKT+ EA+ +IPA N++R I+ IAGG Y E++ I+  +PFVTLYG P
Sbjct  73   PKVIRVSQDGSGDFKTVTEAINSIPAGNSQRVIVSIAGGVYKEKITIERTKPFVTLYGSP  132

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISG  610
             + P L  + TA Q GT+ SA++ V SDYF+  N+ ++NSAPRP GK    QAVAL  SG
Sbjct  133  NDMPKLTYSGTAQQYGTVDSASIIVESDYFVGANLIIENSAPRPDGKAAGGQAVALRTSG  192

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            +KAAFYNC+  GFQDTLCD+   HF+KDCYIEGTVDF FG   SI LNTEL V     ++
Sbjct  193  DKAAFYNCRMLGFQDTLCDDRGFHFFKDCYIEGTVDFIFGSGTSIYLNTELRVLGDSGLS  252

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSAD  874
            ++TA  R+S  EDTG S V C ITG+ +
Sbjct  253  VITAQARQSNTEDTGYSLVHCSITGTGN  280



>ref|XP_011040323.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=362

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 182/282 (65%), Gaps = 7/282 (2%)
 Frame = +2

Query  65   METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
            M T ++  +V + +L+         DT PIP E S + SWF+A+V+P       +DPAL 
Sbjct  1    MSTGKVTGMVAIVILLLVSPAAGSRDTGPIPGEPSSLNSWFQANVKPYTQRNGTLDPALE  60

Query  245  KAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
             AEA P  + V K   G FKT+  AV++I + NT+R I+ I  G YNE+++ID  +PFVT
Sbjct  61   TAEAKPKTIMVRKDGSGDFKTLTSAVRSISSGNTQRVIVDIGSGVYNEKIQIDKGKPFVT  120

Query  419  LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVAL  598
              G  ++ PTL  A TA   GT+YSATL V SDYF+A NI +KNS+PRPSGK  +QAVAL
Sbjct  121  FKGSARSVPTLTFAGTARVYGTVYSATLQVDSDYFVASNIIIKNSSPRPSGKLKEQAVAL  180

Query  599  TISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPG  778
             I G+KAAFYNC+  GFQDTLCD+  +HF+KDCYIEGTVDF FG  KS+ L T ++V   
Sbjct  181  RIGGDKAAFYNCRLVGFQDTLCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLGTAINVLAD  240

Query  779  DTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
              +A++TA  R    +DTG SFV C++ G      K A LGR
Sbjct  241  QGLAVITAQARNKE-DDTGFSFVHCKVNGI----GKGAFLGR  277



>ref|XP_002309337.2| hypothetical protein POPTR_0006s20000g [Populus trichocarpa]
 gb|EEE92860.2| hypothetical protein POPTR_0006s20000g [Populus trichocarpa]
Length=365

 Score =   266 bits (680),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 176/258 (68%), Gaps = 6/258 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  PIPA+ S +  WF+ +V+PL + +  +DPAL  AEA P  +KV K   G+FKT+++A
Sbjct  26   DKSPIPADPSSLNKWFQDNVRPLANRKGTIDPALKAAEAKPRTIKVRKDGSGEFKTLKDA  85

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP  N +R I+ I  G+Y E++KI+  +PFVT  G P N PTL    TA + GT+YS
Sbjct  86   INSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGSPSNMPTLSFDGTARKYGTVYS  145

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL   +DYF+A NI +KNSAPRP G+   +QAVAL ISG+K+AFYNC+F GFQDTLCD+
Sbjct  146  ATLEAEADYFVAANIIIKNSAPRPKGQLKGEQAVALRISGDKSAFYNCRFIGFQDTLCDD  205

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
              +H +KDCYIEGTVD+ FG  KS+ L TELHV   +    +TAH R +  E+TG SFV 
Sbjct  206  KGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDEKGNFITAHARNNEAENTGFSFVH  265

Query  851  CRITGSADPKAKVAVLGR  904
            C++ G+     K A LGR
Sbjct  266  CKVDGNG---TKRAYLGR  280



>ref|XP_004513231.1| PREDICTED: pectinesterase 1-like [Cicer arietinum]
Length=370

 Score =   266 bits (680),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/273 (50%), Positives = 177/273 (65%), Gaps = 4/273 (1%)
 Frame = +2

Query  68   ETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVK  247
            +TVR    V + +       V+  D VPIP++K+Q+ +WF  +V+PL   +  +DPALV 
Sbjct  4    KTVRSYIHVALVISFLTANIVLSDDNVPIPSDKAQLNTWFNNNVKPLSQRKNTLDPALVT  63

Query  248  AEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTL  421
            AE     +KV K   G FKTI +A+K+IP  NTKR I++I GG +NE++ I   +PFVTL
Sbjct  64   AEEGAKVVKVMKDGSGDFKTITDAIKSIPEGNTKRVIVYIGGGNFNEKITIGRTKPFVTL  123

Query  422  YGD-PKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVA  595
            YG    N P L    TA Q GT+ SATL V  DYF+A NI + N+APRP GK    QAVA
Sbjct  124  YGALGGNMPNLTYGGTAQQYGTVDSATLIVEGDYFVAANIMISNTAPRPDGKRQGAQAVA  183

Query  596  LTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFP  775
            L ISG+KA+FYNCK  GFQDT+CD+ N+H +K+C I+GTVDF FG  KS+ LNTEL V  
Sbjct  184  LRISGDKASFYNCKLLGFQDTVCDDRNRHLFKNCLIQGTVDFIFGSGKSLYLNTELRVLG  243

Query  776  GDTMAMVTAHGRKSAIEDTGLSFVQCRITGSAD  874
               M ++ A  RKS  ED G SFV C ITG+ +
Sbjct  244  DTGMTVIVAQARKSDSEDNGYSFVHCDITGTGN  276



>emb|CDY23044.1| BnaC07g31430D [Brassica napus]
Length=451

 Score =   269 bits (687),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/264 (51%), Positives = 181/264 (69%), Gaps = 4/264 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            L + I+ V++  P  V   D  PIP  K+++E WF  +V  L S +  +DPAL+ AEA P
Sbjct  8    LILTILLVVITWPV-VYGNDATPIPQNKNRIEQWFNTNVPSLASRKDKLDPALLTAEATP  66

Query  263  VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
               + G+G  F T+ EA+ ++P  N +R II +  G+Y E+V ID ++PF+TLYG+P   
Sbjct  67   RVRQNGRG-DFNTLTEAINSVPVGNNERVIIKLGHGEYKEKVTIDRNKPFITLYGNPNAM  125

Query  443  PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKA  619
            P L    TAA+ GT+ SATL VLSDYFMA+NI VKNSAP P GK    QA+++ ISGNKA
Sbjct  126  PVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNKA  185

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            AFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L+T+L+V  GD + ++T
Sbjct  186  AFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRVIT  244

Query  800  AHGRKSAIEDTGLSFVQCRITGSA  871
            AH  KS  E +G SFV C++TG+ 
Sbjct  245  AHAGKSTEEKSGYSFVHCKVTGTG  268



>gb|KFK25128.1| hypothetical protein AALP_AA8G069700 [Arabis alpina]
Length=361

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 175/263 (67%), Gaps = 3/263 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            ++  ++VF    V+  DT PIP ++S++  WF  +V P    +  +DPAL  AEA+ + +
Sbjct  8    IVAFLVVFASPVVLATDTDPIPEDRSKIPQWFHTNVAPYSKRKGTLDPALDAAEASRLII  67

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  GG FKTI EAVK+IPA N  R II +A G YNE+V ID  RPFVTL G P    
Sbjct  68   TVNQQGGGNFKTINEAVKSIPAGNKNRVIIKLAPGIYNEKVTIDIARPFVTLLGQPGAET  127

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    TAA+ GT+ SATL V SDYFMA N+ +KN+AP P      QA+A+ I+G+KAAF
Sbjct  128  VLTYHGTAAKYGTVESATLIVWSDYFMAANLVIKNTAPMPKPGSQGQALAMRINGDKAAF  187

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            YNC+FYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TA 
Sbjct  188  YNCRFYGFQDTLCDDKGTHFFKDCYIEGTYDFIFGRGASLYLNTKLHAV-GDGLRVITAQ  246

Query  806  GRKSAIEDTGLSFVQCRITGSAD  874
            GR+S  E  G +FV C++TG+ +
Sbjct  247  GRQSDNEQNGYTFVHCKVTGTGN  269



>ref|XP_003516497.1| PREDICTED: pectinesterase PPME1 [Glycine max]
Length=369

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 170/247 (69%), Gaps = 3/247 (1%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKT  301
            V+  DTVPIPA K+Q+  W+  +V PL   +  +DPALV AE     +KV +   G+FKT
Sbjct  24   VLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTMDPALVTAEEGAKVVKVMQDGSGEFKT  83

Query  302  IQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG  481
            I +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    TA Q G
Sbjct  84   ITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGTAQQYG  143

Query  482  TIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDT  658
            T+ SATL V SDYF+A NI + N+APRP  K P  QAVAL ISG+KAAFYNCK YGFQDT
Sbjct  144  TVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMYGFQDT  203

Query  659  LCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGL  838
            +CD+ N+HF+KDC I+GT+D+ FG  KS+ ++TEL     + + ++ A  RKS  ED   
Sbjct  204  ICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVIVAQARKSETEDNAY  263

Query  839  SFVQCRI  859
            SFV C +
Sbjct  264  SFVHCDV  270



>gb|AAT99258.1| pectin-methyltransferase precursor [Salsola kali]
Length=362

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 182/256 (71%), Gaps = 10/256 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY---LKVGKGGQFKTIQEAVKT  322
            IP   +++ESWF+ +V+P+ S +KG++P++V+ E+  V    ++    G+FKTI +AVK 
Sbjct  26   IPPNPAELESWFQGAVKPV-SEQKGLEPSVVQTESGGVETIEVRQDGSGKFKTISDAVKH  84

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSAT  499
            +   NTKR II I  G+Y E+VKI+   P++TLYG DPKNRPT+  A TAA+ GT+ SAT
Sbjct  85   VKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSAT  144

Query  500  LYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDNIN  676
            + V SDY +  ++ V NSAPRP GK    QA AL ISG++AAFYNCKF GFQDT+CD+  
Sbjct  145  VIVESDYSVGAHLIVTNSAPRPDGKRKGAQAGALRISGDRAAFYNCKFTGFQDTVCDDKG  204

Query  677  KHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCR  856
             HF+ DCY EGTVDF FG+A+S+ LNTELHV PGD MAM+TAH RK+A    G SFV C+
Sbjct  205  NHFFTDCYTEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCK  264

Query  857  ITGSADPKAKVAVLGR  904
            +TG+       A+LGR
Sbjct  265  VTGTGG----TALLGR  276



>ref|XP_011076542.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=370

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 174/265 (66%), Gaps = 4/265 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE--A  256
            + VV +  L+  P  +   D  PIPA K+Q+ SWF  +V PL S    +DPA+V+AE   
Sbjct  11   VEVVFLTALLVLPIALSTNDE-PIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNV  69

Query  257  APVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              V ++  + G FKT+ +A+K++P  N  R II I  G Y E+VKID    F+TLYGDP 
Sbjct  70   TVVRVRTDRSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYIEKVKIDRYTHFITLYGDPN  129

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGN  613
            N P ++   TAAQ GT+ SATL V SDYF AVN+ + NSAPRP GK    QAVA+ I+G 
Sbjct  130  NMPVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPRPDGKRVGAQAVAMKIAGE  189

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
             A+FYNC+ YGFQDTLCD+  KH +KDCY+EGTVDF FG  +S+ LN+E+HV PGD ++ 
Sbjct  190  YASFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSF  249

Query  794  VTAHGRKSAIEDTGLSFVQCRITGS  868
            + AH R    E  G  FV CR+TG+
Sbjct  250  IAAHSRSKHNEANGYVFVHCRVTGT  274



>ref|XP_011076543.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=370

 Score =   265 bits (678),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 173/265 (65%), Gaps = 4/265 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE--A  256
            + VV +  L+  P  +   D  PIPA K+Q+ SWF  +V PL S    +DPA+V+AE   
Sbjct  11   VEVVFLTALLVLPIALSTNDE-PIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNV  69

Query  257  APVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              V ++    G FKT+ +A+K++P  N  R II I  G Y E+VKID    F+TLYGDP 
Sbjct  70   TVVRVRTDGSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYTEKVKIDRYTHFITLYGDPN  129

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGN  613
            N P ++   TAAQ GT+ SATL V SDYF AVN+ + NSAPRP GK    QAVA+ I+G 
Sbjct  130  NMPVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPRPDGKRVGAQAVAMKIAGE  189

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
             A+FYNC+ YGFQDTLCD+  KH +KDCY+EGTVDF FG  +S+ LN+E+HV PGD ++ 
Sbjct  190  YASFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSF  249

Query  794  VTAHGRKSAIEDTGLSFVQCRITGS  868
            + AH R    E  G  FV CR+TG+
Sbjct  250  IAAHSRSKHNEANGYVFVHCRVTGT  274



>ref|XP_002277202.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38546.3| unnamed protein product [Vitis vinifera]
Length=369

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 170/247 (69%), Gaps = 3/247 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D   IP++KSQ+  WFR S+Q  +  R  +DPALV+AE +   +KV K  GG F T+  A
Sbjct  27   DNAQIPSDKSQLAPWFRNSIQKYKLRRTTLDPALVEAEDSVKIIKVSKSGGGNFNTVMAA  86

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            V ++PA NT+R II+I GG+Y E++KID D+PF+T YG P++ P L    TAA+ GT+ S
Sbjct  87   VNSVPAGNTRRVIIWIGGGEYEEKIKIDRDKPFITFYGSPEDMPKLSFDGTAAEFGTVDS  146

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL V SDYFMAVNI V NS+PRP GK    QAVAL +SG+KAAFYNC+  GFQDTLCD+
Sbjct  147  ATLIVESDYFMAVNIIVINSSPRPDGKRKGAQAVALRVSGDKAAFYNCRLIGFQDTLCDD  206

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
              +HF+  CY+EGTVD+ FG  KS+ L+TELH       +++TA  R    ED G SFV 
Sbjct  207  RGRHFFHGCYVEGTVDYIFGSGKSLYLSTELHTKGDGGFSVITAQARNLESEDNGYSFVH  266

Query  851  CRITGSA  871
            C ++G+ 
Sbjct  267  CTLSGTG  273



>ref|XP_008234141.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=367

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 176/263 (67%), Gaps = 7/263 (3%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            + + +++F     +  D  P+ A++SQV +WF  +V+P  + R  +DPAL  AEA    +
Sbjct  14   LTMTLILFTATITMADDHTPVLADQSQVNTWFNNNVKPYTARRGTLDPALATAEAGQKVI  73

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
            KV K   GQFKTI +A       NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  74   KVMKDGSGQFKTITDAX----XXNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPANMP  129

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAA  622
            TL  A T+ + GT+ SAT+   SDYF+A N+ +KNS+PRP GK    QAVAL +SGNK+A
Sbjct  130  TLTFAGTSQKYGTVNSATVIAESDYFVASNVIIKNSSPRPDGKRVGAQAVALRVSGNKSA  189

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
             YNCK  GFQDTLCD+   H +KDC+IEGTVDF +G  KS+ LNTELHV   + + ++TA
Sbjct  190  LYNCKLIGFQDTLCDDRGNHLFKDCFIEGTVDFIWGSGKSLYLNTELHVLGDNGLTVITA  249

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
              R SA EDTG SFV C+ITG+ 
Sbjct  250  QARDSASEDTGYSFVHCKITGTG  272



>ref|XP_010452709.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   264 bits (675),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 175/260 (67%), Gaps = 3/260 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            +I  ++VF P  V+  D  PIPAEK+QVE WF+A+VQP  + R  +DPAL  AEA+P  +
Sbjct  9    LIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPALEAAEASPRII  68

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  GG F +I  A+K+IP  N  R II +A G Y E+V +D  RPFVTL G P    
Sbjct  69   TVNQKGGGDFTSINAAIKSIPVGNKIRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPGAET  128

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    T+A+ GT+ SATL V + YFMA N+++ N+AP P      QA+A+ I+ +KAAF
Sbjct  129  NLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQGQALAMRINADKAAF  188

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            YNC+FYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TAH
Sbjct  189  YNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  247

Query  806  GRKSAIEDTGLSFVQCRITG  865
             R+++ + +G SFV C++TG
Sbjct  248  NRQNSNDQSGYSFVHCKVTG  267



>gb|KEH17536.1| pectinesterase-like protein [Medicago truncatula]
 gb|KEH17537.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 174/267 (65%), Gaps = 4/267 (1%)
 Frame = +2

Query  80   LLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            ++NV I+  L F     +  DT+P+PA ++QV+SWF  +V PL+  +  +DPALV AEA 
Sbjct  9    MINVAIIVAL-FMVNVALSDDTIPVPANRAQVDSWFNTNVGPLEQRKSTLDPALVTAEAG  67

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
               +KV +   G FKTI +A+ +IP  NT R I+ I GG YNE++KID  +PFVTLYG P
Sbjct  68   AKVIKVMQDGSGDFKTITDAINSIPTGNTVRVIVNIGGGSYNEKIKIDRTKPFVTLYGAP  127

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISG  610
             N P L    TA Q GT+ SATL   SDYF+A NI V NSAPRP GK    QAVAL ISG
Sbjct  128  GNMPNLTYGGTAKQYGTVDSATLIAESDYFVAANILVSNSAPRPDGKTAGGQAVALRISG  187

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            +KAAFYNCKF+GFQDT+CD+ + H +KDC I+GTVDF FG   S+ L +EL         
Sbjct  188  DKAAFYNCKFFGFQDTICDDRHNHIFKDCVIQGTVDFIFGSGTSLYLKSELRALDDTGPT  247

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSA  871
            ++ A  RK+A +    SFV C ITG+ 
Sbjct  248  VIVAQARKTASDADLYSFVHCDITGTG  274



>ref|XP_006485036.1| PREDICTED: pectinesterase PPME1-like [Citrus sinensis]
Length=370

 Score =   264 bits (674),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 166/244 (68%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTI  325
            IP EKSQ+ESWF A+V+P    +  +DPAL  A+A    +KV +   G+FKTI +A+ +I
Sbjct  34   IPPEKSQIESWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDAINSI  93

Query  326  PARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLY  505
            P  NTKR I+ I  G+Y E++KID  +PF+T YG P   P +    TA + GT+ SATL 
Sbjct  94   PQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDSATLI  153

Query  506  VLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTLCDNINKH  682
            V SDYFMAVNI + NS+PRP GK +  QAVAL ISG KAAFYNCK  GFQDTLCD+   H
Sbjct  154  VESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDDRGNH  213

Query  683  FYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRIT  862
            F+KDC+I+GTVDF FG  KS+ L+TEL       + ++TAH R+S  ED G +FV C I 
Sbjct  214  FFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVHCTIE  273

Query  863  GSAD  874
            GS +
Sbjct  274  GSGN  277



>ref|XP_006437032.1| hypothetical protein CICLE_v10031872mg [Citrus clementina]
 gb|ESR50272.1| hypothetical protein CICLE_v10031872mg [Citrus clementina]
Length=370

 Score =   263 bits (673),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 166/244 (68%), Gaps = 3/244 (1%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTI  325
            IP EKSQ+ESWF A+V+P    +  +DPAL  A+A    +KV +   G+FKTI +A+ +I
Sbjct  34   IPPEKSQIESWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDAINSI  93

Query  326  PARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLY  505
            P  NTKR I+ I  G+Y E++KID  +PF+T YG P   P +    TA + GT+ SATL 
Sbjct  94   PQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDSATLI  153

Query  506  VLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTLCDNINKH  682
            V SDYFMAVNI + NS+PRP GK +  QAVAL ISG KAAFYNCK  GFQDTLCD+   H
Sbjct  154  VESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDDRGNH  213

Query  683  FYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRIT  862
            F+KDC+I+GTVDF FG  KS+ L+TEL       + ++TAH R+S  ED G +FV C I 
Sbjct  214  FFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVHCTIE  273

Query  863  GSAD  874
            GS +
Sbjct  274  GSGN  277



>ref|XP_006399226.1| hypothetical protein EUTSA_v10013913mg [Eutrema salsugineum]
 gb|ESQ40679.1| hypothetical protein EUTSA_v10013913mg [Eutrema salsugineum]
Length=361

 Score =   263 bits (672),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 175/266 (66%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLV-FCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +++ IV   V F    V+  DT PIP ++SQ+  WF+ +V P    +  +DPAL  AEA+
Sbjct  4    ISLAIVAFFVAFASPVVLATDTAPIPEDRSQIPEWFKTNVAPYSQRKGTLDPALDAAEAS  63

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
               + V +  GG FKTI EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P
Sbjct  64   RQVITVDQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQP  123

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGN  613
             +   L    TAAQ GT+ SATL + SDYFMA N+ +KN++P P      QA+A+ I+G+
Sbjct  124  GSETVLTYHGTAAQYGTVESATLIIWSDYFMAANLIIKNTSPMPKPGSQGQALAMRINGD  183

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFY+CKF+GFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + +
Sbjct  184  KAAFYSCKFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            +TAH R+S  E  G +FV C++TG+ 
Sbjct  243  ITAHARESENEQNGYTFVHCKVTGTG  268



>ref|XP_003634032.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38547.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   263 bits (672),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 170/247 (69%), Gaps = 3/247 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D   IP++KSQ+  WFR S+Q  +  R  +DPALV+AE +   +KV K  GG F T+  A
Sbjct  26   DNAQIPSDKSQLAPWFRNSIQKYKLRRTTLDPALVEAEDSVKIIKVSKSGGGNFNTVMAA  85

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            V ++PA NT+R II+I GG Y E++KID ++PF+T YG P++ P L    TAA+ GT+ S
Sbjct  86   VNSVPAGNTQRVIIWIGGGVYEEKIKIDRNKPFITFYGSPEDMPKLSFDGTAAKFGTVDS  145

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL V SDYFMAVNI V NS+PRP GK    QAVAL +SG+KAAFYNC+  GFQDTLCD+
Sbjct  146  ATLIVESDYFMAVNIIVINSSPRPDGKRKGAQAVALRVSGDKAAFYNCRLIGFQDTLCDD  205

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
              +HF+ +CY+EGTVD+ FG  KS+ L+TELH       +++TA  R    ED G SFV 
Sbjct  206  RGRHFFHECYVEGTVDYIFGSGKSLYLSTELHTKGDGGFSVITAQARNLEWEDNGYSFVH  265

Query  851  CRITGSA  871
            C ++G+ 
Sbjct  266  CTLSGTG  272



>ref|XP_004287800.1| PREDICTED: probable pectinesterase 48-like [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   263 bits (671),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 175/263 (67%), Gaps = 4/263 (2%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA-PVY  268
            +++   V     V   D   IP++KS V+ WF+ +V+PL   +  +DP LVKAE   P  
Sbjct  14   LMMITTVLLAATVSMADDPVIPSDKSAVDKWFQDNVKPLADRKSSLDPDLVKAEDGDPKI  73

Query  269  LKV-GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
            +KV   GG FK I EA+ +IPA NTKR II++ GG YNE++ I  ++PFVTL GD KN P
Sbjct  74   VKVMANGGDFKKISEAIDSIPASNTKRVIIYVGGGVYNEKITIPKNKPFVTLMGDSKNMP  133

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAA  622
             L     +A+ GT+YSATL V SDYF+ VN+N+ NS+PRP GK +  QA+AL +SGNKAA
Sbjct  134  NLTFNGDSAKYGTLYSATLSVESDYFVGVNLNIINSSPRPDGKKEGAQALALKLSGNKAA  193

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
             YNC+ +GFQDTLCD+   HF KD Y+EGTVDF FG  KS+ LNT ++V     M ++TA
Sbjct  194  LYNCQMFGFQDTLCDDQGNHFIKDSYVEGTVDFIFGSGKSLYLNTHINVLGDSGMTVITA  253

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
            + R+   ED G SFV C ITG+ 
Sbjct  254  NAREGD-EDKGYSFVHCSITGTG  275



>ref|XP_010491360.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/260 (50%), Positives = 174/260 (67%), Gaps = 3/260 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            +I  ++VF P  V+  D  PIPAEK+QVE WF+A+VQP  + R  +DP L  AEA+P  +
Sbjct  9    LIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPDLEAAEASPRII  68

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  GG F +I  A+K+IP  N  R II +A G Y E+V +D  RPFVTL G P    
Sbjct  69   TVNQKGGGDFTSINAAIKSIPVGNKVRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPGAET  128

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    T+A+ GT+ SATL V + YFMA N+++ N+AP P      QA+A+ I+ +KAAF
Sbjct  129  NLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQGQALAMRINADKAAF  188

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            YNC+FYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TAH
Sbjct  189  YNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  247

Query  806  GRKSAIEDTGLSFVQCRITG  865
             R+++ + +G SFV C++TG
Sbjct  248  NRQNSNDQSGYSFVHCKVTG  267



>ref|XP_003517889.1| PREDICTED: pectinesterase PPME1-like [Glycine max]
Length=369

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 165/243 (68%), Gaps = 3/243 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D VPIPA K Q+ +WF  +V PL   +  +DPALV AE     +KV +   G+FKTI +A
Sbjct  28   DNVPIPANKEQLGTWFSTNVGPLDQRKSTIDPALVAAEEGAKVVKVMQDGSGEFKTITDA  87

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + ++P  NTKR I+FI  G YNE++KI+  +PFVTLYG P+  P L    TA Q GT+ S
Sbjct  88   INSVPNGNTKRVIVFIGAGNYNEKIKIERTKPFVTLYGVPEKMPNLTFGGTAQQYGTVDS  147

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL V SDYF+A NI + N+APRP  K P  QAVAL ISG+KAAFYNCK +GFQDT+CD+
Sbjct  148  ATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMFGFQDTICDD  207

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
             NKHF+KDC I+GT+D+ FG  KS+ ++TEL     + + ++ A  RKS  ED   SFV 
Sbjct  208  RNKHFFKDCLIQGTMDYIFGSGKSLYMSTELRTLGDNGITVIVAQARKSETEDNAYSFVH  267

Query  851  CRI  859
            C +
Sbjct  268  CDV  270



>ref|XP_010523318.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=364

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/265 (49%), Positives = 172/265 (65%), Gaps = 4/265 (2%)
 Frame = +2

Query  89   VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY  268
            V ++ VL   P  V+  D  PIP  K QV  WF A VQP    +  +DPAL  AE++P  
Sbjct  9    VALLMVLASPPPAVLANDVTPIPENKGQVNPWFNAQVQPFSRRKATLDPALAAAESSPRV  68

Query  269  LKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
            ++V K  GG F T+  A+ +IP+ N +R II +  G+Y E+V I   +PFVTLYG P   
Sbjct  69   IRVNKNGGGDFNTLTAAINSIPSGNARRVIIKLGPGEYREKVTIGRTKPFVTLYGQPNAM  128

Query  443  PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQ-QAVALTISGNKA  619
            P L     A Q GT  SATL VLSDYF AVNI VKN+AP+P  + D  QA+A+ ISGNKA
Sbjct  129  PVLTFNGKATQYGTFNSATLIVLSDYFTAVNIIVKNTAPKPDPRRDDGQALAMRISGNKA  188

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            AFYNCKFYGFQDTLCD+   HF+KDCY+EGT DF FG+  S+ + T +H   G+ + +++
Sbjct  189  AFYNCKFYGFQDTLCDDTGNHFFKDCYVEGTFDFIFGNGTSLYIGTLIHAV-GNGIRVIS  247

Query  800  AHGRKSAIEDTGLSFVQCRITGSAD  874
            A G +SA + +G SFV C++TG  +
Sbjct  248  AQGAQSAKDPSGYSFVHCKVTGEGE  272



>ref|XP_010666418.1| PREDICTED: pectinesterase 1-like [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 176/256 (69%), Gaps = 9/256 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY---LKVGKGGQFKTIQEAVKT  322
            IP   ++VE+WF   V+P+   +  ++P+++ AE   V    ++    G+FKTI +AVK 
Sbjct  25   IPENAAEVETWFSNVVKPISQAKGALEPSVIDAENGGVETIDVRQDGSGKFKTISDAVKH  84

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSAT  499
            +   N KR II I  G+Y E+VKI+  + ++T YG DPKNRPT+    TAAQ GT+ SAT
Sbjct  85   VKVGNKKRVIITIGPGEYREKVKIERLQSYITFYGTDPKNRPTITFGGTAAQYGTVDSAT  144

Query  500  LYVLSDYFMAVNINVKNSAPRPSGKPDQ-QAVALTISGNKAAFYNCKFYGFQDTLCDNIN  676
            L V SDYF+A N+ + NSAPRP+GK    QA A+ ISG+++AFYNCKF GFQDT+CD+  
Sbjct  145  LIVESDYFVAANLIISNSAPRPNGKTKGGQAAAIRISGDRSAFYNCKFTGFQDTVCDDKG  204

Query  677  KHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCR  856
             HF+KDCYIEGTVDF FG+A+SI LNTELHV PGD  AM+TAH R +     G SFV C+
Sbjct  205  NHFFKDCYIEGTVDFIFGEARSIYLNTELHVIPGDLEAMITAHARGNQDGVGGYSFVHCK  264

Query  857  ITGSADPKAKVAVLGR  904
            +TG+      +AVLGR
Sbjct  265  VTGTGG----IAVLGR  276



>ref|XP_007038214.1| Pectinesterase isoform 2, partial [Theobroma cacao]
 gb|EOY22715.1| Pectinesterase isoform 2, partial [Theobroma cacao]
Length=314

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/277 (49%), Positives = 180/277 (65%), Gaps = 18/277 (6%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +   I  +LV  P  V+  ++ PIP +KSQ+++WF A+++P  +    +DPAL KAE A 
Sbjct  11   VGAAICTILVLAPV-VLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAA  69

