BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25884_g4_i1 len=1063 path=[5631:0-483 6115:484-502 24411:503-504
24413:505-521 9261:522-1056 24737:1057-1062]

Length=1063
                                                                      Score     E

gb|AHL24653.1|  Fra e 11.01 allergen                                    368   9e-122   
ref|XP_006365350.1|  PREDICTED: pectinesterase 2-like                   362   1e-119   
ref|XP_009789874.1|  PREDICTED: pectinesterase 1-like                   362   2e-119   
ref|XP_006365351.1|  PREDICTED: pectinesterase 2-like                   356   3e-117   
ref|XP_004239982.1|  PREDICTED: pectinesterase 1-like                   355   1e-116   
emb|CDP13860.1|  unnamed protein product                                354   1e-116   
ref|XP_004239981.2|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    350   7e-115   
sp|B2VPR8.1|AL11B_OLEEU  RecName: Full=Pectinesterase 2; AltName:...    350   8e-115   Olea europaea
ref|XP_009626579.1|  PREDICTED: pectinesterase 1-like                   349   2e-114   
sp|D8VPP5.1|AL11A_OLEEU  RecName: Full=Pectinesterase 1; AltName:...    346   2e-113   
emb|CDP19851.1|  unnamed protein product                                341   3e-112   
ref|XP_010087095.1|  Pectinesterase PPME1                               338   3e-110   
ref|XP_004513231.1|  PREDICTED: pectinesterase 1-like                   336   2e-109   
ref|XP_010667524.1|  PREDICTED: pectinesterase 2-like                   335   5e-109   
ref|XP_011076542.1|  PREDICTED: pectinesterase 1-like                   335   5e-109   
ref|XP_011076543.1|  PREDICTED: pectinesterase 1-like                   335   8e-109   
ref|XP_009125688.1|  PREDICTED: pectinesterase PPME1-like               333   2e-108   
emb|CDY14046.1|  BnaC02g01630D                                          332   9e-108   
gb|ADH82125.1|  pectinesterase                                          332   1e-107   
gb|AAX11261.1|  pectin methylesterase allergenic protein                330   3e-107   Kali turgidum [common saltwort]
gb|AAX11262.1|  pectin methylesterase allergenic protein                329   3e-107   Kali turgidum [common saltwort]
ref|XP_004516439.1|  PREDICTED: pectinesterase PPME1-like               330   4e-107   
emb|CDX98975.1|  BnaC09g48600D                                          330   5e-107   
gb|KEH30561.1|  pectinesterase-like protein                             330   6e-107   
gb|ACO34813.1|  Sal k 1 pollen allergen                                 328   7e-107   Kali turgidum [common saltwort]
ref|XP_009122341.1|  PREDICTED: pectinesterase PPME1                    326   2e-105   
emb|CDX70037.1|  BnaA10g23860D                                          325   3e-105   
ref|XP_003518804.1|  PREDICTED: pectinesterase PPME1                    325   4e-105   
gb|KHN29928.1|  Pectinesterase PPME1-like protein                       325   5e-105   
ref|XP_011076539.1|  PREDICTED: pectinesterase 1-like                   331   2e-104   
ref|XP_006289810.1|  hypothetical protein CARUB_v10003415mg             322   7e-104   
ref|XP_002871269.1|  ATPPME1                                            321   1e-103   
gb|KFK25126.1|  hypothetical protein AALP_AA8G069500                    321   2e-103   
ref|NP_177152.2|  pectinesterase PPME1                                  320   3e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423212.1|  PREDICTED: pectinesterase PPME1-like               320   4e-103   
ref|XP_008244214.1|  PREDICTED: putative pectinesterase 63              320   4e-103   
ref|XP_007218171.1|  hypothetical protein PRUPE_ppa007533mg             320   4e-103   
ref|XP_010452707.1|  PREDICTED: pectinesterase PPME1                    319   8e-103   
ref|XP_009122340.1|  PREDICTED: probable pectinesterase 49              318   1e-102   
ref|XP_010491358.1|  PREDICTED: pectinesterase PPME1-like               318   1e-102   
ref|NP_568181.1|  putative pectinesterase 48                            317   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007038213.1|  Pectinesterase, putative isoform 1                 317   6e-102   
ref|XP_004287800.1|  PREDICTED: probable pectinesterase 48-like         317   8e-102   
gb|AAM65347.1|  pectin methyl-esterase-like protein                     316   8e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040323.1|  PREDICTED: pectinesterase PPME1-like               317   8e-102   
gb|AAT99258.1|  pectin-methyltransferase precursor                      316   9e-102   
ref|XP_006399225.1|  hypothetical protein EUTSA_v10013901mg             316   2e-101   
ref|XP_006394480.1|  hypothetical protein EUTSA_v10004453mg             315   2e-101   
gb|KEH17536.1|  pectinesterase-like protein                             315   2e-101   
ref|XP_011014352.1|  PREDICTED: pectinesterase PPME1-like               315   2e-101   
ref|XP_003517875.1|  PREDICTED: pectinesterase PPME1                    315   3e-101   
ref|XP_006572809.1|  PREDICTED: uncharacterized protein LOC100306...    315   3e-101   
ref|XP_002318199.2|  hypothetical protein POPTR_0012s11460g             315   4e-101   Populus trichocarpa [western balsam poplar]
ref|XP_009136508.1|  PREDICTED: putative pectinesterase 63 isofor...    315   4e-101   
ref|XP_011033438.1|  PREDICTED: pectinesterase PPME1-like               315   4e-101   
ref|XP_007216116.1|  hypothetical protein PRUPE_ppa018812mg             315   4e-101   
ref|XP_002277202.1|  PREDICTED: putative pectinesterase 63              315   5e-101   Vitis vinifera
ref|XP_007207766.1|  hypothetical protein PRUPE_ppa026550mg             314   7e-101   
ref|XP_003516497.1|  PREDICTED: pectinesterase PPME1                    314   7e-101   
gb|AAG52566.1|AC010675_14  putative pectin methylesterase; 8433-9798    313   7e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318197.1|  hypothetical protein POPTR_0012s12720g             314   8e-101   Populus trichocarpa [western balsam poplar]
ref|XP_008234142.1|  PREDICTED: putative pectinesterase 63              314   9e-101   
emb|CAB87930.1|  pectin methyl-esterase-like protein                    313   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228727.1|  PREDICTED: pectinesterase PPME1-like               313   1e-100   
ref|XP_007206641.1|  hypothetical protein PRUPE_ppa021246mg             313   1e-100   
ref|XP_008234143.1|  PREDICTED: putative pectinesterase 63              313   2e-100   
ref|XP_010038407.1|  PREDICTED: putative pectinesterase 63              313   3e-100   
ref|XP_010666416.1|  PREDICTED: pectinesterase 2-like                   312   3e-100   
ref|XP_003634032.1|  PREDICTED: putative pectinesterase 63              312   4e-100   
ref|XP_010666418.1|  PREDICTED: pectinesterase 1-like                   311   6e-100   
ref|XP_002309337.2|  hypothetical protein POPTR_0006s20000g             311   7e-100   Populus trichocarpa [western balsam poplar]
ref|XP_007207707.1|  hypothetical protein PRUPE_ppa025119mg             311   7e-100   
ref|XP_002530224.1|  Pectinesterase U1 precursor, putative              311   8e-100   Ricinus communis
ref|XP_002321778.1|  hypothetical protein POPTR_0015s12220g             311   1e-99    Populus trichocarpa [western balsam poplar]
ref|XP_008229317.1|  PREDICTED: putative pectinesterase 63              311   1e-99    
ref|XP_010546425.1|  PREDICTED: pectinesterase PPME1-like               310   2e-99    
dbj|BAB09012.1|  pectin methylesterase-like protein                     310   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006381893.1|  hypothetical protein POPTR_0006s20010g             310   2e-99    
ref|XP_003517889.1|  PREDICTED: pectinesterase PPME1-like               309   7e-99    
ref|XP_007215602.1|  hypothetical protein PRUPE_ppa007761mg             308   8e-99    
ref|XP_002511045.1|  Pectinesterase-1 precursor, putative               308   1e-98    Ricinus communis
ref|XP_010662219.1|  PREDICTED: putative pectinesterase 63              308   1e-98    
ref|XP_010457627.1|  PREDICTED: putative pectinesterase 63              308   1e-98    
ref|XP_010666417.1|  PREDICTED: putative pectinesterase 63              308   1e-98    
gb|KEH38558.1|  pectinesterase-like protein                             307   3e-98    
emb|CDY23044.1|  BnaC07g31430D                                          310   4e-98    
ref|XP_006286828.1|  hypothetical protein CARUB_v10003776mg             307   4e-98    
ref|XP_008449624.1|  PREDICTED: pectinesterase PPME1-like               307   4e-98    
emb|CBI38549.3|  unnamed protein product                                308   4e-98    
ref|XP_004140272.1|  PREDICTED: pectinesterase PPME1-like               306   5e-98    
ref|XP_007222175.1|  hypothetical protein PRUPE_ppa007766mg             306   8e-98    
ref|XP_006399226.1|  hypothetical protein EUTSA_v10013913mg             306   8e-98    
ref|XP_009362807.1|  PREDICTED: putative pectinesterase 63              306   1e-97    
gb|EYU20154.1|  hypothetical protein MIMGU_mgv1a008641mg                306   1e-97    
ref|XP_010523318.1|  PREDICTED: pectinesterase PPME1-like               306   1e-97    
ref|XP_010452709.1|  PREDICTED: probable pectinesterase 49              306   1e-97    
emb|CAN66682.1|  hypothetical protein VITISV_005088                     306   1e-97    Vitis vinifera
ref|XP_008219199.1|  PREDICTED: pectinesterase PPME1-like               306   1e-97    
gb|KGN48071.1|  hypothetical protein Csa_6G428040                       304   2e-97    
gb|KGN48072.1|  hypothetical protein Csa_6G428290                       305   3e-97    
ref|XP_006485036.1|  PREDICTED: pectinesterase PPME1-like               305   3e-97    
gb|KFK27921.1|  hypothetical protein AALP_AA8G447400                    304   5e-97    
ref|XP_006437032.1|  hypothetical protein CICLE_v10031872mg             304   5e-97    
ref|XP_004156059.1|  PREDICTED: pectinesterase PPME1-like               304   9e-97    
ref|XP_010491360.1|  PREDICTED: probable pectinesterase 49              303   1e-96    
ref|XP_008449623.1|  PREDICTED: putative pectinesterase 63              303   1e-96    
ref|XP_004140273.1|  PREDICTED: pectinesterase PPME1-like               303   1e-96    
ref|XP_007153340.1|  hypothetical protein PHAVU_003G027000g             303   1e-96    
ref|XP_010423211.1|  PREDICTED: probable pectinesterase 49              303   2e-96    
gb|KFK25128.1|  hypothetical protein AALP_AA8G069700                    302   3e-96    
ref|XP_009362793.1|  PREDICTED: putative pectinesterase 63              302   3e-96    
gb|KDO57708.1|  hypothetical protein CISIN_1g039631mg                   302   4e-96    
emb|CDP21978.1|  unnamed protein product                                298   4e-96    
ref|XP_006289803.1|  hypothetical protein CARUB_v10003407mg             301   8e-96    
ref|XP_010546117.1|  PREDICTED: pectinesterase PPME1-like isoform X2    300   9e-96    
ref|XP_010546116.1|  PREDICTED: pectinesterase PPME1-like isoform X1    301   9e-96    
ref|XP_008234141.1|  PREDICTED: putative pectinesterase 63              301   1e-95    
ref|XP_009363888.1|  PREDICTED: putative pectinesterase 63              300   1e-95    
ref|XP_002511043.1|  Pectinesterase-1 precursor, putative               300   2e-95    Ricinus communis
gb|KHG24685.1|  Pectinesterase PPME1 -like protein                      300   3e-95    
ref|XP_007038214.1|  Pectinesterase isoform 2                           297   5e-95    
gb|KDP39968.1|  hypothetical protein JCGZ_03499                         298   7e-95    
ref|XP_008338559.1|  PREDICTED: putative pectinesterase 63              299   8e-95    
ref|XP_009130989.1|  PREDICTED: probable pectinesterase 50              298   2e-94    
gb|KDP39971.1|  hypothetical protein JCGZ_03502                         303   3e-94    
ref|XP_002511044.1|  Pectinesterase-3 precursor, putative               296   5e-94    Ricinus communis
ref|XP_010452708.1|  PREDICTED: probable pectinesterase 50              296   5e-94    
emb|CDX81050.1|  BnaC03g03040D                                          296   5e-94    
ref|XP_010109161.1|  Pectinesterase PPME1                               296   8e-94    
ref|XP_010491359.1|  PREDICTED: probable pectinesterase 50              296   8e-94    
ref|XP_004174112.1|  PREDICTED: pectinesterase PPME1-like               294   9e-94    
ref|XP_006572810.1|  PREDICTED: uncharacterized protein LOC100306...    295   1e-93    
ref|XP_010523329.1|  PREDICTED: pectinesterase PPME1-like               295   2e-93    
ref|XP_010423208.1|  PREDICTED: probable pectinesterase 50 isofor...    295   2e-93    
ref|NP_196360.1|  putative pectinesterase 50                            294   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871271.1|  pectinesterase family protein                      294   3e-93    
ref|XP_004140274.1|  PREDICTED: probable pectinesterase 48-like         295   3e-93    
gb|KFK25127.1|  hypothetical protein AALP_AA8G069600                    294   3e-93    
gb|KDP39969.1|  hypothetical protein JCGZ_03500                         295   4e-93    
ref|XP_002277388.2|  PREDICTED: putative pectinesterase 63              295   5e-93    Vitis vinifera
ref|XP_004169214.1|  PREDICTED: probable pectinesterase 48-like         294   6e-93    
ref|XP_002511042.1|  Pectinesterase-1 precursor, putative               291   5e-92    Ricinus communis
emb|CAN78808.1|  hypothetical protein VITISV_030725                     291   1e-91    Vitis vinifera
ref|XP_007204487.1|  hypothetical protein PRUPE_ppa019696mg             290   2e-91    
ref|XP_007204920.1|  hypothetical protein PRUPE_ppa026195mg             289   2e-91    
ref|NP_196359.1|  putative pectinesterase 49                            289   3e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136509.1|  PREDICTED: putative pectinesterase 63 isofor...    288   5e-91    
ref|XP_002871270.1|  pectinesterase family protein                      288   9e-91    
gb|KDP22496.1|  hypothetical protein JCGZ_26327                         296   1e-90    
gb|KHN28380.1|  Putative pectinesterase 48                              286   2e-90    
ref|XP_002866448.1|  pectinesterase family protein                      286   2e-90    
ref|XP_009125689.1|  PREDICTED: probable pectinesterase 50              287   3e-90    
emb|CDY14045.1|  BnaC02g01620D                                          286   3e-90    
ref|XP_010109162.1|  putative pectinesterase 50                         286   3e-90    
ref|NP_200976.1|  putative pectinesterase 63                            285   7e-90    Arabidopsis thaliana [mouse-ear cress]
gb|EPS69429.1|  hypothetical protein M569_05334                         283   1e-89    
ref|XP_006280767.1|  hypothetical protein CARUB_v10026738mg             284   2e-89    
ref|XP_010252431.1|  PREDICTED: putative pectinesterase 63              285   2e-89    
ref|XP_008376964.1|  PREDICTED: probable pectinesterase 48              283   2e-89    
ref|XP_009363892.1|  PREDICTED: probable pectinesterase 48              284   2e-89    
emb|CDY02121.1|  BnaA03g40460D                                          279   6e-88    
ref|XP_004174171.1|  PREDICTED: probable pectinesterase 49-like         272   1e-85    
ref|XP_004289004.1|  PREDICTED: pectinesterase PPME1-like               275   2e-85    
ref|XP_004140271.1|  PREDICTED: pectinesterase PPME1-like               274   2e-85    
ref|XP_006381567.1|  hypothetical protein POPTR_0006s13930g             274   3e-85    
ref|XP_007204919.1|  hypothetical protein PRUPE_ppa020130mg             273   6e-85    
gb|KDP33954.1|  hypothetical protein JCGZ_07525                         273   7e-85    
ref|XP_002277518.1|  PREDICTED: putative pectinesterase 63 isofor...    273   1e-84    Vitis vinifera
emb|CBI27759.3|  unnamed protein product                                273   1e-84    
ref|XP_011039979.1|  PREDICTED: putative pectinesterase 63              273   1e-84    
ref|XP_010483849.1|  PREDICTED: putative pectinesterase 63              270   1e-84    
ref|XP_008242288.1|  PREDICTED: putative pectinesterase 63              272   2e-84    
ref|XP_010259713.1|  PREDICTED: pectinesterase PPME1-like               271   2e-84    
ref|XP_011016271.1|  PREDICTED: putative pectinesterase 63              272   2e-84    
ref|XP_007202075.1|  hypothetical protein PRUPE_ppa005976mg             274   3e-84    
gb|KHN15646.1|  Putative pectinesterase 63                              269   3e-84    
gb|KHN47850.1|  Putative pectinesterase 63                              269   4e-84    
ref|XP_009123158.1|  PREDICTED: probable pectinesterase 49              268   7e-84    
ref|XP_006474682.1|  PREDICTED: putative pectinesterase 63-like         268   4e-83    
ref|XP_010656088.1|  PREDICTED: putative pectinesterase 63 isofor...    269   4e-83    
ref|XP_010259712.1|  PREDICTED: pectinesterase PPME1-like               267   6e-83    
ref|XP_007219211.1|  hypothetical protein PRUPE_ppa017319mg             264   9e-83    
ref|XP_006452876.1|  hypothetical protein CICLE_v10010655mg             267   2e-82    
gb|KDO73799.1|  hypothetical protein CISIN_1g047018mg                   266   2e-82    
ref|XP_008391732.1|  PREDICTED: putative pectinesterase 63              265   8e-82    
ref|XP_009343360.1|  PREDICTED: putative pectinesterase 63              265   8e-82    
ref|XP_008450966.1|  PREDICTED: putative pectinesterase 63              265   1e-81    
ref|XP_009348900.1|  PREDICTED: putative pectinesterase 63 isofor...    263   6e-81    
ref|XP_004144054.1|  PREDICTED: probable pectinesterase 50-like         263   1e-80    
ref|XP_008344163.1|  PREDICTED: putative pectinesterase 63              259   5e-80    
ref|XP_002516214.1|  Pectinesterase-3 precursor, putative               255   8e-78    Ricinus communis
gb|KHG22980.1|  Pectinesterase PPME1 -like protein                      253   3e-77    
ref|XP_007154546.1|  hypothetical protein PHAVU_003G127700g             251   1e-76    
ref|XP_009402033.1|  PREDICTED: putative pectinesterase 63              251   5e-76    
ref|XP_009348902.1|  PREDICTED: putative pectinesterase 63 isofor...    248   1e-75    
ref|XP_010243601.1|  PREDICTED: pectinesterase PPME1-like               248   1e-75    
ref|NP_001234964.1|  uncharacterized protein LOC100306177 precursor     241   3e-74    
ref|XP_006843862.1|  hypothetical protein AMTR_s00007p00264370          244   9e-74    
ref|XP_007038215.1|  Pectin lyase-like superfamily protein, putat...    241   1e-73    
ref|XP_003541318.1|  PREDICTED: putative pectinesterase 63-like         242   5e-73    
ref|XP_007038216.1|  Pectin lyase-like superfamily protein, putat...    236   9e-72    
gb|KEH25488.1|  pectinesterase                                          237   3e-71    
ref|XP_007145123.1|  hypothetical protein PHAVU_007G212000g             236   1e-70    
gb|KHN07870.1|  Putative pectinesterase 63                              233   7e-70    
gb|KHG12918.1|  putative pectinesterase 53 -like protein                231   1e-68    
ref|XP_008338574.1|  PREDICTED: pectinesterase PPME1-like               226   2e-68    
ref|XP_003609956.1|  Pectinesterase                                     228   8e-68    
ref|XP_001769271.1|  predicted protein                                  226   1e-66    
ref|XP_009414379.1|  PREDICTED: probable pectinesterase 53 isofor...    225   4e-66    
ref|XP_009414378.1|  PREDICTED: probable pectinesterase 53 isofor...    224   1e-65    
ref|XP_007219703.1|  hypothetical protein PRUPE_ppa024066mg             221   2e-65    
ref|XP_003530551.1|  PREDICTED: probable pectinesterase 53-like i...    223   3e-65    
ref|XP_001769817.1|  predicted protein                                  221   6e-65    
ref|XP_003524409.1|  PREDICTED: probable pectinesterase 53-like         221   1e-64    
gb|ACU13228.1|  unknown                                                 216   1e-64    Glycine max [soybeans]
ref|XP_007051206.1|  Pectinesterase                                     220   3e-64    
ref|XP_010276487.1|  PREDICTED: probable pectinesterase 53 isofor...    219   6e-64    
gb|KDP28296.1|  hypothetical protein JCGZ_14067                         219   7e-64    
ref|XP_006349162.1|  PREDICTED: probable pectinesterase 53-like         219   1e-63    
ref|XP_010276488.1|  PREDICTED: probable pectinesterase 53 isofor...    218   2e-63    
emb|CBI27989.3|  unnamed protein product                                215   3e-63    
gb|ACU18534.1|  unknown                                                 211   5e-63    Glycine max [soybeans]
ref|XP_004503496.1|  PREDICTED: probable pectinesterase 53-like         216   8e-63    
emb|CAN63186.1|  hypothetical protein VITISV_037092                     216   1e-62    Vitis vinifera
ref|XP_010656255.1|  PREDICTED: probable pectinesterase 53              216   1e-62    
ref|XP_003630703.1|  Pectinesterase                                     216   1e-62    
ref|XP_003632380.2|  PREDICTED: probable pectinesterase 53              216   1e-62    
gb|KCW58194.1|  hypothetical protein EUGRSUZ_H00909                     216   2e-62    
ref|XP_004229371.1|  PREDICTED: probable pectinesterase 53              215   2e-62    
ref|XP_006371972.1|  hypothetical protein POPTR_0018s06820g             216   3e-62    
ref|XP_010069754.1|  PREDICTED: probable pectinesterase 53 isofor...    216   3e-62    
ref|XP_010679463.1|  PREDICTED: probable pectinesterase 53              214   4e-62    
ref|XP_002320279.2|  hypothetical protein POPTR_0014s11240g             214   4e-62    Populus trichocarpa [western balsam poplar]
ref|XP_004495886.1|  PREDICTED: probable pectinesterase 53-like         214   8e-62    
ref|XP_003591360.1|  Pectinesterase                                     213   9e-62    
gb|AFK35509.1|  unknown                                                 213   1e-61    
ref|XP_008801747.1|  PREDICTED: probable pectinesterase 53              213   1e-61    
ref|XP_009787978.1|  PREDICTED: probable pectinesterase 53 isofor...    213   2e-61    
gb|KEH27219.1|  pectinesterase                                          213   2e-61    
ref|XP_004969916.1|  PREDICTED: probable pectinesterase 53-like         213   2e-61    
ref|XP_010914653.1|  PREDICTED: probable pectinesterase 53              213   2e-61    
gb|AFK39158.1|  unknown                                                 213   2e-61    
ref|XP_010094410.1|  putative pectinesterase 53                         212   3e-61    
ref|XP_011040796.1|  PREDICTED: probable pectinesterase 53              213   3e-61    
ref|XP_007152966.1|  hypothetical protein PHAVU_004G175200g             212   4e-61    
emb|CDY68784.1|  BnaCnng60500D                                          209   5e-61    
ref|XP_011009863.1|  PREDICTED: probable pectinesterase 53              211   6e-61    
ref|XP_006353578.1|  PREDICTED: probable pectinesterase 53-like         211   8e-61    
ref|XP_004251642.1|  PREDICTED: probable pectinesterase 53              210   1e-60    
ref|XP_009399936.1|  PREDICTED: probable pectinesterase 68              209   1e-60    
ref|NP_001044216.1|  Os01g0743200                                       211   1e-60    Oryza sativa Japonica Group [Japonica rice]
emb|CDY48409.1|  BnaAnng09780D                                          208   2e-60    
ref|XP_007160279.1|  hypothetical protein PHAVU_002G308000g             210   2e-60    
ref|XP_008673062.1|  PREDICTED: pectinesterase isoform X1               210   2e-60    
ref|XP_006387630.1|  hypothetical protein POPTR_0746s00200g             207   2e-60    
ref|XP_006400534.1|  hypothetical protein EUTSA_v10013810mg             210   3e-60    
ref|XP_009397881.1|  PREDICTED: probable pectinesterase 68              209   3e-60    
ref|XP_010249481.1|  PREDICTED: probable pectinesterase 53              209   3e-60    
ref|XP_009591684.1|  PREDICTED: probable pectinesterase 53              209   3e-60    
ref|XP_010240218.1|  PREDICTED: probable pectinesterase 68              209   3e-60    
ref|XP_010069753.1|  PREDICTED: probable pectinesterase 53 isofor...    210   3e-60    
ref|XP_010688346.1|  PREDICTED: probable pectinesterase 53              210   4e-60    
ref|NP_197474.1|  probable pectinesterase 53                            209   4e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976450.1|  PREDICTED: probable pectinesterase 68-like         208   4e-60    
gb|KHG03314.1|  putative pectinesterase 8 -like protein                 208   4e-60    
ref|XP_009120862.1|  PREDICTED: probable pectinesterase 53              209   4e-60    
ref|XP_009406173.1|  PREDICTED: probable pectinesterase 53 isofor...    209   5e-60    
ref|XP_004961453.1|  PREDICTED: probable pectinesterase 53-like i...    209   5e-60    
emb|CDY31785.1|  BnaC01g27410D                                          205   6e-60    
gb|KHG28421.1|  putative pectinesterase 53 -like protein                209   7e-60    
ref|XP_003529058.2|  PREDICTED: probable pectinesterase 53-like         209   7e-60    
gb|KHN14256.1|  Putative pectinesterase 53                              208   8e-60    
ref|XP_006475590.1|  PREDICTED: probable pectinesterase 53-like i...    207   8e-60    
ref|XP_010454257.1|  PREDICTED: probable pectinesterase 53              209   8e-60    
ref|XP_011078244.1|  PREDICTED: probable pectinesterase 53              208   9e-60    
ref|XP_010493050.1|  PREDICTED: probable pectinesterase 53              208   9e-60    
ref|XP_008242479.1|  PREDICTED: probable pectinesterase 53              208   1e-59    
ref|XP_003567104.1|  PREDICTED: probable pectinesterase 53 isofor...    208   1e-59    
gb|EMT14071.1|  Putative pectinesterase 68                              207   1e-59    
ref|XP_007204399.1|  hypothetical protein PRUPE_ppa007112mg             208   1e-59    
ref|XP_008352338.1|  PREDICTED: probable pectinesterase 53              208   1e-59    
ref|XP_002871903.1|  pectinesterase family protein                      208   1e-59    
ref|XP_009126386.1|  PREDICTED: probable pectinesterase 53              208   1e-59    
ref|XP_006475589.1|  PREDICTED: probable pectinesterase 53-like i...    207   2e-59    
gb|KHN40374.1|  Putative pectinesterase 53                              206   2e-59    
ref|XP_010535938.1|  PREDICTED: probable pectinesterase 53              207   2e-59    
ref|XP_010420786.1|  PREDICTED: probable pectinesterase 53 isofor...    207   2e-59    
emb|CDY42290.1|  BnaC02g08960D                                          207   2e-59    
ref|XP_006287923.1|  hypothetical protein CARUB_v10001159mg             207   3e-59    
emb|CDP03246.1|  unnamed protein product                                206   3e-59    
gb|KDP42780.1|  hypothetical protein JCGZ_00479                         207   4e-59    
gb|EEC79546.1|  hypothetical protein OsI_20666                          207   4e-59    
ref|NP_001056077.1|  Os05g0521600                                       207   4e-59    
ref|XP_008337605.1|  PREDICTED: probable pectinesterase 53              206   4e-59    
gb|KDP33787.1|  hypothetical protein JCGZ_07358                         206   5e-59    
ref|XP_010110876.1|  putative pectinesterase 53                         206   5e-59    
ref|XP_004287482.1|  PREDICTED: probable pectinesterase 53-like         206   5e-59    
ref|XP_003516527.2|  PREDICTED: probable pectinesterase 53-like         206   6e-59    
ref|XP_009352561.1|  PREDICTED: probable pectinesterase 53              206   6e-59    
ref|XP_011093645.1|  PREDICTED: probable pectinesterase 53 isofor...    206   7e-59    
ref|XP_004513038.1|  PREDICTED: probable pectinesterase 53-like         206   8e-59    
gb|EYU27258.1|  hypothetical protein MIMGU_mgv1a025960mg                203   9e-59    
gb|KFK42874.1|  hypothetical protein AALP_AA1G050100                    205   1e-58    
ref|XP_008649911.1|  PREDICTED: probable pectinesterase 53              206   1e-58    
ref|XP_006853729.1|  hypothetical protein AMTR_s00056p00166920          205   1e-58    
ref|XP_002968924.1|  hypothetical protein SELMODRAFT_65663              202   1e-58    
emb|CDY44939.1|  BnaA02g04440D                                          207   2e-58    
ref|XP_008387348.1|  PREDICTED: probable pectinesterase 53              205   2e-58    
ref|XP_010683975.1|  PREDICTED: probable pectinesterase 15 isofor...    206   2e-58    
ref|XP_010915080.1|  PREDICTED: probable pectinesterase 53 isofor...    205   2e-58    
ref|XP_008657240.1|  PREDICTED: probable pectinesterase 53              205   2e-58    
ref|XP_010522833.1|  PREDICTED: probable pectinesterase 53              204   3e-58    
ref|XP_008669043.1|  PREDICTED: probable pectinesterase 68              203   3e-58    
emb|CAD41229.2|  OSJNBa0010H02.16                                       203   3e-58    
gb|EYU30697.1|  hypothetical protein MIMGU_mgv1a024695mg                203   3e-58    
gb|KDP46694.1|  hypothetical protein JCGZ_06482                         204   3e-58    
ref|XP_001752210.1|  predicted protein                                  204   4e-58    
ref|XP_007013011.1|  Pectin lyase-like superfamily protein isoform 1    204   4e-58    
ref|XP_001756557.1|  predicted protein                                  201   5e-58    
ref|XP_002514210.1|  Pectinesterase PPE8B precursor, putative           204   5e-58    
ref|XP_006646312.1|  PREDICTED: probable pectinesterase 53-like         203   5e-58    
ref|XP_006451320.1|  hypothetical protein CICLE_v10010616mg             203   6e-58    
ref|XP_001777108.1|  predicted protein                                  201   6e-58    
ref|XP_002458469.1|  hypothetical protein SORBIDRAFT_03g034250          204   6e-58    
ref|XP_002961718.1|  hypothetical protein SELMODRAFT_76693              202   7e-58    
ref|XP_010276489.1|  PREDICTED: probable pectinesterase 53 isofor...    202   7e-58    
ref|XP_010271483.1|  PREDICTED: probable pectinesterase 53              203   1e-57    
gb|KGN66185.1|  hypothetical protein Csa_1G575010                       203   1e-57    
ref|XP_004158420.1|  PREDICTED: probable pectinesterase 53-like         203   1e-57    