Query  263  VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV K   G F TI +A+ ++P+ NTKR II I GG Y E+++ID  +PF+T YGDP+
Sbjct  70   HIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPR  129

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGN  613
            N P L    TA Q GT+ SATL V SDYF+A NI ++N+APRP G     QAV+L ISG+
Sbjct  130  NMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGD  189

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNCK  GFQDTLCD+   HF+KDCYI GTVDF FG  KS+ L           + +
Sbjct  190  KAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLG----------VTV  239

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            +TA  R+S+ E+TG SFV C +TG+A      A LGR
Sbjct  240  ITAQARESSSENTGYSFVHCTVTGTASG----AYLGR  272



>ref|XP_010423211.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   261 bits (668),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 174/260 (67%), Gaps = 3/260 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            +I  ++VF P  V+  D  PIPAEK+QVE WF+A+VQP  + R  +DP L  AEA+P  +
Sbjct  9    LIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPDLEAAEASPRII  68

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  GG F ++  A+K+IP  N  R II +A G Y E+V +D  RPFVTL G P    
Sbjct  69   TVNQKGGGDFTSVNAAIKSIPVGNKIRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPGAET  128

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    T+A+ GT+ SATL V + YFMA N+++ N+AP P      QA+A+ I+ +KAAF
Sbjct  129  NLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQGQALAMRINADKAAF  188

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            YNC+FYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TAH
Sbjct  189  YNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  247

Query  806  GRKSAIEDTGLSFVQCRITG  865
             R+++ + +G SFV C++TG
Sbjct  248  NRQNSNDQSGYSFVHCKVTG  267



>emb|CDX81050.1| BnaC03g03040D [Brassica napus]
Length=361

 Score =   261 bits (667),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 173/266 (65%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLV-FCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +++ IV  L+ F    V+  DT PIP ++SQ+  WF+ +V P    +  +DPAL  AE A
Sbjct  4    ISLTIVAFLIAFASPVVLATDTAPIPEDRSQIPQWFQTNVAPYSQRKGTLDPALEAAETA  63

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
               + V +  G  FKTI EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P
Sbjct  64   RQIITVNQKGGANFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDVARPFVTLLGQP  123

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGN  613
             +   L    TAAQ GT+ SATL V SDYF+A N+ +KN+AP P      QA+A+ I+G+
Sbjct  124  GSETILTYHGTAAQYGTVESATLIVWSDYFLAANLIIKNTAPMPKPGAQGQALAMRINGD  183

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFY+CKFYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + +
Sbjct  184  KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            +TA  R+S  E  G +FV C+ITG+ 
Sbjct  243  ITAQARQSDTEQNGYTFVHCKITGTG  268



>ref|XP_002321778.1| hypothetical protein POPTR_0015s12220g [Populus trichocarpa]
 gb|EEF05905.1| hypothetical protein POPTR_0015s12220g [Populus trichocarpa]
Length=362

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/282 (48%), Positives = 179/282 (63%), Gaps = 7/282 (2%)
 Frame = +2

Query  65   METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
            M T ++  +    +L+         DT PIP E S + SWF A+V+        +DPAL 
Sbjct  1    MSTGKVTGIAAFVILLLVSTTAGSKDTSPIPGEPSSLNSWFHANVKSYTQRNGTLDPALE  60

Query  245  KAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
             AEA P  ++V K   G FKT+  AV++I + NT+R I+ I  G YNE+++I+ ++PFVT
Sbjct  61   TAEAKPKTIRVRKDGSGDFKTLTGAVRSISSGNTQRVIVDIGSGVYNEKIQIEKEKPFVT  120

Query  419  LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVAL  598
              G   + PTL  A TA   GT+YSATL V SDYF+A NI +KNS+PRPSGK  +QAVAL
Sbjct  121  FKGSASSMPTLTFAGTARVYGTVYSATLQVDSDYFVASNIIIKNSSPRPSGKLKEQAVAL  180

Query  599  TISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPG  778
             I G+KAAFYNC+  GFQDTLCD+  +HF+KDCYIEGTVDF FG  KS+ L T ++V   
Sbjct  181  RIGGDKAAFYNCRLIGFQDTLCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLGTAINVLAD  240

Query  779  DTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
              +A++TA  R    +DTG SFV C++ G      K A LGR
Sbjct  241  QGLAVITAQARNKE-DDTGFSFVHCKVNGI----GKWAFLGR  277



>gb|KDO57708.1| hypothetical protein CISIN_1g039631mg [Citrus sinensis]
Length=369

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 166/248 (67%), Gaps = 3/248 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D   IP EKSQ+ SWF A+V+P    +  +DPAL  A+A    +KV +   G+FKTI +A
Sbjct  29   DGAVIPPEKSQIGSWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDA  88

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP  NTKR I+ I  G+Y E++KID  +PF+T YG P   P +    TA + GT+ S
Sbjct  89   INSIPQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDS  148

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL V SDYFMAVNI + NS+PRP GK +  QAVAL ISG KAAFYNCK  GFQDTLCD+
Sbjct  149  ATLIVESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDD  208

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF+KDC+I+GTVDF FG  KS+ L+TEL       + ++TAH R+S  ED G +FV 
Sbjct  209  RGNHFFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVH  268

Query  851  CRITGSAD  874
            C I GS +
Sbjct  269  CTIEGSGN  276



>ref|XP_010666417.1| PREDICTED: putative pectinesterase 63 [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 186/282 (66%), Gaps = 14/282 (5%)
 Frame = +2

Query  77   RLLNVVIVCVLVFCPGGVIPLDT-VPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE  253
            R LN+V+    +     +  +D    IP   ++VE+WF   V+P+   +  ++P++++AE
Sbjct  3    RKLNIVLASFFLV----IFRIDAQTLIPENPAEVETWFNNVVKPISQVKGALEPSVIEAE  58

Query  254  AAPVY---LKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
               V    ++    G+FKTI +AVK +   N KR II I  G+Y E+VKI+  + ++T Y
Sbjct  59   NGGVETIDVRQDGSGKFKTIADAVKHVKVGNKKRVIITIGPGEYREKVKIERLQSYITFY  118

Query  425  G-DPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQ-QAVAL  598
            G DPKNRPT+  A TAAQ GT+ SATL V SDYF+A N+ + NSAPRP GK    QA A+
Sbjct  119  GTDPKNRPTITFAGTAAQYGTVDSATLIVESDYFVAANLIISNSAPRPDGKTKGGQAAAI  178

Query  599  TISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPG  778
             ISG+++AFYNCKF GFQDT+CD+   HF+KDCYIEGTVDF FG+A+SI LNTELHV PG
Sbjct  179  RISGDRSAFYNCKFTGFQDTVCDDKGNHFFKDCYIEGTVDFIFGEARSIYLNTELHVIPG  238

Query  779  DTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            D  AM+TAH R +     G SFV C++TG+       AVLGR
Sbjct  239  DLEAMITAHARGNQDGVGGYSFVHCKVTGT----GSYAVLGR  276



>ref|XP_006286828.1| hypothetical protein CARUB_v10003776mg [Capsella rubella]
 gb|EOA19726.1| hypothetical protein CARUB_v10003776mg [Capsella rubella]
Length=362

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 172/262 (66%), Gaps = 3/262 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            +I  ++ F    V+  D  PIPAEK+QVE WF+A+V+PL   +  +DP L  AEA+P  +
Sbjct  9    LIAFLVAFATPVVLADDITPIPAEKAQVEPWFKANVKPLSERKGTLDPLLEAAEASPRII  68

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  GG F TI  A+K+IP  N KR I+ +A G Y E+V ID  RPFVTL G P    
Sbjct  69   TVNQKGGGDFTTINAAIKSIPLENKKRVIVKLAPGVYKEKVTIDIGRPFVTLLGKPGAET  128

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    T+A+ GT+ SATL + + YFMA N+N+ N++P P      QA+A+ I+G+KAAF
Sbjct  129  NLTFDGTSAKYGTVESATLIIWAQYFMAANLNLINTSPMPKPGTQGQALAMRINGDKAAF  188

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            YNC+FYGFQDTLCD+   HF+K+CYIEGT DF FG   S+ LNT+LH   GD + ++TAH
Sbjct  189  YNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  247

Query  806  GRKSAIEDTGLSFVQCRITGSA  871
             R++  E  G SFV C+ITG  
Sbjct  248  NRQNDNEQNGYSFVHCKITGDG  269



>ref|XP_002530224.1| Pectinesterase U1 precursor, putative [Ricinus communis]
 gb|EEF32171.1| Pectinesterase U1 precursor, putative [Ricinus communis]
Length=368

 Score =   260 bits (664),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/282 (48%), Positives = 175/282 (62%), Gaps = 6/282 (2%)
 Frame = +2

Query  65   METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
            M ++  +   I+ VL          DT  IP  +S + SWF A+V+P  S +  ++PAL 
Sbjct  5    MTSLDAIKCAIILVLAVLISTATSDDTEQIPESQSALNSWFEANVKPYASRKGTLNPALE  64

Query  245  KAEAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
             AEA P  +KV     G FKT+ +A+K+IP +NT+R I+ I  G Y E++ +D  +PFVT
Sbjct  65   AAEANPKTIKVRTDGSGDFKTVTDALKSIPVKNTQRVIVDIGPGVYTEKITVDIQKPFVT  124

Query  419  LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVAL  598
            LYG P   PTL    TA + GT  SATL V+SDYF+A NI +KN+APRP+GKP  QAVAL
Sbjct  125  LYGSPNAMPTLAFGGTAKEYGTDDSATLIVMSDYFVAANIIIKNTAPRPNGKPQGQAVAL  184

Query  599  TISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPG  778
             + G+KAA YNC+  GFQDTLCD+   HF+KDCYIEGT+DF FG  KSI LN+ +HV   
Sbjct  185  RLWGSKAAIYNCRILGFQDTLCDDHGMHFFKDCYIEGTIDFIFGLGKSIYLNSIIHVVDD  244

Query  779  DTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
              + ++TA       EDTG  FV C ITG        A LGR
Sbjct  245  KLLTVITAQAGSDPKEDTGFVFVHCSITGD----GTGAFLGR  282



>ref|XP_009130989.1| PREDICTED: probable pectinesterase 50 [Brassica rapa]
Length=361

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/266 (49%), Positives = 173/266 (65%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLV-FCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +++ IV  LV F    V+  DT PIP ++SQ+  WF+ +V P    +  +DP+L  AE A
Sbjct  4    ISLTIVAFLVAFASPVVLATDTAPIPEDRSQIPQWFQTNVAPYSQRKGTLDPSLEAAETA  63

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
               + V +  G  FKTI EA+K+IP  N  R +I +A G YNE+V ID  RPF+TL G P
Sbjct  64   RQVITVNQKGGANFKTINEAIKSIPTGNKNRVVIKLAPGVYNEKVTIDVARPFITLLGQP  123

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGN  613
             +   L    TAAQ GT+ SATL V SDYF+A N+ +KN+AP P      QA+A+ I+G+
Sbjct  124  GSETILTYHGTAAQYGTVESATLIVWSDYFLAANLIIKNTAPMPKPGAQGQALAMRINGD  183

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFY+CKFYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + +
Sbjct  184  KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            +TA  R+S  E  G +FV C+ITG+ 
Sbjct  243  ITAQARQSDTEQNGYTFVHCKITGTG  268



>ref|XP_006289803.1| hypothetical protein CARUB_v10003407mg [Capsella rubella]
 gb|EOA22701.1| hypothetical protein CARUB_v10003407mg [Capsella rubella]
Length=362

 Score =   259 bits (661),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/266 (48%), Positives = 176/266 (66%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVI-PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +++ +V  LVF    V+   DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEA+
Sbjct  5    ISMFVVAFLVFFASSVVLATDTDPIPENRAQISQWFQTNVKPYSQRKGTLDPALDAAEAS  64

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
               + V +  GG FKT+ EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P
Sbjct  65   RRVITVNQKGGGNFKTLNEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQP  124

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGN  613
                 L    TAA+ GT+ SATL + S+YF A N+ ++N+AP P      QA+A+ I+G+
Sbjct  125  GAETVLTYHGTAAKYGTVESATLIIWSEYFQAANLIIRNTAPMPKPGTQGQALAMRINGD  184

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KA+FYNC+FYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + +
Sbjct  185  KASFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  243

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            +TAHGR++A + +G +F  C+ITG+ 
Sbjct  244  ITAHGRQNANDQSGYTFAHCKITGTG  269



>ref|XP_009363892.1| PREDICTED: probable pectinesterase 48 [Pyrus x bretschneideri]
Length=355

 Score =   258 bits (660),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/245 (51%), Positives = 164/245 (67%), Gaps = 3/245 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKTIQEA  313
            D  PIP++ SQ+ +WF  +V+P    +  +DPA+  AEA    +KV + G+  FKT+ +A
Sbjct  14   DNTPIPSDHSQINTWFNNNVKPYTERQSTLDPAVATAEAGQTVIKVMQDGKGDFKTVTDA  73

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR I+ I  G+YNE++ I  ++PFVTLYG P     L  A TA + GT+ S
Sbjct  74   INSIPAGNTKRVIVHIGRGEYNEKITIPQNKPFVTLYGSPTKMSNLTFAGTAQKYGTVNS  133

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT+    DYF+A N+ +KNS+PRP GK    QAVAL +SGN +A YNCK  GFQDTLCD+
Sbjct  134  ATVIAEFDYFIATNLLIKNSSPRPDGKRVGAQAVALRVSGNNSALYNCKLVGFQDTLCDD  193

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               H +KDCYIEGTVDF +G  KS+ LNTELHV     + ++TA  R SA EDTG SFV 
Sbjct  194  RGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVITAQARDSASEDTGYSFVH  253

Query  851  CRITG  865
            C +TG
Sbjct  254  CNVTG  258



>ref|XP_010452708.1| PREDICTED: probable pectinesterase 50 [Camelina sativa]
Length=361

 Score =   257 bits (657),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 173/266 (65%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVI-PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +++ +V  LVF    V+   DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEA+
Sbjct  4    MSMSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSQRKGKLDPALDAAEAS  63

Query  260  PVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
             + + V    GG FKTI EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P
Sbjct  64   RLIITVRYTGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQP  123

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGN  613
                 L    TAA+ GT+ SATL V SDYF A N+ ++N+AP P      QA+A+ I+G+
Sbjct  124  GAETVLTYHGTAAKYGTVESATLIVWSDYFQAANLIIRNTAPMPKPGSQGQALAMRINGD  183

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFY+CKFYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + +
Sbjct  184  KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            +TA  R SA E  G +FV C+ITG+ 
Sbjct  243  ITAQSRSSANEQNGYTFVHCKITGTG  268



>ref|XP_004516439.1| PREDICTED: pectinesterase PPME1-like [Cicer arietinum]
Length=367

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 173/262 (66%), Gaps = 4/262 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +NV I+  L F    V+  D   +PAE+++V+SWF +++ PL+  +  +DPALV AEA  
Sbjct  10   INVAIIVAL-FSANVVLSDDNAAVPAERAEVDSWFNSNIGPLEQRKSTLDPALVTAEANA  68

Query  263  VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV +   G FK+I +A+ +IP+ NT+R I+ I GG Y E++KI+  +PF+T  G P 
Sbjct  69   TIVKVNQDGSGDFKSITDAINSIPSGNTQRVILNIGGGNYQEKIKIEKTKPFITFIGTPS  128

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGN  613
            N P L    TA + GT+ SATL V SDYF+A NI + NSAPRP GK    QAVA+ I+G+
Sbjct  129  NMPNLTYGGTAQEYGTVDSATLIVESDYFVASNIMISNSAPRPDGKKSGAQAVAMRITGD  188

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNCKF GFQDT+CD+ N HF+KDC I+GTVDF FG+ +S+ L  EL V     M +
Sbjct  189  KAAFYNCKFLGFQDTICDDKNIHFFKDCLIQGTVDFIFGNGRSLYLKNELRVLGNAEMTV  248

Query  794  VTAHGRKSAIEDTGLSFVQCRI  859
            + A  RKS  E +  +FV C +
Sbjct  249  IVAQARKSESEKSLYTFVHCDV  270



>ref|XP_002871271.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47530.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 173/262 (66%), Gaps = 3/262 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            V+  ++VF    V+  DT PIP  ++Q+  WF+A+V+P    +  +DPAL  AEAA   +
Sbjct  8    VVAFLVVFASPLVLATDTDPIPETRAQIPQWFKANVKPYSQRKGTLDPALEAAEAARQII  67

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  G  FKTI EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P    
Sbjct  68   TVNQKGGANFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQPGAET  127

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    TAA+ GT+ SATL V ++YF+A ++ +KN+AP P      QA+A+ I+ +KAAF
Sbjct  128  VLTYHGTAAKYGTVESATLIVWAEYFLAAHLTIKNTAPMPKPGSQGQALAMRINADKAAF  187

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            Y+C+F+GFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TA 
Sbjct  188  YSCRFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAQ  246

Query  806  GRKSAIEDTGLSFVQCRITGSA  871
            GR+SA E  G +FV C++TG+ 
Sbjct  247  GRQSANEQNGYTFVHCKVTGTG  268



>ref|XP_010491359.1| PREDICTED: probable pectinesterase 50 [Camelina sativa]
Length=361

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/266 (48%), Positives = 174/266 (65%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVI-PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +++ +V  LVF    V+   DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEA+
Sbjct  4    MSMSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSMRKGKLDPALDAAEAS  63

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
             + + V +  GG FKTI EA+K+IP  N  R II +A G YNE+V +D  RPF+TL G P
Sbjct  64   RLIITVNQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTVDIARPFITLLGQP  123

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGN  613
                 L    TAA+ GT+ SATL V +DYF A N+ ++N+AP P      QA+A+ I+G+
Sbjct  124  GAETVLTYHGTAAKYGTVESATLIVWADYFQAANLIIRNTAPMPKPGSQGQALAMRINGD  183

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFY+CKFYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + +
Sbjct  184  KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            +TA  R SA E  G +FV C+ITG+ 
Sbjct  243  ITAQSRSSANEQNGYTFVHCKITGTG  268



>ref|XP_011076539.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=623

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 173/263 (66%), Gaps = 10/263 (4%)
 Frame = +2

Query  107  LVFCPGGVI------PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE--AAP  262
            +V+C GG +      P D  PIPA K+Q+ SWF  +V PL S    +DPA+V+AE     
Sbjct  266  VVYCRGGGLLDRSSRPSDE-PIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNVTV  324

Query  263  VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
            V ++    G FKT+ +A+K++P  N  R II I  G Y E+VKID    F+TLYGDP N 
Sbjct  325  VRVRTDGSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYTEKVKIDRYTHFITLYGDPNNM  384

Query  443  PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKA  619
            P ++   TAAQ GT+ SATL V SDYF AVN+ + NSAP+P GK    QAVA+ I+G  A
Sbjct  385  PVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPKPDGKRVGAQAVAIKIAGEYA  444

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            +FYNC+ YGFQDTLCD+  KH +KDCY+EGTVDF FG  +S+ LN+E+HV PGD ++ + 
Sbjct  445  SFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSFIA  504

Query  800  AHGRKSAIEDTGLSFVQCRITGS  868
            AH R    E  G  FV CR+TG+
Sbjct  505  AHSRSKHNEANGYVFVHCRVTGT  527



>ref|XP_002511045.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51647.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=366

 Score =   256 bits (653),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 173/272 (64%), Gaps = 6/272 (2%)
 Frame = +2

Query  95   IVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLK  274
            ++   +     VI  D  PIPA + Q+ SWF+A+V+P  S +  +DPAL  AE AP  +K
Sbjct  14   VIAATLLAATTVISDDATPIPAAEDQINSWFQANVKPFSSRKGTLDPALEAAETAPKRIK  73

Query  275  V--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPT  448
            V     G FK++ +A+K+IP+ N  R I+ I  G Y E+V ID  +PFVTL G     PT
Sbjct  74   VRLDGSGDFKSVTDALKSIPSGNEHRVIVDIGAGVYTEKVIIDRIKPFVTLLGSSNPMPT  133

Query  449  LVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFY  628
            L    TA + GT+YSATL V +DYF+A NI +KN+APRP G+   QAVAL ++G+K AFY
Sbjct  134  LQFDGTAKKYGTVYSATLTVEADYFVAANIIIKNTAPRPDGRAGAQAVALRVAGDKTAFY  193

Query  629  NCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHG  808
            NC+  GFQDT+CD+  +HF+KDCYIEGTVDF FG  KS+ L T L+V     M ++TA  
Sbjct  194  NCRILGFQDTVCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLKTNLNVIKEKFMTVITAQA  253

Query  809  RKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            + ++ ED+G SFV   I G A      A LGR
Sbjct  254  KHTSSEDSGFSFVHSNIAGDATD----AYLGR  281



>ref|NP_196360.1| putative pectinesterase 50 [Arabidopsis thaliana]
 sp|Q9LY17.1|PME50_ARATH RecName: Full=Probable pectinesterase 50; Short=PE 50; AltName: 
Full=Pectin methylesterase 50; Short=AtPME50; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87932.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AED91156.1| putative pectinesterase 50 [Arabidopsis thaliana]
Length=361

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 171/262 (65%), Gaps = 3/262 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            V+  ++VF    V+  DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEAA   +
Sbjct  8    VVAFLVVFASPVVLATDTDPIPENRAQIPQWFKTNVKPYSQRKGTLDPALEAAEAARQII  67

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  G  FKT+ EA+K+IP  N  R II +A G YNE+V ID  RPF+TL G P    
Sbjct  68   TVNQKGGANFKTLNEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFITLLGQPGAET  127

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    TAAQ GT+ SATL V ++YF A ++ +KN+AP P      QA+A+ I+ +KAAF
Sbjct  128  VLTYHGTAAQYGTVESATLIVWAEYFQAAHLTIKNTAPMPKPGSQGQALAMRINADKAAF  187

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            Y+C+F+GFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TA 
Sbjct  188  YSCRFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAQ  246

Query  806  GRKSAIEDTGLSFVQCRITGSA  871
            GR+SA E  G +FV C++TG+ 
Sbjct  247  GRQSATEQNGYTFVHCKVTGTG  268



>gb|KHG24685.1| Pectinesterase PPME1 -like protein [Gossypium arboreum]
Length=369

 Score =   255 bits (652),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/274 (48%), Positives = 181/274 (66%), Gaps = 11/274 (4%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            + V +L+F P  V    + PIPA+KSQ+ +WF   ++ ++     +DP LV+AE  P  +
Sbjct  16   ICVSILLFAPIIV----SQPIPADKSQINAWFNGIIKSVKERGNTLDPELVEAETKPRII  71

Query  272  KV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
            KV  G GG+F TI +A++++P+ NTKR I+ I  G Y E+++I+ ++PF+TL GDPK  P
Sbjct  72   KVMQGGGGEFDTITKAIESVPSGNTKRVIVSIGPGSYKEKIRIERNKPFITLLGDPKKMP  131

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAA  622
             L    TA Q GT+ SATL     YF+  N+N+ N+APRP GK    QAVAL +SG+++A
Sbjct  132  NLTFDGTAKQFGTVDSATLITECSYFVGANLNILNTAPRPDGKMVGAQAVALRVSGDRSA  191

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
            FYNCK  GFQDTLCD+   HF+KDC+I GTVDF FG  KS+ LNTE+ V     + ++TA
Sbjct  192  FYNCKIIGFQDTLCDDRGNHFFKDCHIRGTVDFIFGSGKSLYLNTEIFVEGDPGLTVITA  251

Query  803  HGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
              R+S+ EDTG SFV   I+G+    AK A LGR
Sbjct  252  QARESSSEDTGYSFVHGSISGT----AKNAFLGR  281



>ref|XP_010666416.1| PREDICTED: pectinesterase 2-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 183/268 (68%), Gaps = 6/268 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            LNV++   L+          T+ IP  +++V++WF++ ++P+   +  ++P++++AE   
Sbjct  5    LNVILASFLLVNITFTASAQTL-IPESEAEVDTWFQSVIKPISELKGTLEPSILEAENGG  63

Query  263  VY---LKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-D  430
            V    ++    G+FKTI +AVK +   NTKR II I  G+Y E+++++  + ++T YG D
Sbjct  64   VETLDVRQDGSGKFKTISDAVKHVKVGNTKRVIITIGPGEYREKIQLERMQSYITFYGTD  123

Query  431  PKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTIS  607
            PKNRPT+  A TAA+ G + SATL V SDYF+A N+ + NSAPRP GK    QA A+ IS
Sbjct  124  PKNRPTITFAGTAAEFGAVDSATLIVESDYFVAANLIISNSAPRPDGKKKGAQAAAIRIS  183

Query  608  GNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTM  787
            G++AAFYNCKF GFQ+T+CD+   HF+KDCY+EGT DF FG+AKS+ LNTELHV PGD  
Sbjct  184  GDRAAFYNCKFTGFQNTICDDQGNHFFKDCYVEGTADFIFGEAKSLYLNTELHVIPGDGE  243

Query  788  AMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            A++ AH RK   ++ G SFV C++TG+ 
Sbjct  244  AIIAAHARKDLDDEGGYSFVHCKVTGTG  271



>gb|KFK25127.1| hypothetical protein AALP_AA8G069600 [Arabis alpina]
Length=363

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/262 (50%), Positives = 172/262 (66%), Gaps = 5/262 (2%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQP--LQSGRKGVDPALVKAEAAPV  265
            ++  ++VF    V+  D  PIPA+K+QVE WF+  V+P  ++ GR  +DPAL  AE AP 
Sbjct  8    MVAFLIVFAFPVVLADDVTPIPADKAQVEPWFKTHVKPFSVRRGRGILDPALEAAEVAPR  67

Query  266  YLKVG--KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
             + V    GG FK+I EA+K+IP  NTKR II +A G Y+E+V ID  RPFVTL G P  
Sbjct  68   TITVNPKGGGNFKSINEAIKSIPTGNTKRVIIKLAPGVYHEKVTIDVGRPFVTLLGKPGA  127

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKA  619
               L    TAA+ GT+ SATL V +  F+A N+N+ N+ P P      QA+A+ I+G+KA
Sbjct  128  ETNLTYDGTAAKFGTVESATLIVWATNFIAANLNIINTNPMPKAGTQGQALAMRINGDKA  187

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            AFY C+FYGFQDTLCD+   HF+K CYIEGT DF FG   S+ LNT LH   GD + ++T
Sbjct  188  AFYRCRFYGFQDTLCDDRGNHFFKGCYIEGTYDFIFGRGASLYLNTHLHAV-GDGLRVIT  246

Query  800  AHGRKSAIEDTGLSFVQCRITG  865
            AH R+S  E +G +FV C++TG
Sbjct  247  AHNRQSNNEQSGYAFVHCKVTG  268



>ref|XP_010423208.1| PREDICTED: probable pectinesterase 50 isoform X1 [Camelina sativa]
 ref|XP_010423209.1| PREDICTED: probable pectinesterase 50 isoform X2 [Camelina sativa]
Length=361

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/266 (49%), Positives = 173/266 (65%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVI-PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +++ +V  LVF    V+   DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEA+
Sbjct  4    MSMSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSQRKGKLDPALDAAEAS  63

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
             + + V +  GG FKTI EA+K+IP  N  R II +A G YNE+V +D  RPFVTL G  
Sbjct  64   RLIITVNQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTVDIARPFVTLLGQL  123

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGN  613
                 L    TAA+ GT+ SATL V SDYF A N+ ++N+AP P      QA+A+ I+G+
Sbjct  124  GAETVLTYHGTAAKYGTVESATLIVWSDYFQAANLIIRNTAPMPKPGSQGQALAMRINGD  183

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFY+CKFYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + +
Sbjct  184  KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            +TA  R SA E  G +FV C+ITG+ 
Sbjct  243  ITAQSRSSANEQNGYTFVHCKITGTG  268



>gb|KEH38558.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/266 (49%), Positives = 172/266 (65%), Gaps = 4/266 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +NV I+  L F    V+  D  PIPA ++Q+++WF  +V PL   +  +DP+LV AEAAP
Sbjct  10   INVAIIVAL-FTANVVLSDDLTPIPANRAQLDAWFNTNVGPLAQRKATLDPSLVAAEAAP  68

Query  263  VYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              + V + G+  FKTI +A+ +IP  N KR I+ I GG YNE++KI+  +PFVTLY  P 
Sbjct  69   KVITVMQDGKGDFKTITDAINSIPTGNNKRVIVKIGGGNYNEKIKIERTKPFVTLYAAPG  128

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGN  613
              P +    TAA+ GT+ SATL V SDYF+A NI + NSAPRP G K  +QAVAL ISG+
Sbjct  129  TMPNITFGGTAAKYGTVDSATLIVESDYFVAANIMLSNSAPRPDGRKAGEQAVALRISGD  188

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            +AAFYNCK  GFQDT+CD+ + HF+KDC I+GTVDF FG   S+ L  EL         +
Sbjct  189  RAAFYNCKILGFQDTICDDRHNHFFKDCLIQGTVDFIFGSGTSLYLKNELRALGDAGPTV  248

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSA  871
            + A  RKSA +    SFV C ITG+ 
Sbjct  249  IVAQARKSASDADLYSFVHCDITGTG  274



>ref|XP_008449624.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
 ref|XP_008449625.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
 ref|XP_008449626.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
Length=368

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 168/257 (65%), Gaps = 6/257 (2%)
 Frame = +2

Query  143  TVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAV  316
            + PIP EKSQ+++WF  +V+PL   +  +DPALV AE     +KV   G   FKTI EA+
Sbjct  27   STPIPVEKSQIDAWFSQNVKPLADRKAELDPALVAAEENATIIKVMSDGTGDFKTITEAI  86