gb|KHN26987.1|  Putative pectinesterase 53                              202   1e-57    
ref|XP_008656475.1|  PREDICTED: probable pectinesterase 53 isofor...    203   1e-57    
ref|XP_007046753.1|  Pectin lyase-like superfamily protein isoform 1    202   1e-57    
ref|XP_002964788.1|  hypothetical protein SELMODRAFT_83442              201   1e-57    
ref|XP_003625222.1|  hypothetical protein MTR_7g092780                  203   1e-57    
ref|XP_011093643.1|  PREDICTED: probable pectinesterase 53 isofor...    202   2e-57    
ref|NP_001167796.1|  pectinesterase precursor                           203   2e-57    
ref|XP_004135808.1|  PREDICTED: probable pectinesterase 53-like         203   2e-57    
ref|XP_008804057.1|  PREDICTED: probable pectinesterase 53              202   2e-57    
ref|XP_002448293.1|  hypothetical protein SORBIDRAFT_06g024730          201   2e-57    
ref|XP_008450789.1|  PREDICTED: probable pectinesterase 53              202   2e-57    
ref|XP_004493561.1|  PREDICTED: probable pectinesterase 8-like          203   2e-57    
ref|XP_006444558.1|  hypothetical protein CICLE_v10024027mg             202   2e-57    
ref|XP_002440102.1|  hypothetical protein SORBIDRAFT_09g026060          203   2e-57    
ref|XP_003566023.2|  PREDICTED: probable pectinesterase 53              201   2e-57    
gb|KHG26932.1|  putative pectinesterase 53 -like protein                201   3e-57    
ref|XP_004964049.1|  PREDICTED: probable pectinesterase 53-like         203   3e-57    
ref|XP_010267113.1|  PREDICTED: probable pectinesterase 53              201   3e-57    
ref|XP_007013013.1|  Pectin lyase-like superfamily protein isoform 3    201   4e-57    
gb|KEH21331.1|  pectinesterase                                          200   4e-57    
ref|XP_009119166.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    202   4e-57    
ref|XP_003579301.1|  PREDICTED: putative pectinesterase 63              202   4e-57    
ref|XP_010915072.1|  PREDICTED: probable pectinesterase 53 isofor...    201   4e-57    
ref|XP_002531506.1|  Pectinesterase-2 precursor, putative               200   7e-57    
ref|XP_008461405.1|  PREDICTED: probable pectinesterase 53              201   8e-57    
ref|XP_010534682.1|  PREDICTED: probable pectinesterase 15              199   8e-57    
ref|NP_001067039.1|  Os12g0563700                                       201   8e-57    
ref|XP_002974192.1|  hypothetical protein SELMODRAFT_101090             198   1e-56    
ref|XP_010049610.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    199   2e-56    
ref|XP_006418040.1|  hypothetical protein EUTSA_v10009800mg             200   2e-56    
ref|XP_011076540.1|  PREDICTED: pectinesterase 2-like                   194   2e-56    
ref|XP_004169876.1|  PREDICTED: probable pectinesterase 53-like         199   2e-56    
ref|XP_006653657.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    198   3e-56    
ref|XP_001777828.1|  predicted protein                                  197   3e-56    
ref|XP_006492456.1|  PREDICTED: probable pectinesterase 53-like         199   3e-56    
ref|XP_004136146.1|  PREDICTED: probable pectinesterase 53-like         199   3e-56    
ref|XP_010935867.1|  PREDICTED: putative pectinesterase 14              200   5e-56    
ref|XP_002521065.1|  Pectinesterase-1 precursor, putative               199   6e-56    
ref|XP_007215489.1|  hypothetical protein PRUPE_ppa006779mg             199   6e-56    
ref|XP_009402793.1|  PREDICTED: probable pectinesterase 53              198   6e-56    
ref|XP_007162301.1|  hypothetical protein PHAVU_001G140600g             199   6e-56    
ref|XP_009802490.1|  PREDICTED: probable pectinesterase 53              198   6e-56    
ref|XP_010037120.1|  PREDICTED: probable pectinesterase 15              199   7e-56    
ref|XP_002310842.1|  hypothetical protein POPTR_0007s13780g             197   7e-56    
ref|XP_002975044.1|  hypothetical protein SELMODRAFT_102829             196   7e-56    
ref|XP_010098841.1|  putative pectinesterase 15                         199   7e-56    
gb|EEC69509.1|  hypothetical protein OsI_38743                          199   7e-56    
ref|XP_008656474.1|  PREDICTED: probable pectinesterase 53 isofor...    198   7e-56    
gb|EYU27262.1|  hypothetical protein MIMGU_mgv1a011822mg                195   8e-56    
gb|KHN26371.1|  Putative pectinesterase 8                               198   8e-56    
ref|XP_006380792.1|  hypothetical protein POPTR_0007s13780g             197   8e-56    
ref|XP_003553427.1|  PREDICTED: probable pectinesterase 8-like          198   8e-56    
ref|XP_010919565.1|  PREDICTED: probable pectinesterase 68              196   1e-55    
ref|XP_008229648.1|  PREDICTED: probable pectinesterase 8               198   1e-55    
ref|XP_006357894.1|  PREDICTED: probable pectinesterase 8-like          197   1e-55    
ref|XP_009118594.1|  PREDICTED: probable pectinesterase 8               198   1e-55    
gb|EYU27253.1|  hypothetical protein MIMGU_mgv1a022744mg                195   2e-55    
ref|XP_002962216.1|  hypothetical protein SELMODRAFT_76951              196   2e-55    
ref|XP_006654665.1|  PREDICTED: probable pectinesterase 53-like         197   3e-55    
ref|XP_010543016.1|  PREDICTED: probable pectinesterase 8               197   3e-55    
ref|NP_172023.1|  putative pectinesterase 8                             197   3e-55    
ref|XP_008451885.1|  PREDICTED: probable pectinesterase 8               197   3e-55    
gb|EYU46841.1|  hypothetical protein MIMGU_mgv1a019910mg                196   3e-55    
ref|XP_004972590.1|  PREDICTED: probable pectinesterase 8-like          196   4e-55    
ref|XP_009610336.1|  PREDICTED: probable pectinesterase 8 isoform X1    196   5e-55    
ref|XP_010316821.1|  PREDICTED: probable pectinesterase 53              195   5e-55    
ref|XP_002892282.1|  predicted protein                                  196   5e-55    
ref|XP_006429777.1|  hypothetical protein CICLE_v10011953mg             196   5e-55    
ref|XP_010093131.1|  putative pectinesterase 8                          196   5e-55    
ref|XP_001763134.1|  predicted protein                                  193   6e-55    
ref|XP_009386766.1|  PREDICTED: putative pectinesterase 14              197   6e-55    
ref|XP_006425546.1|  hypothetical protein CICLE_v10027321mg             195   7e-55    
gb|AFW82525.1|  hypothetical protein ZEAMMB73_386621                    196   8e-55    
ref|XP_011025911.1|  PREDICTED: probable pectinesterase 53              195   8e-55    
ref|XP_003631899.2|  PREDICTED: probable pectinesterase 53              195   9e-55    
emb|CDX77772.1|  BnaC07g20260D                                          194   1e-54    
ref|XP_001775877.1|  predicted protein                                  192   1e-54    
dbj|BAD87905.1|  pectinesterase-like                                    194   1e-54    
gb|ABD64977.1|  pectinesterase family protein                           194   1e-54    
ref|NP_181208.1|  putative pectinesterase 14                            193   1e-54    
ref|XP_006481444.1|  PREDICTED: probable pectinesterase 8-like          195   1e-54    
ref|XP_008787556.1|  PREDICTED: putative pectinesterase 14              196   1e-54    
ref|XP_004172449.1|  PREDICTED: probable pectinesterase 53-like         194   1e-54    
ref|XP_010262227.1|  PREDICTED: putative pectinesterase 63              194   2e-54    
ref|XP_002323171.2|  hypothetical protein POPTR_0016s01920g             194   2e-54    
ref|XP_006381362.1|  hypothetical protein POPTR_0006s12170g             195   2e-54    
ref|XP_008653773.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    196   2e-54    
gb|EYU33537.1|  hypothetical protein MIMGU_mgv1a008469mg                194   2e-54    
ref|XP_009406172.1|  PREDICTED: probable pectinesterase 53 isofor...    195   2e-54    
ref|XP_002965130.1|  hypothetical protein SELMODRAFT_83276              194   2e-54    
ref|XP_009803530.1|  PREDICTED: probable pectinesterase 8 isoform X1    194   2e-54    
ref|XP_006340937.1|  PREDICTED: probable pectinesterase 53-like         193   2e-54    
ref|XP_004146488.1|  PREDICTED: probable pectinesterase 53-like         194   2e-54    
gb|ABR18283.1|  unknown                                                 193   2e-54    
ref|XP_006401814.1|  hypothetical protein EUTSA_v10015978mg             194   3e-54    
ref|XP_008660472.1|  PREDICTED: putative pectinesterase 63              194   3e-54    
ref|XP_009599854.1|  PREDICTED: probable pectinesterase 53              194   3e-54    
ref|XP_008786957.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    193   3e-54    
ref|XP_008465244.1|  PREDICTED: probable pectinesterase 53              194   3e-54    
ref|XP_010260644.1|  PREDICTED: probable pectinesterase 8               194   3e-54    
ref|XP_008653334.1|  PREDICTED: pectinesterase QRT1 isoform X1          193   3e-54    
ref|XP_006477195.1|  PREDICTED: probable pectinesterase 68-like         193   3e-54    
ref|XP_004961452.1|  PREDICTED: probable pectinesterase 53-like i...    195   3e-54    
ref|XP_009101416.1|  PREDICTED: probable pectinesterase 68              193   3e-54    
ref|XP_009406174.1|  PREDICTED: probable pectinesterase 53 isofor...    192   3e-54    
gb|KFK36544.1|  hypothetical protein AALP_AA4G137600                    192   3e-54    
ref|XP_011018831.1|  PREDICTED: probable pectinesterase 15 isofor...    194   3e-54    
ref|XP_009772188.1|  PREDICTED: probable pectinesterase 8               193   4e-54    
gb|KDO61446.1|  hypothetical protein CISIN_1g018249mg                   193   4e-54    
ref|NP_199561.1|  pectin methylesterase 5                               193   4e-54    
ref|XP_004168775.1|  PREDICTED: probable pectinesterase 8-like          194   4e-54    
ref|XP_006440314.1|  hypothetical protein CICLE_v10020787mg             192   5e-54    
ref|XP_010475224.1|  PREDICTED: probable pectinesterase 8               194   5e-54    
ref|XP_002445213.1|  hypothetical protein SORBIDRAFT_07g006050          194   5e-54    
ref|XP_004147773.1|  PREDICTED: probable pectinesterase 8-like          193   5e-54    
emb|CDY59290.1|  BnaA06g39970D                                          192   6e-54    
gb|KCW58195.1|  hypothetical protein EUGRSUZ_H00909                     192   6e-54    
ref|XP_002459865.1|  hypothetical protein SORBIDRAFT_02g012560          194   6e-54    
ref|XP_010457617.1|  PREDICTED: probable pectinesterase 8               193   7e-54    
ref|XP_007162815.1|  hypothetical protein PHAVU_001G183100g             194   8e-54    
ref|XP_010686768.1|  PREDICTED: probable pectinesterase 8               194   8e-54    
ref|XP_006280682.1|  hypothetical protein CARUB_v10026646mg             192   9e-54    
ref|XP_001764345.1|  predicted protein                                  191   1e-53    
ref|XP_010025544.1|  PREDICTED: probable pectinesterase 8               193   1e-53    
ref|XP_010481313.1|  PREDICTED: probable pectinesterase 68              192   1e-53    
ref|XP_009612401.1|  PREDICTED: probable pectinesterase 8               192   2e-53    
ref|XP_009349568.1|  PREDICTED: probable pectinesterase 8               192   2e-53    
ref|XP_002863340.1|  pectinesterase family protein                      191   2e-53    
ref|XP_004243648.1|  PREDICTED: probable pectinesterase 8               192   2e-53    
ref|XP_006398447.1|  hypothetical protein EUTSA_v10000935mg             191   2e-53    
ref|XP_009787979.1|  PREDICTED: probable pectinesterase 53 isofor...    191   2e-53    
ref|XP_011001039.1|  PREDICTED: probable pectinesterase 8               192   3e-53    
ref|XP_003538735.1|  PREDICTED: probable pectinesterase 68-like         190   4e-53    
ref|XP_001774315.1|  predicted protein                                  188   4e-53    
ref|XP_010915098.1|  PREDICTED: probable pectinesterase 53 isofor...    190   4e-53    
ref|XP_003553567.1|  PREDICTED: probable pectinesterase 15-like         192   4e-53    
ref|XP_007049055.1|  Pectinesterase                                     191   4e-53    
ref|XP_010232305.1|  PREDICTED: probable pectinesterase 53 isofor...    191   4e-53    
gb|KHG28220.1|  putative pectinesterase 53 -like protein                190   5e-53    
ref|XP_006279166.1|  hypothetical protein CARUB_v10007965mg             189   5e-53    
ref|XP_011014966.1|  PREDICTED: probable pectinesterase 8               191   5e-53    
ref|XP_003559976.2|  PREDICTED: pectinesterase QRT1-like                191   5e-53    
gb|KHG12413.1|  putative pectinesterase 15 -like protein                191   5e-53    
gb|ABG46325.1|  putative pectin methylesterase                          190   5e-53    
gb|ABD65006.1|  pectinesterase family protein                           189   5e-53    
ref|XP_001760885.1|  predicted protein                                  187   5e-53    
ref|XP_003611307.1|  Pectinesterase                                     190   5e-53    
ref|XP_010484902.1|  PREDICTED: probable pectinesterase 8               191   5e-53    
ref|XP_003571529.1|  PREDICTED: probable pectinesterase 8               191   5e-53    
ref|XP_011070218.1|  PREDICTED: probable pectinesterase 68              189   6e-53    
ref|XP_010546523.1|  PREDICTED: probable pectinesterase 15 isofor...    191   6e-53    
ref|XP_002303355.2|  hypothetical protein POPTR_0003s07460g             190   6e-53    
gb|KHN42698.1|  Putative pectinesterase 68                              190   6e-53    
ref|XP_002965129.1|  hypothetical protein SELMODRAFT_167160             189   7e-53    
ref|XP_009128974.1|  PREDICTED: probable pectinesterase 68 isofor...    190   7e-53    
ref|XP_002962215.1|  hypothetical protein SELMODRAFT_165098             189   7e-53    
gb|KCW71970.1|  hypothetical protein EUGRSUZ_E00425                     190   7e-53    
ref|XP_009143563.1|  PREDICTED: probable pectinesterase 15              191   7e-53    
emb|CDY69057.1|  BnaCnng61650D                                          189   7e-53    
ref|XP_010679844.1|  PREDICTED: probable pectinesterase 53              190   7e-53    
ref|XP_008662740.1|  PREDICTED: probable pectinesterase 8               191   7e-53    
ref|XP_010264302.1|  PREDICTED: probable pectinesterase 68              189   8e-53    
ref|XP_006659931.1|  PREDICTED: probable pectinesterase 8-like          190   9e-53    
ref|XP_003517421.1|  PREDICTED: probable pectinesterase 68              189   9e-53    
ref|XP_007013012.1|  Pectin lyase-like superfamily protein isoform 2    188   9e-53    
emb|CBI31927.3|  unnamed protein product                                189   9e-53    
ref|XP_008378333.1|  PREDICTED: probable pectinesterase 8               190   1e-52    
gb|AAB71446.1|  Similar to Prunus pectinesterase (gb|X95991)            190   1e-52    
ref|XP_006285001.1|  hypothetical protein CARUB_v10006308mg             188   1e-52    
ref|XP_011031878.1|  PREDICTED: probable pectinesterase 68              189   1e-52    
gb|KFK31368.1|  hypothetical protein AALP_AA6G103300                    189   1e-52    



>gb|AHL24653.1| Fra e 11.01 allergen [Fraxinus excelsior]
Length=368

 Score =   368 bits (944),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 181/331 (55%), Positives = 232/331 (70%), Gaps = 7/331 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             L  VIV + + C   V   D VPIPA+ +Q+ SWF   V+PL + +  +DPALV AE+ P
Sbjct  11    LETVIVSI-ILCMPIVFSDDRVPIPADSAQINSWFDGIVRPLSARKATLDPALVTAESEP  69

Query  263   --VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DP  433
               + LK    G FKTI +A+KTIP  NTKR I+ +A G Y E+VKI   +PF+T YG DP
Sbjct  70    KVIKLKSDGSGDFKTINDAIKTIPDGNTKRVILSLAPGNYKEKVKIGMYKPFITFYGEDP  129

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITG  610
              N P LV   TA +  T+ SATL V SDYF+AVN+ + NSAPRP GKR+  QA AL I G
Sbjct  130   NNMPVLVFGGTAKEYDTVESATLIVESDYFNAVNLKIVNSAPRPDGKREGAQAAALRIGG  189

Query  611   DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
             DK+SFYN K YG+QDTLCD   +HFYKDCY+EGTVDF+FG+ KS++LNT+L VIPGDQ+A
Sbjct  190   DKSSFYNVKLYGYQDTLCDDRGKHFYKDCYIEGTVDFIFGSGKSLYLNTELHVIPGDQLA  249

Query  791   MVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             M++A  R ++ EDTG+SFVHC+VTG   VA LGR W P +K +FAYT + +AI P+GW  
Sbjct  250   MITAQARKTDSEDTGYSFVHCKVTGTGGVAYLGRSWMPAAKVVFAYTEMSDAINPKGWSI  309

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             ++  P++  T  F EY+N GPGA +D R KF
Sbjct  310   VK--PEHESTVRFAEYDNKGPGANVDKRAKF  338



>ref|XP_006365350.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=367

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/334 (52%), Positives = 232/334 (69%), Gaps = 5/334 (1%)
 Frame = +2

Query  71    TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
             T+  L  +++ +L+F P  V   DT+PIPA+KSQ+ SWF A+V+PL + +  +DPALV A
Sbjct  6     TIFALETIVLTILLFIPR-VFSDDTIPIPADKSQLNSWFEANVKPLDARKDTLDPALVAA  64

Query  251   EAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
             EA    +KV     G FKT+ EAVK+IP  N +R II+I GG Y E+VKI+ ++PFVTLY
Sbjct  65    EANKTIIKVRTDGSGDFKTLTEAVKSIPEGNKRRVIIWIGGGNYTEKVKIERNKPFVTLY  124

Query  425   GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALT  601
             GDPKN P ++   TA Q   + SAT+ V S+YFSAVNI+  N+APRP GK +  QA AL 
Sbjct  125   GDPKNVPNIIFHGTAKQYTIVESATVIVESEYFSAVNINFVNTAPRPDGKMELAQAAALR  184

Query  602   ITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGD  781
               GDKAS YNCK +GFQDT CD + +HF+KDCY+EGTVDF+FGN KSI+LNT+  VIPGD
Sbjct  185   TGGDKASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSIYLNTEAHVIPGD  244

Query  782   QMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEG  961
              MAMV+AH R++E  D+G+SFVHC +TG    A LGR W P+ K +F Y+ + + + PEG
Sbjct  245   PMAMVTAHARDAENVDSGYSFVHCTITGTGNTAYLGRAWKPFGKVVFLYSDMTDVVHPEG  304

Query  962   WMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             W      P+N  + ++GEYN  G GA ++ R  F
Sbjct  305   WSD-NGKPENDKSVFYGEYNCKGAGAALEKRVGF  337



>ref|XP_009789874.1| PREDICTED: pectinesterase 1-like [Nicotiana sylvestris]
Length=367

 Score =   362 bits (928),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/336 (52%), Positives = 234/336 (70%), Gaps = 15/336 (4%)
 Frame = +2

Query  71    TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
             T+  +  +++ +L+F P  V   D+VPIPA+KSQ++SWF  +V+PL + +  +DPALV A
Sbjct  6     TIFAVEAIVITILLFIPR-VFSDDSVPIPADKSQIKSWFETNVKPLDARKDTLDPALVAA  64

Query  251   EAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
             EA    +KV     G+FKT+ +A+ +IP  N +R II I GG Y E+VKID  +PF+TLY
Sbjct  65    EANKTIIKVRADGSGEFKTLTDAINSIPQGNKRRVIISIGGGNYTEKVKIDRYKPFITLY  124

Query  425   GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALT  601
             GDPKN P ++   TA   GT+ SAT+ V S+YFSAVNI+  NSAPRP GKR+  QA AL 
Sbjct  125   GDPKNVPNIIFNGTAKDYGTVDSATVVVESEYFSAVNINFVNSAPRPDGKRELAQAAALR  184

Query  602   ITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGD  781
               GDKAS YNCK YGFQDT CD + +HF+KDCY+EGTVDF+FGN KS++LNT++ VIPGD
Sbjct  185   TGGDKASLYNCKMYGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTEMHVIPGD  244

Query  782   QMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEG  961
              MAM++AH R +   D+G+SFVHC +TG  K A+LGR W P++K +++YT + + + PEG
Sbjct  245   PMAMITAHARGAGNVDSGYSFVHCMITGTGKTALLGRAWKPFAKVVYSYTDMSDVVHPEG  304

Query  962   WMGMRTNPKNGGTCY-----FGEYNNTGPGAKMDGR  1054
             W        NG + Y     +GEYN  G GA MDGR
Sbjct  305   W------SDNGKSDYDRSVFYGEYNCKGAGATMDGR  334



>ref|XP_006365351.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=368

 Score =   356 bits (914),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 226/334 (68%), Gaps = 4/334 (1%)
 Frame = +2

Query  71    TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
             T+ ++  +I+  L F   GV   D VPIPA+KSQ+ SWF A+V+PL + +  +DPALV A
Sbjct  6     TIFVVETIIITFLFFNIIGVFSDDLVPIPADKSQLNSWFEANVKPLDARKDTLDPALVAA  65

Query  251   EAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
             EA    +KV     G FKTI EAVK+IP  N +R II+I GG Y E++KI+  +PFVT Y
Sbjct  66    EANKTIIKVRTDGSGDFKTITEAVKSIPEGNKRRVIIWIGGGNYTEKIKIERTKPFVTFY  125

Query  425   GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQ-QAVALT  601
             GD KN P ++   TA +  T+ SAT+ V S+YF+AVNI+  N+APRP GK D+ QA AL 
Sbjct  126   GDSKNVPNIIFHGTAKEYTTVDSATVIVESEYFNAVNINFVNTAPRPDGKSDKAQAAALR  185

Query  602   ITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGD  781
               GDKAS YNCK +GFQDT CD + +HF+KDCY+EGTVDF+FGN KS++LNT+  VIPGD
Sbjct  186   TGGDKASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTETHVIPGD  245

Query  782   QMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEG  961
              MAMV+AH R +E  D+GFSFVHC +TG    A LGR W  YSK +F+YT + + I PEG
Sbjct  246   PMAMVTAHARAAENFDSGFSFVHCMITGTGNTAYLGRAWKQYSKVVFSYTDMTDVIHPEG  305

Query  962   WMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             W        +  T Y+GEY   G GA +D R  F
Sbjct  306   WSNFGKKEFD-STVYYGEYKCKGAGATLDKRVPF  338



>ref|XP_004239982.1| PREDICTED: pectinesterase 1-like [Solanum lycopersicum]
Length=368

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/334 (53%), Positives = 225/334 (67%), Gaps = 4/334 (1%)
 Frame = +2

Query  71    TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
             T+ ++  +I+  L+     V   D VPIPA+KSQ+ SWF A+V+PL + +  +DPALV A
Sbjct  6     TIFVVETIIITFLLLNIIEVFSDDLVPIPADKSQLNSWFEANVKPLDARKDTLDPALVAA  65

Query  251   EAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
             EA    +KV     G FKTI EAVK+IP  N KR II+I  G Y E++KI+  +PFVTLY
Sbjct  66    EANKTIIKVRTYGSGDFKTITEAVKSIPEGNKKRVIIWIGSGNYTEKIKIERTKPFVTLY  125

Query  425   GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQ-QAVALT  601
             GDPKN P ++   TA +  T+ SAT+ V S+YFSAVNI+  N+APRP GK D+ QA AL 
Sbjct  126   GDPKNVPNIIFHGTAQEYTTVDSATVIVESEYFSAVNINFVNTAPRPDGKSDKAQAAALR  185

Query  602   ITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGD  781
               GDKAS YNCK +GFQDT CD + +HF+KDCY+EGTVDF+FGN KS++LNT+  VIPGD
Sbjct  186   TGGDKASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTETHVIPGD  245

Query  782   QMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEG  961
              MAMV+A  R  E  D+GFSFVHC +TG    A LGR W  YSK +F+YT + + I PEG
Sbjct  246   PMAMVTAQARAVENFDSGFSFVHCMITGTGNTAYLGRAWKQYSKVVFSYTDMTDVIHPEG  305

Query  962   WMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             W       + G T Y+GEY   G GA +D R  F
Sbjct  306   WSDFG-KKEFGSTVYYGEYKCKGAGATLDKRVPF  338



>emb|CDP13860.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/328 (52%), Positives = 230/328 (70%), Gaps = 5/328 (2%)
 Frame = +2

Query  65    METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
             M  + L   ++   L+F P  V+  +TVP PA+K+Q+ SWF  +VQPL S +  +DPALV
Sbjct  1     MGDMALNKAILFSTLLFIPL-VLSDNTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALV  59

Query  245   KAEAAP--VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
              AEA P  + LK    G+FKTI +A+ +IP  NT R II +  G Y E++KI+ ++PF+T
Sbjct  60    AAEANPRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFIT  119

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVA  595
             + GDP + PTLV   TAA+ GT+ SATL V SDYF+A N+ + NSAPRP G  +  QA+A
Sbjct  120   IIGDPNHMPTLVFGGTAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALA  179

Query  596   LTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIP  775
             + I GDKASFYNCKF GFQDTLCD   +H +KDCY+EGTVDF+FGN KSI+LN +L VIP
Sbjct  180   VRIGGDKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIP  239

Query  776   GDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKP  955
             GD+ A ++A  R+++ EDTG+SFVHC+VTG  + A LGR W PY K +FAYT + +A+ P
Sbjct  240   GDRQAWITAQARHTDAEDTGYSFVHCKVTGTGRTAYLGRTWMPYGKVVFAYTDMSDAVIP  299

Query  956   EGWMGMRTNPKNGGTCYFGEYNNTGPGA  1039
              GW     +P+   T  FGE+++TGPG+
Sbjct  300   AGWSN-NFHPETEKTVLFGEFSSTGPGS  326



>ref|XP_004239981.2| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 1-like, partial 
[Solanum lycopersicum]
Length=358

 Score =   350 bits (897),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 223/324 (69%), Gaps = 5/324 (2%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             + + +L+F P  V   D VPIPA+KSQ+ S F A+V+PL + +  +DPALV AEA    +
Sbjct  4     IFLIILLFIPR-VFSDDLVPIPADKSQLNSGFEANVKPLDARKDTLDPALVAAEANKTII  62

Query  272   KV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV     G FKT+ EAVK+IP  N +R II+I GG Y E+VKI+ ++PFVTLYGDPKN P
Sbjct  63    KVRTDGSGDFKTLTEAVKSIPEDNKRRVIIWIGGGNYTEKVKIERNKPFVTLYGDPKNVP  122

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKAS  622
              ++ + TA Q   + S T+ V S+YFSAVNI+  N+APRP GK +  QA AL   GDKAS
Sbjct  123   NIIFSGTAKQYTIVESGTVIVESEYFSAVNINFVNTAPRPDGKMELAQAAALRTAGDKAS  182

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
              YNCK +GFQDT CD   +HF+KDCY+EGTVDF+FGN KSI+LNT+  VIPGD MAMV+A
Sbjct  183   LYNCKMFGFQDTFCDDKGKHFFKDCYIEGTVDFIFGNGKSIYLNTEAHVIPGDPMAMVTA  242

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
             H R+ E  D+G+SFVHC +TG    A LGR W P+SK +F+YT + + + PEGW      
Sbjct  243   HARDGENVDSGYSFVHCTITGTGNTAYLGRAWKPFSKVVFSYTDMTDVVHPEGWSD-NGK  301

Query  983   PKNGGTCYFGEYNNTGPGAKMDGR  1054
             P+N  + ++GEYN  G GA    R
Sbjct  302   PENDKSVFYGEYNCKGAGAASGKR  325



>sp|B2VPR8.1|AL11B_OLEEU RecName: Full=Pectinesterase 2; AltName: Full=Pollen allergen 
Ole e 11.0102; Short=Ole e 11-2; AltName: Allergen=Ole e 11.0102; 
Flags: Precursor [Olea europaea]
 gb|AAY88919.1| Ole e 11.0102 allergen precursor [Olea europaea]
Length=364

 Score =   350 bits (897),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 177/331 (53%), Positives = 230/331 (69%), Gaps = 9/331 (3%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE--A  256
             +  V++ +L++ P  V+  D  PIPA  +Q+ SWF   +QP+   +  +DPALV AE  A
Sbjct  6     VEAVLLGILLYIPI-VLSDDRAPIPANSAQLNSWFDGIIQPVAVRKATMDPALVTAEGQA  64

Query  257   APVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DP  433
               + LK    G FK+I EA+K+IP  NTKR I+  + G Y+E+VKI   + ++T YG DP
Sbjct  65    KVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSFSPGNYSEKVKIGMYKHYITFYGEDP  124

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITG  610
              N P LV   TAA+ GT+ SATL V S+YFSAVN+ + NSAPRP GKR   QA AL I+G
Sbjct  125   NNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISG  184

Query  611   DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
             DKASFYN K YGFQDTLCD   +HFYKDCY+EGTVDF+FG+ KSIFLNT+L  +PGDQ A
Sbjct  185   DKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPGDQPA  244