Query  317  KTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSA  496
             ++PA N KR +I I  G Y E++KID ++PFVTLYG PK  P L     AA+ GT+YSA
Sbjct  87   ASVPADNKKRVMISIGDGIYKEKLKIDRNKPFVTLYGSPKGMPKLTFDGDAAKFGTVYSA  146

Query  497  TLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNI  673
            TL V +DYF A N+ ++NS+PRP G +   QA+A    G KAA YNCKF GFQDTLCD+ 
Sbjct  147  TLIVEADYFTAANLVIENSSPRPDGVRKGAQALAARFMGTKAAIYNCKFTGFQDTLCDDD  206

Query  674  NKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQC  853
              HFYKDC+I+GTVDF FG   S+ +NT+L V     +A++TAH R+   + +G SFV C
Sbjct  207  GLHFYKDCFIQGTVDFIFGKGTSLYVNTQLDVAGDGGLAVITAHSREQESDGSGYSFVHC  266

Query  854  RITGSADPKAKVAVLGR  904
             ITG+     K   LGR
Sbjct  267  SITGTG---GKNTFLGR  280



>emb|CDY14045.1| BnaC02g01620D [Brassica napus]
Length=361

 Score =   253 bits (646),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/262 (48%), Positives = 169/262 (65%), Gaps = 3/262 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            ++  ++ F    V+  DT PIP  ++Q+  WF+ +V P    +  +DPAL  AEAA + +
Sbjct  8    IVAFIVAFVLPVVLATDTAPIPEVRAQIPQWFKTNVAPYSQRKGTLDPALDAAEAARIIV  67

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  G  FK+I EA+K+IP  N KR II +A G Y E+V +D  RPFVTL G P ++ 
Sbjct  68   TVNQKGGANFKSINEAIKSIPIGNKKRVIIKLAPGIYTEKVTVDVGRPFVTLLGQPGSQT  127

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    TAAQ GT+ SATL V SDYFMA N+ +KN++P P      QA+A+ I+G+ AAF
Sbjct  128  VLTYHGTAAQYGTVESATLIVWSDYFMAANLIIKNTSPMPKPGSQGQALAMRINGDYAAF  187

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            Y C FYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TA 
Sbjct  188  YTCSFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTKLHAV-GDGLRVITAQ  246

Query  806  GRKSAIEDTGLSFVQCRITGSA  871
             R+S  E  G +FV C+ITG+ 
Sbjct  247  SRQSNTEQNGYTFVHCKITGTG  268



>ref|XP_009125689.1| PREDICTED: probable pectinesterase 50 [Brassica rapa]
 emb|CDY55180.1| BnaAnng13710D [Brassica napus]
Length=361

 Score =   253 bits (645),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 169/262 (65%), Gaps = 3/262 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            ++  ++ F    V+  DT PIP  ++Q+  WF+ +V P    +  +DPAL  AEAA + +
Sbjct  8    IVAFIVAFILPVVLATDTAPIPEVRAQIPQWFKTNVAPYSQRKGTLDPALDAAEAARIIV  67

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             V +  G  FK+I EA+K+IP  N KR II +A G Y E+V +D  RPFVTL G P ++ 
Sbjct  68   TVNQKGGANFKSINEAIKSIPIGNKKRVIIKLAPGIYTEKVTVDVGRPFVTLLGQPGSQT  127

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAF  625
             L    TAAQ GT+ SATL + SDYFMA N+ +KN++P P      QA+A+ I+G+ AAF
Sbjct  128  VLTYHGTAAQYGTVESATLIIWSDYFMAANLIIKNTSPMPKPGSQGQALAMRINGDYAAF  187

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAH  805
            Y C FYGFQDTLCD+   HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TA 
Sbjct  188  YTCSFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTKLHAV-GDGLRVITAQ  246

Query  806  GRKSAIEDTGLSFVQCRITGSA  871
             R+S  E  G +FV C+ITG+ 
Sbjct  247  SRQSNTEQNGYTFVHCKITGTG  268



>ref|XP_002277388.2| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38548.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/263 (51%), Positives = 169/263 (64%), Gaps = 5/263 (2%)
 Frame = +2

Query  95   IVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLK  274
            +V   +  P  V+  D   IP +  Q+ SWF   +Q     R  +DP LVKAE     +K
Sbjct  16   MVFFFLVLPSTVLA-DDPQIPDDAIQLASWFNDVIQSHNLRRTTLDPVLVKAEERVKIIK  74

Query  275  V--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPT  448
            V  G GG F  +  AV ++PA NT+R II+I GG Y E++KID  +PF+T YG P + P 
Sbjct  75   VSKGGGGNFNKVMAAVDSVPAGNTQRVIIWIGGGVYEEKIKIDRSKPFITFYGSPDDMPM  134

Query  449  LVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAF  625
            L    TAA+ GT+ SATL V SDYFMAVNI V NS+PRP G+ +  QAVA+ +SG+KAAF
Sbjct  135  LSFDGTAAKFGTVDSATLIVESDYFMAVNIIVINSSPRPEGRRNGGQAVAVRVSGDKAAF  194

Query  626  YNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHV-FPGDTMAMVTA  802
            YNCK  GFQDTLCD+  +HF+  CYIEGTVDF FG  KS+ L+TELH    G   +++TA
Sbjct  195  YNCKLVGFQDTLCDDRGRHFFHGCYIEGTVDFIFGSGKSLYLSTELHAKGAGGEFSVITA  254

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
              RK   ED G SFV CR++GS 
Sbjct  255  QARKLESEDNGYSFVHCRVSGSG  277



>ref|XP_002866448.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42707.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/273 (50%), Positives = 170/273 (62%), Gaps = 32/273 (12%)
 Frame = +2

Query  56   EYCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDP  235
             Y    V +L VVI   +VF        D  PIP  K ++E WF  +V+  Q+GR     
Sbjct  4    NYVSLIVTILLVVITSPVVFGN------DAAPIPENKGRIEQWFNTNVK--QNGR-----  50

Query  236  ALVKAEAAPVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFV  415
                             G FKTI EA+ ++ A NT+R II I  G Y E+V ID ++PF+
Sbjct  51   -----------------GHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRNKPFI  93

Query  416  TLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAV  592
            TLYG P   P L    TAAQ GT+ SATL VLSDYFMAVNI VKNSAP P GK    QA+
Sbjct  94   TLYGHPNAMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKRKGAQAL  153

Query  593  ALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVF  772
            ++ ISGNKAAFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L T+L+V 
Sbjct  154  SMRISGNKAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV  213

Query  773  PGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
             GD + ++TAH  KSA E +G SFV C++TG+ 
Sbjct  214  -GDGIRVITAHAGKSAAEKSGYSFVHCKVTGTG  245



>ref|XP_008449623.1| PREDICTED: putative pectinesterase 63 [Cucumis melo]
Length=369

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 132/287 (46%), Positives = 178/287 (62%), Gaps = 11/287 (4%)
 Frame = +2

Query  56   EYCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKG-VD  232
            +YC+  +RL   ++            PL    IP EKSQ++ W+  +V+   +  K  +D
Sbjct  2    KYCINALRLTRWIMFLEAFAAILAASPL----IPTEKSQLDEWYWENVKAFGNRNKAELD  57

Query  233  PALVKAEAAPVYLKV-GKG-GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDR  406
            P LV AE +   +KV G G G FKTI EA++++P  NTKR +I+I GG Y E++KID ++
Sbjct  58   PELVAAEESATVIKVRGDGSGDFKTIAEAIESVPIGNTKRIVIWIGGGVYKEKLKIDRNK  117

Query  407  PFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQ  583
            PFVTLYG P N P L     A++ GT+YSATL V +DYF A N+ ++NS+PRP G +   
Sbjct  118  PFVTLYGSPNNMPNLTFDGDASKYGTVYSATLIVEADYFTAANLVIENSSPRPDGVRKGA  177

Query  584  QAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTEL  763
            QA+A  I GNKAA YNCKF GFQDTLCD+   H YKDC+I+GTVDF FG   S+ LNT+L
Sbjct  178  QALAARIRGNKAAIYNCKFIGFQDTLCDDDGLHLYKDCFIQGTVDFIFGKGTSLYLNTQL  237

Query  764  HVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             V     + ++ AH R    + +G SFV C ITG+     +   LGR
Sbjct  238  DVVGNGGLGVIAAHSRDQESDGSGYSFVHCSITGTG---GRNTYLGR  281



>ref|XP_010662219.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
Length=373

 Score =   251 bits (640),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 168/259 (65%), Gaps = 8/259 (3%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D + IP +K+Q+ +WF  +++  +  R  +DP LVKAE     +KV K  GG FKT+ +A
Sbjct  30   DDLQIPNDKTQLTAWFGRTIKNYKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            V ++P  N  R II+I GG Y E++KID  +PFVT YG P + P L    TAA+ GT+ S
Sbjct  90   VNSVPEGNAGRVIIWIGGGVYEEKIKIDRTKPFVTFYGSPDHMPMLSFDGTAAKYGTVDS  149

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            A+L V S YFM VNI V NS+P+P GK    QAVAL ISG+KAAFYN K  GFQDTLCD+
Sbjct  150  ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTM-AMVTAHGRKSAIEDTGLSFV  847
             N+HF+K CYIEGTVDF FG  KSI L+TE+H      M  ++TAH R    EDTG SFV
Sbjct  210  RNRHFFKKCYIEGTVDFIFGSGKSIFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  848  QCRITGSADPKAKVAVLGR  904
             C I+G+         LGR
Sbjct  270  HCTISGT----GSTTFLGR  284



>ref|NP_200976.1| putative pectinesterase 63 [Arabidopsis thaliana]
 sp|Q9FKF3.2|PME63_ARATH RecName: Full=Putative pectinesterase 63; Short=PE 63; AltName: 
Full=Pectin methylesterase 63; Short=AtPME63; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED97505.1| putative pectinesterase 63 [Arabidopsis thaliana]
Length=338

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 169/273 (62%), Gaps = 32/273 (12%)
 Frame = +2

Query  56   EYCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDP  235
             Y    V +L VVI   +VF        D  PIP  K ++E WF  +V+  Q+GR     
Sbjct  4    NYVSLIVTILLVVITSPVVFGN------DAAPIPENKGRIEQWFNTNVK--QNGR-----  50

Query  236  ALVKAEAAPVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFV  415
                             G FKTI EA+ ++ A NT+R II I  G Y E+V ID  +PF+
Sbjct  51   -----------------GHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRSKPFI  93

Query  416  TLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAV  592
            TLYG P   P L    TAAQ GT+ SATL VLSDYFMAVNI +KNSAP P GK    QA+
Sbjct  94   TLYGHPNAMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIILKNSAPMPDGKRKGAQAL  153

Query  593  ALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVF  772
            ++ ISGNKAAFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L T+L+V 
Sbjct  154  SMRISGNKAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV  213

Query  773  PGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
             GD + ++TAH  KSA E +G SFV C++TG+ 
Sbjct  214  -GDGIRVITAHAGKSAAEKSGYSFVHCKVTGTG  245



>gb|EPS69429.1| hypothetical protein M569_05334, partial [Genlisea aurea]
Length=305

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 169/255 (66%), Gaps = 13/255 (5%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKT  322
            IPA+KSQ+++WF  +V     G+K  +  A+  AEA    + V K   G+FKTI +A+K+
Sbjct  29   IPADKSQLDTWFNRNV-----GQKATLSTAVADAEAKTTVISVSKDGSGKFKTIGDALKS  83

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
            +P  N  R +I I  G Y E+++I+  +P VTLYGDPKN P LV   +AA+V  I SATL
Sbjct  84   VPENNKNRVVIHIGPGNYTEKIRIERSKPHVTLYGDPKNMPVLVYGESAAKVNIIESATL  143

Query  503  YVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTLCDNINK  679
             V  DYF AVN+ + NS+PRP GK    QA AL  SG+ A+FYNC+F+GFQDT+ D+  +
Sbjct  144  IVEGDYFSAVNLVIVNSSPRPDGKIKLAQAAALRTSGDGASFYNCRFHGFQDTILDDAGR  203

Query  680  HFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRI  859
            H +KDCYIEGTVDF  G  +S+ LNTE+HV PG+ M  +TAH RK+  +  G SFV CRI
Sbjct  204  HLFKDCYIEGTVDFICGSGQSLYLNTEVHVIPGEPMGFITAHARKTTGDPGGYSFVHCRI  263

Query  860  TGSADPKAKVAVLGR  904
            TG+ +     A LGR
Sbjct  264  TGAGE----TAYLGR  274



>emb|CAN78808.1| hypothetical protein VITISV_030725 [Vitis vinifera]
Length=368

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 159/238 (67%), Gaps = 4/238 (2%)
 Frame = +2

Query  170  QVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV--GKGGQFKTIQEAVKTIPARNTK  343
            Q+ SWF   +Q     R  +DP LVKAE     +KV  G GG F  +  AV ++PA NT+
Sbjct  11   QLASWFNDXIQSHNLRRTTLDPVLVKAEERVKIIKVSKGGGGNFNKVMAAVDSVPAGNTQ  70

Query  344  RYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYF  523
            R II+I GG Y E++KID  +PF+T YG P + P L    TAA+ GT+ SATL V SDYF
Sbjct  71   RVIIWIGGGVYEEKIKIDRSKPFITFYGSPDDMPMLSFDGTAAKFGTVDSATLIVESDYF  130

Query  524  MAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCY  700
            MAVNI V NS+PRP G+ +  QAVA+ +SG+KAAFYNCK  GFQDTLCD+  +HF+  CY
Sbjct  131  MAVNIIVINSSPRPEGRRNGGQAVAVRVSGDKAAFYNCKLVGFQDTLCDDRGRHFFHGCY  190

Query  701  IEGTVDFFFGDAKSIILNTELHV-FPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            IEGTVDF FG  KS+ L+TELH    G   +++TA  RK   ED G SFV CR++GS 
Sbjct  191  IEGTVDFIFGSGKSLYLSTELHAKGAGGEFSVITAQARKLESEDNGYSFVHCRVSGSG  248



>ref|NP_196359.1| putative pectinesterase 49 [Arabidopsis thaliana]
 sp|Q9LY18.1|PME49_ARATH RecName: Full=Probable pectinesterase 49; Short=PE 49; AltName: 
Full=Pectin methylesterase 49; Short=AtPME49; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87931.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AAM63813.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AAO22596.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO50592.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AED91155.1| putative pectinesterase 49 [Arabidopsis thaliana]
Length=361

 Score =   249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 172/264 (65%), Gaps = 4/264 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTV-PIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +++ +V +LVF    V+  D + PIPA+++Q+  WF A+V+P    R  +DP L  AEA+
Sbjct  4    ISLALVALLVFFASPVVLADDITPIPADRAQIPQWFMANVKPFSQRRGTLDPELEAAEAS  63

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
               + V +  GG FKTI  A+K+IP  N  R II +A G Y+E+V +D  RP+VTL G P
Sbjct  64   RRVIIVNQNGGGDFKTINAAIKSIPLANKNRVIIKLAPGIYHEKVTVDVGRPYVTLLGKP  123

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGN  613
                 L  A TAA+ GT+ SATL V +  F+A N+N+ N++P P      QA+A+ I+G+
Sbjct  124  GAETNLTYAGTAAKYGTVESATLIVWATNFLAANLNIINTSPMPKPGTQGQALAMRINGD  183

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNC+FYGFQDTLCD+   HF+K+CYIEGT DF FG   S+ L T+LH   GD + +
Sbjct  184  KAAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLTTQLHAV-GDGLRV  242

Query  794  VTAHGRKSAIEDTGLSFVQCRITG  865
            + AH R+S  E  G SFV C++TG
Sbjct  243  IAAHNRQSTTEQNGYSFVHCKVTG  266



>emb|CBI38549.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/259 (51%), Positives = 168/259 (65%), Gaps = 8/259 (3%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D + IP +K+Q+ +WF  +++  +  R  +DP LVKAE     +KV K  GG FKT+ +A
Sbjct  30   DDLQIPNDKTQLTAWFGRTIKNYKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            V ++P  N  R II+I GG Y E++KID  +PFVT YG P + P L    TAA+ GT+ S
Sbjct  90   VNSVPEGNAGRVIIWIGGGVYEEKIKIDRTKPFVTFYGSPDHMPMLSFDGTAAKYGTVDS  149

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            A+L V S YFM VNI V NS+P+P GK    QAVAL ISG+KAAFYN K  GFQDTLCD+
Sbjct  150  ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTM-AMVTAHGRKSAIEDTGLSFV  847
             N+HF+K CYIEGTVDF FG  KSI L+TE+H      M  ++TAH R    EDTG SFV
Sbjct  210  RNRHFFKKCYIEGTVDFIFGSGKSIFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  848  QCRITGSADPKAKVAVLGR  904
             C I+G+         LGR
Sbjct  270  HCTISGT----GSTTFLGR  284



>emb|CDY02121.1| BnaA03g40460D [Brassica napus]
Length=302

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 171/264 (65%), Gaps = 27/264 (10%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            L + I+ V++  P  V   D  PIP  K+++E WF  +V+  Q+GR              
Sbjct  8    LILTILLVVITWPV-VYGNDATPIPQNKNRIEQWFNNNVR--QNGR--------------  50

Query  263  VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
                    G FKT+ EA+ ++P  N +R II +  G+Y E+V ID ++PF+TLYGDP   
Sbjct  51   --------GDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPNAM  102

Query  443  PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKA  619
            P L    TAA+ GT+ SATL VLSDYFMA+NI VKNSAP P GK    QA+++ ISGNKA
Sbjct  103  PVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNKA  162

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            AFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L+T+L+V  GD + ++T
Sbjct  163  AFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRVIT  221

Query  800  AHGRKSAIEDTGLSFVQCRITGSA  871
            AH  KS  E +G SFV C++TG+ 
Sbjct  222  AHAGKSTEEKSGYSFVHCKVTGTG  245



>ref|XP_002511044.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF51646.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=366

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 186/279 (67%), Gaps = 7/279 (3%)
 Frame = +2

Query  74   VRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE  253
            + +++ VI  +L+     VI  D  PIPA ++QV SWF+A+V+   S +  +DPAL+ AE
Sbjct  8    IAIIHYVIAAILL-AATTVISDDATPIPAAENQVNSWFQANVKHFSSRKGTLDPALLAAE  66

Query  254  AAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG  427
            AAP  +KV     G FK++ +A+K+IP+ N  R I+ I  G Y E+V ID  +PFVTL G
Sbjct  67   AAPKRIKVRLDGSGDFKSVTDALKSIPSGNEHRVIVDIGCGVYTEKVTIDRIKPFVTLLG  126

Query  428  DPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTIS  607
              K+ PTL  A TA + GT+YSATL V +DYF+A NI +KN+APRP G+   QAVAL ++
Sbjct  127  SSKHMPTLQFAGTAKKYGTVYSATLTVEADYFVAANIIIKNTAPRPDGRAGAQAVALRVA  186

Query  608  GNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTM  787
            G+KAAFYNC+  GFQDT+CD+  +HF+KDCYIEGTVDF FG  KS+ L T L+V     M
Sbjct  187  GDKAAFYNCRILGFQDTVCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLKTHLNVIKEKFM  246

Query  788  AMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             ++TA  + ++ ED+G SFV   ITG A      A LGR
Sbjct  247  TVITAQAKHTSSEDSGFSFVHSSITGDATD----AYLGR  281



>ref|XP_002511043.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51645.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=364

 Score =   248 bits (633),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 169/261 (65%), Gaps = 5/261 (2%)
 Frame = +2

Query  98   VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
            +  +V     V   DT PIP   S +  WF A+V+PL   +  +DPAL  AEA P  +KV
Sbjct  15   ILAIVLAANTVSSDDTTPIPEAASGIAGWFSANVKPLADRKGTLDPALEAAEANPKTIKV  74

Query  278  --GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
                 G+FKTI +AVK+IP+ NT+R I+ I  G YNE++ I+ D+PFVT  G P N  T+
Sbjct  75   RLDGSGEFKTIADAVKSIPSGNTQRVIVDIGPGTYNEKITIERDKPFVTFLG-PSNMATI  133

Query  452  VAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFY  628
                TA + GT+YSATL V S+YF+A N+ ++N+APRP GK P  QA+A+   G+KAAFY
Sbjct  134  AFGGTAHEYGTVYSATLQVESEYFIAANLIIQNTAPRPDGKTPGAQALAVRTGGSKAAFY  193

Query  629  NCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHG  808
              K  GFQDTLCD+   HF+KDCYIEGTVDF FG  KSI LNTE++V       ++TA  
Sbjct  194  KVKMLGFQDTLCDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTEINVLTDAEPTVITAQA  253

Query  809  RKSAIEDTGLSFVQCRITGSA  871
            R+ + EDTG SFV C + G+ 
Sbjct  254  RQGS-EDTGFSFVHCSVGGTG  273



>ref|XP_007153340.1| hypothetical protein PHAVU_003G027000g [Phaseolus vulgaris]
 gb|ESW25334.1| hypothetical protein PHAVU_003G027000g [Phaseolus vulgaris]
Length=369

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 175/274 (64%), Gaps = 9/274 (3%)
 Frame = +2

Query  59   YCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPA  238
            YC   V L+ V +   +V      +P D  P+P++K+++ SWF+++V  L+  +  +DP 
Sbjct  7    YCSIKVTLMVVFLTTQVV------LPDDDTPMPSDKTELGSWFQSNVGTLRKRKGSLDPK  60

Query  239  LVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPF  412
            LV AE     +KV +   G++KTI +A+++IP+ NT R I++I  G Y+E++ ++  +PF
Sbjct  61   LVAAEEGAKVVKVMQDGSGEYKTISDALRSIPSGNTMRVILYIGPGNYHEKITVEKTKPF  120

Query  413  VTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQA  589
            VT YG P N P L    TA Q GT+ SATL VLSDYF+A NI + NSAPRP       QA
Sbjct  121  VTFYGKPGNMPNLTYDGTARQYGTVDSATLIVLSDYFVAANIIISNSAPRPDENSVGGQA  180

Query  590  VALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHV  769
            VAL ISG+KA FYNC+ YG+QDTL D+ N+HF+KDC I+G VD+ FG  KS+ +N E+  
Sbjct  181  VALRISGDKATFYNCELYGYQDTLLDDANRHFFKDCLIQGYVDYIFGSGKSLYVNCEIRT  240

Query  770  FPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
               +    +TA  RK+  ED G SFV C +TG+ 
Sbjct  241  LGDEGFTFITAQARKNKQEDNGFSFVHCELTGTG  274



>ref|XP_004174112.1| PREDICTED: pectinesterase PPME1-like, partial [Cucumis sativus]
Length=309

 Score =   246 bits (627),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 170/254 (67%), Gaps = 7/254 (3%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKV-GKG-GQFKTIQEAVKT  322
            +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV G G G FKTI EA+ +
Sbjct  27   VPVDKTQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMGDGTGDFKTITEAIAS  86

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
            +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  87   VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLSFDGVASKYGTVYSATL  146

Query  503  YVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKH  682
             V +DYF+A N+ ++N++PRP+G+ + QA+A    G K+AFYNCKF+GFQDTLCD+   H
Sbjct  147  IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFFGFQDTLCDDDGLH  206

Query  683  FYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRIT  862
             YKDC+I+GTVDF FG   S+ LNTEL+V      A++TAH R+   + +G SFV C IT
Sbjct  207  LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  266

Query  863  GSADPKAKVAVLGR  904
            G+     K   LGR
Sbjct  267  GN----GKDTYLGR  276



>ref|XP_007204487.1| hypothetical protein PRUPE_ppa019696mg [Prunus persica]
 gb|EMJ05686.1| hypothetical protein PRUPE_ppa019696mg [Prunus persica]
Length=368

 Score =   248 bits (632),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 164/248 (66%), Gaps = 6/248 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D   +  +  QV +WF  +V P +  +  +DPALV AE     +KV K   G+FKTI  A
Sbjct  30   DETLVVTDHPQVNTWFNNNVNPYKERQGTLDPALVTAEVGQTVVKVMKDRSGEFKTITGA  89

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            V +IP  NTKR I++I GG+YNE++ I  ++ FVT YG P N PTL  A TA + GT+ S
Sbjct  90   VNSIPVDNTKRVIVYIGGGEYNEKITIPRNKSFVTFYGSPTNIPTLTFAGTAQKYGTVDS  149

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            AT+   SDYF+A N+ +KNS+P+P GK   +QA+AL +SGNK+A +NC+  GFQDTLCD+
Sbjct  150  ATVIAESDYFVAANLIIKNSSPKPDGKRVGEQALALRVSGNKSALFNCRLIGFQDTLCDD  209

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF++DC+IEGTVDF FG  KS+ L   LHV   + M ++ A  R SA EDTG SFV 
Sbjct  210  KGNHFFQDCFIEGTVDFIFGSGKSLYL---LHVLGNNEMTVIIAQARNSASEDTGYSFVH  266

Query  851  CRITGSAD  874
            C ITG+ +
Sbjct  267  CNITGTGN  274



>ref|XP_007204919.1| hypothetical protein PRUPE_ppa020130mg [Prunus persica]
 gb|EMJ06118.1| hypothetical protein PRUPE_ppa020130mg [Prunus persica]
Length=350

 Score =   247 bits (631),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 168/268 (63%), Gaps = 17/268 (6%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPL--DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEA  256
            ++  +   L+  P  +I +  D  P+PA+ SQV +WF  +V P +  +  +DP LV  E 
Sbjct  10   VHAALTMTLLILPTAIIAVADDDTPVPADHSQVNTWFNNNVNPYKERQGTLDPTLVTDEV  69

Query  257  APVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGD  430
                +KV K   G+FKTI +AV +IP  NTK  I++I GG+YNE++ I  ++PF+T YG 
Sbjct  70   GQTVIKVMKDGSGEFKTITDAVNSIPTNNTKHVIVYIGGGEYNEKITIPRNKPFITFYGS  129

Query  431  PKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISG  610
            P N PTL  A TA + GT+ SAT+ V SDYF+A N  +K             A+AL + G
Sbjct  130  PTNMPTLTFAGTAQKYGTVDSATVIVESDYFVAANFIIK-------------ALALRVLG  176

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            NK+A +NC+  GFQDTLCD+   +F+KDC+IEGTVDF FG  KS+ LNTELHV   + M 
Sbjct  177  NKSALFNCRLIGFQDTLCDDKGNYFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNNEMT  236

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSAD  874
            ++T   R SA EDTG SF+ C ITG+ +
Sbjct  237  VITTQARDSASEDTGYSFLYCNITGTGN  264



>emb|CAN66682.1| hypothetical protein VITISV_005088 [Vitis vinifera]
Length=373

 Score =   248 bits (633),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 131/259 (51%), Positives = 167/259 (64%), Gaps = 8/259 (3%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D + IP +K+Q+ +WF  +++  +  R  +DP LVKAE     +KV K  GG FKT+ +A
Sbjct  30   DDLQIPNDKTQLTAWFGRTIKNHKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            V ++P  N  R II+  GG Y E++KID  +PFVT YG P   P L    TAA+ GT+ S
Sbjct  90   VNSVPXGNXXRVIIWXGGGVYEEKIKIDRTKPFVTFYGSPDXMPMLSFDGTAAKYGTVDS  149

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            A+L V S YFM VNI V NS+P+P GK    QAVAL ISG+KAAFYN K  GFQDTLCD+
Sbjct  150  ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTM-AMVTAHGRKSAIEDTGLSFV  847
             N+HF+K+CYIEGTVDF FG  KS+ L+TE+H      M  ++TAH R    EDTG SFV
Sbjct  210  RNRHFFKECYIEGTVDFIFGSGKSLFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  848  QCRITGSADPKAKVAVLGR  904
             C I+G+         LGR
Sbjct  270  HCTISGT----GSTTFLGR  284



>ref|XP_007204920.1| hypothetical protein PRUPE_ppa026195mg, partial [Prunus persica]
 gb|EMJ06119.1| hypothetical protein PRUPE_ppa026195mg, partial [Prunus persica]
Length=332

 Score =   246 bits (629),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/241 (51%), Positives = 162/241 (67%), Gaps = 6/241 (2%)
 Frame = +2

Query  161  EKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPAR  334
            +  QV +WF  +V P +  +  +DPALV AE     +KV K   G+FKTI  AV +IP  
Sbjct  1    DHPQVNTWFNNNVNPYKERQGTLDPALVTAEVGQTVVKVMKDRSGEFKTITGAVNSIPVD  60

Query  335  NTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLS  514
            NTKR I++I GG+YNE++ I  ++ FVT YG P N PTL  A TA + GT+ SAT+   S
Sbjct  61   NTKRVIVYIGGGEYNEKITIPRNKSFVTFYGSPTNIPTLTFAGTAQKYGTVDSATVIAES  120

Query  515  DYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYK  691
            DYF+A N+ +KNS+P+P GK   +QA+AL +SGNK+A +NC+  GFQDTLCD+   HF++
Sbjct  121  DYFVAANLIIKNSSPKPDGKRVGEQALALRVSGNKSALFNCRLIGFQDTLCDDKGNHFFQ  180

Query  692  DCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            DC+IEGTVDF FG  KS+ L   LHV   + M ++ A  R SA EDTG SFV C ITG+ 
Sbjct  181  DCFIEGTVDFIFGSGKSLYL---LHVLGNNEMTVIIAQARNSASEDTGYSFVHCNITGTG  237

Query  872  D  874
            +
Sbjct  238  N  238



>ref|XP_007038215.1| Pectin lyase-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY22716.1| Pectin lyase-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
Length=293

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 164/244 (67%), Gaps = 4/244 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +   I  +LV  P  V+  ++ PIP +KSQ+++WF A+++P  +    +DPAL KAE A 
Sbjct  11   VGAAICTILVLAPV-VLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAA  69

Query  263  VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV K   G F TI +A+ ++P+ NTKR II I GG Y E+++ID  +PF+T YGDP+
Sbjct  70   HIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPR  129

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGN  613
            N P L    TA Q GT+ SATL V SDYF+A NI ++N+APRP G     QAV+L ISG+
Sbjct  130  NMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGD  189

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNCK  GFQDTLCD+   HF+KDCYI GTVDF FG  KS+ LNT L+V     + +
Sbjct  190  KAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLNTVLYVDGQKGVTV  249

Query  794  VTAH  805
            +TA 
Sbjct  250  ITAQ  253



>ref|XP_009136509.1| PREDICTED: putative pectinesterase 63 isoform X2 [Brassica rapa]
Length=338

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 171/264 (65%), Gaps = 27/264 (10%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            L + I+ V++  P  V   D  PIP  K+++E WF  +V+  Q+GR              
Sbjct  8    LILTILLVVITWPV-VYGNDATPIPQNKNRIEQWFNNNVR--QNGR--------------  50

Query  263  VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
                    G FKT+ EA+ ++P  N +R II +  G+Y E+V ID ++PF+TLYGDP   
Sbjct  51   --------GDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPNAM  102

Query  443  PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKA  619
            P L    TAA+ GT+ SATL VLSDYFMA+NI VKNSAP P GK    QA+++ ISGNKA
Sbjct  103  PVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNKA  162

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            AFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L+T+L+V  GD + ++T
Sbjct  163  AFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRVIT  221

Query  800  AHGRKSAIEDTGLSFVQCRITGSA  871
            AH  KS  E +G SFV C++TG+ 
Sbjct  222  AHAGKSTEEKSGYSFVHCKVTGTG  245



>ref|XP_004156059.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
 gb|KGN48070.1| hypothetical protein Csa_6G428030 [Cucumis sativus]
Length=370

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 166/257 (65%), Gaps = 8/257 (3%)
 Frame = +2

Query  149  PIPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVK  319
            PIP EKSQ+  WF  +V+P     K  +DPAL  AE     +KV   G   FKT+ EA+ 
Sbjct  29   PIPVEKSQLAGWFTENVKPFAVRNKAELDPALATAEENATVIKVMSDGTGNFKTVTEAIA  88

Query  320  TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSA  496
            ++PA N KR +I+I  G Y E++KID ++PFVTLYG DPKN P L     AA+ GT+YSA
Sbjct  89   SVPADNKKRVVIWIGVGVYKEKLKIDRNKPFVTLYGSDPKNMPKLTFDGDAAKYGTVYSA  148

Query  497  TLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNI  673
            TL V +DYF A N+ ++NS+PRP G +   QA+A    G KAA YNCKF GFQDTLCD+ 
Sbjct  149  TLIVEADYFTAANLIIENSSPRPDGVRKGAQALAARFMGTKAAIYNCKFLGFQDTLCDDD  208

Query  674  NKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQC  853
              HFYKDC+I+GTVDF FG   S+ LNT+L V     +A++TAH R+   + +G SFV C
Sbjct  209  GLHFYKDCFIQGTVDFIFGKGTSLYLNTQLDVAGDGGLAVITAHSREQEADTSGYSFVHC  268

Query  854  RITGSADPKAKVAVLGR  904
             ITG+     K   LGR
Sbjct  269  SITGTG---GKNTYLGR  282



>ref|XP_002871270.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47529.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 171/264 (65%), Gaps = 4/264 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTV-PIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            +++ +V +LVF    V+  D + PIPA+++ +  WF+A+V+P    R  +DP L  AEA+
Sbjct  4    ISLSLVALLVFFASPVVLADDITPIPADRALISQWFKANVKPFSQRRGTLDPDLEAAEAS  63

Query  260  PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
               + V +  GG FKTI  A+K+IP  N  R II +A G Y+E+V ID  RPFVTL G P
Sbjct  64   RRVITVNQNGGGDFKTINAAIKSIPLANKNRVIIKLAPGIYHEKVTIDIGRPFVTLLGKP  123

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGN  613
                 L    TAA+ GT+ SATL V +  F+A N+N+ N++P P      QA+A+ I+G+
Sbjct  124  GAETNLTYDGTAAKYGTVESATLIVWATNFLAANLNIINTSPMPKPGTQGQALAMRINGD  183

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNC+FYGFQDTLCD+   HF+K+CYIEGT DF FG   S+ L T+LH   GD + +
Sbjct  184  KAAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLTTQLHAV-GDGLRV  242

Query  794  VTAHGRKSAIEDTGLSFVQCRITG  865
            + AH R+S  E  G SFV C++TG
Sbjct  243  IAAHNRQSTNEQNGYSFVHCKVTG  266



>ref|NP_001234964.1| uncharacterized protein LOC100306177 precursor [Glycine max]
 gb|ACU14235.1| unknown [Glycine max]
Length=248

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 154/218 (71%), Gaps = 3/218 (1%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKT  301
            V+  DTVPIPA K+Q+  W+  +V PL   +  VDPALV AE     +KV +   G++KT
Sbjct  24   VLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAKVVKVMQDGSGEYKT  83

Query  302  IQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG  481
            I +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    TA Q G
Sbjct  84   ITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGTAQQYG  143

Query  482  TIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDT  658
            T+ SATL V SDYF+A NI + N+APRP  K P  QAVAL ISG+KAAFYNCK YGFQDT
Sbjct  144  TVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMYGFQDT  203

Query  659  LCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVF  772
            +CD+ N+HF+KDC I+ T+D+ FG  KS+ ++TEL   
Sbjct  204  ICDDRNRHFFKDCLIQSTMDYIFGSGKSLYVSTELRTL  241



>ref|XP_004174171.1| PREDICTED: probable pectinesterase 49-like, partial [Cucumis 
sativus]
Length=286

 Score =   243 bits (620),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/254 (47%), Positives = 167/254 (66%), Gaps = 7/254 (3%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKT  322
            +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV   G   FKT+ EA+ +
Sbjct  27   VPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMSDGTGDFKTVTEAIAS  86

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
            +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  87   VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLTFDGVASKYGTVYSATL  146

Query  503  YVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKH  682
             V +DYF+A N+ ++N++PRP+G+ + QA+A    G K+AFYNCKF GFQDTLCD+   H
Sbjct  147  IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFLGFQDTLCDDDGLH  206

Query  683  FYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRIT  862
             YKDC+I+GTVDF FG   S+ LNTEL+V      A++TAH R+   + +G SFV C IT
Sbjct  207  LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  266

Query  863  GSADPKAKVAVLGR  904
            G+     K   LGR
Sbjct  267  GN----GKDTFLGR  276



>ref|XP_004140274.1| PREDICTED: probable pectinesterase 48-like [Cucumis sativus]
Length=373

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 176/286 (62%), Gaps = 10/286 (3%)
 Frame = +2

Query  59   YCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRK-GVDP  235
            YC   +R+   ++    +     +I   +  IP EKS+++ W+   V+      K  +D 
Sbjct  3    YCNNALRVTRWIL---FLEVSAAIILAASHMIPTEKSELDGWYSEHVKSFNKRDKMKLDS  59

Query  236  ALVKAEAAPVYLKV-GKG-GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRP  409
             LV AE     +KV G G G FKTI EA++++PA NTKR +I+I GG Y E++KID ++P
Sbjct  60   ELVAAEENATVIKVRGDGSGDFKTITEAIESVPACNTKRVVIWIGGGVYKEKLKIDRNKP  119

Query  410  FVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQ  586
            FVTLYG P N P L     A++ GT+YSATL V +DYF A N+ ++NS+PRP GK   +Q
Sbjct  120  FVTLYGSPNNMPNLTFDGDASKYGTVYSATLTVEADYFTAANLIIENSSPRPDGKRKGEQ  179

Query  587  AVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELH  766
            A+A  I GNK A YNCKF GFQDTLCD+   H YKDC+I+GTVDF FG   S+ LNT+L 
Sbjct  180  ALAARIWGNKVAIYNCKFIGFQDTLCDDRGLHLYKDCFIQGTVDFVFGKGTSLYLNTQLD  239

Query  767  VFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            V     + ++ AH R+   E +G SFV C ITG+     +   LGR
Sbjct  240  VVVDGGLGVIAAHSREQESECSGFSFVHCSITGTG---GRNTYLGR  282



>ref|XP_004140272.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=364

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 170/254 (67%), Gaps = 7/254 (3%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKV-GKG-GQFKTIQEAVKT  322
            +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV G G G FKTI EA+ +
Sbjct  27   VPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMGDGTGDFKTITEAIAS  86

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
            +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  87   VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLSFDGVASKYGTVYSATL  146

Query  503  YVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKH  682
             V +DYF+A N+ ++N++PRP+G+ + QA+A    G K+AFYNCKF+GFQDTLCD+   H
Sbjct  147  IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFFGFQDTLCDDDGLH  206

Query  683  FYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRIT  862
             YKDC+I+GTVDF FG   S+ LNTEL+V      A++TAH R+   + +G SFV C IT
Sbjct  207  LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  266

Query  863  GSADPKAKVAVLGR  904
            G+     K   LGR
Sbjct  267  GN----GKDTYLGR  276



>ref|XP_004169214.1| PREDICTED: probable pectinesterase 48-like [Cucumis sativus]
 gb|KGN48073.1| hypothetical protein Csa_6G428540 [Cucumis sativus]
Length=373

 Score =   245 bits (626),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 130/286 (45%), Positives = 176/286 (62%), Gaps = 10/286 (3%)
 Frame = +2

Query  59   YCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRK-GVDP  235
            YC   +R+   ++    +     +I   +  IP EKS+++ W+   V+      K  +D 
Sbjct  3    YCNNALRVTRWIL---FLEVSAAIILAASHMIPTEKSELDGWYSEHVKSFNKRDKMKLDS  59

Query  236  ALVKAEAAPVYLKV-GKG-GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRP  409
             LV AE     +KV G G G FKTI EA++++PA NTKR +I+I GG Y E++KID ++P
Sbjct  60   ELVAAEENATVIKVRGDGSGDFKTITEAIESVPACNTKRVVIWIGGGVYKEKLKIDRNKP  119

Query  410  FVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQ  586
            FVTLYG P N P L     A++ GT+YSATL V +DYF A N+ ++NS+PRP GK   +Q
Sbjct  120  FVTLYGSPNNMPNLTFDGDASKYGTVYSATLTVEADYFTAANLIIENSSPRPDGKRKGEQ  179

Query  587  AVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELH  766
            A+A  I GNK A YNCKF GFQDTLCD+   H YKDC+I+GTVDF FG   S+ LNT+L 
Sbjct  180  ALAARIWGNKVAIYNCKFIGFQDTLCDDRGLHLYKDCFIQGTVDFIFGGGTSLYLNTQLD  239

Query  767  VFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            V     + ++ AH R+   E +G SFV C ITG+     +   LGR
Sbjct  240  VVVDGGLGVIAAHSREQESECSGFSFVHCSITGTG---GRNTYLGR  282



>ref|XP_006280767.1| hypothetical protein CARUB_v10026738mg [Capsella rubella]
 gb|EOA13665.1| hypothetical protein CARUB_v10026738mg [Capsella rubella]
Length=338

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 166/267 (62%), Gaps = 32/267 (12%)
 Frame = +2

Query  74   VRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE  253
            V +L VVI   +VF        D  PIP  K ++E WF  +V+  Q+GR           
Sbjct  10   VTILLVVITSPVVFGN------DAAPIPQNKGRIEQWFNTNVK--QNGR-----------  50

Query  254  AAPVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                       G FKTI EA+K++   NT+R II +  G Y E+V ID  +PF+TLYG P
Sbjct  51   -----------GHFKTITEAIKSVGEGNTRRVIIKVGPGVYKEKVTIDRSKPFITLYGHP  99

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISG  610
               P L    TAAQ GT+ SATL VLSDYFMAVNI VKNSAP P GK    QA+++ ISG
Sbjct  100  NAMPVLTYDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKKKGAQALSMRISG  159

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            NKAAFYNCKFYG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L T+L+V  GD + 
Sbjct  160  NKAAFYNCKFYGYQDTVCDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIR  218

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSA  871
            ++ A   KSA E +G SFV C++TG+ 
Sbjct  219  VIAAQAGKSAEEKSGYSFVHCKVTGTG  245



>gb|KGN48071.1| hypothetical protein Csa_6G428040 [Cucumis sativus]
Length=339

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 169/254 (67%), Gaps = 7/254 (3%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKV-GKG-GQFKTIQEAVKT  322
            +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV G G G FKTI EA+ +
Sbjct  2    VPVDKTQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMGDGTGDFKTITEAIAS  61

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
            +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  62   VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLSFDGVASKYGTVYSATL  121

Query  503  YVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKH  682
             V +DYF+A N+ ++N++PRP+G+ + QA+A    G K+AFYNCKF GFQDTLCD+   H
Sbjct  122  IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFLGFQDTLCDDDGLH  181

Query  683  FYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRIT  862
             YKDC+I+GTVDF FG   S+ LNTEL+V      A++TAH R+   + +G SFV C IT
Sbjct  182  LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  241

Query  863  GSADPKAKVAVLGR  904
            G+     K   LGR
Sbjct  242  GN----GKDTYLGR  251



>ref|XP_002511042.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51644.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=364

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 163/243 (67%), Gaps = 5/243 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV--GKGGQFKTIQEA  313
            DT P+P   S +  WF A+V+PL   +  +DPAL  AEA P  +KV     G+FKTI +A
Sbjct  29   DTTPMPDAASGIAGWFSANVKPLADRKGTLDPALEAAEANPKTIKVRLDGSGEFKTITDA  88

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            VK+IP+ NT+R I+ I  G Y E++ I+ D+PFVT  G P N  T+    TA + GT+YS
Sbjct  89   VKSIPSGNTQRVIVDIGPGTYKEKITIERDKPFVTFLG-PPNMATIAFGGTAQEFGTVYS  147

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL V S+YF+A N+ ++N+APRP GK P  QA+A+ I G+KAAFY  K  GFQDTLCD+
Sbjct  148  ATLQVESEYFIAANLIIQNTAPRPDGKRPGAQALAVRIGGSKAAFYKVKMLGFQDTLCDD  207

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF+KDCYIEGTVDF FG  KSI LNTE++V       ++TA  R+ + EDTG SFV 
Sbjct  208  KGFHFFKDCYIEGTVDFIFGSGKSIYLNTEINVLTDAEPTVITAQARQGS-EDTGFSFVH  266

Query  851  CRI  859
            C +
Sbjct  267  CSV  269



>ref|XP_010109161.1| Pectinesterase PPME1 [Morus notabilis]
 gb|EXC21090.1| Pectinesterase PPME1 [Morus notabilis]
Length=359

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 167/261 (64%), Gaps = 4/261 (2%)
 Frame = +2

Query  98   VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
            +  ++     V+  D   +P  K+Q+ SWF  +V+P+   +  +DPALV AE     + V
Sbjct  7    LLTILLSVAAVLGSDYSAVPPNKAQLHSWFNQNVRPVNERKSTLDPALVAAEQGRRVITV  66

Query  278  GKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
             K G   FK I +A+ ++P+ N KR II I  G+Y E++ ID  + FVTLYG+P  +PTL
Sbjct  67   RKDGTGNFKRITDAINSVPSNNNKRVIIKIGPGEYREKITIDRTKRFVTLYGNPNAKPTL  126

Query  452  VAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFY  628
                TA Q GT+ S TL  L+DYF+A N+ +KN+AP+P GK    QA AL ISG+K+A Y
Sbjct  127  SYGGTAEQYGTVDSGTLIALADYFVAANLIIKNTAPKPDGKRKGAQASALRISGDKSAVY  186

Query  629  NCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHG  808
            NC+  GFQDT+CD+   HF+KDCYIEGTVDF FG   SI LNTELHV     + ++TA  
Sbjct  187  NCRILGFQDTICDDRGYHFFKDCYIEGTVDFIFGSGTSIYLNTELHVVQDSGIEVITAQA  246

Query  809  RKSAIEDTGLSFVQCRITGSA  871
            R+S  ++TG SF+ C +TG+ 
Sbjct  247  RQSN-DNTGYSFLHCAVTGTG  266



>ref|XP_010252431.1| PREDICTED: putative pectinesterase 63 [Nelumbo nucifera]
Length=370

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 173/260 (67%), Gaps = 12/260 (5%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPL----QSGRKGVD----PALVKAEAAPVYLKVGK  283
            VI + +  +   +++++ W +  +Q      +  R+GVD    PAL  AEA+   +KV K
Sbjct  21   VIEVPSTALSQGETEIDRWIQKHIQAYVARKEELREGVDTALEPALKAAEASRRVIKVRK  80

Query  284  --GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVA  457
               G F+T+ EA+ TIPA NTKR I++I  G + E++K++  +PFVT +  PK++PTLV 
Sbjct  81   NGAGDFRTVTEAISTIPAGNTKRTIVWIGPGVFEEKIKVNRSQPFVTFFALPKDKPTLVY  140

Query  458  ATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD-QQAVALTISGNKAAFYNC  634
              TA   GT+ SA++ V SDYFMAVNI  KNSAP P GK +  QAVA+ ISG+ AAFY C
Sbjct  141  HGTAKDYGTVDSASVIVESDYFMAVNIIFKNSAPEPDGKREGAQAVAMRISGDMAAFYGC  200

Query  635  KFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRK  814
             F GFQDTLCD+  +HF+KDCYIEGTVD+ FG+ KSI LNTELH     T A +TA  R+
Sbjct  201  SFIGFQDTLCDDKGRHFFKDCYIEGTVDYIFGNGKSIYLNTELHSVSNRT-AFITAQARE  259

Query  815  SAIEDTGLSFVQCRITGSAD  874
               +D+G SF+ C+ITG+ +
Sbjct  260  RVDDDSGYSFIHCKITGNGE  279



>gb|KGN48072.1| hypothetical protein Csa_6G428290 [Cucumis sativus]
Length=368

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/254 (47%), Positives = 167/254 (66%), Gaps = 7/254 (3%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKT  322
            +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV   G   FKT+ EA+ +
Sbjct  31   VPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMSDGTGDFKTVTEAIAS  90

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
            +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  91   VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLTFDGVASKYGTVYSATL  150

Query  503  YVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKH  682
             V +DYF+A N+ ++N++PRP+G+ + QA+A    G K+AFYNCKF GFQDTLCD+   H
Sbjct  151  IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFLGFQDTLCDDDGLH  210

Query  683  FYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRIT  862
             YKDC+I+GTVDF FG   S+ LNTEL+V      A++TAH R+   + +G SFV C IT
Sbjct  211  LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  270

Query  863  GSADPKAKVAVLGR  904
            G+     K   LGR
Sbjct  271  GN----GKDTFLGR  280



>ref|XP_004140273.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=364

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/254 (47%), Positives = 167/254 (66%), Gaps = 7/254 (3%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKT  322
            +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV   G   FKT+ EA+ +
Sbjct  27   VPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMSDGTGDFKTVTEAIAS  86

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
            +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  87   VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLTFDGVASKYGTVYSATL  146

Query  503  YVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKH  682
             V +DYF+A N+ ++N++PRP+G+ + QA+A    G K+AFYNCKF GFQDTLCD+   H
Sbjct  147  IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFLGFQDTLCDDDGLH  206

Query  683  FYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRIT  862
             YKDC+I+GTVDF FG   S+ LNTEL+V      A++TAH R+   + +G SFV C IT
Sbjct  207  LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  266

Query  863  GSADPKAKVAVLGR  904
            G+     K   LGR
Sbjct  267  GN----GKDTYLGR  276



>ref|XP_010109162.1| putative pectinesterase 50 [Morus notabilis]
 gb|EXC21091.1| putative pectinesterase 50 [Morus notabilis]
Length=361

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 177/278 (64%), Gaps = 8/278 (3%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +   ++ +LV     V+    VPIP  ++QV +WF  +++P    +  +DP LVKAE   
Sbjct  3    VQAALLTILVATATVVLANGDVPIPENEAQVNTWFNQNIRPFGERKGTLDPNLVKAEEGV  62

Query  263  VYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGD-P  433
              ++V K G   FK I +A+KTIPA NTKR II I  G+Y+E+V ID+++P+V+L G  P
Sbjct  63   KIIRVRKDGSEDFKKIADAIKTIPAWNTKRVIIDIGPGEYHEKVLIDYNQPYVSLVGSSP  122

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISG  610
            K+RPT+    TA Q GT+ SAT+ VL+ YF+A N+  KNSAPRP   K D QA+A  I+G
Sbjct  123  KDRPTITYGATAKQYGTVDSATVIVLAPYFVAANLIFKNSAPRPDPYKKDGQALAFRING  182

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            +KAAF+N KF GFQDTLCD+   HF+KDCYIEGTVDF FG   S+ LN +L V     + 
Sbjct  183  DKAAFFNSKFIGFQDTLCDDRGYHFFKDCYIEGTVDFIFGRGTSLYLNADLFVIGDKGLT  242

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            ++TA GR   +  TG SFV  RI G+ +       LGR
Sbjct  243  VITAQGRGDRVS-TGYSFVHSRIEGTGN---STTFLGR  276



>gb|EYU20154.1| hypothetical protein MIMGU_mgv1a008641mg [Erythranthe guttata]
Length=367

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 177/288 (61%), Gaps = 12/288 (4%)
 Frame = +2

Query  65   MET----VRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVD  232
            MET    +  LN V+V VL+  P       + PIPA+ SQ+ SWF  +V    S +  + 
Sbjct  1    METKSSYIFTLNAVLVTVLLSLPVARSGGGSEPIPADASQINSWFNKNVGDAASRKATLA  60

Query  233  PALVKAEAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDR  406
            P L  AEA P  +KV     G FKTI +AVK+IP  N  R I+ I  GKY E+V +  ++
Sbjct  61   PELAAAEANPKVIKVRADGSGDFKTINDAVKSIPDGNKNRVIVSIGPGKYKEKVTVGANK  120

Query  407  PFVTLYGDPKNRPTLVAATTAAQV-GTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-D  580
            PFVTL GD  N PT+V   TA +  G +YSATL   SDYF AVN+ V N+APRP GK  D
Sbjct  121  PFVTLRGDAGNMPTIVYDDTAKKSKGVVYSATLSAESDYFSAVNLKVVNTAPRPDGKMVD  180

Query  581  QQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTE  760
             QAVAL I G  A+ YNCK YGFQDTL D+  KHFYKDCYIEGT DF +G A SI LNTE
Sbjct  181  AQAVALKIIGKYASIYNCKLYGFQDTLFDDKGKHFYKDCYIEGTYDFIWGSAASIYLNTE  240

Query  761  LHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            LH+  GD +A++ A+ R ++ E  G  F  C++TG+      +  LGR
Sbjct  241  LHIISGDPLAVIAANARSASAEPNGYVFAHCKVTGT----GAMGYLGR  284



>ref|XP_007038216.1| Pectin lyase-like superfamily protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY22717.1| Pectin lyase-like superfamily protein, putative isoform 4 [Theobroma 
cacao]
Length=283

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 163/254 (64%), Gaps = 4/254 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +   I  +LV  P  V+  ++ PIP +KSQ+++WF A+++P  +    +DPAL KAE A 
Sbjct  11   VGAAICTILVLAPV-VLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAA  69

Query  263  VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV K   G F TI +A+ ++P+ NTKR II I GG Y E+++ID  +PF+T YGDP+
Sbjct  70   HIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPR  129

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGN  613
            N P L    TA Q GT+ SATL V SDYF+A NI ++N+APRP G     QAV+L ISG+
Sbjct  130  NMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGD  189

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAFYNCK  GFQDTLCD+   HF+KDCYI GTVDF FG  KS+ L   +       +  
Sbjct  190  KAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLGVTVITAQNCFLRR  249

Query  794  VTAHGRKSAIEDTG  835
            +   G++S  +  G
Sbjct  250  IQVQGKRSKFQWAG  263



>ref|XP_007219211.1| hypothetical protein PRUPE_ppa017319mg, partial [Prunus persica]
 gb|EMJ20410.1| hypothetical protein PRUPE_ppa017319mg, partial [Prunus persica]
Length=270

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/246 (52%), Positives = 156/246 (63%), Gaps = 29/246 (12%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D+ PIPA+ SQV SWF  +V+PL   +  +D A+V AE  P  +KV K   G FKT+ EA
Sbjct  7    DSTPIPADGSQVGSWFDNNVKPLTERKGTLDAAIVTAEDGPKLIKVMKDGSGNFKTLTEA  66

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP RNTKR +++I GG YNE++KI  ++PFVTLYG P N P L    TA + GT+YS
Sbjct  67   INSIPERNTKRVVVYIGGGVYNEKIKIPQNKPFVTLYGSPNNMPNLTFDGTAQKYGTVYS  126

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
             TL V SDYF A NI V      P G +PD QAVAL ISG+KA+FYNCKF+GFQDTL D 
Sbjct  127  GTLIVESDYFRAANIIVT-----PDGIRPDAQAVALQISGDKASFYNCKFFGFQDTLYDY  181

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF+KDCYI+GTVDF FG  KS+ L                     SA ED   SFV 
Sbjct  182  KGLHFFKDCYIQGTVDFIFGKGKSLYL---------------------SASEDNEFSFVH  220

Query  851  CRITGS  868
            C+ITG+
Sbjct  221  CKITGT  226



>gb|KHN28380.1| Putative pectinesterase 48, partial [Glycine soja]
Length=313

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 150/214 (70%), Gaps = 3/214 (1%)
 Frame = +2

Query  227  VDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
            VDPALV AE     +KV +   G+FKTI +A+K+IP+ NTKR II+I  G YNE++KI+ 
Sbjct  1    VDPALVTAEEGAKVVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEK  60

Query  401  DRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-P  577
             +PFVTLYG P+  P L    TA Q GT+ SATL V SDYF+A NI + N+APRP  K P
Sbjct  61   TKPFVTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTP  120

Query  578  DQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNT  757
              QAVAL ISG+KAAFYNCK YGFQDT+CD+ N+HF+KDC I+GT+D+ FG  KS+ ++T
Sbjct  121  GGQAVALRISGDKAAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVST  180

Query  758  ELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRI  859
            EL     + + ++ A  RKS  ED   SFV C +
Sbjct  181  ELRTLGDNGITVIVAQARKSETEDNAYSFVHCDV  214



>ref|XP_008242288.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=370

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 166/250 (66%), Gaps = 11/250 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGV------DPALVKAEAAPVYLKVGKGG--QFKTIQ  307
            IP   SQ+++W   +++   + RK        D  L+ AE A   + V K G   FKT+ 
Sbjct  32   IPPHLSQLDTWIVHNIRDY-ANRKATQATLRFDSKLLSAEYAVKIITVKKDGTGDFKTVT  90

Query  308  EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTI  487
            +AV +IP+ NT+R ++FI GG+Y E++ +D  RPFVT YGD  + P++    TA + GT 
Sbjct  91   DAVNSIPSWNTRRVVVFIRGGEYREKILVDASRPFVTFYGDKNDVPSITFDGTALKYGTW  150

Query  488  YSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGFQDTLC  664
             SAT+ V +DYF+AVNI   NSAP P G +P  QAVA+ ISG+KAAF+NC+F GFQDTLC
Sbjct  151  DSATVAVDADYFVAVNIAFVNSAPMPDGNRPGAQAVAMRISGDKAAFHNCRFIGFQDTLC  210

Query  665  DNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSF  844
            D+  +HF+KDCYI+GTVDF FG+ KS+ LN  +H    + M ++TAH R+ A +D+G +F
Sbjct  211  DDRGRHFFKDCYIQGTVDFIFGNGKSLYLNNRIHSV-ANGMGVITAHAREDAADDSGFAF  269

Query  845  VQCRITGSAD  874
            V C ITG+ D
Sbjct  270  VHCNITGTGD  279



>gb|KDP39968.1| hypothetical protein JCGZ_03499 [Jatropha curcas]
Length=358

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/272 (48%), Positives = 172/272 (63%), Gaps = 17/272 (6%)
 Frame = +2

Query  98   VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
            +  +VF    V   D VPIP  +++V +WF A+V+PL   +  +D  L  AEA P  +KV
Sbjct  15   IIAIVFTAITVSSDDAVPIPEAEAEVNAWFEANVKPLADRKGTLDGNLEAAEATPKTIKV  74

Query  278  GK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
                 G+FKTI +AVK+IPA+NT+R I+ I  G Y E++ ++ ++ FV+  G P+ +  +
Sbjct  75   SADGSGEFKTITDAVKSIPAKNTQRVIVDIGPGTYTEKITVEKEKGFVSFIGVPE-KTII  133

Query  452  VAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFY  628
              A TA + GT+YSATL V SD+F        N+AP P G +P  QAVA  I GN A+FY
Sbjct  134  EFAGTAHEYGTVYSATLQVESDFF--------NTAPPPDGVRPGAQAVAFRIGGNMASFY  185

Query  629  NCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHG  808
            NC+F GFQDT+CD+   HF+KDCYIEGTVDF FG  KSI LNT+L V     M ++ A  
Sbjct  186  NCRFIGFQDTICDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTQLEVIQDKDMTVIVAQA  245

Query  809  RKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            R +A E+TG SFV C ITG    KAK A LGR
Sbjct  246  RGNA-EETGFSFVHCSITG----KAKGAFLGR  272



>gb|KDP39971.1| hypothetical protein JCGZ_03502 [Jatropha curcas]
Length=548

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 173/272 (64%), Gaps = 9/272 (3%)
 Frame = +2

Query  98   VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
            +  +VF    V   D  PIP  +++V + F A+V+PL   +  ++  L  AEA P  +KV
Sbjct  15   IIAIVFTATTVTSDDAAPIPEAEAEVNACFEANVKPLADRKGTLNADLEAAEATPKTIKV  74