Query  791   MVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             +++A  R +E EDTG+ FV+C+VTG    A LGR W P +K +FAYT +G+AI PEGW+ 
Sbjct  245   IITAQARKTESEDTGYYFVNCRVTGGG--AFLGRSWMPAAKVVFAYTEMGDAIHPEGWIL  302

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             ++  P++  T  F EYNN GPGA M+ R KF
Sbjct  303   VK--PEHESTVRFPEYNNKGPGANMEKRAKF  331



>ref|XP_009626579.1| PREDICTED: pectinesterase 1-like [Nicotiana tomentosiformis]
Length=367

 Score =   349 bits (895),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/336 (50%), Positives = 230/336 (68%), Gaps = 15/336 (4%)
 Frame = +2

Query  71    TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
             T+  +  +++ +++F P  V   D+VPIPA+KSQ+ SWF  +V+PL + +  +DPALV A
Sbjct  6     TIFAVEAIVITIVLFIPR-VFSDDSVPIPADKSQINSWFETNVKPLDARKDTLDPALVAA  64

Query  251   EAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
             EA    +KV     G+FKT+ +A+ +IP  N +R II I GG Y E+VKI+  +PF+TLY
Sbjct  65    EANKTTIKVRADGSGEFKTLTDAINSIPQGNKRRVIISIGGGNYTEKVKIERYKPFITLY  124

Query  425   GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALT  601
             GDPKN P ++   TA   GT+ SAT+ V S+YF+AVNI+  NSAPRP GKR+  QA AL 
Sbjct  125   GDPKNVPNIIFNGTAKDYGTVDSATVVVESEYFTAVNINFVNSAPRPDGKRELAQAAALR  184

Query  602   ITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGD  781
               GDKAS YNCK YGFQDT CD + +HF+KDCY+EGTVDF+FGN KS++LNT++ VIPGD
Sbjct  185   TGGDKASLYNCKMYGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTEMHVIPGD  244

Query  782   QMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEG  961
              MAM++AH R +   D+G+SFVHC +TG    A LGR W P++K +++YT + + + PEG
Sbjct  245   PMAMITAHARGAGNVDSGYSFVHCMITGTGNTAFLGRAWKPFAKVVYSYTDMSDVVHPEG  304

Query  962   WMGMRTNPKNGGTCY-----FGEYNNTGPGAKMDGR  1054
             W        NG + Y     +GEYN  G GA M+ R
Sbjct  305   W------SDNGKSDYDRSVFYGEYNCKGAGATMERR  334



>sp|D8VPP5.1|AL11A_OLEEU RecName: Full=Pectinesterase 1; AltName: Full=Pollen allergen 
Ole e 11.0101; Short=Ole e 11-1; AltName: Allergen=Ole e 11.0101; 
Flags: Precursor [Olea europaea]
 gb|ACZ57582.1| Ole e 11.0101 allergen precursor [Olea europaea]
Length=364

 Score =   346 bits (888),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/331 (53%), Positives = 229/331 (69%), Gaps = 9/331 (3%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +  V++ +L++ P  V+  D  PIP+  +Q+ SWF   +QP+   +  +DPALV AE   
Sbjct  6     VEAVLLGILLYIPI-VLSDDRAPIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTAEGQT  64

Query  263   --VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DP  433
               + LK    G FK+I EA+K+IP  NTKR I+ +A G Y+E+VKI   + ++T YG DP
Sbjct  65    KVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFYGEDP  124

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITG  610
              N P LV   TAA+ GT+ SATL V S+YFSAVN+ + NSAPRP GKR   QA AL I+G
Sbjct  125   NNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISG  184

Query  611   DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
             DKASFYN K YGFQDTLCD   +HFYKDCY+EGTVDF+FG+ KSIFLNT+L  +PGDQ A
Sbjct  185   DKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPGDQPA  244

Query  791   MVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             +++A  R ++ EDTG+ FV+C+VTG    A LGR W P +K +FAYT + +AI PEGW+ 
Sbjct  245   IITAQARKTDSEDTGYYFVNCRVTGGG--AFLGRSWMPAAKVVFAYTEMVDAIHPEGWIL  302

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             ++  P++  T  F EYNN GPGA M+ R KF
Sbjct  303   VK--PEHESTVRFSEYNNKGPGANMEKRAKF  331



>emb|CDP19851.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   341 bits (875),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 162/298 (54%), Positives = 214/298 (72%), Gaps = 4/298 (1%)
 Frame = +2

Query  80   LLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
            L   ++   L+F P  V+  DTVP PA+K+Q+ SWF  +VQPL S +  +DPALV AEA 
Sbjct  3    LNKAILFSTLLFIPL-VLSDDTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALVAAEAN  61

Query  260  P--VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
            P  + LK    G+FKTI +A+ +IP  NT R II +  G Y E++KI+ ++PF+T+ GDP
Sbjct  62   PRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFITIIGDP  121

Query  434  KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITG  610
             + PTLV   TAA+ GT+ SATL V SDYF+A N+ + NSAPRP G  +  QA+A+ I G
Sbjct  122  NHMPTLVFGGTAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALAVRIGG  181

Query  611  DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
            DKASFYNCKF GFQDTLCD   +H +KDCY+EGTVDF+FGN KSI+LN +L VIPGD+ A
Sbjct  182  DKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIPGDRQA  241

Query  791  MVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW  964
             ++A  R+++ EDTG+SFVHC+VTG  + A LGR W PY K +FAYT + +A+ P+GW
Sbjct  242  WITAQARHTDAEDTGYSFVHCKVTGTGRTAYLGRTWMPYGKVVFAYTDMSDAVIPDGW  299



>ref|XP_010087095.1| Pectinesterase PPME1 [Morus notabilis]
 gb|EXB26150.1| Pectinesterase PPME1 [Morus notabilis]
Length=368

 Score =   338 bits (868),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 173/330 (52%), Positives = 225/330 (68%), Gaps = 8/330 (2%)
 Frame = +2

Query  89    VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPV-  265
             V++V  L+     V   D V IP +K Q+ SWF  +V+PL S  KG+DPALV AE  P  
Sbjct  10    VLLVVALIATNNIVNADDNVQIPYQKGQLNSWFNGNVRPL-SASKGLDPALVAAETGPAK  68

Query  266   YLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              +KV K   G FKT+QEA+ ++P+ N+KR II++ GG+Y+E+V ID  +PF+TLYG P N
Sbjct  69    VVKVAKDGSGDFKTVQEAINSVPSGNSKRVIIYVGGGEYHEKVTIDRSKPFITLYGSPTN  128

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTG-KRDQQAVALTITGDK  616
              PT+  A TAAQ GT+ SATL V SDYF  VN+ ++NSAPRP G ++  QAVAL  +G+K
Sbjct  129   MPTISYAGTAAQYGTVDSATLIVGSDYFVGVNLIIKNSAPRPDGIRKGAQAVALRASGNK  188

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM-AM  793
             A+FY CK  GFQDTLCD    H +KDCY+EGTVDF+FG+  S++LNT+L VI    M ++
Sbjct  189   ATFYKCKLLGFQDTLCDDRGFHLFKDCYIEGTVDFIFGSGTSLYLNTELHVISDPTMESV  248

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R S  + TGFSFVHC +TGN+K AVLGR W P +K IFAYT +G  I P+GW   
Sbjct  249   ITAQARQSA-DGTGFSFVHCTITGNAKDAVLGRAWMPNAKVIFAYTNLGGVISPQGWSD-  306

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               +P+   T +FGEY NTG  A  DGR  F
Sbjct  307   NMHPERDNTVFFGEYQNTGASANDDGRVDF  336



>ref|XP_004513231.1| PREDICTED: pectinesterase 1-like [Cicer arietinum]
Length=370

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 219/336 (65%), Gaps = 5/336 (1%)
 Frame = +2

Query  68    ETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVK  247
             +TVR    V + +       V+  D VPIP++K+Q+ +WF  +V+PL   +  +DPALV 
Sbjct  4     KTVRSYIHVALVISFLTANIVLSDDNVPIPSDKAQLNTWFNNNVKPLSQRKNTLDPALVT  63

Query  248   AEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTL  421
             AE     +KV K   G FKTI +A+K+IP  NTKR I++I GG +NE++ I   +PFVTL
Sbjct  64    AEEGAKVVKVMKDGSGDFKTITDAIKSIPEGNTKRVIVYIGGGNFNEKITIGRTKPFVTL  123

Query  422   YGD-PKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVA  595
             YG    N P L    TA Q GT+ SATL V  DYF A NI + N+APRP GKR   QAVA
Sbjct  124   YGALGGNMPNLTYGGTAQQYGTVDSATLIVEGDYFVAANIMISNTAPRPDGKRQGAQAVA  183

Query  596   LTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIP  775
             L I+GDKASFYNCK  GFQDT+CD  NRH +K+C ++GTVDF+FG+ KS++LNT+LRV+ 
Sbjct  184   LRISGDKASFYNCKLLGFQDTVCDDRNRHLFKNCLIQGTVDFIFGSGKSLYLNTELRVLG  243

Query  776   GDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKP  955
                M ++ A  R S+ ED G+SFVHC +TG      LGR W  +SK +FAYT++ + +  
Sbjct  244   DTGMTVIVAQARKSDSEDNGYSFVHCDITGTGNGTFLGRAWMSHSKAVFAYTHMTSVVNQ  303

Query  956   EGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             EGW   R + +   T YFGEY NTGPGA + GR K 
Sbjct  304   EGWSDNR-HSQYASTVYFGEYRNTGPGADLKGRSKI  338



>ref|XP_010667524.1| PREDICTED: pectinesterase 2-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 166/329 (50%), Positives = 227/329 (69%), Gaps = 7/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             LN+ + C L+      I   TV IPA  ++VE WF++ V+P+ + +  ++P+++ AE   
Sbjct  5     LNIALACFLIVNIAFTINAQTV-IPANAAEVERWFQSVVKPISAAKGTLEPSVIAAEDGG  63

Query  263   VY---LKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-D  430
             V    ++    G+FKTI +AVK +   N KR II I  G+Y E++KI+  + ++T YG D
Sbjct  64    VETLDVRQDGKGKFKTISDAVKHVKVGNKKRVIIKIGPGEYREKIKIERFQSYITFYGTD  123

Query  431   PKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTIT  607
             PKNRPT+  A TAAQ GT+ SATL V SDYF A NI + NSAPRP GK+   QA A+ I+
Sbjct  124   PKNRPTITFAGTAAQYGTVDSATLIVESDYFVAANIIISNSAPRPDGKKKGAQAAAIRIS  183

Query  608   GDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM  787
             GD+++FYNCKF GFQDT+CD   +HF+KDCY+EGTVDF+FG A+S++LNT+L VIPGD+ 
Sbjct  184   GDRSAFYNCKFVGFQDTVCDDKGKHFFKDCYIEGTVDFIFGEARSLYLNTELHVIPGDRE  243

Query  788   AMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWM  967
             AM+ AH R ++  + G+SFVHC+VTG    AVLGR WF  ++++FAY+ I + IKPEGW 
Sbjct  244   AMIVAHARKNQDGEGGYSFVHCKVTGTGGHAVLGRAWFDAARSVFAYSTISDVIKPEGWS  303

Query  968   GMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               R N K   T +FGEY NTGPGA +  R
Sbjct  304   DNR-NQKCQKTVFFGEYANTGPGADLKRR  331



>ref|XP_011076542.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=370

 Score =   335 bits (859),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 220/330 (67%), Gaps = 5/330 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE--A  256
             + VV +  L+  P  +   D  PIPA K+Q+ SWF  +V PL S    +DPA+V+AE   
Sbjct  11    VEVVFLTALLVLPIALSTNDE-PIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNV  69

Query  257   APVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               V ++  + G FKT+ +A+K++P  N  R II I  G Y E+VKID    F+TLYGDP 
Sbjct  70    TVVRVRTDRSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYIEKVKIDRYTHFITLYGDPN  129

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
             N P ++   TAAQ GT+ SATL V SDYFSAVN+ + NSAPRP GKR   QAVA+ I G+
Sbjct  130   NMPVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPRPDGKRVGAQAVAMKIAGE  189

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
              ASFYNC+ YGFQDTLCD   +H +KDCYVEGTVDF+FG+ +S++LN+++ VIPGD ++ 
Sbjct  190   YASFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSF  249

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++AH R+   E  G+ FVHC+VTG +  A L R WFPY + IFAY+ + +A+ P+GW   
Sbjct  250   IAAHSRSKHNEANGYVFVHCRVTGTNGTAYLARSWFPYGRVIFAYSQLSDAVNPQGWSNN  309

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               N  +  T YFGEY+N GPG+ +  R  +
Sbjct  310   GQNHTD-STVYFGEYHNEGPGSDLSKRAAY  338



>ref|XP_011076543.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=370

 Score =   335 bits (858),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 219/330 (66%), Gaps = 5/330 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE--A  256
             + VV +  L+  P  +   D  PIPA K+Q+ SWF  +V PL S    +DPA+V+AE   
Sbjct  11    VEVVFLTALLVLPIALSTNDE-PIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNV  69

Query  257   APVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               V ++    G FKT+ +A+K++P  N  R II I  G Y E+VKID    F+TLYGDP 
Sbjct  70    TVVRVRTDGSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYTEKVKIDRYTHFITLYGDPN  129

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
             N P ++   TAAQ GT+ SATL V SDYFSAVN+ + NSAPRP GKR   QAVA+ I G+
Sbjct  130   NMPVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPRPDGKRVGAQAVAMKIAGE  189

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
              ASFYNC+ YGFQDTLCD   +H +KDCYVEGTVDF+FG+ +S++LN+++ VIPGD ++ 
Sbjct  190   YASFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSF  249

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++AH R+   E  G+ FVHC+VTG +  A L R WFPY + IFAY+ + +A+ P+GW   
Sbjct  250   IAAHSRSKHNEANGYVFVHCRVTGTNGTAYLARSWFPYGRVIFAYSQLSDAVNPQGWSNN  309

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               N  +  T YFGEY+N GPG+ +  R  +
Sbjct  310   GQNHTD-STVYFGEYHNEGPGSDLSKRAAY  338



>ref|XP_009125688.1| PREDICTED: pectinesterase PPME1-like [Brassica rapa]
 gb|AGX13881.1| pectin methylesterase [Brassica rapa subsp. chinensis]
 emb|CDY55179.1| BnaAnng13700D [Brassica napus]
Length=363

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/329 (50%), Positives = 226/329 (69%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  V+VF    V+  D  PIP  K Q E WF+ +V PL S RKG+DPALV AEA+P
Sbjct  6     VSMLLAMVMVFVTPMVLADDNTPIPEAKPQAEQWFKTNVAPLPS-RKGLDPALVAAEASP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+FKT+ +A+K+IP +NTKR II +A G+Y E+V ID  +PF+TL GDPK 
Sbjct  65    RTINVNPKGGEFKTLTDALKSIPEKNTKRVIIKMAPGEYKEKVTIDKKKPFITLMGDPKA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDK  616
              P L    TAAQ GT+ SA+L +LSDYF AVNI V+NSAP+P GKR   QA+A+ I+G+ 
Sbjct  125   MPVLTYDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNN  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKF+GFQDTLCD    HF+KDCY+EGT DF+FG+  S++L+TQL  + GD + ++
Sbjct  185   AAFYNCKFHGFQDTLCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLDTQLHAV-GDGIKVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             SAH   S +E +G+SFVHC+VTG+     LGR W  + K ++AYT + + + P GW   +
Sbjct  244   SAHAGKSAEEKSGYSFVHCKVTGDGGGIYLGRSWKSHPKVVYAYTEMSSLVNPTGWKANK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 +  T ++GEY  TGPG+    R  F
Sbjct  304   VAAHD-KTVFYGEYKCTGPGSHTAKRVPF  331