Query  278  --GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
                 G+FKTI EAVK IPA+N +R I+ I  G Y E++ ++ D+PFV+  G P+ +  +
Sbjct  75   RADGSGEFKTITEAVKRIPAKNAQRVIVDIGPGTYTEKITVEKDKPFVSFVGVPE-KTII  133

Query  452  VAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFY  628
              A TA + GT+YSATL V SD+F+   + +KN+AP P GK P  QAVA  I+G+ ++FY
Sbjct  134  EFAGTAHEYGTVYSATLQVESDFFVGSGLVIKNTAPAPDGKRPGAQAVAFRIAGSMSSFY  193

Query  629  NCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHG  808
            NC+F GFQDT+CD+   HF+KDCY+EGTVDF FG  KSI LNT+L V     M ++ A  
Sbjct  194  NCRFIGFQDTICDDKGFHFFKDCYVEGTVDFIFGSGKSIYLNTQLEVLQDKEMTVIVAQA  253

Query  809  RKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            R +A EDTG SFV C + G    KAK A LGR
Sbjct  254  RGNA-EDTGFSFVHCSVAG----KAKGAYLGR  280



>gb|KHG22980.1| Pectinesterase PPME1 -like protein [Gossypium arboreum]
Length=363

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/269 (45%), Positives = 170/269 (63%), Gaps = 11/269 (4%)
 Frame = +2

Query  89   VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY  268
            V+ + +L+F P  V    + PIP +KSQVE+WF   ++P++   K +DP LV+A   P  
Sbjct  15   VICISILLFAPIVV----SQPIPVDKSQVETWFNDIIKPVKERGKTLDPELVEAGTEPRI  70

Query  269  LKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
            ++V  G GG+F TI + ++++P+ N K  II I  G Y E+++I+ ++PF+TL GDPKN 
Sbjct  71   IRVMQGGGGEFNTITKTIESVPSGNGKHVIISIGPGSYKEKIRIERNKPFITLVGDPKNM  130

Query  443  PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKA  619
            P L    T  Q GT+  A   + S YF+  N+N+ N+ PRP GK    QAVAL +SG+++
Sbjct  131  PNLTFDGTVKQYGTVDGAAFIIESSYFVGANLNIVNTPPRPDGKMVGAQAVALRVSGDRS  190

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHV---FPGD-TM  787
            AFYNCK  GFQD L D+   HF+KDC+I GTVDF F     + LN+E+ V     GD  M
Sbjct  191  AFYNCKIIGFQDILFDDRGNHFFKDCHIRGTVDFIFRSGTFLYLNSEIFVEGDLEGDPEM  250

Query  788  AMVTAHGRKSAIEDTGLSFVQCRITGSAD  874
            A++T   RKS+ EDTG SF   RIT +A+
Sbjct  251  AVITIQARKSSSEDTGYSFAHGRITETAN  279



>gb|KDP39969.1| hypothetical protein JCGZ_03500 [Jatropha curcas]
Length=404

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/254 (47%), Positives = 168/254 (66%), Gaps = 9/254 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP--VYLKVGKGGQFKTIQEAVKTI  325
            +P  +++V +WF A+V+PL   +  ++  L  AEA P  + ++    G+FKTI +AVK+I
Sbjct  1    MPEAEAEVNAWFEANVKPLADRKGTLNADLEAAEATPKTITVRADGSGEFKTITDAVKSI  60

Query  326  PARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLY  505
            PA+N +R I+ I  G Y E++ ++ D+PFV+  G P+ +  +  A TA + GT+YSATL 
Sbjct  61   PAKNAQRVIVDIGPGTYTEKITVEKDKPFVSFVGVPE-KTIIEFAGTAHEYGTVYSATLQ  119

Query  506  VLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKH  682
            V SD+F+   + +KN+AP P GK P  QAVA  I+G+ ++FYNC+F GFQDT+CD+   H
Sbjct  120  VESDFFVGSGLVIKNTAPAPDGKRPGAQAVAFRIAGSMSSFYNCRFIGFQDTICDDKGFH  179

Query  683  FYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRIT  862
            F+KDCY+EGTVDF FG  KSI LNT+L V     M ++ A  R +A EDTG SFV C + 
Sbjct  180  FFKDCYVEGTVDFIFGSGKSIYLNTQLEVLQDKEMTVIVAQARGNA-EDTGFSFVHCSVA  238

Query  863  GSADPKAKVAVLGR  904
            G    KAK A LGR
Sbjct  239  G----KAKGAYLGR  248



>ref|XP_010483849.1| PREDICTED: putative pectinesterase 63 [Camelina sativa]
Length=309

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G FKTI EA+K++ A NT R II +  G Y E+V ID ++PF+TLYG P   P L    T
Sbjct  22   GHFKTITEAIKSVQAGNTGRVIIKVGPGVYKEKVTIDRNKPFITLYGHPNAMPVLTYDGT  81

Query  467  AAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFY  643
            A + GT+ SATL VLSDYFMA+NI VKN+AP P GK    QA+++ ISGNKAAFYNCKFY
Sbjct  82   ALRYGTVDSATLIVLSDYFMAINIIVKNNAPMPDGKMKGAQALSMRISGNKAAFYNCKFY  141

Query  644  GFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAI  823
            G+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L T+L+V  GD + ++TAH  KSA 
Sbjct  142  GYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIRVITAHAGKSAQ  200

Query  824  EDTGLSFVQCRITGSA  871
            E +G SFV C++TG+ 
Sbjct  201  EKSGYSFVHCKVTGTG  216



>ref|XP_002277518.1| PREDICTED: putative pectinesterase 63 isoform X2 [Vitis vinifera]
Length=379

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 172/267 (64%), Gaps = 13/267 (5%)
 Frame = +2

Query  107  LVFCPGGVIPLDTVPIPAEKSQVESWFRASV----QPLQSGRKGV----DPALVKAEAAP  262
            ++F P  V+   T  IP++ S++++W   ++    Q +   +KG+    DP LV AEA  
Sbjct  23   MIFIPA-VVSDKTKHIPSDTSKLDAWIATNIREYRQRIWESKKGLHSSLDPILVAAEAEV  81

Query  263  VYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV K G   FKTI +A+ +IP  N KR +I+I GG+Y E++ ID  +PF+TLYG   
Sbjct  82   NVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEYWEKITIDRSKPFITLYGSTA  141

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGN  613
            + P++    TA + GT+ SAT+ V SDYFMAVNI   NSAP P GK    QAVA+ ISG+
Sbjct  142  DMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVNSAPMPDGKRVGAQAVAMRISGD  201

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAF+NC F GFQDTLCD+  +HF+KDC I+GTVDF FGD KS+ LNT +       + +
Sbjct  202  KAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGDGKSLYLNTMIQSV-AKGVGV  260

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSAD  874
            +TA  R++  + +G +FV C I+GS D
Sbjct  261  ITAQARENVADTSGFAFVHCNISGSGD  287



>emb|CBI27759.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   229 bits (585),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 172/267 (64%), Gaps = 13/267 (5%)
 Frame = +2

Query  107  LVFCPGGVIPLDTVPIPAEKSQVESWFRASV----QPLQSGRKGV----DPALVKAEAAP  262
            ++F P  V+   T  IP++ S++++W   ++    Q +   +KG+    DP LV AEA  
Sbjct  35   MIFIPA-VVSDKTKHIPSDTSKLDAWIATNIREYRQRIWESKKGLHSSLDPILVAAEAEV  93

Query  263  VYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV K G   FKTI +A+ +IP  N KR +I+I GG+Y E++ ID  +PF+TLYG   
Sbjct  94   NVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEYWEKITIDRSKPFITLYGSTA  153

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGN  613
            + P++    TA + GT+ SAT+ V SDYFMAVNI   NSAP P GK    QAVA+ ISG+
Sbjct  154  DMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVNSAPMPDGKRVGAQAVAMRISGD  213

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAF+NC F GFQDTLCD+  +HF+KDC I+GTVDF FGD KS+ LNT +       + +
Sbjct  214  KAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGDGKSLYLNTMIQSV-AKGVGV  272

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSAD  874
            +TA  R++  + +G +FV C I+GS D
Sbjct  273  ITAQARENVADTSGFAFVHCNISGSGD  299



>gb|KDP22496.1| hypothetical protein JCGZ_26327 [Jatropha curcas]
Length=651

 Score =   236 bits (601),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 164/258 (64%), Gaps = 8/258 (3%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D  PIP +KSQV+SWF A V+PL S +  ++  L  AEA P  +KV +   G FKTI +A
Sbjct  315  DATPIPPDKSQVQSWFAAHVKPLASRKGTLNSTLEAAEAKPKTIKVRQDGSGNFKTITDA  374

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            V ++PA+N +R II I  G Y E+V I  ++PF+T  G PK   TL    TAA+ GT+YS
Sbjct  375  VNSVPAKNAQRVIIDIGPGVYTEKVTIPREKPFITFRGPPK-MATLQFGGTAAKYGTVYS  433

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL V S++F+A N+ +KN+AP+P GK    QAVAL    +  AFYN +  GFQDTLCD+
Sbjct  434  ATLQVESEFFVAANLIIKNTAPQPDGKRKGAQAVALRTGASMQAFYNVRLLGFQDTLCDD  493

Query  671  INKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQ  850
               HF+KDCYIEGTVDF FG  KSI LNT+L+V       ++TA  R+   ED G SFV 
Sbjct  494  KGFHFFKDCYIEGTVDFIFGSGKSIYLNTQLYVLEEKDAQIITAQAREKEGEDIGYSFVH  553

Query  851  CRITGSADPKAKVAVLGR  904
            C I G  +     A LGR
Sbjct  554  CDIKGVGNR----AFLGR  567



>ref|XP_008338574.1| PREDICTED: pectinesterase PPME1-like [Malus domestica]
Length=233

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 149/225 (66%), Gaps = 3/225 (1%)
 Frame = +2

Query  86   NVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPV  265
            +++I+ +L+      I  DT+PIP++ SQV SWF  +V+     +  +DPALV AE AP 
Sbjct  6    SLMIITILLTSSTAAIADDTIPIPSDSSQVASWFDNNVKTYNERKSTLDPALVAAEHAPQ  65

Query  266  YLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
             +KV +  GG FKTI +A+ +IPA NTKR  ++I GG YNE++ I  ++PFVT YG PK+
Sbjct  66   VIKVMQDGGGNFKTITDAINSIPAGNTKRMFVYIKGGVYNEKITIPHNKPFVTFYGSPKS  125

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNK  616
             P +    TA + GT+YS TL V SDYF AVN+ + NSAP P G +   QAVA+ ISGNK
Sbjct  126  MPNITFDGTAQKYGTVYSGTLIVESDYFRAVNLVIINSAPEPDGIREGAQAVAVQISGNK  185

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIIL  751
            AAFYNCK  G+QDTL D    H  KDC+I+GTVDF F   K + L
Sbjct  186  AAFYNCKMIGYQDTLYDYKGLHLXKDCFIQGTVDFIFRKGKXLYL  230



>ref|XP_007202075.1| hypothetical protein PRUPE_ppa005976mg [Prunus persica]
 gb|EMJ03274.1| hypothetical protein PRUPE_ppa005976mg [Prunus persica]
Length=434

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/250 (47%), Positives = 165/250 (66%), Gaps = 11/250 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGV------DPALVKAEAAPVYLKVGKGG--QFKTIQ  307
            IP   SQ+++W   +++   + RK        D  L+ AE A   + V K G   FKT+ 
Sbjct  96   IPPHLSQLDTWIVHNMRDY-ANRKATQVTLRFDSKLLSAEYAFKIITVKKDGTGDFKTVT  154

Query  308  EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTI  487
            +AV +IP+ N +R ++FI GG+Y E++ +D  RPFVT YGD  + P++    TA + GT 
Sbjct  155  DAVNSIPSWNKRRVVVFIDGGEYREKILVDVSRPFVTFYGDKNDVPSITFDGTALKYGTW  214

Query  488  YSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLC  664
             SAT+ + +DYF+AVNI   NSAP P GK P  QAVA+ ISG+KAAF++C+F GFQDTLC
Sbjct  215  DSATVAIEADYFVAVNIAFVNSAPMPDGKRPGAQAVAMRISGDKAAFHSCRFIGFQDTLC  274

Query  665  DNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSF  844
            D+  +HF+KDCYI+GTVDF FG+ KS+ LN  +H    + M ++TAH R+ A +D+G +F
Sbjct  275  DDRGRHFFKDCYIQGTVDFIFGNGKSLYLNNRIHSV-ANGMGVITAHAREDAADDSGFAF  333

Query  845  VQCRITGSAD  874
            V C ITG+ D
Sbjct  334  VHCNITGTGD  343



>ref|XP_009123158.1| PREDICTED: probable pectinesterase 49 [Brassica rapa]
Length=295

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 138/194 (71%), Gaps = 1/194 (1%)
 Frame = +2

Query  284  GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAAT  463
            GG FKTI EA+K+IP  NTKR II +A G Y+E+V +D  RPFVTL G P     L    
Sbjct  8    GGDFKTINEAIKSIPIGNTKRVIIKLAPGVYHEKVTVDVGRPFVTLMGKPGAETNLTFDG  67

Query  464  TAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFY  643
            TA++ GT+ SATL + + YF+A N++VKN+AP P      QA+A+ I+G+KAAFYNC+FY
Sbjct  68   TASKFGTMESATLIIWAKYFVAANLHVKNTAPMPKAGTQGQALAMRINGDKAAFYNCRFY  127

Query  644  GFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAI  823
            GFQDTLCD+I  HF+KDCYIEGT DF FG   S+ LNT+LH   GD + ++TAH R+S  
Sbjct  128  GFQDTLCDDIGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAHNRQSEN  186

Query  824  EDTGLSFVQCRITG  865
            +  G SFV C+ITG
Sbjct  187  QQNGYSFVHCKITG  200



>ref|XP_004289004.1| PREDICTED: pectinesterase PPME1-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   228 bits (580),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 166/265 (63%), Gaps = 15/265 (6%)
 Frame = +2

Query  152  IPAEKSQVESWF---------RASVQPLQSGRKGV--DPALVKAEAAPVYLKVGKGG--Q  292
            IP  ++ ++ W          R +V   +S   G   D  L  AE A   ++V K G   
Sbjct  29   IPENEADLDDWIVRNMREYDKRKAVLNTRSDVPGTHFDTELAAAEDAGRVIRVKKDGTGD  88

Query  293  FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAA  472
            FKT+ +AVK+IP  N +R +++I GG+Y E++ ++  +PFVT YGD  + P++    TAA
Sbjct  89   FKTVTDAVKSIPTGNKRRVVVWIGGGEYREKILVEMTKPFVTFYGDKNDMPSITYDGTAA  148

Query  473  QVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGF  649
              GT  SAT+ V SDYF+AVNI   NSAP P G + D QAVA+ ISG+KAAFYNCKF GF
Sbjct  149  VYGTWNSATVAVESDYFVAVNIAFVNSAPMPDGIRKDAQAVAMRISGDKAAFYNCKFMGF  208

Query  650  QDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIED  829
            QDTLCD+  +HF+KDC+I+GTVDF FG+ KS+ L + L+    + + ++TAHGR  A +D
Sbjct  209  QDTLCDDKGRHFFKDCFIQGTVDFIFGNGKSLYLKSTLNSV-ANGVGVITAHGRSEAQDD  267

Query  830  TGLSFVQCRITGSADPKAKVAVLGR  904
            TG SFV C I G+ D     A  GR
Sbjct  268  TGFSFVYCTIKGTGDTLLGRAWRGR  292



>gb|ACU13228.1| unknown [Glycine max]
Length=218

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 139/195 (71%), Gaps = 3/195 (2%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKT  301
            V+  DTVPIPA K+Q+  W+  +V PL   +  +DPALV AE     +KV +   G+FKT
Sbjct  24   VLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTMDPALVTAEEGAKVVKVMQDGSGEFKT  83

Query  302  IQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG  481
            I +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    TA Q G
Sbjct  84   ITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGTAQQYG  143

Query  482  TIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDT  658
            T+ SATL V SDYF+A NI + N+APRP  K P  QAVAL ISG+KAAFYNCK YGFQDT
Sbjct  144  TVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMYGFQDT  203

Query  659  LCDNINKHFYKDCYI  703
            +CD+ N+HF+KDC I
Sbjct  204  ICDDRNRHFFKDCLI  218



>gb|KHN15646.1| Putative pectinesterase 63 [Glycine soja]
Length=296

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 136/192 (71%), Gaps = 1/192 (1%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G+FKTI +A+ ++P  NTKR I+FI  G YNE++KI+  +PFVTLYG P+  P L    T
Sbjct  6    GEFKTITDAINSVPNGNTKRVIVFIGAGNYNEKIKIERTKPFVTLYGVPEKMPNLTFGGT  65

Query  467  AAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFY  643
            A Q GT+ SATL V SDYF+A NI + N+APRP  K P  QAVAL ISG+KAAFYNCK +
Sbjct  66   AQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMF  125

Query  644  GFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAI  823
            GFQDT+CD+ NKHF+KDC I+GT+D+ FG  KS+ ++TEL     + + ++ A  RKS  
Sbjct  126  GFQDTICDDRNKHFFKDCLIQGTMDYIFGSGKSLYMSTELRTLGDNGITVIVAQARKSET  185

Query  824  EDTGLSFVQCRI  859
            ED   SFV C +
Sbjct  186  EDNAYSFVHCDV  197



>ref|XP_008391732.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=365

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 164/250 (66%), Gaps = 11/250 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGV------DPALVKAEAAPVYLKVGKGG--QFKTIQ  307
            IP   SQ++SW   +++   + RK        D  L+ AE     + V K G  QF+T+ 
Sbjct  27   IPPNFSQLDSWIXHNMRDY-ANRKATQXTLRFDAQLLSAEEIVRIITVRKDGTGQFRTVT  85

Query  308  EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTI  487
            +AV +IP+ NT+R ++FI GG Y E+V +D  +PFVT YGD  + P++    TA + GT 
Sbjct  86   DAVNSIPSGNTRRVVVFIGGGVYTEKVLVDASKPFVTFYGDQNDVPSITFDGTALKYGTW  145

Query  488  YSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGFQDTLC  664
             S+T+ V SDYF+AVNI   NSAP P G +P  QAVA+ ISG+KAAF+NC+F GFQDTL 
Sbjct  146  NSSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLL  205

Query  665  DNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSF  844
            D+  +HF+KDC+++GTVDF FG+ KS+ LN  +H    + M ++TAH R++  +D+G +F
Sbjct  206  DDRGRHFFKDCHVQGTVDFIFGNGKSLYLNNTIHSV-ANGMGVITAHARENVEDDSGFAF  264

Query  845  VQCRITGSAD  874
            V C ITG+ D
Sbjct  265  VHCNITGTGD  274



>ref|XP_010656088.1| PREDICTED: putative pectinesterase 63 isoform X1 [Vitis vinifera]
Length=382

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 172/270 (64%), Gaps = 16/270 (6%)
 Frame = +2

Query  107  LVFCPGGVIPLDTVPIPAEKSQVESWFRASV----QPLQSGRKGV----DPALVKAEAAP  262
            ++F P  V+   T  IP++ S++++W   ++    Q +   +KG+    DP LV AEA  
Sbjct  23   MIFIPA-VVSDKTKHIPSDTSKLDAWIATNIREYRQRIWESKKGLHSSLDPILVAAEAEV  81

Query  263  VYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV K G   FKTI +A+ +IP  N KR +I+I GG+Y E++ ID  +PF+TLYG   
Sbjct  82   NVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEYWEKITIDRSKPFITLYGSTA  141

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINV---KNSAPRPSGKP-DQQAVALTI  604
            + P++    TA + GT+ SAT+ V SDYFMAVNI      NSAP P GK    QAVA+ I
Sbjct  142  DMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVVRTNSAPMPDGKRVGAQAVAMRI  201

Query  605  SGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDT  784
            SG+KAAF+NC F GFQDTLCD+  +HF+KDC I+GTVDF FGD KS+ LNT +       
Sbjct  202  SGDKAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGDGKSLYLNTMIQSV-AKG  260

Query  785  MAMVTAHGRKSAIEDTGLSFVQCRITGSAD  874
            + ++TA  R++  + +G +FV C I+GS D
Sbjct  261  VGVITAQARENVADTSGFAFVHCNISGSGD  290



>ref|XP_009343360.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=366

 Score =   224 bits (571),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 163/250 (65%), Gaps = 11/250 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGV------DPALVKAEAAPVYLKVGKGG--QFKTIQ  307
            IP   SQ++SW   +++   + RK        D  L+ AE     + V K G  QF+T+ 
Sbjct  28   IPPNFSQLDSWIAHNMRGY-TNRKATQATLRFDAQLLSAEEIVRIITVRKDGTGQFRTVT  86

Query  308  EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTI  487
            +AV +IP+ NT+R ++FI GG Y E++ +D  +PFVT YGD  + P++    TA + GT 
Sbjct  87   DAVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTW  146

Query  488  YSATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGFQDTLC  664
             S+T+ V SDYF+AVNI   NSAP P G +P  QAVA+ ISG+KAAF+NC+F GFQDTL 
Sbjct  147  NSSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLL  206

Query  665  DNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSF  844
            D+  +HF+KDC+I+GTVDF FG+ KS+ LN  +H    + M ++TAH R +  +D+G +F
Sbjct  207  DDRGRHFFKDCHIQGTVDFIFGNGKSLYLNNTIHSV-ANGMGVITAHARANVEDDSGFAF  265

Query  845  VQCRITGSAD  874
            V C ITG+ D
Sbjct  266  VHCNITGTGD  275



>ref|XP_009348902.1| PREDICTED: putative pectinesterase 63 isoform X2 [Pyrus x bretschneideri]
Length=335

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 163/249 (65%), Gaps = 9/249 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-----VDPALVKAEAAPVYLKVGKGG--QFKTIQE  310
            IP   SQ++SW   +++   + +        D  ++ AE     + V K G  QF+T+ +
Sbjct  28   IPPNFSQLDSWIAHNMRGYTNLKATQATLRFDAQILSAEEIVRIITVRKDGTGQFRTVTD  87

Query  311  AVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIY  490
            AV +IP+ NT+R ++FI GG Y E++ +D  +PFVT YGD  + P++    TA + GT  
Sbjct  88   AVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  147

Query  491  SATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGFQDTLCD  667
            S+T+ V SDYF+AVNI   NSAP P G +P  QAVA+ ISG+KAAF+NC+F GFQDTL D
Sbjct  148  SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  207

Query  668  NINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFV  847
            +  +HF+KDC+I+GTVDF FG+ KS+ LN  +H    + M ++TAH R++  +D+G +FV
Sbjct  208  DRGRHFFKDCHIQGTVDFIFGNGKSLYLNNMIHSV-ANGMGVITAHARENVEDDSGFAFV  266

Query  848  QCRITGSAD  874
             C ITG+ D
Sbjct  267  HCNITGTGD  275



>gb|KHN47850.1| Putative pectinesterase 63 [Glycine soja]
Length=300

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G+FKTI +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    T
Sbjct  6    GEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGT  65

Query  467  AAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFY  643
            A Q GT+ SATL V SDYF+A NI + N+APRP  K P  QAVAL ISG+KAAFYNCK Y
Sbjct  66   AQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMY  125

Query  644  GFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSII----LNTELHVFPGDTMAMVTAHGR  811
            GFQDT+CD+ N+HF+KDC I+GT+D+ FG  KS+     ++TEL     + + ++ A  R
Sbjct  126  GFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVVSKISTELRTLGDNGITVIVAQAR  185

Query  812  KSAIEDTGLSFVQCRI  859
            KS  ED   SFV C +
Sbjct  186  KSETEDNAYSFVHCDV  201



>ref|XP_009348900.1| PREDICTED: putative pectinesterase 63 isoform X1 [Pyrus x bretschneideri]
Length=366

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 163/249 (65%), Gaps = 9/249 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-----VDPALVKAEAAPVYLKVGKGG--QFKTIQE  310
            IP   SQ++SW   +++   + +        D  ++ AE     + V K G  QF+T+ +
Sbjct  28   IPPNFSQLDSWIAHNMRGYTNLKATQATLRFDAQILSAEEIVRIITVRKDGTGQFRTVTD  87

Query  311  AVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIY  490
            AV +IP+ NT+R ++FI GG Y E++ +D  +PFVT YGD  + P++    TA + GT  
Sbjct  88   AVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  147

Query  491  SATLYVLSDYFMAVNINVKNSAPRPSG-KPDQQAVALTISGNKAAFYNCKFYGFQDTLCD  667
            S+T+ V SDYF+AVNI   NSAP P G +P  QAVA+ ISG+KAAF+NC+F GFQDTL D
Sbjct  148  SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  207

Query  668  NINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFV  847
            +  +HF+KDC+I+GTVDF FG+ KS+ LN  +H    + M ++TAH R++  +D+G +FV
Sbjct  208  DRGRHFFKDCHIQGTVDFIFGNGKSLYLNNMIHSV-ANGMGVITAHARENVEDDSGFAFV  266

Query  848  QCRITGSAD  874
             C ITG+ D
Sbjct  267  HCNITGTGD  275



>ref|XP_006381567.1| hypothetical protein POPTR_0006s13930g [Populus trichocarpa]
 gb|ERP59364.1| hypothetical protein POPTR_0006s13930g [Populus trichocarpa]
Length=375

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 161/250 (64%), Gaps = 13/250 (5%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGR----KGV-----DPALVKAEAAPVYLKVGKGG--QFK  298
            +PA+ S+V++W   ++      +    KG+     D  L  AE     ++V K G   F 
Sbjct  31   VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDELLASAEDRLRLIRVAKDGFADFT  90

Query  299  TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
            TI +A++TIP  N +R II I GG+Y E++ I  ++PF+T YGDP + P +V   TA+Q 
Sbjct  91   TISDALETIPKDNKRRTIIQIGGGEYWEKITIKCNKPFITFYGDPMDIPRIVFNGTASQY  150

Query  479  GTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGFQD  655
            GTIYSAT+ V SDYFMAVN+   NSAP P+  +   QAV++ ISG+KAAF+NCKF GFQD
Sbjct  151  GTIYSATVAVESDYFMAVNVAFVNSAPLPNVNRTGGQAVSMRISGDKAAFHNCKFIGFQD  210

Query  656  TLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTG  835
            TLCD+  +HF+KDCY+ GTVDF FG+ KS+ LNT +      T  ++TA  R+   ED+G
Sbjct  211  TLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIDSVAEGT-GVITAQAREHVTEDSG  269

Query  836  LSFVQCRITG  865
             +F+ C +TG
Sbjct  270  FTFIHCNLTG  279



>ref|XP_008344163.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=324

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/218 (49%), Positives = 150/218 (69%), Gaps = 4/218 (2%)
 Frame = +2

Query  230  DPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFD  403
            D  L+ AE     + V K G  QF+T+ +AV +IP+ NT+R ++FI GG Y E+V +D  
Sbjct  17   DAQLLSAEEIVRIITVRKDGTGQFRTVTDAVNSIPSGNTRRVVVFIGGGVYTEKVLVDAS  76

Query  404  RPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSG-KPD  580
            +PFVT YGD  + P++    TA + GT  S+T+ V SDYF+AVNI   NSAP P G +P 
Sbjct  77   KPFVTFYGDQNDVPSITFDGTALKYGTWNSSTVAVESDYFVAVNIAFVNSAPMPDGIRPG  136

Query  581  QQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTE  760
             QAVA+ ISG+KAAF+NC+F GFQDTL D+  +HF+KDC+++GTVDF FG+ KS+ LN  
Sbjct  137  AQAVAMRISGDKAAFHNCRFIGFQDTLLDDRGRHFFKDCHVQGTVDFIFGNGKSLYLNNT  196

Query  761  LHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSAD  874
            +H    + M ++TAH R++  +D+G +FV C ITG+ D
Sbjct  197  IHSV-ANGMGVITAHARENVEDDSGFAFVHCNITGTGD  233



>ref|XP_011016271.1| PREDICTED: putative pectinesterase 63 [Populus euphratica]
Length=375

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/250 (46%), Positives = 160/250 (64%), Gaps = 13/250 (5%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGR----KGV-----DPALVKAEAAPVYLKVGKGG--QFK  298
            +PA+ S+V++W   ++      +    KG+     D  L  AE     ++V K G   F 
Sbjct  31   VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDELLASAEDRLRLIRVAKDGFADFT  90

Query  299  TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
            TI +A++TI   N +R II I GG+Y E++ I  ++PFVT YGDP + P +V   TA+Q 
Sbjct  91   TISDALETIQKDNKRRIIIQIGGGEYWEKITIKCNKPFVTFYGDPMDIPRIVFNGTASQY  150

Query  479  GTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGFQD  655
            GTIYSAT+ V SDYFMAVN+   NSAP P+  +   QAVA+ ISG+KAAF+NCKF GFQD
Sbjct  151  GTIYSATVAVESDYFMAVNVAFVNSAPMPNVNRTGGQAVAMRISGDKAAFHNCKFIGFQD  210

Query  656  TLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTG  835
            TLCD+  +HF+KDCY+ GTVDF FG+ KS+ LNT +      T  ++TA  R+   ED+G
Sbjct  211  TLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIASVAEGT-GVITAQAREHVTEDSG  269

Query  836  LSFVQCRITG  865
             +F+ C +TG
Sbjct  270  FTFIHCNLTG  279



>ref|XP_011039979.1| PREDICTED: putative pectinesterase 63 [Populus euphratica]
Length=375

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/250 (46%), Positives = 160/250 (64%), Gaps = 13/250 (5%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGR----KGV-----DPALVKAEAAPVYLKVGKGG--QFK  298
            +PA+ S+V++W   ++      +    KG+     D  L  AE     ++V K G   F 
Sbjct  31   VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDELLASAEDRLRLIRVAKDGFADFT  90