>emb|CDY14046.1| BnaC02g01630D [Brassica napus]
Length=363

 Score =   332 bits (850),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 163/329 (50%), Positives = 226/329 (69%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  V+VF    V+  D  PIP  K QVE WF+ +V PL S RKG+DPALV AEA+P
Sbjct  6     VSMLLAMVMVFVTPMVLADDNTPIPEAKPQVEQWFKTNVAPLPS-RKGLDPALVAAEASP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+FKT+ +A+K++P +NTKR II +A G+Y E+V +D  +PF+TL GDPK 
Sbjct  65    RTINVNPKGGEFKTLTDALKSVPEKNTKRVIIKMAPGEYKEKVTLDKKKPFITLMGDPKA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDK  616
              P L    TAAQ GT+ SA+L +LSDYF AVNI V+NSAP+P GKR   QA+A+ I+G+ 
Sbjct  125   MPVLTFDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNN  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKF+GFQDT+CD    HF+KDCY+EGT DF+FG+  S++L TQL  + GD + ++
Sbjct  185   AAFYNCKFHGFQDTVCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLETQLHAV-GDGIKVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             SAH   S +E +G+SFVHC+VTG+     LGR W  + K ++AYT + + + P GW   +
Sbjct  244   SAHAGKSAEEKSGYSFVHCKVTGDGGGIYLGRSWKSHPKVVYAYTEMSSLVNPTGWQANK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 +  T ++GEY  TGPG+    R  F
Sbjct  304   VAAHD-KTVFYGEYKCTGPGSHTAKRVPF  331



>gb|ADH82125.1| pectinesterase [Brassica rapa subsp. pekinensis]
Length=363

 Score =   332 bits (850),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/329 (50%), Positives = 225/329 (68%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  V+VF    V+  D  PIP  K Q E WF+ +V PL S RKG+DPALV AEA+P
Sbjct  6     VSMLLAMVMVFVTPMVLADDNTPIPEAKPQAEQWFKTNVAPLPS-RKGLDPALVAAEASP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+FKT+ +A+K+IP +NTKR II +  G+Y E+V ID  +PF+TL GDPK 
Sbjct  65    RTINVNPKGGEFKTLTDALKSIPEKNTKRVIIKMGPGEYKEKVTIDKKKPFITLMGDPKA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDK  616
              P L    TAAQ GT+ SA+L +LSDYF AVNI V+NSAP+P GKR   QA+A+ I+G+ 
Sbjct  125   MPVLTYDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNN  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKF+GFQDTLCD    HF+KDCY+EGT DF+FG+  S++L+TQL  + GD + ++
Sbjct  185   AAFYNCKFHGFQDTLCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLDTQLHAV-GDGIKVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             SAH   S +E +G+SFVHC+VTG+     LGR W  + K ++AYT + + + P GW   +
Sbjct  244   SAHAGKSAEEKSGYSFVHCKVTGDGGGIYLGRSWKSHPKVVYAYTEMSSLVNPTGWKANK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 +  T ++GEY  TGPG+    R  F
Sbjct  304   VAAHD-KTVFYGEYRCTGPGSHTAKRVPF  331



>gb|AAX11261.1| pectin methylesterase allergenic protein [Salsola kali]
Length=339

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/307 (53%), Positives = 216/307 (70%), Gaps = 7/307 (2%)
 Frame = +2

Query  149   PIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY---LKVGKGGQFKTIQEAVK  319
             PIP   +++ESWF+ +V+P+ S +KG++P++V+AE+  V    ++    G+FKTI +AVK
Sbjct  2     PIPPNPAELESWFQGAVKPV-SEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVK  60

Query  320   TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSA  496
              +   NTKR II I  G+Y E+VKI+   P++TLYG DPKNRPT+  A TAA+ GT+ SA
Sbjct  61    HVKVGNTKRVIITIGPGEYREKVKIEGLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSA  120

Query  497   TLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDHN  673
             TL V SDYF   N+ V NSAPRP GKR   QA AL I+GD+A+FYNCKF GFQDT+CD  
Sbjct  121   TLIVESDYFVGANLIVSNSAPRPAGKRKGAQASALRISGDRAAFYNCKFTGFQDTVCDDK  180

Query  674   NRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHC  853
               H +KDCY+EGTVD +FG A+S++LNT+L V+PGD MAM++AH R +     G+SFVHC
Sbjct  181   GNHLFKDCYIEGTVDLIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHC  240

Query  854   QVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGP  1033
             +VTG    A+LGR WF  ++ +F+Y  + +A+KPEGW      P    T +FGEY NTGP
Sbjct  241   KVTGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSD-NNKPAAQKTIFFGEYKNTGP  299

Query  1034  GAKMDGR  1054
             GA  D R
Sbjct  300   GAAADKR  306



>gb|AAX11262.1| pectin methylesterase allergenic protein [Salsola kali]
Length=339

 Score =   329 bits (844),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/307 (53%), Positives = 217/307 (71%), Gaps = 7/307 (2%)
 Frame = +2

Query  149   PIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY---LKVGKGGQFKTIQEAVK  319
             PIP   +++ESWF+ +V+P+ S +KG++P++V+AE+  V    ++    G+FKTI +AVK
Sbjct  2     PIPPNPAELESWFQGAVKPV-SEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVK  60

Query  320   TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSA  496
              +   NTKR II I  G+Y E+VKI+   P++TLYG DPKNRPT+  A TAA+ GT+ SA
Sbjct  61    HVKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSA  120

Query  497   TLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDHN  673
             TL V SDYF   N+ V NSAPRP GKR   +A AL I+GD+A+FYNCKF GFQDT+CD  
Sbjct  121   TLIVESDYFVGANLIVSNSAPRPDGKRKGARASALRISGDRAAFYNCKFTGFQDTVCDDK  180

Query  674   NRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHC  853
               H +KDCY+EGTVDF+FG A+S++LNT+L V+PGD MAM++AH R +     G+SFVHC
Sbjct  181   GNHLFKDCYIEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHC  240

Query  854   QVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGP  1033
             +VTG    A+LGR WF  ++ +F+Y  + +A+KPEGW      P    T +FGEY NTGP
Sbjct  241   KVTGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSD-NNKPAAQKTIFFGEYKNTGP  299

Query  1034  GAKMDGR  1054
             GA  D R
Sbjct  300   GAAADKR  306



>ref|XP_004516439.1| PREDICTED: pectinesterase PPME1-like [Cicer arietinum]
Length=367

 Score =   330 bits (846),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 161/327 (49%), Positives = 217/327 (66%), Gaps = 5/327 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +NV I+  L F    V+  D   +PAE+++V+SWF +++ PL+  +  +DPALV AEA  
Sbjct  10    INVAIIVAL-FSANVVLSDDNAAVPAERAEVDSWFNSNIGPLEQRKSTLDPALVTAEANA  68

Query  263   VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV +   G FK+I +A+ +IP+ NT+R I+ I GG Y E++KI+  +PF+T  G P 
Sbjct  69    TIVKVNQDGSGDFKSITDAINSIPSGNTQRVILNIGGGNYQEKIKIEKTKPFITFIGTPS  128

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGD  613
             N P L    TA + GT+ SATL V SDYF A NI + NSAPRP GK+   QAVA+ ITGD
Sbjct  129   NMPNLTYGGTAQEYGTVDSATLIVESDYFVASNIMISNSAPRPDGKKSGAQAVAMRITGD  188

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FYNCKF GFQDT+CD  N HF+KDC ++GTVDF+FGN +S++L  +LRV+   +M +
Sbjct  189   KAAFYNCKFLGFQDTICDDKNIHFFKDCLIQGTVDFIFGNGRSLYLKNELRVLGNAEMTV  248

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             + A  R SE E + ++FVHC VTG      LGR W  YSK IFAY+ + + + P GW   
Sbjct  249   IVAQARKSESEKSLYTFVHCDVTGTGTGTYLGRAWMAYSKVIFAYSTLSSVLNPLGWSNN  308

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             R +P+   T YFGEY NTGPGA   GR
Sbjct  309   R-HPEYDKTSYFGEYMNTGPGADTKGR  334



>emb|CDX98975.1| BnaC09g48600D [Brassica napus]
Length=365

 Score =   330 bits (846),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 228/329 (69%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  V+VF    V+  D  PIP  K QVE WF A+V PL + RKG+DPALV AEA P
Sbjct  6     VSILLALVVVFVTPMVLADDATPIPEAKVQVEQWFEANVAPLPA-RKGLDPALVAAEAEP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+FKT+ +A+K++PA NTKR II IA G+Y E+V ID ++PF+TL GDPK 
Sbjct  65    RTITVDPKGGEFKTLMDAIKSVPAENTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPKA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDK  616
              P +    TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+K
Sbjct  125   MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIIVKNTAPAPDGKAKGAQALSMRISGNK  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + ++
Sbjct  185   AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVV-GDGIRVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             +AH   S++E +G+SFVHC+VTG  +   LGR W  + K ++AYT + + + P GW   +
Sbjct  244   TAHAGKSKEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQENK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 +  T ++GEY   G G++ + R  F
Sbjct  304   IAAHD-KTVFYGEYKCQGEGSQTEKRVPF  331



>gb|KEH30561.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   330 bits (845),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 215/327 (66%), Gaps = 5/327 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +N+ I+ VL+F   GV+  DT+PIPAEK+Q++SWF ++V PL+  +  +DPALV AEA  
Sbjct  10    INIAII-VLLFTVKGVLSDDTIPIPAEKTQLDSWFNSNVGPLEQRKSALDPALVTAEAGA  68

Query  263   VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV +   G FKTI +A+ +IP  NTKR I+ I GG YNE++KI+  +PFVTLYG P 
Sbjct  69    KVIKVMQDGSGDFKTITDAINSIPTGNTKRVIVSIGGGNYNEKIKIERTKPFVTLYGTPA  128

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
             N P L    TA Q GT+ SATL V SDYF A N+ + NSAPRP GK    QAVAL I+GD
Sbjct  129   NMPNLTYGGTAKQYGTVDSATLIVESDYFVAANMLISNSAPRPDGKSAGAQAVALRISGD  188

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FYNCKF GFQDT+CD  + HF+KDC ++GTVDF+FG+  S++  ++LR +      +
Sbjct  189   KAAFYNCKFLGFQDTICDDRHNHFFKDCLIQGTVDFIFGSGTSLYFKSELRALGDAGPTV  248

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             + A  R S  +   +SFVHC VTG      L R W  Y K IFAY+ + N + P+GW   
Sbjct  249   IVAQARKSVSDADLYSFVHCDVTGTGSTTFLARAWMTYPKIIFAYSTMSNVVDPKGWDNT  308

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               +P+   T YFGEY NTGP +   GR
Sbjct  309   M-HPEFDKTSYFGEYQNTGPKSDPKGR  334



>gb|ACO34813.1| Sal k 1 pollen allergen [Salsola kali]
Length=339

 Score =   328 bits (842),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 162/306 (53%), Positives = 216/306 (71%), Gaps = 7/306 (2%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY---LKVGKGGQFKTIQEAVKT  322
             IP   +++ESWF+ +V+P+ S +KG++P++V+AE+  V    ++    G+FKTI +AVK 
Sbjct  3     IPPNPAELESWFQGAVKPV-SEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVKH  61

Query  323   IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSAT  499
             +   NTKR II I  G+Y E+VKI+   P++TLYG DPKNRPT+  A TAA+ GT+ SAT
Sbjct  62    VKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSAT  121

Query  500   LYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDHNN  676
             L V SDYF   N+ V NSAPRP GKR   QA AL I+GD+A+FYNCKF GFQDT+CD   
Sbjct  122   LIVESDYFVGANLIVSNSAPRPDGKRKGAQASALRISGDRAAFYNCKFTGFQDTVCDDKG  181

Query  677   RHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQ  856
              H +KDCY+EGTVDF+FG A+S++LNT+L V+PGD MAM++AH R +     G+SFVHC+
Sbjct  182   NHLFKDCYIEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCK  241

Query  857   VTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPG  1036
             VTG    A+LGR WF  ++ +F+Y  + +A+KPEGW      P    T +FGEY NTGPG
Sbjct  242   VTGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSD-NNKPAAQKTIFFGEYKNTGPG  300

Query  1037  AKMDGR  1054
             A  D R
Sbjct  301   AAADKR  306



>ref|XP_009122341.1| PREDICTED: pectinesterase PPME1 [Brassica rapa]
 gb|AGX13882.1| pectin methylesterase [Brassica rapa subsp. chinensis]
Length=365

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 225/329 (68%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  V+VF    V+  D  PIP  K QVE WF A+V PL + RKG+DPALV AEA P
Sbjct  6     VSILLALVVVFVTPTVLADDATPIPEAKVQVEQWFEANVAPLPA-RKGLDPALVAAEAEP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+FKT+ +A+K++PA NTKR II IA G+Y E+V ID ++PF+TL GDPK 
Sbjct  65    RTITVDPKGGEFKTLMDAIKSVPAANTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPKA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDK  616
              P +    TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ 
Sbjct  125   MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKMKGAQALSMRISGNM  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + ++
Sbjct  185   AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVV-GDGIRVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             +AH   S  E +G+SFVHC+VTG  +   LGR W  + K ++AYT + + + P GW   +
Sbjct  244   TAHAGKSADEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQENK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 +  T ++GEY   G G++ + R  F
Sbjct  304   IAAHD-KTVFYGEYKCQGEGSQTEKRVPF  331



>emb|CDX70037.1| BnaA10g23860D [Brassica napus]
Length=365

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 225/329 (68%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  V+VF    V+  D  PIP  K QVE WF A+V PL + RKG+DPALV AEA P
Sbjct  6     VSILLALVVVFVTPMVLADDATPIPEAKVQVEQWFEANVAPLPA-RKGLDPALVAAEAEP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+FKT+ +A+K++PA NTKR II IA G+Y E+V ID ++PF+TL GDPK 
Sbjct  65    RTITVDPKGGEFKTLMDAIKSVPAANTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPKA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDK  616
              P +    TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ 
Sbjct  125   MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKMKGAQALSMRISGNM  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + ++
Sbjct  185   AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVV-GDGIRVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             +AH   S  E +G+SFVHC+VTG  +   LGR W  + K ++AYT + + + P GW   +
Sbjct  244   TAHAGKSADEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQENK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 +  T ++GEY   G G++ + R  F
Sbjct  304   IAAHD-KTVFYGEYKCQGEGSQTEKRVPF  331



>ref|XP_003518804.1| PREDICTED: pectinesterase PPME1 [Glycine max]
Length=369

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 209/308 (68%), Gaps = 4/308 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             DTVPIPA K+Q+ +WF  +V PL   +  +DPALV AE     +KV +   G+FKTI +A
Sbjct  28    DTVPIPAHKAQLGTWFSTNVGPLDQRKSTMDPALVAAEEGAKVVKVMQDGSGEFKTITDA  87

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IP+ NTKR I++I  G YNE++KI+  +PF+TLYG P+  P L    TA + GT+ S
Sbjct  88    INSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPFITLYGVPEKMPNLTFGGTALKYGTVDS  147

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             ATL V SDYF A NI + NSAPRP GK +  QAVAL I+GDKA+FYNCKF+GFQDT+CD 
Sbjct  148   ATLIVESDYFVAANIIISNSAPRPDGKIQGGQAVALRISGDKAAFYNCKFFGFQDTICDD  207

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
              NRHF+KDC ++GT+D++FG+ KS++L+T+LR +    + ++ A  R S  ED  +SFVH
Sbjct  208   RNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRTLGDTGITVIVAQARKSPTEDNAYSFVH  267

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C VTG      LGR W P+ + +FAY+ +   +K EGW     +P++     FGEY NTG
Sbjct  268   CDVTGTGNGTFLGRAWMPHPRVVFAYSTMSAVVKKEGWSN-NNHPEHDKNVRFGEYQNTG  326

Query  1031  PGAKMDGR  1054
             PGA   GR
Sbjct  327   PGADPKGR  334



>gb|KHN29928.1| Pectinesterase PPME1-like protein [Glycine soja]
Length=369

 Score =   325 bits (833),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/308 (50%), Positives = 209/308 (68%), Gaps = 4/308 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             DTVPIPA K+Q+ +WF  +V PL   +  +DPALV AE     +KV +   G+FKTI +A
Sbjct  28    DTVPIPANKAQLGTWFSTNVGPLDQRKSTMDPALVAAEEGAKVVKVMQDGSGEFKTITDA  87

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IP+ NTKR I++I  G YNE++KI+  +PF+TLYG P+  P L    TA + GT+ S
Sbjct  88    INSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPFITLYGVPEKMPNLTFGGTALKYGTVDS  147

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             ATL V SDYF A NI + NSAPRP GK +  QAVAL I+GDKA+FYNCKF+GFQDT+CD 
Sbjct  148   ATLIVESDYFVAANIIISNSAPRPDGKIQGGQAVALRISGDKAAFYNCKFFGFQDTICDD  207

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
              NRHF+KDC ++GT+D++FG+ KS++L+T+LR +    + ++ A  R S  ED  +SFVH
Sbjct  208   RNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRTLGDTGITVIVAQARKSPTEDNAYSFVH  267

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C VTG      LGR W P+ + +FAY+ +   +K EGW     +P++     FGEY NTG
Sbjct  268   CDVTGTGNGTFLGRAWMPHPRVVFAYSTMSAVVKKEGWSN-NNHPEHDKNVRFGEYQNTG  326

Query  1031  PGAKMDGR  1054
             PGA   GR
Sbjct  327   PGADPKGR  334



>ref|XP_011076539.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=623

 Score =   331 bits (849),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/328 (50%), Positives = 219/328 (67%), Gaps = 11/328 (3%)
 Frame = +2

Query  107   LVFCPGGVI------PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE--AAP  262
             +V+C GG +      P D  PIPA K+Q+ SWF  +V PL S    +DPA+V+AE     
Sbjct  266   VVYCRGGGLLDRSSRPSDE-PIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNVTV  324

Query  263   VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
             V ++    G FKT+ +A+K++P  N  R II I  G Y E+VKID    F+TLYGDP N 
Sbjct  325   VRVRTDGSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYTEKVKIDRYTHFITLYGDPNNM  384

Query  443   PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKA  619
             P ++   TAAQ GT+ SATL V SDYFSAVN+ + NSAP+P GKR   QAVA+ I G+ A
Sbjct  385   PVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPKPDGKRVGAQAVAIKIAGEYA  444

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             SFYNC+ YGFQDTLCD   +H +KDCYVEGTVDF+FG+ +S++LN+++ VIPGD ++ ++
Sbjct  445   SFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSFIA  504

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             AH R+   E  G+ FVHC+VTG +  A L R WFPY + IFAY+ + +A+ P+GW     
Sbjct  505   AHSRSKHNEANGYVFVHCRVTGTNGTAYLARSWFPYGRVIFAYSQLSDAVNPQGWSNNGQ  564

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             N  +  T YFGEY+N GPG+ +  R  +
Sbjct  565   NHTD-STVYFGEYHNEGPGSDLSKRAAY  591



>ref|XP_006289810.1| hypothetical protein CARUB_v10003415mg [Capsella rubella]
 gb|EOA22708.1| hypothetical protein CARUB_v10003415mg [Capsella rubella]
Length=361

 Score =   322 bits (824),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 224/329 (68%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  ++VF    V   D  PIP  K QVE WF+ +V PL   RKG+DPALV AEAAP
Sbjct  6     VSILLGLLVVFVSPVVFADDVTPIPETKPQVEQWFKTNVAPLAQ-RKGLDPALVAAEAAP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL G P  
Sbjct  65    RTITVNPKGGEFKTLTDALKSVPAGNTKRVIIKMAPGEYREKVTIDKNKPFITLMGQPNA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDK  616
              P +    TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ 
Sbjct  125   MPVISFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNM  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + ++
Sbjct  185   AAFYNCKFYGFQDTVCDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             +AH   S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   +
Sbjct  244   AAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             T P +  T ++GEY  +GPG+    R  F
Sbjct  304   T-PAHDKTVFYGEYKCSGPGSHKAKRVPF  331



>ref|XP_002871269.1| ATPPME1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47528.1| ATPPME1 [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 224/329 (68%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  ++VF    V   D  PIP  K QV  WF+A+V PL   RKG+DPALV AEAAP
Sbjct  6     VSILLGLLVVFVSPVVFADDVTPIPEAKPQVAQWFKANVAPLAQ-RKGLDPALVAAEAAP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL G P  
Sbjct  65    RIINVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAPGEYREKVTIDRNKPFITLMGQPGA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDK  616
              P +    TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ 
Sbjct  125   MPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNF  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + ++
Sbjct  185   AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             +AH   S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   +
Sbjct  244   AAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             T P +  T ++GEY  +GPG+    R  F
Sbjct  304   T-PAHDKTVFYGEYKCSGPGSHKAKRVPF  331



>gb|KFK25126.1| hypothetical protein AALP_AA8G069500 [Arabis alpina]
Length=362

 Score =   321 bits (822),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 221/328 (67%), Gaps = 6/328 (2%)
 Frame = +2

Query  89    VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY  268
             +++  ++VF    V   D  PIPA K  VE WF+  V PL   RKG+DPALV AEAAP  
Sbjct  8     ILLALLVVFVTPMVFADDNAPIPASKPGVEQWFKTHVAPLPQ-RKGLDPALVAAEAAPKT  66

Query  269   LKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP-KNR  442
             + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL G P  N 
Sbjct  67    ITVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLLGQPGANM  126

Query  443   PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKA  619
             P +    TAA+ GT+ SA+L +LSDYF AVNI V+NSAP P GK +  QA+++ I+G+ A
Sbjct  127   PVITYDGTAAKYGTVDSASLIILSDYFMAVNIIVKNSAPAPDGKTKGAQALSMRISGNYA  186

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + +++
Sbjct  187   AFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIT  245

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             AH   S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   + 
Sbjct  246   AHAGKSAEEKSGYSFVHCKVTGTGSGIYLGRAWMSHPKVVYAYTEMTSVVNPSGWQENK-  304

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              P N  T ++GEY  +G G++   R  F
Sbjct  305   QPANDKTVFYGEYKCSGAGSQTAKRVPF  332



>ref|NP_177152.2| pectinesterase PPME1 [Arabidopsis thaliana]
 sp|Q84WM7.1|PPME1_ARATH RecName: Full=Pectinesterase PPME1; Short=AtPPME1; Short=PE PPME1; 
AltName: Full=Pectin methylesterase 9; Short=AtPME9; AltName: 
Full=Pectin methylesterase PPME1; AltName: Full=Protein 
POLLEN SPECIFIC PME 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22801.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE35001.1| pectinesterase PPME1 [Arabidopsis thaliana]
Length=361

 Score =   320 bits (820),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 223/329 (68%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  ++VF    V   D  PIP  K QV  WF A+V PL   RKG+DPALV AEAAP
Sbjct  6     VSILLGLLMVFVTPMVFADDVTPIPEGKPQVAQWFNANVGPLAQ-RKGLDPALVAAEAAP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL G P  
Sbjct  65    RIINVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMGQPNA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDK  616
              P +    TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ 
Sbjct  125   MPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNF  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + ++
Sbjct  185   AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             +AH   S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   +
Sbjct  244   AAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             T P +  T ++GEY  +GPG+    R  F
Sbjct  304   T-PAHDKTVFYGEYKCSGPGSHKAKRVPF  331



>ref|XP_010423212.1| PREDICTED: pectinesterase PPME1-like [Camelina sativa]
Length=361

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 224/329 (68%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  ++VF    V   D  PIP  K QVE WF+A+V PL   RKG+DPALV AEAAP
Sbjct  6     VSILLGLLVVFVSPVVFADDVTPIPEAKPQVEQWFKANVGPLAQ-RKGLDPALVAAEAAP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+F T+  A+K++PA NTKR II IA G Y E+V I+ ++PF+TL G P  
Sbjct  65    RIINVNPKGGEFTTLTAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPTA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDK  616
              P ++   TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ 
Sbjct  125   MPVIIFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNF  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + ++
Sbjct  185   AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             +AH   S +E +G+SFVHC+VTG  +   LGR W  + K ++AYT + + + P GW   +
Sbjct  244   TAHAGKSAEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQENK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             T P +  T ++GEY  +GPG+    R  F
Sbjct  304   T-PAHDKTVFYGEYKCSGPGSISAKRVPF  331



>ref|XP_008244214.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   320 bits (820),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/334 (46%), Positives = 220/334 (66%), Gaps = 14/334 (4%)
 Frame = +2

Query  71    TVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKA  250
             T+ LLN +IV          +  D  P+PA++SQV +WF  +V P +  +  +DPALV A
Sbjct  17    TLILLNAIIV----------VADDDAPVPADQSQVNTWFNNNVNPNKERQGKLDPALVTA  66

Query  251   EAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
             E     +KV K   G+FKTI +AV +IPA NTKR I++I GG+YNE++ I  + PFVT Y
Sbjct  67    ELGQTIVKVMKDGSGEFKTITDAVNSIPAENTKRVIVYIGGGEYNEKITIPRNIPFVTFY  126

Query  425   GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALT  601
             G P N PTL+    A + GT+ SAT+   SDYF A N+ ++NS+P+P GKR  +QA+AL 
Sbjct  127   GSPTNMPTLIFGGNAQKYGTVDSATVIAESDYFVAANLIIKNSSPKPDGKRVGEQALALR  186

Query  602   ITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGD  781
             ++G+K++ +NC+  GFQDTLCD    HF+KDC++EGTVDF+FG+ KS++LNT+L V+  +
Sbjct  187   VSGNKSALFNCRVIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNN  246

Query  782   QMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEG  961
             +M +++A  R+S  EDTG+SFVHC +TG      LGR W    + +FAYT +   I P G
Sbjct  247   EMTVITAQARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFAYTSMSEVITPAG  306

Query  962   WMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             W   +  P+   T ++GE+  +GPG+ M GR K+
Sbjct  307   W-NNKNRPERDSTVFYGEHKCSGPGSSMVGRVKY  339



>ref|XP_007218171.1| hypothetical protein PRUPE_ppa007533mg [Prunus persica]
 gb|EMJ19370.1| hypothetical protein PRUPE_ppa007533mg [Prunus persica]
Length=364

 Score =   320 bits (819),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 218/327 (67%), Gaps = 4/327 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             + + +++F     +  D  P+PA++SQV +WF  +V+P  + R  +DP L KAEA+   +
Sbjct  7     LTMTLILFTATIAMADDHTPVPADQSQVNTWFNNNVKPYTARRGTLDPTLAKAEASQKVI  66

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV K   GQFKTI +AV +IPA NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  67    KVMKNGSGQFKTITDAVNSIPAGNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPTNMP  126

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKAS  622
             TL  A T+ + GT+ SAT+   SDYF A N+ ++NS+PRP GKR   QAVAL ++G+K++
Sbjct  127   TLTFAGTSQKYGTVNSATVIAESDYFVAANVIIKNSSPRPDGKRVGAQAVALRVSGNKSA  186

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
              YNCK  GFQDTLCD    H +KDC++EGTVDF++G+ KS++LNT+L V+  + + +++A
Sbjct  187   LYNCKLIGFQDTLCDDRGNHLFKDCFIEGTVDFIWGSGKSLYLNTELHVLGDNGLTVITA  246

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R+S  EDTG+SFVHC++TG      LGR W      ++AYT +   I P GW     +
Sbjct  247   QARDSASEDTGYSFVHCKITGTGSGTYLGRAWRTNPMVVYAYTSMTKVINPAGWSD-NNH  305

Query  983   PKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             P+   T ++GEY  +GPG+   GR K+
Sbjct  306   PERDSTVFYGEYKCSGPGSSAVGREKY  332



>ref|XP_010452707.1| PREDICTED: pectinesterase PPME1 [Camelina sativa]
Length=361

 Score =   319 bits (817),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 223/329 (68%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  ++VF    V   D  PIP  K QVE WF+A+V PL   RKG+DPALV AEAAP
Sbjct  6     VSILLGLLVVFVSPMVFADDVTPIPEAKPQVEQWFKANVGPLAQ-RKGLDPALVAAEAAP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+F T+  A+K++PA NTKR II IA G Y E+V I+ ++PF+TL G P  
Sbjct  65    RIINVNPKGGEFTTLTAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPTA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDK  616
              P +    TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ 
Sbjct  125   MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNF  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + ++
Sbjct  185   AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             +AH   S +E +G+SFVHC+VTG  +   LGR W  + K ++AYT + + + P GW   +
Sbjct  244   TAHAGKSAEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQENK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             T P +  T ++GEY  +GPG+    R  F
Sbjct  304   T-PAHDKTVFYGEYKCSGPGSLSAKRVPF  331



>ref|XP_009122340.1| PREDICTED: probable pectinesterase 49 [Brassica rapa]
 emb|CDX70038.1| BnaA10g23870D [Brassica napus]
Length=361

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 212/323 (66%), Gaps = 4/323 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             +I  +++F    V+  D  PIP +K+QVE+WF+A+VQP  + R  +DP L  AEA+P  +
Sbjct  8     MIAFLVIFALPAVVADDITPIPEDKAQVEAWFKANVQPYSARRGTLDPVLDAAEASPQII  67

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  GG FKTI EA+K+IP  NTKR II +A G Y+E+V +D  RPFVTL G P    
Sbjct  68    NVNQEGGGDFKTINEAIKSIPIGNTKRVIIKLAPGVYHEKVTVDVGRPFVTLMGKPGAET  127

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    TA++ GT+ SATL + + YF A N+ V+N+AP P      QA+A+ I GDKA+F
Sbjct  128   NLTFDGTASKFGTMESATLIIWAKYFVAANLHVKNTAPMPKAGTQGQALAMRINGDKAAF  187

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             YNC+FYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +++AH
Sbjct  188   YNCRFYGFQDTLCDDIGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  246

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
              R SE +  G+SFVHC++TG      LGR W  + K ++AYT + + + P GW   R N 
Sbjct  247   NRQSENQQNGYSFVHCKITGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPTGWQENR-NR  305