Query  299  TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
            TI +A++TI   N +R II I GG+Y E++ I  ++PFVT YGDP + P +V   TA+Q 
Sbjct  91   TISDALETIQKDNKRRIIIQIGGGEYWEKITIKCNKPFVTFYGDPMDIPRIVFNGTASQY  150

Query  479  GTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGFQD  655
            GTIYSAT+ V SDYFMAVN+   NSAP P+  +   QAVA+ ISG+KAAF+NCKF GFQD
Sbjct  151  GTIYSATVAVESDYFMAVNVAFVNSAPMPNVNRTGGQAVAMRISGDKAAFHNCKFIGFQD  210

Query  656  TLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTG  835
            TLCD+  +HF+KDCY+ GTVDF FG+ KS+ LNT +      T  ++TA  R+   ED+G
Sbjct  211  TLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIASVAEGT-GVITAQAREHVTEDSG  269

Query  836  LSFVQCRITG  865
             +F+ C +TG
Sbjct  270  FTFIHCNLTG  279



>ref|XP_004140271.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=353

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/256 (47%), Positives = 153/256 (60%), Gaps = 23/256 (9%)
 Frame = +2

Query  149  PIPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVK  319
            PIP EKSQ+  WF  +V+P     K  +DPAL  AE     +KV   G   FKT+ EA+ 
Sbjct  29   PIPVEKSQLAGWFTENVKPFAVRNKAELDPALATAEENATVIKVMSDGTGNFKTVTEAIA  88

Query  320  TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSA  496
            ++PA N KR +I+I  G Y E++KID ++PFVTLYG DPKN P L     AA+ GT+YSA
Sbjct  89   SVPADNKKRVVIWIGVGVYKEKLKIDRNKPFVTLYGSDPKNMPKLTFDGDAAKYGTVYSA  148

Query  497  TLYVLSDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNIN  676
            TL V +DYF A N+ ++ +  +                 KAA YNCKF GFQDTLCD+  
Sbjct  149  TLIVEADYFTAANLIIEKNNIK----------------TKAAIYNCKFLGFQDTLCDDDG  192

Query  677  KHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCR  856
             H YKDC+I+GTVDF FG   S+ LNT+L V     +A VTAH R+   + +G SFV C 
Sbjct  193  LHLYKDCFIQGTVDFVFGKGTSLYLNTQLDVAGDGGLAGVTAHSREQEADTSGYSFVHCS  252

Query  857  ITGSADPKAKVAVLGR  904
            ITG+     K   LGR
Sbjct  253  ITGTG---GKNTYLGR  265



>ref|XP_004144054.1| PREDICTED: probable pectinesterase 50-like [Cucumis sativus]
 ref|XP_004159358.1| PREDICTED: probable pectinesterase 50-like [Cucumis sativus]
 gb|KGN66331.1| Pectinesterase [Cucumis sativus]
Length=394

 Score =   218 bits (556),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/258 (43%), Positives = 163/258 (63%), Gaps = 10/258 (4%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPL------QSGRKGVDPALVKAEAAPVYLKVGKGG  289
            V+   T  IPA+ S+++ W   +++        ++G K +D  L +AE     + V K G
Sbjct  35   VVEAHTKTIPADSSKLDEWIGHNMKEYNDRKTNETGIKALDRRLAEAEDCVQLITVRKDG  94

Query  290  Q--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAAT  463
            +  F TI EA+ +IP+ N +R +++I GG Y E++ ID  +PFVTLYG    RP +    
Sbjct  95   RGNFSTITEAIDSIPSGNRRRVVVWIGGGVYREKITIDASKPFVTLYGQKGKRPMITFDG  154

Query  464  TAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKF  640
            TA++ GT+ SAT+ V SDYF+AVN+   NSAP P  G    QAVA+ ISG+KAAF+ C F
Sbjct  155  TASEFGTVKSATVAVESDYFVAVNLTFVNSAPMPELGGTGGQAVAMRISGDKAAFHGCHF  214

Query  641  YGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSA  820
             GFQDTLCD+  +HF+KDCY++GTVDF FG+ KS+ L T ++     T  ++TA  R+ A
Sbjct  215  IGFQDTLCDDRGRHFFKDCYVQGTVDFIFGNGKSLYLKTTINSVAEGT-GVITAQAREDA  273

Query  821  IEDTGLSFVQCRITGSAD  874
             +++G +F  C ITG+ D
Sbjct  274  TDESGFTFAYCNITGTGD  291



>ref|XP_008450966.1| PREDICTED: putative pectinesterase 63 [Cucumis melo]
Length=394

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/269 (42%), Positives = 170/269 (63%), Gaps = 11/269 (4%)
 Frame = +2

Query  98   VCVLVFCPGGV-IPLDTVPIPAEKSQVESWFRASVQPL------QSGRKGVDPALVKAEA  256
            + +L+  P  V +   T  IPA+ S+++ W   +++        ++G K +D  L +AE 
Sbjct  24   LIILITIPSTVLVEARTKTIPADSSKLDEWIAHNMREYNDRKMNETGIKALDRRLAEAED  83

Query  257  APVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGD  430
                + V K G+  F TI EA+++IP+ N +R +++I GG Y E++ ID  +PFVTLYG 
Sbjct  84   CVRLITVRKDGRGNFSTITEAIESIPSGNRRRVVVWIGGGVYREKITIDASKPFVTLYGQ  143

Query  431  PKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTIS  607
               RP +    TA++ GT+ SAT+ V SDYF+AVN+   NSAP P  G    QAVA+ IS
Sbjct  144  KGKRPVITFDGTASEFGTVKSATVAVESDYFVAVNLTFVNSAPMPELGGTGGQAVAMRIS  203

Query  608  GNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTM  787
            G+KAAF+ C F GFQDTLCD+  +HF++DCYI+GTVDF FG+ KS+ L T ++    + +
Sbjct  204  GDKAAFHECHFIGFQDTLCDDRGRHFFRDCYIQGTVDFIFGNGKSLYLKTTINSV-AEGI  262

Query  788  AMVTAHGRKSAIEDTGLSFVQCRITGSAD  874
             ++TA  R+ A +++G +F  C ITG+ +
Sbjct  263  GVITAQAREDATDESGFTFAYCNITGTGN  291



>gb|KDP33954.1| hypothetical protein JCGZ_07525 [Jatropha curcas]
Length=374

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/250 (44%), Positives = 158/250 (63%), Gaps = 13/250 (5%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG--------VDPALVKAEAAPVYLKVGKG---GQFK  298
            +P E S++ SW   +++     +          +D  LV AE     + V K      F+
Sbjct  31   VPIEYSKLRSWVSDNIKDFNRHKSEDSEGTPIVLDERLVAAEDGVRVITVAKNSTVADFE  90

Query  299  TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
            TI +A+ ++P  NT R II+I GG+Y E++ ++  +PF+TLYG+  + P +V   TA+  
Sbjct  91   TITDAINSVPVNNTARRIIWIRGGEYWEKITVNVSKPFITLYGEAADMPMIVFNGTASVY  150

Query  479  GTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGFQD  655
            GTIYSAT+ V SDYFMAVN+   N+AP P       QAVA+ ISG+KAAFYNCKF GFQD
Sbjct  151  GTIYSATVAVESDYFMAVNVVFLNAAPMPDVNITGAQAVAMRISGDKAAFYNCKFVGFQD  210

Query  656  TLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTG  835
            TLCD+  +HF+KDCY+ GTVDF FG+ KS+ LNT +     +T  ++TA GR++  E++G
Sbjct  211  TLCDDRGRHFFKDCYVVGTVDFIFGNGKSLYLNTTIESVANET-GVITAQGRENTEEESG  269

Query  836  LSFVQCRITG  865
             +F+ C +TG
Sbjct  270  FTFIHCNLTG  279



>ref|XP_006452876.1| hypothetical protein CICLE_v10010655mg [Citrus clementina]
 gb|ESR66116.1| hypothetical protein CICLE_v10010655mg [Citrus clementina]
Length=369

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 116/253 (46%), Positives = 161/253 (64%), Gaps = 13/253 (5%)
 Frame = +2

Query  152  IPAEKSQVESW-------FRASVQPLQSGRKG--VDPALVKAEAAPVYLKVGKGGQ--FK  298
            IP + S++E+W       F      L  G+    VD  L  AE     + V K G+  FK
Sbjct  27   IPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAAAEDGFRVITVRKDGRGDFK  86

Query  299  TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
            TI +AVK+IP+ NT+R ++ I GG+Y E++ ++  + FVT +GDP + P +V   TA   
Sbjct  87   TITDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTFFGDPFDMPKIVFNGTALHF  146

Query  479  GTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQD  655
            GT+ SAT+ V SDYF+A N+   NSAP P GK    QAVA+ ISG+KAAF+NCKF G+QD
Sbjct  147  GTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAMRISGDKAAFHNCKFIGYQD  206

Query  656  TLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTG  835
            TLCD+  +HF+KDCYI+GTVDF FG+ KS+ L T + V   + + ++TA  R+   +D+G
Sbjct  207  TLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTI-VSVANGLGVITAQAREQVNDDSG  265

Query  836  LSFVQCRITGSAD  874
             +FV C ITGS D
Sbjct  266  FTFVHCNITGSGD  278



>gb|ACU18534.1| unknown [Glycine max]
Length=217

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 136/189 (72%), Gaps = 3/189 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            DTVPIPA K+Q+ +WF  +V PL   +  +DPALV AE     +KV +   G+FKTI +A
Sbjct  28   DTVPIPAHKAQLGTWFSTNVGPLDQRKSTMDPALVAAEEGAKVVKVMQDGSGEFKTITDA  87

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP+ NTKR I++I  G YNE++KI+  +PF+TLYG P+  P L    TA + GT+ S
Sbjct  88   INSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPFITLYGVPEKMPNLTFGRTALKYGTVDS  147

Query  494  ATLYVLSDYFMAVNINVKNSAPRPSGK-PDQQAVALTISGNKAAFYNCKFYGFQDTLCDN  670
            ATL V S+YF+A NI + NSAPRP GK    QAVAL ISG+KAAFYNCKF+GFQDT+ D+
Sbjct  148  ATLIVESNYFVAANIIISNSAPRPDGKIQGGQAVALRISGDKAAFYNCKFFGFQDTIYDD  207

Query  671  INKHFYKDC  697
             N+HF+KDC
Sbjct  208  RNRHFFKDC  216



>ref|XP_006474682.1| PREDICTED: putative pectinesterase 63-like [Citrus sinensis]
Length=369

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 161/253 (64%), Gaps = 13/253 (5%)
 Frame = +2

Query  152  IPAEKSQVESW-------FRASVQPLQSGRKG--VDPALVKAEAAPVYLKVGKGGQ--FK  298
            IP + S++E+W       F      L  G+    VD  L  AE     + V K G+  FK
Sbjct  27   IPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAAAEDGFRVITVRKDGRGDFK  86

Query  299  TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
            T+ +AVK+IP+ NT+R ++ I GG+Y E++ ++  + FVT +GDP + P +V   TA   
Sbjct  87   TVTDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTFFGDPFDMPKIVFNGTALHF  146

Query  479  GTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQD  655
            GT+ SAT+ V SDYF+A N+   NSAP P GK    QAVA+ ISG+KAAF+NCKF G+QD
Sbjct  147  GTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAMRISGDKAAFHNCKFMGYQD  206

Query  656  TLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTG  835
            TLCD+  +HF+KDCYI+GTVDF FG+ KS+ L T + V   + + ++TA  R+   +D+G
Sbjct  207  TLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTI-VSVANGLGVITAQAREQVNDDSG  265

Query  836  LSFVQCRITGSAD  874
             +FV C ITGS D
Sbjct  266  FTFVHCNITGSGD  278



>gb|KDO73799.1| hypothetical protein CISIN_1g047018mg [Citrus sinensis]
Length=369

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 161/253 (64%), Gaps = 13/253 (5%)
 Frame = +2

Query  152  IPAEKSQVESW-------FRASVQPLQSGRKG--VDPALVKAEAAPVYLKVGKGGQ--FK  298
            IP + S++E+W       F      L  G+    VD  L  AE     + V K G+  FK
Sbjct  27   IPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAAAEDGFRVITVRKDGRGDFK  86

Query  299  TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
            T+ +AVK+IP+ NT+R ++ I GG+Y E++ ++  + FVT +GDP + P +V   TA   
Sbjct  87   TVTDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTFFGDPFDMPKIVFNGTALHF  146

Query  479  GTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQD  655
            GT+ SAT+ V SDYF+A N+   NSAP P GK    QAVA+ ISG+KAAF+NCKF G+QD
Sbjct  147  GTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAMRISGDKAAFHNCKFIGYQD  206

Query  656  TLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTG  835
            TLCD+  +HF+KDCYI+GTVDF FG+ KS+ L T + V   + + ++TA  R+   +D+G
Sbjct  207  TLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTI-VSVANGLGVITAQAREQVNDDSG  265

Query  836  LSFVQCRITGSAD  874
             +FV C ITGS D
Sbjct  266  FTFVHCNITGSGD  278



>ref|XP_010259713.1| PREDICTED: pectinesterase PPME1-like [Nelumbo nucifera]
Length=336

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 153/228 (67%), Gaps = 8/228 (4%)
 Frame = +2

Query  206  LQSGRKGVDPALVKAEAAPVYLKVG--KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYN  379
            L  G   +D AL  AE +   +KV     G+FKT+ +A+K+IP  N +R +I I  G+Y 
Sbjct  22   LPIGGDSLDAALADAEKSKKVIKVNLDGSGEFKTVTDALKSIPTDNKERVVISIGPGEYV  81

Query  380  ERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAP  559
            E++ +D  +PF+T YG P+N PTL    TA + GT+ SA++ VL+DYF+A NI +KNSAP
Sbjct  82   EKITVD--KPFITFYGSPQNMPTLSFGGTAHEYGTVDSASVMVLADYFVAANIIMKNSAP  139

Query  560  RPSGK---PDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFG  730
             P+G+      QAVA+ +SG+KAAFYNC+F GFQDTL     +H++KDCY+EGTVDF FG
Sbjct  140  IPTGQFRFNGGQAVAMRVSGDKAAFYNCRFIGFQDTLLAYKGRHYFKDCYVEGTVDFVFG  199

Query  731  DAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSAD  874
              K++ +NTE+     + + M+ A  RK+A ED G SFV C++TG+ D
Sbjct  200  GGKTLFMNTEIRSISNE-LVMIVAQARKNASEDNGFSFVHCKVTGTGD  246



>ref|XP_010259712.1| PREDICTED: pectinesterase PPME1-like [Nelumbo nucifera]
Length=337

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 141/199 (71%), Gaps = 6/199 (3%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G+FKT+ EA+K+IP  N +R +I I  G+Y E++ +D  +PF+T YG P+N PTL    T
Sbjct  52   GEFKTVTEALKSIPKYNKERVVISIGPGEYVEKITVD--KPFITFYGSPQNMPTLSFDGT  109

Query  467  AAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGK---PDQQAVALTISGNKAAFYNCK  637
            A + GT+ SA++ VL++YF+AVNI +KNSAP P+GK      QAVA+ +SG+KAAFYNC+
Sbjct  110  AHEYGTVDSASVMVLANYFVAVNIIMKNSAPIPTGKFRFNGGQAVAMRVSGDKAAFYNCR  169

Query  638  FYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKS  817
            F GFQDTL     +H++KDCY+EGTVDF FG  K++ +NTE+     + + M+ A  RK+
Sbjct  170  FIGFQDTLLAYKGRHYFKDCYVEGTVDFVFGGGKTLFMNTEIRSVSNE-LVMIVAQARKN  228

Query  818  AIEDTGLSFVQCRITGSAD  874
            A ED G SFV C +TG+ D
Sbjct  229  ASEDNGFSFVHCNVTGTGD  247



>emb|CDY48409.1| BnaAnng09780D [Brassica napus]
Length=304

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 138/211 (65%), Gaps = 17/211 (8%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G FKT+ EA+ ++P  N +R II +  G+Y E+V ID ++PF+TLYG+P   P L     
Sbjct  9    GDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGNPNAMPVLTFDGM  68

Query  467  AAQVGTIYSATLYVLSDYFMAVNINVKNS---APR-------------PSGKPDQQAVAL  598
            A + GT+ SATL VLSDYFMA+NI VK +    PR                K  +QA+++
Sbjct  69   AVEYGTVDSATLIVLSDYFMAINIIVKVAYVINPRFIIVTKKIILLQCRMEKGKEQALSM  128

Query  599  TISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPG  778
             ISGNKAAFYNCK YG+QDT+CD+   HF+KDCYIEGT DF FG  +S+ L+T+L+V   
Sbjct  129  RISGNKAAFYNCKLYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVVR-  187

Query  779  DTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            D + ++TAH  KS  E +G SFV C++TG+ 
Sbjct  188  DGLRVITAHAGKSTEEKSGYSFVHCKVTGTG  218



>ref|XP_002516214.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46216.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=378

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 157/252 (62%), Gaps = 15/252 (6%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGV---------DPALVKAEAAPVYLKVGKG----GQ  292
            +P + S++++W   ++    + +  +         +  L  AE++   + V K       
Sbjct  33   VPKDISKLKTWVADNINQFNNRKSDLSERIPRIILNKRLADAESSVRVITVAKRDDQFAD  92

Query  293  FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAA  472
            F++I +A+ +IP  N +R II+I GG+Y E++ I+  +PF+TLYGDP + P +V   TAA
Sbjct  93   FQSISDAIDSIPINNKQRRIIWIKGGEYFEKITINTSKPFITLYGDPGDMPKIVFNGTAA  152

Query  473  QVGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGF  649
            + GT+YSAT+ V S YFMAVNI   NSAP P   K   QAVA+ ISG+KAAF+NCKF GF
Sbjct  153  RYGTVYSATVAVESKYFMAVNIAFVNSAPMPDVNKTGAQAVAMRISGDKAAFHNCKFVGF  212

Query  650  QDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIED  829
            QDTLCD+  +H ++DCYI GTVDF FG+ KS+ LNT +      T  ++TA  R+S  + 
Sbjct  213  QDTLCDDRGRHVFRDCYIVGTVDFIFGNGKSLYLNTTIETVAQGT-GVITAQARESVTDS  271

Query  830  TGLSFVQCRITG  865
            +  +F+ C +TG
Sbjct  272  SEFTFIHCNLTG  283



>ref|XP_010243601.1| PREDICTED: pectinesterase PPME1-like, partial [Nelumbo nucifera]
Length=341

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 136/199 (68%), Gaps = 4/199 (2%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G FKT+ +A+ +IPA N  R ++ I  G+Y E++K+D ++PFVT YG P + PTL    T
Sbjct  54   GDFKTMTDAINSIPAGNKDRIVLSIGPGEYVEKIKVDGNKPFVTFYGAPGSMPTLSFHGT  113

Query  467  AAQVGTIYSATLYVLSDYFMAVNINVKNSA---PRPSGKPDQQAVALTISGNKAAFYNCK  637
            + + GT+ SA++ VLSDYF+A NI  KN+A            QAVA+ ISG+ AAFYNCK
Sbjct  114  SGEYGTVDSASVIVLSDYFVAANIIFKNTAPPPSGQGSGQGGQAVAMRISGDMAAFYNCK  173

Query  638  FYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKS  817
            F GFQDTL D+  +H++KDCYIEGTVDF FG  KS+ +NTELH    D +A++TA  RKS
Sbjct  174  FIGFQDTLLDDKGRHYFKDCYIEGTVDFIFGSGKSLYMNTELHSVAKD-LAVITAQARKS  232

Query  818  AIEDTGLSFVQCRITGSAD  874
              ED G SFV C +TG+ D
Sbjct  233  DSEDDGYSFVHCTVTGTGD  251



>ref|XP_007219703.1| hypothetical protein PRUPE_ppa024066mg, partial [Prunus persica]
 gb|EMJ20902.1| hypothetical protein PRUPE_ppa024066mg, partial [Prunus persica]
Length=330

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/242 (46%), Positives = 149/242 (62%), Gaps = 22/242 (9%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTI  325
            +PA+ SQV +WF  +V+P  +    +D  L  AEA+   +KV K G  QFKTI +AV + 
Sbjct  27   LPADHSQVNTWFNNNVKPYTARNGTLDSTLAMAEASQKVIKVNKDGRGQFKTIADAVNSN  86

Query  326  PARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLY  505
            P  NTKR I++I GG YNE++ I  ++PFVT YG P    TL  A TA + GT+ S T+ 
Sbjct  87   PVGNTKRVIVYI-GGVYNEKITIPQNKPFVTFYGSPTTMSTLTFAGTAQKYGTVDSTTVI  145

Query  506  VLSDYFMA-VNINVK-NSAPRPSGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDNIN  676
              SDYF+A + + ++ NS+PRP GK   +QA+AL +S NK+A +NC+  GFQDTLCD+  
Sbjct  146  AESDYFVAAITLLLRYNSSPRPDGKRVGEQALALRVSSNKSALFNCRLIGFQDTLCDDRG  205

Query  677  KHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCR  856
             HF+KDC+IEGT                LHV   + M ++TA  R S  EDTG SFV C 
Sbjct  206  NHFFKDCFIEGT----------------LHVLGNNEMTVITAQARDSTSEDTGDSFVHCN  249

Query  857  IT  862
            IT
Sbjct  250  IT  251



>ref|XP_007154546.1| hypothetical protein PHAVU_003G127700g [Phaseolus vulgaris]
 gb|ESW26540.1| hypothetical protein PHAVU_003G127700g [Phaseolus vulgaris]
Length=343

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 139/212 (66%), Gaps = 10/212 (5%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-----DPKNRPTL  451
            G F+T+ EAV +IP+ N +R +++I  G+Y E+V +D  +PFVT YG     D    P +
Sbjct  48   GDFRTVTEAVNSIPSGNKRRVVVWIGMGEYREKVTVDRSKPFVTFYGERNESDSHTMPII  107

Query  452  VAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGNKAAFY  628
                TA + GT+ SAT+ V SDYF+AVN+   NS+PRP       QA+A+ ISG+KAAFY
Sbjct  108  TYHATALKYGTVDSATVAVDSDYFVAVNVAFVNSSPRPDENSVGAQALAMRISGDKAAFY  167

Query  629  NCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHG  808
            NCKF  FQDTLCD+  +HF+KDCYI+G+ DF FG+ KSI L + +       ++++TA G
Sbjct  168  NCKFVSFQDTLCDDKGRHFFKDCYIQGSYDFIFGNGKSIYLRSRIESV-AKGLSVITAQG  226

Query  809  RKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            R+S  EDTG +F+ C ITGS +   +   LGR
Sbjct  227  RESIGEDTGFTFLHCNITGSGN---RNTYLGR  255



>ref|XP_009402033.1| PREDICTED: putative pectinesterase 63 [Musa acuminata subsp. 
malaccensis]
Length=394

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 142/219 (65%), Gaps = 4/219 (2%)
 Frame = +2

Query  227  VDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
            ++P L + E +   + V K   G F+TI +A+K+IP+ NT R +I I  G Y E++ +D 
Sbjct  86   LEPLLAETERSGRVVTVRKDGNGDFRTITDAIKSIPSGNTARTVIKIGPGVYREKILVDQ  145

Query  401  DRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRP-SGKP  577
             RP+VT YG P   PT+    TAA+ GT  SAT+ V S YF+A N+  +N+AP P  G  
Sbjct  146  SRPYVTFYGQPGAMPTISFDGTAARYGTANSATVAVESSYFVASNVIFENTAPMPVDGVQ  205

Query  578  DQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNT  757
              QAVA+ ISG+ AAFYNCKFYG+QDTLCD+  +HF+K+C+I GTVDF FG+ +SI  N 
Sbjct  206  GAQAVAMRISGDMAAFYNCKFYGYQDTLCDDTGRHFFKNCFIRGTVDFIFGNGRSIYQNC  265

Query  758  ELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSAD  874
            E+     D +A +TA  R +  + +G SF+ C ITG+ +
Sbjct  266  EIESV-ADNVAYITAQARSNISDKSGFSFIHCNITGTGN  303



>ref|XP_006843862.1| hypothetical protein AMTR_s00007p00264370 [Amborella trichopoda]
 gb|ERN05537.1| hypothetical protein AMTR_s00007p00264370 [Amborella trichopoda]
Length=365

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 141/217 (65%), Gaps = 3/217 (1%)
 Frame = +2

Query  227  VDPALVKAEAAPVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
            ++ AL  AE     L V K G   + T+Q AV +IP  NT+RYI+ I  G Y E+V +  
Sbjct  54   MEDALAVAENGTKVLVVCKDGSCDYGTLQAAVDSIPVGNTQRYILKIKPGLYKEKVNVPR  113

Query  401  DRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD  580
             +PFVT  GDP N PT+     +A+ GT  SAT+ V +DYF+A+N+  +NS+PRP    +
Sbjct  114  TKPFVTFLGDPINMPTISYNGNSAKYGTWNSATVIVEADYFIAMNVIFENSSPRPKDGEE  173

Query  581  QQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTE  760
             QAVAL ISG+KAAFY C+F GFQDTLCD++ +H +K+C+I+GTVDF FG A+S+  N E
Sbjct  174  GQAVALRISGDKAAFYRCRFIGFQDTLCDDVGRHLFKNCFIQGTVDFIFGAARSLYSNCE  233

Query  761  LHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            ++       A +TA  R S  ++ G SFV C+ITG+ 
Sbjct  234  INSVATGRTA-ITAQARSSESDEGGFSFVNCKITGTG  269



>ref|XP_011076540.1| PREDICTED: pectinesterase 2-like, partial [Sesamum indicum]
Length=212

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 131/203 (65%), Gaps = 4/203 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE--A  256
            + VV +  L+  P  +   D  PIPA+K+Q+ SWF  +V PL S    +DPA+V+AE   
Sbjct  11   VEVVFLIALLVLPIALSTNDE-PIPADKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNV  69

Query  257  APVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              V ++    G FKT+ +A+K++P  N  R II I  G Y E+VKID    F+TLYGDP 
Sbjct  70   TVVRVRTDGSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYTEKVKIDRYTHFITLYGDPN  129

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGN  613
            N P ++   TAAQ GT+ SATL V SDYF AVN+ + NSAPRP GK    QAVA+ I+G 
Sbjct  130  NMPVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPRPDGKRVGAQAVAMKIAGE  189

Query  614  KAAFYNCKFYGFQDTLCDNINKH  682
             A+FYNC+ YGFQDTLCD+  KH
Sbjct  190  YASFYNCRMYGFQDTLCDDRGKH  212



>ref|XP_003541318.1| PREDICTED: putative pectinesterase 63-like [Glycine max]
Length=347

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 138/207 (67%), Gaps = 12/207 (6%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-------DPKNR-  442
            G F+T+ +AV +IP+ N +R +++I  G Y E++ +D  +PFVT YG       D  +R 
Sbjct  46   GDFRTVTDAVNSIPSGNKRRVVVWIGRGVYREKITVDRSKPFVTFYGERNGNDNDNDSRD  105

Query  443  --PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGN  613
              P +    TA + GT+ SAT+ V +DYF+AVN+   NS+PRP       QA+A+ ISG+
Sbjct  106  IMPIITYDATALRYGTVDSATVAVDADYFVAVNVAFVNSSPRPEENSVGAQALAMRISGD  165

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAF+NCKF GFQDTLCD+  +HF+KDCYI+GT DF FG+ KSI L + +     + +++
Sbjct  166  KAAFFNCKFIGFQDTLCDDKGRHFFKDCYIQGTYDFIFGNGKSIYLRSTIESVA-NGLSV  224

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSAD  874
            +TA GR+S  EDTG +F+ C ITGS +
Sbjct  225  ITAQGRESMAEDTGFTFLHCNITGSGN  251



>ref|XP_003609956.1| Pectinesterase [Medicago truncatula]
 gb|AES92153.1| pectinesterase [Medicago truncatula]
Length=345

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 144/234 (62%), Gaps = 16/234 (7%)
 Frame = +2

Query  227  VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
            ++  L  AE     ++V K G   F T+ +AVK+IP+ N +R +++I  G+Y E++ +D 
Sbjct  40   LEEHLTAAETTVRVVRVRKDGTGDFTTVTDAVKSIPSGNKRRVVVWIGMGEYREKITVDR  99

Query  401  DRPFVTLYGDPKNR-----PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRP  565
             + FVT YG+   +     P +    TA + GT+ SAT+ V +DYF+AVN+   NS+P P
Sbjct  100  SKRFVTFYGERNGKDNDMMPIITYDATALRYGTLDSATVAVDADYFVAVNVAFVNSSPMP  159

Query  566  SGKP-DQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKS  742
                   QA+A+ ISG+KAAFYNCKF GFQDTLCD+  KHF+KDC+I+GT DF FG+ KS
Sbjct  160  DENSVGGQALAMRISGDKAAFYNCKFIGFQDTLCDDYGKHFFKDCFIQGTYDFIFGNGKS  219

Query  743  IILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            I LN          + ++TA GR+   +DTG +FV C ITGS     +   LGR
Sbjct  220  IYLNRLQR-----GLNVITAQGRERMSDDTGFTFVHCNITGSGH---RNTYLGR  265



>gb|KHN07870.1| Putative pectinesterase 63 [Glycine soja]
Length=337

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 136/207 (66%), Gaps = 13/207 (6%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-------DPKNR-  442
            G F T+  AV +IP+ N +R +++I  G Y E++ +D  +PFVT YG       D  +R 
Sbjct  37   GDFTTVT-AVNSIPSGNKRRVVVWIGRGVYREKITVDRSKPFVTFYGERNGNDNDNDSRD  95

Query  443  --PTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP-DQQAVALTISGN  613
              P +    TA + GT+ SAT+ V +DYF+AVN+   NS+PRP       QA+A+ ISG+
Sbjct  96   IMPIITYDATALRYGTVDSATVAVDADYFVAVNVAFVNSSPRPEENSVGAQALAMRISGD  155

Query  614  KAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAM  793
            KAAF+NCKF GFQDTLCD+  +HF+KDCYI+GT DF FG+ KSI L + +     + +++
Sbjct  156  KAAFFNCKFIGFQDTLCDDKGRHFFKDCYIQGTYDFIFGNGKSIYLRSTIESV-ANGLSV  214

Query  794  VTAHGRKSAIEDTGLSFVQCRITGSAD  874
            +TA GR+S  EDTG +F+ C ITGS +
Sbjct  215  ITAQGRESMAEDTGFTFLHCNITGSGN  241



>ref|XP_007145123.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
 gb|ESW17117.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
Length=370

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 102/231 (44%), Positives = 139/231 (60%), Gaps = 10/231 (4%)
 Frame = +2

Query  206  LQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYN  379
            L+S  K  D  L +AE+  V + V + G   FKTI EA+ +IP RNT R I+ I+ G Y 
Sbjct  52   LKSKWKVADLKLRQAESNKVIITVSQDGSADFKTISEALNSIPPRNTMRVIVSISPGVYR  111

Query  380  ERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQ-------VGTIYSATLYVLSDYFMAVNI  538
            E+V I    PF+TL G+  N PT+    TA+        +GT +SAT+ V + YF+A+NI
Sbjct  112  EKVMIPRTMPFITLSGEAGNPPTITGNDTASASKRNGTPLGTFHSATVAVDASYFVAINI  171

Query  539  NVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVD  718
              +NSAP   G+  +Q VAL ISG KAAFYNC F G QDTL D+   HF+ +C I+G+VD
Sbjct  172  KFENSAPHEIGRRGEQGVALRISGTKAAFYNCSFNGAQDTLYDHKGLHFFHNCSIQGSVD  231

Query  719  FFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            F FG A+S+  N  L+      +A +TA  R ++  D+G SF  C +TGS 
Sbjct  232  FIFGYARSLYQNCYLNS-TTKKVASITAQKRTNSSLDSGFSFQNCTVTGSG  281



>ref|XP_001769271.1| predicted protein [Physcomitrella patens]
 gb|EDQ65983.1| predicted protein [Physcomitrella patens]
Length=370

 Score =   177 bits (450),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 151/286 (53%), Gaps = 21/286 (7%)
 Frame = +2

Query  80   LLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            L+ V +VC      G      +  +P  + +V + F + VQ +       + A   A  A
Sbjct  11   LVTVALVCSAEPAQG------SQKVPETREEVIASFASWVQRVGEKHAAWERAAKTATTA  64

Query  260  PVYL-KVGK---------GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRP  409
              +  KVG+          G FKT+ EA+ +IP  +     I +  G YNERV I   + 
Sbjct  65   DEFASKVGETVIVVDQSGAGNFKTVNEALNSIPEHSKSPVTIKVNAGTYNERVVIPKSKE  124

Query  410  FVTLYGDPKNRPTLVAATTAAQVGTIY-SATLYVLSDYFMAVNINVKNSAPRPSGKPDQQ  586
            F+TL G  ++   + A+  A   GT Y SAT  V + +F A NI+ +NS+P P G   QQ
Sbjct  125  FITLQGAGRDVTKITASNAAGNSGTTYTSATFGVSAPHFTARNISFENSSPPPDGGAQQQ  184

Query  587  AVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELH  766
            AVAL  +G+  AFY C FYG QDTL D+  +HF+KD  I GTVDF FGD KS+  N EL 
Sbjct  185  AVALRTTGDMNAFYGCAFYGHQDTLYDHRGRHFFKDTLIVGTVDFIFGDGKSLYKNCELR  244

Query  767  VFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            V P  +   +TA  R S  EDTG SFV C++TGS  P+     LGR
Sbjct  245  VLP-SSGGSLTAQKRLSGSEDTGYSFVNCKVTGSGPPQ---VYLGR  286



>gb|KEH25488.1| pectinesterase [Medicago truncatula]
Length=338

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 135/226 (60%), Gaps = 12/226 (5%)
 Frame = +2

Query  221  KGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
             G+D  L +AEA PV +KV K    +FKTIQEA+ +IP +N +R I+ IA G Y E++ +
Sbjct  25   NGLDFKLRQAEANPVIIKVSKDASSKFKTIQEALNSIPPQNNRRVIVSIAAGVYREKILV  84

Query  395  DFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFMAVNINVKNS  553
                PF+T  GDP ++P ++   TA  +G       T+ SAT+ V SDYF+AVN+  +N+
Sbjct  85   KL--PFITFLGDPTDQPIVIGNDTAHDIGGDGKPLRTLNSATVAVDSDYFIAVNMKFQNT  142

Query  554  APRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGD  733
            A    G  D QAVAL  SGNK+AFYNC FYGFQDTL D+   H++++C+I+G+VDF FG 
Sbjct  143  ASPRIGSNDDQAVALRTSGNKSAFYNCSFYGFQDTLYDHQGLHYFENCFIQGSVDFIFGH  202

Query  734  AKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
             +S+     +     + M  +TA  R     ++G S       GS 
Sbjct  203  GRSLYEGCIIKSI-AEKMGFITAQDRSKESMESGFSIQNSHAIGSG  247



>ref|XP_001769817.1| predicted protein [Physcomitrella patens]
 gb|EDQ65379.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 130/214 (61%), Gaps = 9/214 (4%)
 Frame = +2

Query  257  APVYLKVGKG-GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
            A +Y+   +G G F T+Q A+  +P  N +R  I +A G Y E++ +   +P+VT+ G  
Sbjct  51   AVIYVNRKRGVGHFTTVQAAIDHVPVNNDRRVHIIVAPGVYKEKIVVPSSKPYVTILGGG  110

Query  434  KNRPTLVAATTA-------AQVGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQA  589
             N   L    TA       A++GT +SA+L V + YF+A NI +KN+A  P+ G   +QA
Sbjct  111  WNNTILQWNDTADCADKEGAKLGTYWSASLAVEAQYFIARNITIKNTASMPAAGAAGKQA  170

Query  590  VALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHV  769
            VAL ++G+ AAFY C+F   QDTL D++ +H++KDCYIEG++DF FG+ +S+  +  LH 
Sbjct  171  VALRVTGDTAAFYGCRFMSTQDTLYDHVGRHYFKDCYIEGSIDFVFGNGRSLYESCHLHA  230

Query  770  FPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
             P  T   V A  R +  E TG SF+ C+ITGS 
Sbjct  231  LPRTTFGSVAAQKRGNVSEQTGFSFLNCKITGSG  264



>ref|XP_004495886.1| PREDICTED: probable pectinesterase 53-like [Cicer arietinum]
Length=380

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/235 (40%), Positives = 139/235 (59%), Gaps = 11/235 (5%)
 Frame = +2

Query  197  VQPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGG  370
            ++ L +  +G+D  L +AE+  V + V + G   FKTI EA+ +IP  NT+RYI+ IA G
Sbjct  50   LKVLSATEQGLDLKLRQAESKIVRITVNQNGTADFKTITEAINSIPLNNTRRYIVSIAPG  109

Query  371  KYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFMA  529
             Y E++ I   +PF+T  GD  +RPT+    T   +G       T  ++T+ V + YF+A
Sbjct  110  TYREKITIPKKKPFITFLGDAMDRPTITGNDTKGMIGRDGTELKTFNTSTVAVEARYFIA  169

Query  530  VNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEG  709
            +NIN +N+A   +   ++Q VAL +S NK AFYNC FYG QDTL D+   H++K+C I+G
Sbjct  170  ININFENTARHDNASKEEQGVALRVSANKTAFYNCSFYGAQDTLYDHKGLHYFKNCLIKG  229

Query  710  TVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGR-KSAIEDTGLSFVQCRITGSA  871
            TVDF FG  +S   N  +H     T + +TA  R K+    +G SF   ++TGS 
Sbjct  230  TVDFIFGYGRSFYENCHIHS-TTKTKSYITAQRRSKNTSMASGFSFKNSKVTGSG  283



>gb|KHG12918.1| putative pectinesterase 53 -like protein [Gossypium arboreum]
Length=377

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 152/289 (53%), Gaps = 23/289 (8%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVK--------  247
            +IV VLV C            P  +++ E W   + +  +S R   D +LV         
Sbjct  11   LIVLVLVICNYSST-TSASSNPGSETEFEKWLGWNARNHRSKRLAADRSLVMSVLDDNLV  69

Query  248  -AEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
             AE   V + V +   G FKTI EA+ +IP RNT+R I+ I  G Y E++ I    PF+T
Sbjct  70   IAEKNNVMINVSRDGSGDFKTINEALNSIPLRNTRRVILVIKPGIYREKITIPRTMPFIT  129

Query  419  LYGDPKNRPTLVAATTAAQ-------VGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKP  577
              GD  N PT+    TA+        + T  SAT+ V ++YF+A+NI  +N+ P   G  
Sbjct  130  FQGDANNPPTITGNDTASSSSKDGRPLKTFQSATVAVDANYFVAINIKFENTVPHTIGSK  189

Query  578  DQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNT  757
              QAVA+ ISG KAAFYNC FYG QDTL D+   H++ +C+I+G+VDF FG  +S+  N 
Sbjct  190  GGQAVAVRISGTKAAFYNCSFYGDQDTLYDHKGLHYFNNCFIQGSVDFIFGYGRSLYENC  249

Query  758  ELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             L+      +A +TA  R SA   +G SF    +TG+      +  LGR
Sbjct  250  YLNSI-AKKVASLTAQKRSSASMASGFSFKDSVVTGNG---TGLVYLGR  294



>ref|XP_010276489.1| PREDICTED: probable pectinesterase 53 isoform X3 [Nelumbo nucifera]
Length=336

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 139/237 (59%), Gaps = 15/237 (6%)
 Frame = +2

Query  221  KGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
            KG+D  L KAE   V ++V + G   + +IQEA+  IP +NT+R I+ I  G Y E++ I
Sbjct  72   KGLDTKLKKAELNKVRVRVSQDGTGDYSSIQEALDDIPLKNTRRVILEINPGVYREKILI  131

Query  395  DFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFMAVNINVKNS  553
               +PF+T  GD  N PT+    TA+  G       T  SAT+ V +DYF+A+NI  +N+
Sbjct  132  PRSQPFITFLGDSANPPTITGNDTASGTGRDGKPLKTFQSATVGVNADYFVAINIIFENT  191

Query  554  APRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGD  733
            AP   G   +QAVAL ISGNKAAF+NC FYG QDTL D+   H++ +C+I+G+VDF FG 
Sbjct  192  APHDIGSTGEQAVALRISGNKAAFHNCSFYGSQDTLYDHKGLHYFNNCFIQGSVDFIFGY  251

Query  734  AKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             +S+  N  L+      +A +TA  R +    +G SF    +TGS      +  LGR
Sbjct  252  GRSLYENCYLNSIS-KKVASLTAQKRTNISLSSGFSFKDSVVTGSG-----LVYLGR  302



>ref|XP_009414379.1| PREDICTED: probable pectinesterase 53 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=388

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 148/249 (59%), Gaps = 14/249 (6%)
 Frame = +2

Query  164  KSQVESWFRASV---QPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIP  328
            K Q  + FR S    +P   G + +D  L KAEAA V   V + G   +++I+EA+ TIP
Sbjct  48   KQQSAATFRPSFVFGEPGVVGPRAIDLKLSKAEAAAVRYIVSQDGTGNYRSIREAIGTIP  107

Query  329  ARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TI  487
              NT+R I+ I  G Y E++ I    PF+TL GDP + P +    TAA++G       T 
Sbjct  108  LHNTRRVILEIRPGIYREKIVIPKSMPFITLLGDPASPPIISGNDTAAKMGDNGRALKTF  167

Query  488  YSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGFQDTLC  664
             S T+ V S++F+A  I  +N+AP P  G+   QAVA+ +SG+KAAFYNC FYG QDTL 
Sbjct  168  RSPTVAVNSNFFLAAYIQFENTAPVPDVGQRGGQAVAVRVSGDKAAFYNCSFYGEQDTLY  227

Query  665  DNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSF  844
            D+   H++K+C+I+G+VDF FG  +S+  N  L+      +A +TA  R  A  ++G SF
Sbjct  228  DHKGLHYFKNCFIQGSVDFIFGYGRSLYENCYLNSV-AKKVAALTAQKRNMASMESGFSF  286

Query  845  VQCRITGSA  871
            V+  ITGS 
Sbjct  287  VRSTITGSG  295



>ref|XP_009414378.1| PREDICTED: probable pectinesterase 53 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=389

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 104/249 (42%), Positives = 148/249 (59%), Gaps = 14/249 (6%)
 Frame = +2

Query  164  KSQVESWFRASV---QPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIP  328
            K Q  + FR S    +P   G + +D  L KAEAA V   V + G   +++I+EA+ TIP
Sbjct  48   KQQSAATFRPSFVFGEPGVVGPRAIDLKLSKAEAAAVRYIVSQDGTGNYRSIREAIGTIP  107

Query  329  ARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TI  487
              NT+R I+ I  G Y E++ I    PF+TL GDP + P +    TAA++G       T 
Sbjct  108  LHNTRRVILEIRPGIYREKIVIPKSMPFITLLGDPASPPIISGNDTAAKMGDNGRALKTF  167

Query  488  YSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGFQDTLC  664
             S T+ V S++F+A  I  +N+AP P  G+   QAVA+ +SG+KAAFYNC FYG QDTL 
Sbjct  168  RSPTVAVNSNFFLAAYIQFENTAPVPDVGQRGGQAVAVRVSGDKAAFYNCSFYGEQDTLY  227

Query  665  DNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSF  844
            D+   H++K+C+I+G+VDF FG  +S+  N  L+      +A +TA  R  A  ++G SF
Sbjct  228  DHKGLHYFKNCFIQGSVDFIFGYGRSLYENCYLNSV-AKKVAALTAQKRNMASMESGFSF  286

Query  845  VQCRITGSA  871
            V+  ITGS 
Sbjct  287  VRSTITGSG  295



>ref|XP_003524409.1| PREDICTED: probable pectinesterase 53-like [Glycine max]
Length=375

 Score =   170 bits (431),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/254 (40%), Positives = 140/254 (55%), Gaps = 5/254 (2%)
 Frame = +2

Query  119  PGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFK  298
            PG  +  +   +   + Q   W +       S  +  +  L  +    V  K GKGG F 
Sbjct  34   PGNGLSTNMTRVEFSEQQFMKWVKFVGGLKHSVFRTANNKLFPSHTLHVSKKHGKGG-FS  92

Query  299  TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQ-  475
            +IQ A+ ++P  N  R +I +  G Y E+V I   + F+T+ G+  ++  +    TA   
Sbjct  93   SIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSFITIQGEGADKTIVQWGDTAQSQ  152

Query  476  -VGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGF  649
             +GT  SAT  V S YF+A NI  KN+AP P+ G   +Q VAL IS + A F  CKF G 
Sbjct  153  PLGTYGSATFAVNSAYFIAKNITFKNTAPIPAPGAVGKQGVALRISADTAVFQGCKFLGA  212

Query  650  QDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIED  829
            QDTL D+I +H+YKDCYIEG+VDF FG+A S+     +H     T A+ TA GR S +ED
Sbjct  213  QDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQLTGAL-TAQGRSSLLED  271

Query  830  TGLSFVQCRITGSA  871
            TG SFV C++TGS 
Sbjct  272  TGFSFVHCKVTGSG  285



>ref|XP_010276487.1| PREDICTED: probable pectinesterase 53 isoform X1 [Nelumbo nucifera]
Length=392

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 139/237 (59%), Gaps = 15/237 (6%)
 Frame = +2

Query  221  KGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
            KG+D  L KAE   V ++V + G   + +IQEA+  IP +NT+R I+ I  G Y E++ I
Sbjct  72   KGLDTKLKKAELNKVRVRVSQDGTGDYSSIQEALDDIPLKNTRRVILEINPGVYREKILI  131

Query  395  DFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFMAVNINVKNS  553
               +PF+T  GD  N PT+    TA+  G       T  SAT+ V +DYF+A+NI  +N+
Sbjct  132  PRSQPFITFLGDSANPPTITGNDTASGTGRDGKPLKTFQSATVGVNADYFVAINIIFENT  191

Query  554  APRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGD  733
            AP   G   +QAVAL ISGNKAAF+NC FYG QDTL D+   H++ +C+I+G+VDF FG 
Sbjct  192  APHDIGSTGEQAVALRISGNKAAFHNCSFYGSQDTLYDHKGLHYFNNCFIQGSVDFIFGY  251

Query  734  AKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             +S+  N  L+      +A +TA  R +    +G SF    +TGS      +  LGR
Sbjct  252  GRSLYENCYLNSIS-KKVASLTAQKRTNISLSSGFSFKDSVVTGSG-----LVYLGR  302



>ref|XP_010276488.1| PREDICTED: probable pectinesterase 53 isoform X2 [Nelumbo nucifera]
Length=391

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 99/237 (42%), Positives = 139/237 (59%), Gaps = 15/237 (6%)
 Frame = +2

Query  221  KGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
            KG+D  L KAE   V ++V + G   + +IQEA+  IP +NT+R I+ I  G Y E++ I
Sbjct  72   KGLDTKLKKAELNKVRVRVSQDGTGDYSSIQEALDDIPLKNTRRVILEINPGVYREKILI  131

Query  395  DFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFMAVNINVKNS  553
               +PF+T  GD  N PT+    TA+  G       T  SAT+ V +DYF+A+NI  +N+
Sbjct  132  PRSQPFITFLGDSANPPTITGNDTASGTGRDGKPLKTFQSATVGVNADYFVAINIIFENT  191

Query  554  APRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGD  733
            AP   G   +QAVAL ISGNKAAF+NC FYG QDTL D+   H++ +C+I+G+VDF FG 
Sbjct  192  APHDIGSTGEQAVALRISGNKAAFHNCSFYGSQDTLYDHKGLHYFNNCFIQGSVDFIFGY  251

Query  734  AKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
             +S+  N  L+      +A +TA  R +    +G SF    +TGS      +  LGR
Sbjct  252  GRSLYENCYLNSIS-KKVASLTAQKRTNISLSSGFSFKDSVVTGSG-----LVYLGR  302



>ref|XP_003530551.1| PREDICTED: probable pectinesterase 53-like isoform X1 [Glycine 
max]
 ref|XP_006584808.1| PREDICTED: probable pectinesterase 53-like isoform X2 [Glycine 
max]
 gb|KHN16649.1| Putative pectinesterase 53 [Glycine soja]
Length=375

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 139/254 (55%), Gaps = 5/254 (2%)
 Frame = +2

Query  119  PGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFK  298
            PG  +  +   +   + Q   W +       S  +     L  +    V  K GKGG F 
Sbjct  34   PGNGLSTNMTRVEFSEQQFMKWVKFVGGLKHSVFRTAKNKLFPSHTLHVSKKHGKGG-FS  92

Query  299  TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQ-  475
            +IQ A+ ++P  N  R +I +  G Y E+V I   + FVT+ G+  ++  +    TA   
Sbjct  93   SIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSFVTIQGEGADKTIVQWGDTAQSQ  152

Query  476  -VGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGF  649
             +GT  SAT  V S YF+A NI  KN+AP P+ G   +Q VAL IS + A F  CKF G 
Sbjct  153  PLGTYGSATFAVNSPYFIAKNITFKNTAPIPAPGAVGKQGVALRISADTAVFLGCKFLGA  212

Query  650  QDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIED  829
            QDTL D+I +H+YKDCYIEG+VDF FG+A S+     +H     T A+ TA GR S +ED
Sbjct  213  QDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQLTGAL-TAQGRNSLLED  271

Query  830  TGLSFVQCRITGSA  871
            TG SFV C++TGS 
Sbjct  272  TGFSFVHCKVTGSG  285



>ref|XP_003632380.2| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
 emb|CAN79461.1| hypothetical protein VITISV_042494 [Vitis vinifera]
 emb|CBI36991.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 134/232 (58%), Gaps = 10/232 (4%)
 Frame = +2

Query  203  PLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKY  376
            P   G K +D  L KAE   V + V + G   + TI +A+ TIP  NT+R I+ I  G Y
Sbjct  62   PSGGGGKALDIKLSKAEMNKVTMTVSQDGTADYTTISDALHTIPLYNTRRVILVIKPGVY  121

Query  377  NERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFMAVN  535
             E+V +    PFVT  GD  + PT+    TA+ +G       T  SAT+ V ++YF+A+N
Sbjct  122  REKVTVPRALPFVTFLGDASDPPTITGNDTASVIGRNGVPLKTFQSATVGVDANYFVAIN  181

Query  536  INVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTV  715
            I  +N+AP   G    QAVAL ISG KAAFYNC FYG QDTL D+   H++ +C+I+G+V
Sbjct  182  IKFENTAPHVIGSAGGQAVALRISGTKAAFYNCSFYGSQDTLYDHTGLHYFNNCFIQGSV  241

Query  716  DFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            DF FG  +S+  N  L+      +A +TA  R ++   +G SF  C +TGS 
Sbjct  242  DFIFGYGRSLYENCSLNSV-AKKVASLTAQKRSTSSMASGFSFKDCVVTGSG  292



>gb|EMT14071.1| Putative pectinesterase 68 [Aegilops tauschii]
Length=348

 Score =   169 bits (427),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 141/249 (57%), Gaps = 20/249 (8%)
 Frame = +2

Query  149  PIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFKTIQEAVKTIP  328
            P+ +E +  ES  R   Q  Q    GV   +V A  A         G F +IQ+AV ++P
Sbjct  21   PLASEATTCESARRGHHQYRQP--VGVRRMVVDASGA---------GDFLSIQQAVDSVP  69

Query  329  ARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAA-------QVGTI  487
              N+ R I+ I  G Y E+V +   +P++TL G  ++   +     A+       Q+ T 
Sbjct  70   VNNSVRVIMQINAGTYIEKVVVPASKPYITLEGAGRDVTVVEWHDKASDRGPDGQQLRTY  129

Query  488  YSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVALTISGNKAAFYNCKFYGFQDTLC  664
             +A++ VLS+YF A NI+ KN+AP P  G    QAVA  ISG+KA F+ C FYG QDTLC
Sbjct  130  NTASVTVLSNYFTAKNISFKNTAPAPMPGMQGGQAVAFRISGDKAFFFGCGFYGAQDTLC  189

Query  665  DNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSF  844
            D+  +H+++DCYIEG++DF FG+ +S+  + ELH         V AHGR+   E TG +F
Sbjct  190  DDAGRHYFRDCYIEGSIDFIFGNGRSLYKDCELHS-TARRFGSVAAHGRQGPCERTGFAF  248

Query  845  VQCRITGSA  871
            V CR+TG+ 
Sbjct  249  VNCRVTGTG  257



>emb|CBI27989.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 125/203 (62%), Gaps = 9/203 (4%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G F++IQ+A+ ++P+ N  R +I +  G Y E+V I   + F+T+ G   ++  +    T
Sbjct  24   GDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPAFKSFITIEGAGADKTVVQWGDT  83

Query  467  AAQVG-------TIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAA  622
            A  +G       T  SAT  V S YF+A NI  KN+ P P+ G   +QAVA  ISG+ AA
Sbjct  84   ARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPAPGAVGKQAVAFRISGDTAA  143

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
            F  CKF G QDTL D++ +H+YKDCYIEG+VDF FG+A S+     +H    +T A+ TA
Sbjct  144  FLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQNTGAL-TA  202

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
             GR S +EDTG SFV C++TGS 
Sbjct  203  QGRSSLLEDTGFSFVNCKVTGSG  225



>ref|XP_010240218.1| PREDICTED: probable pectinesterase 68 [Brachypodium distachyon]
Length=353

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/251 (39%), Positives = 139/251 (55%), Gaps = 23/251 (9%)
 Frame = +2

Query  143  TVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFKTIQEAVKT  322
            T P P E ++  S      QP+     GV   +V A  A         G F +IQ+AV +
Sbjct  27   TTPTPCEAARRGSGHHQYRQPV-----GVRRIVVDATGA---------GDFLSIQQAVDS  72

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAA-------QVG  481
            +PA NT R I+ I  G Y E+V +   +P++T  G  ++   +     A+       Q+ 
Sbjct  73   VPANNTVRVIMQINAGSYIEKVLVPASKPYITFEGAGRDVTVVEWHDRASDRGPDGQQLR  132

Query  482  TIYSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVALTISGNKAAFYNCKFYGFQDT  658
            T  SA++ VLS+YF A NI+ KN+AP P  G    QAVA  ISG+KA F+ C FYG QDT
Sbjct  133  TYNSASVTVLSNYFTAKNISFKNTAPAPMPGMQGWQAVAFRISGDKAFFFGCGFYGAQDT  192

Query  659  LCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGL  838
            LCD+  +H+++DCYI+G++DF FG+ +S+  + ELH         V A GR    E TG 
Sbjct  193  LCDDAGRHYFRDCYIQGSIDFIFGNGRSLYKDCELHS-TAQRFGSVAAQGRNGPCERTGF  251

Query  839  SFVQCRITGSA  871
            +FV CR+TG+ 
Sbjct  252  AFVNCRVTGTG  262



>ref|XP_010679463.1| PREDICTED: probable pectinesterase 53 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 106/296 (36%), Positives = 156/296 (53%), Gaps = 35/296 (12%)
 Frame = +2

Query  104  VLVFCPGGVIPLDTVPIPA----EKSQVESWFRASVQPLQSGR-----------------  220
            +L F P   I L  + + +     + + ESW   +VQ  +  R                 
Sbjct  8    LLPFIPLFFISLHHISLWSLATDPQQEYESWLNWNVQNHRQRRPHTLPQPNTAATPAGPS  67

Query  221  KGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
            K +D  L  AE   V L V + G   ++TI EA+  IP RNT+R I+ I+ G Y E++ I
Sbjct  68   KDLDVKLKNAETNKVRLTVNQNGTGDYRTITEAIDNIPLRNTRRVILDISPGIYREKIHI  127

Query  395  DFDRPFVTLYGDPKNRPTLVAATTAA------QVGTIYSATLYVLSDYFMAVNINVKNSA  556
               +PF++  GD  N PT+    TA+       + T  SAT+ V +DYF+A+NI  +N+A
Sbjct  128  PKTKPFISFVGDSSNPPTITGNDTASVTHDGTPLHTFQSATVAVDADYFVALNIIFENTA  187

Query  557  PRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDA  736
                GK  +QAVAL ISG KA+FY   FYG QDTL D+   H++++C+I+G+VDF FG  
Sbjct  188  THEVGKAGEQAVALRISGTKASFYEASFYGSQDTLYDHKGLHYFRNCFIQGSVDFIFGYG  247

Query  737  KSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            +S   N  ++      +A VTA  R  +  ++G SF  C++TGS      +  LGR
Sbjct  248  RSFYENCTINSI-AKKVASVTAQKRSKSSMESGFSFKDCKVTGSG-----LVYLGR  297



>ref|XP_007051206.1| Pectinesterase [Theobroma cacao]
 gb|EOX95363.1| Pectinesterase [Theobroma cacao]
Length=388

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/300 (37%), Positives = 158/300 (53%), Gaps = 34/300 (11%)
 Frame = +2

Query  65   METVRLLNV------VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQS----  214
            M  VRLL        +++ ++VFC        T   P  ++  + W    V+  +S    
Sbjct  1    MTFVRLLMASEYYFQLVLFLIVFC--NFYLKTTSSNPGSETDHDKWLSWHVRNHKSKQIF  58

Query  215  ----------GRKG--VDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYI  352
                      G KG  +D  L  AE   V + VG+   G F+TI EA+ +IP+RN++R I
Sbjct  59   WQAESLIQSPGAKGRVLDDELRMAEMNKVRINVGQDGSGDFRTINEALSSIPSRNSRRVI  118

Query  353  IFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVL  511
            + I  G Y E+V I    PF+T  GD  N PT+    TA+  G       T  SAT+ V 
Sbjct  119  LVIKPGIYREKVVIPRTLPFITFLGDASNPPTITGNDTASGPGKDGMPLKTFQSATVAVD  178

Query  512  SDYFMAVNINVKNSAPRPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYK  691
            ++YF+A+N+  +N+ P   G    QAVAL ISG KAAFYNC FYG QDTL D+   H+  
Sbjct  179  ANYFVAINMKFENTVPHQIGSRGGQAVALRISGTKAAFYNCSFYGDQDTLYDHKGLHYLN  238

Query  692  DCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            +C+I+G+VDF FG  +S+  N  ++      +A +TA  R +A   +G SF  C +TGS+
Sbjct  239  NCFIQGSVDFIFGYGRSLYENCTVNSI-SKKVASLTAQKRSNASLASGFSFKDCVVTGSS  297



>ref|XP_008669043.1| PREDICTED: probable pectinesterase 68 [Zea mays]
 gb|ACL53825.1| unknown [Zea mays]
 tpg|DAA36523.1| TPA: pectinesterase [Zea mays]
Length=349

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 132/229 (58%), Gaps = 13/229 (6%)
 Frame = +2

Query  209  QSGRKGVDPALVKAEAAPVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERV  388
             SG +   P  V+     + +  G  G F +IQ AV ++P  NT R I+ I  G Y E+V
Sbjct  35   HSGHRYRHPVGVR----KIVVDAGGAGDFVSIQRAVDSVPEGNTVRVIVQINAGTYIEKV  90

Query  389  KIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFMAVNINVK  547
             +   +P+VT  G  ++   +     A+  G       T  +A++ +L++YF A NI+ K
Sbjct  91   VVPASKPYVTFQGAGRDVTVVEWHDRASDRGPDGQPLRTYNTASVTILANYFNAKNISFK  150

Query  548  NSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFF  724
            N+AP P  G    QAVA  ISG+KA F+ C FYG QDTLCD+  +H+++DCYIEG++DF 
Sbjct  151  NTAPAPMPGTQGGQAVAFRISGDKAFFFGCGFYGAQDTLCDDAGRHYFRDCYIEGSIDFV  210

Query  725  FGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            FG+A+S+  + ELH         V AHGR+   E TG +FV CR+TG+ 
Sbjct  211  FGNARSLYKDCELHS-TAQRFGSVAAHGRRDPCERTGFAFVNCRVTGTG  258



>emb|CAN63186.1| hypothetical protein VITISV_037092 [Vitis vinifera]
Length=379

 Score =   168 bits (425),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 125/203 (62%), Gaps = 9/203 (4%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G F++IQ+A+ ++P+ N  R +I +  G Y E+V I   + F+T+ G   ++  +    T
Sbjct  90   GDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPXFKSFITIEGAGADKTVVQWGDT  149

Query  467  AAQVG-------TIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAA  622
            A  +G       T  SAT  V S YF+A NI  KN+ P P+ G   +QAVA  ISG+ AA
Sbjct  150  ARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPAPGAVGKQAVAFRISGDTAA  209

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
            F  CKF G QDTL D++ +H+YKDCYIEG+VDF FG+A S+     +H    +T A+ TA
Sbjct  210  FLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQNTGAL-TA  268

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
             GR S +EDTG SFV C++TGS 
Sbjct  269  QGRSSLLEDTGFSFVNCKVTGSG  291



>ref|XP_010271483.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=395

 Score =   168 bits (426),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 125/205 (61%), Gaps = 9/205 (4%)
 Frame = +2

Query  281  KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAA  460
            K G F T+Q+AV ++P  N  R +I I  G Y E+V I   + FVTL G   +R  L   
Sbjct  105  KKGDFVTVQKAVDSLPIVNQCRVLIKIHAGIYREKVDIPATKAFVTLEGAGADRTILQWG  164

Query  461  TTAAQ-------VGTIYSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVALTISGNK  616
             TA +       +GT  SAT  + S YF+A NI  KN+AP P SG   +QAVAL ISG+ 
Sbjct  165  DTADRMGSDRRPLGTFASATFAINSPYFVAKNITFKNTAPLPPSGALGKQAVALRISGDT  224

Query  617  AAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMV  796
            AAF++C F G QDTL D+I +H++KDCYI+G+VDF FGD  S+     LH    ++   +
Sbjct  225  AAFFSCNFIGAQDTLYDHIGRHYFKDCYIQGSVDFIFGDGLSLYEGCHLHAIT-NSYGAL  283

Query  797  TAHGRKSAIEDTGLSFVQCRITGSA  871
            TA  R + +E+TG SFV CR+TGS 
Sbjct  284  TAQKRDNMLEETGFSFVNCRVTGSG  308



>ref|XP_010656255.1| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
Length=379

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 125/203 (62%), Gaps = 9/203 (4%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G F++IQ+A+ ++P+ N  R +I +  G Y E+V I   + F+T+ G   ++  +    T
Sbjct  90   GDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPAFKSFITIEGAGADKTVVQWGDT  149

Query  467  AAQVG-------TIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAA  622
            A  +G       T  SAT  V S YF+A NI  KN+ P P+ G   +QAVA  ISG+ AA
Sbjct  150  ARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPAPGAVGKQAVAFRISGDTAA  209

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
            F  CKF G QDTL D++ +H+YKDCYIEG+VDF FG+A S+     +H    +T A+ TA
Sbjct  210  FLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQNTGAL-TA  268

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
             GR S +EDTG SFV C++TGS 
Sbjct  269  QGRSSLLEDTGFSFVNCKVTGSG  291



>ref|XP_010262227.1| PREDICTED: putative pectinesterase 63 [Nelumbo nucifera]
Length=357

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 133/220 (60%), Gaps = 14/220 (6%)
 Frame = +2

Query  227  VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
            +D AL +AE +   +KV K G   FKT+ +A+ +IP+ N +R I++I  G+Y E++ +D 
Sbjct  55   LDDALAQAEKSSKVIKVRKDGTGDFKTVADAIASIPSGNKQRIILWIGPGEYAEKITVDK  114

Query  401  DRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPSGKPD  580
             +PF+T YG P+N P L +           SA++ V SDYFMA NI  KNSAP   GK  
Sbjct  115  SKPFLTFYGSPENMPILSSHGA--------SASVTVESDYFMAANIIFKNSAPETDGKGG  166

Query  581  Q---QAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIIL  751
                +A A+ ISG+KA FY+C F G   +L D+  +H +KDCYIE T++F  G+ KS+ +
Sbjct  167  GQGGEAAAMRISGDKAVFYSCNFTGSDKSLYDDKGRHLFKDCYIESTLNFISGNGKSLYM  226

Query  752  NTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
             TE+H     T A++T+  ++   EDTG  FV C  TGS 
Sbjct  227  FTEIHS-KAKTNALITSSTKEKENEDTGYCFVYCNFTGSG  265



>ref|XP_006349162.1| PREDICTED: probable pectinesterase 53-like [Solanum tuberosum]
Length=386

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/224 (42%), Positives = 132/224 (59%), Gaps = 10/224 (4%)
 Frame = +2

Query  227  VDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
            +DP L+ AE   + + V +   G F TI+EA+ +IP  N +R I+ I  G Y E++ I  
Sbjct  74   LDPKLIYAEMNKMIISVSQDGSGNFNTIKEALASIPLYNKRRVILDIKPGVYREKINIPR  133

Query  401  DRPFVTLYGDPKNRPTLVAATTAAQVGT-------IYSATLYVLSDYFMAVNINVKNSAP  559
              PFVT  GD  N P +    TA+  GT         SAT+ V +DYF+A+N+  +N+AP
Sbjct  134  SLPFVTFRGDSSNPPRITGNDTASATGTGGTPLKTFQSATVSVDADYFIAINVIFENTAP  193

Query  560  RPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAK  739
               G   +QAVAL ISGNKAAFYNC FYG QDTL D+   H++ +C+I+G+VDF FG  +
Sbjct  194  HVVGTAGEQAVALRISGNKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQGSVDFIFGYGR  253

Query  740  SIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            S+  N +L+      +A +TA  R ++   +G SF    ITG+ 
Sbjct  254  SLYENCQLNSV-AKKVASLTAQKRTNSSILSGFSFKNSTITGTG  296



>ref|XP_004976450.1| PREDICTED: probable pectinesterase 68-like [Setaria italica]
Length=348

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 132/231 (57%), Gaps = 13/231 (6%)
 Frame = +2

Query  203  PLQSGRKGVDPALVKAEAAPVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNE  382
            P  SG     P  V+     V +  G  G F +IQ+AV ++P  N  R I+ I  G Y E
Sbjct  32   PRPSGHGYKHPVGVRK----VVVDAGGAGDFTSIQQAVDSVPVNNNVRVIMQINAGTYIE  87

Query  383  RVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFMAVNIN  541
            +V +   +P++T +G  ++   +     A+  G       T  +A++ +LS+YF A NI+
Sbjct  88   KVLVPASKPYITFHGAGRDVTVVQWHDRASDPGPDGQPLRTYNTASVTILSNYFTAKNIS  147

Query  542  VKNSAPRP-SGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVD  718
             KN+AP P  G    QAVA  ISG+KA F+ C FYG QDTLCD+  +H+++DCYIEG++D
Sbjct  148  FKNTAPAPMPGTQGGQAVAFRISGDKAFFFGCGFYGAQDTLCDDAGRHYFRDCYIEGSID  207

Query  719  FFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
            F FG+A+S+  + EL     +    V AHGR    E TG +FV CR+TG+ 
Sbjct  208  FVFGNARSLYKDCELRS-TAERYGSVAAHGRHDPCERTGFAFVNCRVTGTG  257



>ref|XP_008673062.1| PREDICTED: pectinesterase isoform X1 [Zea mays]
 gb|ACR36293.1| unknown [Zea mays]
Length=391

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 141/266 (53%), Gaps = 25/266 (9%)
 Frame = +2

Query  119  PGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY-LKVGKG---  286
            P  + P +     A + Q   W R        G +        A A+P Y L V K    
Sbjct  46   PSSLFPANATRAEAIERQFVEWVR-----YVGGLRHSTFQHAVARASPSYSLVVDKDPAL  100

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTL-----------YGDP  433
            G F TIQ AV ++PA N  R +I +  G Y E+V +   R F+TL           +GD 
Sbjct  101  GDFTTIQAAVDSLPAINLVRVVIRVNAGTYTEKVTVSAMRAFITLEGAGADKTVVQWGDT  160

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISG  610
             + PT         +GT  SA+  V + YF+A NI  KN++P P  G   +QAVAL +S 
Sbjct  161  ADSPT---GPKGRPLGTFNSASFAVNAQYFLARNITFKNTSPVPKPGAAGKQAVALRVSA  217

Query  611  NKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMA  790
            + AAF  C+F G QDTL D+  +H+YKDCYI+G+VDF FG+A S+  +  +H    D  A
Sbjct  218  DNAAFVGCRFLGAQDTLYDHSGRHYYKDCYIQGSVDFIFGNALSLYEDCHVHAIARDYGA  277

Query  791  MVTAHGRKSAIEDTGLSFVQCRITGS  868
            + TA  R+S +EDTG SFV CR+TGS
Sbjct  278  L-TAQNRQSMLEDTGFSFVNCRVTGS  302



>ref|XP_007046753.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007046754.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90910.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX90911.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=362

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 124/203 (61%), Gaps = 9/203 (4%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            GQF T+Q+A+ ++P  N  R +I+I  G Y E+V+I     ++TL G    +  +    T
Sbjct  72   GQFATVQKAISSLPVVNNCRVVIYIGAGTYREKVEIPATMAYITLEGAGAGKTVIEWDDT  131

Query  467  AAQ-------VGTIYSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVALTISGNKAA  622
            A +       +GT  SAT  V S YF+A NI  KN AP P SG   +QAVAL IS + AA
Sbjct  132  ADRMGQSGRPLGTYGSATFAVNSPYFIAKNITFKNKAPSPPSGALGKQAVALRISADTAA  191

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
            F  CKF G QDTL D+I +H++KDCYIEG+VDF FG+  S+  +  LH    ++   +TA
Sbjct  192  FIGCKFIGAQDTLYDHIGRHYFKDCYIEGSVDFIFGNGLSLYRDCHLHAVT-NSYGALTA  250

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
              R+S +E+TG SFV C++TGS 
Sbjct  251  QKRESFLEETGFSFVNCKVTGSG  273



>ref|XP_004969916.1| PREDICTED: probable pectinesterase 53-like [Setaria italica]
Length=403

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 143/259 (55%), Gaps = 24/259 (9%)
 Frame = +2

Query  149  PIPAEKSQ---VESWFRASVQPLQSGRKGVDPALVKAEAAPVY-LKVGKG---GQFKTIQ  307
            P PA  ++   +E  F   V+ + + R       + A A P Y L V K    G F TIQ
Sbjct  61   PFPANATRAEMIERQFMEWVRYMGALRHSTFQHAL-ARAFPSYSLVVDKNPAFGDFTTIQ  119

Query  308  EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTL-----------YGDPKNRPTLV  454
             A+ ++PA N  R +I +  G Y E+V I   R F+TL           +GD  + PT  
Sbjct  120  AAIDSLPAINLVRVVIRVNAGTYTEKVTISAMRAFITLEGAGADSTIVQWGDTADSPT--  177

Query  455  AATTAAQVGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYN  631
                   +GT  SAT  V + YF+A NI  KN++P P  G   +QAVAL +S + AAF  
Sbjct  178  -GPKGRPLGTFNSATFAVNAQYFLARNITFKNTSPVPKPGATGKQAVALRVSADNAAFVG  236

Query  632  CKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGR  811
            CKF G QDTL D+  +H+YK+CYIEG+VDF FG+A S+  +  +H    D  A+ TA  R
Sbjct  237  CKFLGAQDTLYDHSGRHYYKECYIEGSVDFIFGNALSLYEDCHVHAIARDYGAL-TAQNR  295

Query  812  KSAIEDTGLSFVQCRITGS  868
            +S +EDTG SFV CR+TGS
Sbjct  296  QSMLEDTGFSFVNCRVTGS  314



>emb|CAD41229.2| OSJNBa0010H02.16 [Oryza sativa Japonica Group]
 emb|CAH67415.1| OSIGBa0143N19.9 [Oryza sativa Indica Group]
 gb|EAY95103.1| hypothetical protein OsI_16919 [Oryza sativa Indica Group]
 gb|EAZ31575.1| hypothetical protein OsJ_15719 [Oryza sativa Japonica Group]
Length=344

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 123/204 (60%), Gaps = 9/204 (4%)
 Frame = +2

Query  284  GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAAT  463
            GG F +IQ+AV ++P  NT R I+ I  G Y E+V +   +P++T  G  ++   +    
Sbjct  51   GGDFLSIQQAVNSVPENNTVRVIMQINAGSYIEKVVVPATKPYITFQGAGRDVTVVEWHD  110

Query  464  TAA-------QVGTIYSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVALTISGNKA  619
             A+       Q+ T  +A++ VLS+YF A NI+ KN+AP P  G    QAVA  ISG+KA
Sbjct  111  RASDRGPDGQQLRTYNTASVTVLSNYFTAKNISFKNTAPAPMPGMQGWQAVAFRISGDKA  170

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
             F+ C FYG QDTLCD+  +H+++DCYIEG++DF FG+ +S+  + ELH         V 
Sbjct  171  FFFGCGFYGAQDTLCDDAGRHYFRDCYIEGSIDFVFGNGRSLYKDCELHS-TAQRFGSVA  229

Query  800  AHGRKSAIEDTGLSFVQCRITGSA  871
            A GR    E TG +FV CR+TG+ 
Sbjct  230  AQGRHDPCERTGFAFVNCRVTGTG  253



>gb|KDP28296.1| hypothetical protein JCGZ_14067 [Jatropha curcas]
Length=375

 Score =   165 bits (418),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/235 (41%), Positives = 137/235 (58%), Gaps = 15/235 (6%)
 Frame = +2

Query  227  VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
            +D  L KAE   V + V + G   F TI +A+K+IP+RNT+R II I  G Y E++ I  
Sbjct  59   LDDKLRKAEMNSVRITVNQNGPGDFNTIGDAIKSIPSRNTRRVIIAIKPGVYREKISIPR  118

Query  401  DRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFMAVNINVKNSAP  559
              PF+T  G+  + P +    TA+  G       T  SAT+ V ++YF+A+NI  +N+AP
Sbjct  119  TLPFITFLGESSDPPIITGNDTASVNGKDGMPLKTFQSATVAVDANYFVAINIIFENTAP  178

Query  560  RPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAK  739
               G    QAVAL ISG KAAFY+C FYG QDTL D+   H++ +C+I+G+VDF FG  +
Sbjct  179  HEIGSRGGQAVALRISGTKAAFYSCSFYGNQDTLYDHKGLHYFNNCFIQGSVDFIFGSGR  238

Query  740  SIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGSADPKAKVAVLGR  904
            S+  N  L+      +A +TA  R ++  ++G SF  C +TGS      +  LGR
Sbjct  239  SLYQNCRLNSVT-KKVASLTAQKRNNSSLESGFSFKDCVVTGSG-----LVYLGR  287



>ref|XP_006477195.1| PREDICTED: probable pectinesterase 68-like [Citrus sinensis]
Length=359

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 126/211 (60%), Gaps = 9/211 (4%)
 Frame = +2

Query  263  VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
            + + V   G+FK++Q AV ++P RN    +I I+ G Y E+V +   +P++T  G  ++R
Sbjct  58   ITVDVNGSGEFKSVQAAVDSVPERNRMNVLIQISAGCYIEKVTVPVSKPYITFQGAGRDR  117

Query  443  PTLVAATTAA-------QVGTIYSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVAL  598
              +     A        Q+ T  +A++ V ++YF A NI+ KN+AP P  G    QA A 
Sbjct  118  TVIEWHDRACDRGANGQQLRTYQTASVTVFANYFSARNISFKNTAPAPLPGMQGWQAAAF  177

Query  599  TISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPG  778
             ISG+KA F  C FYG QDTLCD+  +H++K+CYIEG++DF FG+ +S+  + ELH    
Sbjct  178  RISGDKAYFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDFIFGNGRSLYKDCELHSI-A  236

Query  779  DTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
                 + AH RKS  E TG +FV+CR+TG+ 
Sbjct  237  TRFGSIAAHDRKSPDEKTGFAFVRCRVTGTG  267



>gb|KDO61446.1| hypothetical protein CISIN_1g018249mg [Citrus sinensis]
Length=359

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 126/211 (60%), Gaps = 9/211 (4%)
 Frame = +2

Query  263  VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
            + + V   G+FK++Q AV ++P RN    +I I+ G Y E+V +   +P++T  G  ++R
Sbjct  58   ITVDVNGSGEFKSVQAAVDSVPERNRMNVLIQISAGCYIEKVTVPVSKPYITFQGAGRDR  117

Query  443  PTLVAATTAA-------QVGTIYSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVAL  598
              +     A        Q+ T  +A++ V ++YF A NI+ KN+AP P  G    QA A 
Sbjct  118  TVIEWHDRACDRGANGQQLRTYQTASVTVFANYFSARNISFKNTAPAPLPGMQGWQAAAF  177

Query  599  TISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPG  778
             ISG+KA F  C FYG QDTLCD+  +H++K+CYIEG++DF FG+ +S+  + ELH    
Sbjct  178  RISGDKAYFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDFIFGNGRSMYKDCELHSI-A  236

Query  779  DTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
                 + AH RKS  E TG +FV+CR+TG+ 
Sbjct  237  TRFGSIAAHDRKSPDEKTGFAFVRCRVTGTG  267



>ref|XP_006440314.1| hypothetical protein CICLE_v10020787mg [Citrus clementina]
 gb|ESR53554.1| hypothetical protein CICLE_v10020787mg [Citrus clementina]
Length=359

 Score =   164 bits (416),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 126/211 (60%), Gaps = 9/211 (4%)
 Frame = +2

Query  263  VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
            + + V   G+FK++Q AV ++P RN    +I I+ G Y E+V +   +P++T  G  ++R
Sbjct  58   ITVDVNGSGEFKSVQAAVDSVPERNRMNVLIQISAGCYIEKVTVPVSKPYITFQGAGRDR  117

Query  443  PTLVAATTAA-------QVGTIYSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVAL  598
              +     A        Q+ T  +A++ V ++YF A NI+ KN+AP P  G    QA A 
Sbjct  118  TVIEWHDRACDRGANGQQLRTYQTASVTVFANYFSARNISFKNTAPAPLPGMQGWQAAAF  177

Query  599  TISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPG  778
             ISG+KA F  C FYG QDTLCD+  +H++K+CYIEG++DF FG+ +S+  + ELH    
Sbjct  178  RISGDKAYFSGCGFYGAQDTLCDDAGRHYFKECYIEGSIDFIFGNGRSMYKDCELHSI-A  236

Query  779  DTMAMVTAHGRKSAIEDTGLSFVQCRITGSA  871
                 + AH RKS  E TG +FV+CR+TG+ 
Sbjct  237  TRFGSIAAHDRKSPDEKTGFAFVRCRVTGTG  267



>ref|XP_006371972.1| hypothetical protein POPTR_0018s06820g [Populus trichocarpa]
 gb|ERP49769.1| hypothetical protein POPTR_0018s06820g [Populus trichocarpa]
Length=422

 Score =   166 bits (420),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 123/204 (60%), Gaps = 11/204 (5%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G F TIQEA+ ++P  N  R II I  G Y E+V I   + F+T+ G   +  T+V    
Sbjct  133  GDFTTIQEAIDSLPFINLVRVIIKIRAGVYKEKVNIPPLKSFITMEGAGADN-TIVQWGD  191

Query  467  AAQ--------VGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKA  619
             AQ        +GT  SAT  V S +F+A NI  KN+AP P+ G   QQAVAL IS + A
Sbjct  192  TAQTPGARGQPMGTYSSATFAVNSPFFVAKNITFKNTAPLPAPGAMGQQAVALRISADTA  251

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            AF  CKF G QDTL D++ +H+YKDCYIEG+VDF FG+  S+     +H     T A+ T
Sbjct  252  AFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGLSLFEGCHVHAIAQFTGAL-T  310

Query  800  AHGRKSAIEDTGLSFVQCRITGSA  871
            A GR S +EDTG SFV C++TGS 
Sbjct  311  AQGRSSLLEDTGFSFVNCKVTGSG  334



>ref|XP_009399936.1| PREDICTED: probable pectinesterase 68 [Musa acuminata subsp. 
malaccensis]
Length=344

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 122/203 (60%), Gaps = 9/203 (4%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G F ++QEAV ++P  NTKR II I  G Y E+V +   +P+VT  G  +N   +     
Sbjct  51   GDFLSVQEAVDSVPENNTKRVIIHIHAGCYIEKVVVPATKPYVTFQGAGRNVTVIEWHDR  110

Query  467  AA-------QVGTIYSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVALTISGNKAA  622
            A+       Q+ T  +A++ V +++F A NI+ KN+AP P  G    QA A  ISG+KA 
Sbjct  111  ASDRGPNGQQLRTYNTASVTVFANHFSAKNISFKNTAPAPMPGMEGWQAAAFRISGDKAY  170

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
            F+ C FYG QDTLCD+  +H++KDCYIEG++DF FG+ +S+  + +LH    +    V A
Sbjct  171  FFGCGFYGAQDTLCDDAGRHYFKDCYIEGSIDFIFGNGRSMYKDCQLHSI-ANRFGSVAA  229

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
              R S  E TG +FV CR+TGS 
Sbjct  230  QDRNSPCERTGFAFVNCRVTGSG  252



>ref|XP_009397881.1| PREDICTED: probable pectinesterase 68 [Musa acuminata subsp. 
malaccensis]
Length=347

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 120/203 (59%), Gaps = 9/203 (4%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G F ++QEAV  +P  NTKR +I I  G Y E+V +   +P+VT  G  ++   +     
Sbjct  54   GHFSSVQEAVDFVPENNTKRVVIQIHAGHYTEKVIVPATKPYVTFQGAGRDVTVIEWHDR  113

Query  467  AA-------QVGTIYSATLYVLSDYFMAVNINVKNSAPRP-SGKPDQQAVALTISGNKAA  622
            A+       Q+ T  +A++ + + YF A NI+ KN+AP P  G    QA A  ISG+KA 
Sbjct  114  ASDRGPDGQQLRTYNTASVTIFASYFRARNISFKNTAPAPMPGMEGWQAAAFRISGDKAY  173

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
            F+ C FYG QDTLCD+  +H++KDCYIEG++DF FG+ +S+  + +LH    D    + A
Sbjct  174  FFGCGFYGAQDTLCDDAGRHYFKDCYIEGSIDFIFGNGRSMYKDCQLHSI-ADRFGAIAA  232

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
              R S  E TG +FV CR+TG+ 
Sbjct  233  QDRNSPCERTGFAFVNCRVTGTG  255



>ref|XP_007152966.1| hypothetical protein PHAVU_004G175200g [Phaseolus vulgaris]
 gb|ESW24960.1| hypothetical protein PHAVU_004G175200g [Phaseolus vulgaris]
Length=381

 Score =   165 bits (417),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 125/204 (61%), Gaps = 11/204 (5%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G F +IQEA+ ++P  N  R +I +  G Y E+V I   + ++T+ GD     T+V  + 
Sbjct  92   GDFTSIQEAIDSLPFINLVRVVIKVHAGVYTEKVNIPAFKSYITIEGDGAEE-TIVKWSD  150

Query  467  AAQ--------VGTIYSATLYVLSDYFMAVNINVKNSAPRPS-GKPDQQAVALTISGNKA  619
             AQ        +GT  SAT  V S YF+A NI  +N+ P P+ G   +QAVAL IS + A
Sbjct  151  TAQTPGSNGRPLGTYGSATFAVNSPYFIAKNITFQNTTPVPAPGAIGKQAVALRISADTA  210

Query  620  AFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVT  799
            AF  CKF G QDTL D++ +H+YKDCYIEG+VDF FG++ S+     +H    +T A VT
Sbjct  211  AFVGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNSLSLFEGCHVHAIAQNTGA-VT  269

Query  800  AHGRKSAIEDTGLSFVQCRITGSA  871
            A GR S +EDTG SFV C++TGS 
Sbjct  270  AQGRSSMLEDTGFSFVNCKVTGSG  293



>ref|XP_009406174.1| PREDICTED: probable pectinesterase 53 isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=342

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 121/203 (60%), Gaps = 9/203 (4%)
 Frame = +2

Query  287  GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
            G F TIQEAV ++P  N  R +I +  G Y E+V +   R F+T+ G   ++  +    T
Sbjct  88   GDFTTIQEAVDSLPLINLVRVVIKVNAGTYTEKVNVSPMRAFITIQGAGADKTVVQWGDT  147

Query  467  AAQ-------VGTIYSATLYVLSDYFMAVNINVKNSAP-RPSGKPDQQAVALTISGNKAA  622
            A         +GT  SAT  V + YF+A NI  KN+ P  P G   +QAV+L ISG+ AA
Sbjct  148  AETLGPKKQPIGTFNSATFAVNAPYFIARNITFKNTTPVPPPGAMGKQAVSLRISGDTAA  207

Query  623  FYNCKFYGFQDTLCDNINKHFYKDCYIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTA  802
            F  CKF G QDTL D++ +H+YKDCYIEG+VDF FG+A S+     +H    +  A+ TA
Sbjct  208  FVGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNALSLYEGCHVHAIAQNYGAL-TA  266

Query  803  HGRKSAIEDTGLSFVQCRITGSA  871
              R S +EDTG SFV C++TGS 
Sbjct  267  QNRMSLLEDTGFSFVNCKVTGSG  289



>ref|XP_003579301.1| PREDICTED: putative pectinesterase 63 [Brachypodium distachyon]
Length=412

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 139/232 (60%), Gaps = 16/232 (7%)
 Frame = +2

Query  212  SGRKGVDPALVKAEAAPVYLKV---GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNE  382
            +G K +D  L  AEAA V   V   GKG +F+TI EA+K IP +N +R I+ I  G Y E
Sbjct  89   NGGKLLDADLSAAEAAKVRYVVSPNGKG-KFRTISEAIKAIPEKNKQRVILDIQPGTYKE  147

Query  383  RVKIDFDRPFVTLYGDPKNRPTLVAATTA-------AQVGTIYSATLYVLSDYFMAVNIN  541
            +  I   +PFVT  G+P+N P +    TA       A +GT+ SAT+ + SDYFMA  I 
Sbjct  148  KFLIPTTKPFVTFLGNPRNPPVITWDDTAGTRGKDGAPIGTLGSATVAIESDYFMASGIV  207

Query  542  VKNSAP-RPSGKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDCYIEGTVD  718
             KN AP  P G    QAVAL + G KAAFYNC F G QDTL DN   H++K+C ++G+VD
Sbjct  208  FKNHAPLAPPGAKGGQAVALRVFGTKAAFYNCTFDGGQDTLYDNKGLHYFKNCVVKGSVD  267

Query  719  FFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIE---DTGLSFVQCRITG  865
            F FG  +S+ ++  + V     +A++TA  R  +I    ++G SFV+C+I G
Sbjct  268  FIFGFGRSLYVDCTM-VSVTSQVAVLTAQQRSRSIAEATESGFSFVRCKIMG  318



>dbj|BAD87905.1| pectinesterase-like [Oryza sativa Japonica Group]
 dbj|BAG98904.1| unnamed protein product [Oryza sativa Japonica Group]
Length=336

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 149/297 (50%), Gaps = 39/297 (13%)
 Frame = +2

Query  74   VRLLNVVIVCVLVFCPGGV-------------------IPLDTVPIPAEKSQVESWFRAS  196
            VRL+   IV +    PGGV                    P +   + A + Q   W R  
Sbjct  6    VRLV-ACIVALAAVAPGGVAGHTRGVRPGRAAGKQQPSFPENATRVEAIERQFMEWVR--  62

Query  197  VQPLQSGRKGVDPALVKAEAAPVY-LKVGKG---GQFKTIQEAVKTIPARNTKRYIIFIA  364
                  G +        A A P Y L V K    G F TIQ AV ++P  N  R +I + 
Sbjct  63   ---YMGGLEHSTVHHALARAFPSYSLVVDKNPAFGDFTTIQAAVDSLPIINLVRVVIKVN  119

Query  365  GGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQ--------VGTIYSATLYVLSDY  520
             G Y E+V I   R F+TL G   ++  +    TA          +GT  SA+  V + Y
Sbjct  120  AGTYTEKVNISPMRAFITLEGAGADKTIVQWGDTADSPSGRAGRPLGTYSSASFAVNAQY  179

Query  521  FMAVNINVKNSAPRPS-GKPDQQAVALTISGNKAAFYNCKFYGFQDTLCDNINKHFYKDC  697
            F+A NI  KN++P P  G   +QAVAL +S + AAF  C+F G QDTL D+  +H+YK+C
Sbjct  180  FLARNITFKNTSPVPKPGASGKQAVALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKEC  239

Query  698  YIEGTVDFFFGDAKSIILNTELHVFPGDTMAMVTAHGRKSAIEDTGLSFVQCRITGS  868
            YIEG+VDF FG+A S+  +  +H    D  A+ TA  R+S +EDTG SFV CR+TGS
Sbjct  240  YIEGSVDFIFGNALSLFEDCHVHAIARDYGAL-TAQNRQSMLEDTGFSFVNCRVTGS  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1863241968852