Query  986   KNGGTCYFGEYNNTGPGAKMDGR  1054
             +N  T ++GEY  TGPG+  + R
Sbjct  306   ENDKTVFYGEYMCTGPGSHKEKR  328



>ref|XP_010491358.1| PREDICTED: pectinesterase PPME1-like [Camelina sativa]
Length=361

 Score =   318 bits (816),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 222/329 (67%), Gaps = 5/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +++++  ++VF    V   D  PIP  K QVE WF+A+V PL   RKG+DPALV AEAAP
Sbjct  6     VSILLGLLVVFVSPMVFADDVTPIPEAKPQVEQWFKANVGPLPQ-RKGLDPALVAAEAAP  64

Query  263   VYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
               + V  KGG+F TI  A+K++PA NTKR II IA G Y E+V I+ ++PF+TL G P  
Sbjct  65    RIINVNPKGGEFTTITAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPTA  124

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDK  616
              P +    TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ 
Sbjct  125   MPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNY  184

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + ++
Sbjct  185   AAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVI  243

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
             +AH   S +E +G+SFVHC+VTG  +   LGR W  + K ++AYT + + + P GW   +
Sbjct  244   TAHAGKSAEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQENK  303

Query  977   TNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               P +  T ++GEY  +GPG+    R  F
Sbjct  304   V-PAHDKTVFYGEYKCSGPGSLSAKRVPF  331



>ref|NP_568181.1| putative pectinesterase 48 [Arabidopsis thaliana]
 sp|Q9LY19.2|PME48_ARATH RecName: Full=Probable pectinesterase 48; Short=PE 48; AltName: 
Full=Pectin methylesterase 48; Short=AtPME48; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED91154.1| putative pectinesterase 48 [Arabidopsis thaliana]
Length=361

 Score =   317 bits (813),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 222/334 (66%), Gaps = 7/334 (2%)
 Frame = +2

Query  74    VRLLNVVIVC--VLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVK  247
             +R  NV I+   +++F    V   D  PIP  K QV  WF   V PL   RKG+DPALV 
Sbjct  1     MRYTNVSILLGMLVIFVSPMVFADDLTPIPEGKPQVVQWFNTHVGPLAQ-RKGLDPALVA  59

Query  248   AEAAPVYLKVG-KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
             AEAAP  + V  KGG+FKT+ +A+K++PA NTKR II +A G+Y E+V ID ++PF+TL 
Sbjct  60    AEAAPRIINVNPKGGEFKTLTDAIKSVPAGNTKRVIIKMAHGEYREKVTIDRNKPFITLM  119

Query  425   GDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALT  601
             G P   P +    TAA+ GT+ SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ 
Sbjct  120   GQPNAMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMR  179

Query  602   ITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGD  781
             I+G+ A+FYNCKFYGFQDT+CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD
Sbjct  180   ISGNFAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GD  238

Query  782   QMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEG  961
              + +++AH   S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P G
Sbjct  239   GIRVIAAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTG  298

Query  962   WMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             W   +T P +  T ++GEY  +GPG+    R  F
Sbjct  299   WQENKT-PAHDKTVFYGEYKCSGPGSHKAKRVPF  331



>ref|XP_007038213.1| Pectinesterase, putative isoform 1 [Theobroma cacao]
 gb|EOY22714.1| Pectinesterase, putative isoform 1 [Theobroma cacao]
Length=368

 Score =   317 bits (812),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 213/330 (65%), Gaps = 5/330 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +   I  +LV  P  V+  ++ PIP +KSQ+++WF A+++P  +    +DPAL KAE A 
Sbjct  11    VGAAICTILVLAPV-VLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAA  69

Query  263   VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV K   G F TI +A+ ++P+ NTKR II I GG Y E+++ID  +PF+T YGDP+
Sbjct  70    HIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPR  129

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
             N P L    TA Q GT+ SATL V SDYF A NI ++N+APRP G     QAV+L I+GD
Sbjct  130   NMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGD  189

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FYNCK  GFQDTLCD    HF+KDCY+ GTVDF+FG+ KS++LNT L V     + +
Sbjct  190   KAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLNTVLYVDGQKGVTV  249

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R S  E+TG+SFVHC VTG +  A LGR W    + +FAYT + + I P GW   
Sbjct  250   ITAQARESSSENTGYSFVHCTVTGTASGAYLGRAWKTSPRVVFAYTNMSSVIHPLGWSD-  308

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               +P+   T +FGEY   G GA   GR K+
Sbjct  309   NLHPERAKTVFFGEYKCKGKGASFSGREKY  338



>ref|XP_004287800.1| PREDICTED: probable pectinesterase 48-like [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   317 bits (811),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 212/327 (65%), Gaps = 5/327 (2%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA-PVY  268
             +++   V     V   D   IP++KS V+ WF+ +V+PL   +  +DP LVKAE   P  
Sbjct  14    LMMITTVLLAATVSMADDPVIPSDKSAVDKWFQDNVKPLADRKSSLDPDLVKAEDGDPKI  73

Query  269   LKV-GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             +KV   GG FK I EA+ +IPA NTKR II++ GG YNE++ I  ++PFVTL GD KN P
Sbjct  74    VKVMANGGDFKKISEAIDSIPASNTKRVIIYVGGGVYNEKITIPKNKPFVTLMGDSKNMP  133

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKAS  622
              L     +A+ GT+YSATL V SDYF  VN+++ NS+PRP GK++  QA+AL ++G+KA+
Sbjct  134   NLTFNGDSAKYGTLYSATLSVESDYFVGVNLNIINSSPRPDGKKEGAQALALKLSGNKAA  193

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
              YNC+ +GFQDTLCD    HF KD YVEGTVDF+FG+ KS++LNT + V+    M +++A
Sbjct  194   LYNCQMFGFQDTLCDDQGNHFIKDSYVEGTVDFIFGSGKSLYLNTHINVLGDSGMTVITA  253

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
             + R  + ED G+SFVHC +TG      LGR W    K  FAYT +G  +KPEGW     +
Sbjct  254   NAREGD-EDKGYSFVHCSITGTGSGTFLGRAWRAAPKVTFAYTEMGEVVKPEGWTD-NNH  311

Query  983   PKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             P+   +  FGEY NTGPG+ M  R  F
Sbjct  312   PEYDKSVSFGEYKNTGPGSSMSKRVSF  338



>gb|AAM65347.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
Length=342

 Score =   316 bits (809),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/310 (51%), Positives = 213/310 (69%), Gaps = 5/310 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVG-KGGQFKTIQEAV  316
             D  PIP  K QV  WF   V PL   RKG+DPALV AEAAP  + V  KGG+FKT+ +A+
Sbjct  6     DLTPIPEGKPQVVQWFNTHVGPLVQ-RKGLDPALVAAEAAPRIINVNPKGGEFKTLTDAI  64

Query  317   KTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSA  496
             K++PA NTKR II +A G+Y E+V ID ++PF+TL G P   P +    TAA+ GT+ SA
Sbjct  65    KSVPAGNTKRVIIKMAPGEYREKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGTVDSA  124

Query  497   TLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTLCDHN  673
             +L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ A+FYNCKFYGFQDT+CD  
Sbjct  125   SLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTICDDT  184

Query  674   NRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHC  853
               HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + +++AH   S +E++G+SFVHC
Sbjct  185   GNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIAAHAGKSAEENSGYSFVHC  243

Query  854   QVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGP  1033
             +VTG   V  LGR W  + K ++AYT + + + P GW   +T P +  T ++GEY  +GP
Sbjct  244   KVTGTGGVIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENKT-PAHDKTVFYGEYKCSGP  302

Query  1034  GAKMDGRPKF  1063
             G+    R  F
Sbjct  303   GSHKAKRVPF  312



>ref|XP_011040323.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=362

 Score =   317 bits (811),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/335 (48%), Positives = 216/335 (64%), Gaps = 4/335 (1%)
 Frame = +2

Query  65    METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
             M T ++  +V + +L+         DT PIP E S + SWF+A+V+P       +DPAL 
Sbjct  1     MSTGKVTGMVAIVILLLVSPAAGSRDTGPIPGEPSSLNSWFQANVKPYTQRNGTLDPALE  60

Query  245   KAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
              AEA P  + V K   G FKT+  AV++I + NT+R I+ I  G YNE+++ID  +PFVT
Sbjct  61    TAEAKPKTIMVRKDGSGDFKTLTSAVRSISSGNTQRVIVDIGSGVYNEKIQIDKGKPFVT  120

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVAL  598
               G  ++ PTL  A TA   GT+YSATL V SDYF A NI ++NS+PRP+GK  +QAVAL
Sbjct  121   FKGSARSVPTLTFAGTARVYGTVYSATLQVDSDYFVASNIIIKNSSPRPSGKLKEQAVAL  180

Query  599   TITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPG  778
              I GDKA+FYNC+  GFQDTLCD   RHF+KDCY+EGTVDF+FG+ KS++L T + V+  
Sbjct  181   RIGGDKAAFYNCRLVGFQDTLCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLGTAINVLAD  240

Query  779   DQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPE  958
               +A+++A  RN E +DTGFSFVHC+V G  K A LGR W    + +FA+T + + + P 
Sbjct  241   QGLAVITAQARNKE-DDTGFSFVHCKVNGIGKGAFLGRAWTERPRVVFAFTAMSSVVDPG  299

Query  959   GWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             GW   + +P+      FGEY   GPG+   GR KF
Sbjct  300   GWSDNQ-HPERDRIVSFGEYKCKGPGSNPSGRVKF  333



>gb|AAT99258.1| pectin-methyltransferase precursor [Salsola kali]
Length=362

 Score =   316 bits (810),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 213/309 (69%), Gaps = 7/309 (2%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY---LKVGKGGQFKTIQEAVKT  322
             IP   +++ESWF+ +V+P+ S +KG++P++V+ E+  V    ++    G+FKTI +AVK 
Sbjct  26    IPPNPAELESWFQGAVKPV-SEQKGLEPSVVQTESGGVETIEVRQDGSGKFKTISDAVKH  84

Query  323   IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSAT  499
             +   NTKR II I  G+Y E+VKI+   P++TLYG DPKNRPT+  A TAA+ GT+ SAT
Sbjct  85    VKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSAT  144

Query  500   LYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDHNN  676
             + V SDY    ++ V NSAPRP GKR   QA AL I+GD+A+FYNCKF GFQDT+CD   
Sbjct  145   VIVESDYSVGAHLIVTNSAPRPDGKRKGAQAGALRISGDRAAFYNCKFTGFQDTVCDDKG  204

Query  677   RHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQ  856
              HF+ DCY EGTVDF+FG A+S++LNT+L V+PGD MAM++AH R +     G+SFVHC+
Sbjct  205   NHFFTDCYTEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCK  264

Query  857   VTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPG  1036
             VTG    A+LGR WF  ++ +F+Y  + +A KPEGW      P+   T  FGEY NTGPG
Sbjct  265   VTGTGGTALLGRAWFDAARVVFSYCNLSDAAKPEGWSD-NNKPEAQKTILFGEYKNTGPG  323

Query  1037  AKMDGRPKF  1063
             A  D R  +
Sbjct  324   AAPDKRAPY  332



>ref|XP_006399225.1| hypothetical protein EUTSA_v10013901mg [Eutrema salsugineum]
 gb|ESQ40678.1| hypothetical protein EUTSA_v10013901mg [Eutrema salsugineum]
Length=364

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 214/314 (68%), Gaps = 4/314 (1%)
 Frame = +2

Query  128   VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK-GGQFKTI  304
             V+  DT PIP  K QVE WF+ +V PL S +  +DPALV AEA P  + V K GG+F T+
Sbjct  23    VLADDTTPIPEAKPQVEQWFKTNVGPLASRKGTLDPALVAAEAEPRIINVNKKGGEFTTL  82

Query  305   QEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGT  484
              +A+K++PA NTKR II +  G+Y E+V ID ++PF+TL G P   P +    TAA+ GT
Sbjct  83    TDALKSVPAGNTKRVIIKMGPGEYREKVTIDRNKPFITLMGQPNAMPIISFDGTAAKYGT  142

Query  485   IYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTL  661
             + SA+L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+KA+FYNCKFYGFQDT+
Sbjct  143   VDSASLIILSDYFMAVNIVVKNTAPMPDGKTKGAQALSMRISGNKAAFYNCKFYGFQDTI  202

Query  662   CDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFS  841
             CD    HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + +++AH   S +E +G+S
Sbjct  203   CDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVITAHAGKSAEEKSGYS  261

Query  842   FVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYN  1021
             FVHC+VTG+     LGR W  + K ++AYT + + + P GW   +  P +  T ++GEY 
Sbjct  262   FVHCKVTGDGNGIYLGRAWMSHPKVVYAYTEMTSVVNPSGWQENKM-PAHDKTVFYGEYK  320

Query  1022  NTGPGAKMDGRPKF  1063
              +GPG+    R  F
Sbjct  321   CSGPGSHKAKRVPF  334



>ref|XP_006394480.1| hypothetical protein EUTSA_v10004453mg [Eutrema salsugineum]
 gb|ESQ31766.1| hypothetical protein EUTSA_v10004453mg [Eutrema salsugineum]
Length=364

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 220/330 (67%), Gaps = 6/330 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             L V I+ V++  P  V   D  PIP  K ++E WF  +V  L S +  +DPAL+ AEA+P
Sbjct  8     LIVTILLVVITSPI-VSGNDASPIPQNKRRIEQWFNTNVPSLASRKGTLDPALLTAEASP  66

Query  263   VYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV + G+  FKT+ EA+K++PA NT+R II +  G Y E++ ID ++PF+TLYG P 
Sbjct  67    RVIKVKQNGRGHFKTLTEAIKSVPAGNTRRVIIKLGPGVYKEKITIDRNKPFITLYGHPN  126

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGD  613
               P L    TAAQ GT+ SATL VLSDYF AVNI V+NSAP P GKR   QA+++ I+G+
Sbjct  127   AMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKRKGAQALSMRISGN  186

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L TQL V+ GD + +
Sbjct  187   KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLRTQLNVV-GDGLRV  245

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++AH   S  E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   
Sbjct  246   ITAHAGKSAAEKSGYSFVHCKVTGTGTGVYLGRAWMSHPKVVYAYTDMSSVVNPSGWQDN  305

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 ++  T ++GEY  +GPG+  + R K+
Sbjct  306   GQTERD-KTVFYGEYKCSGPGSNKEKRVKY  334



>gb|KEH17536.1| pectinesterase-like protein [Medicago truncatula]
 gb|KEH17537.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 209/328 (64%), Gaps = 5/328 (2%)
 Frame = +2

Query  80    LLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             ++NV I+  L F     +  DT+P+PA ++QV+SWF  +V PL+  +  +DPALV AEA 
Sbjct  9     MINVAIIVAL-FMVNVALSDDTIPVPANRAQVDSWFNTNVGPLEQRKSTLDPALVTAEAG  67

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                +KV +   G FKTI +A+ +IP  NT R I+ I GG YNE++KID  +PFVTLYG P
Sbjct  68    AKVIKVMQDGSGDFKTITDAINSIPTGNTVRVIVNIGGGSYNEKIKIDRTKPFVTLYGAP  127

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITG  610
              N P L    TA Q GT+ SATL   SDYF A NI V NSAPRP GK    QAVAL I+G
Sbjct  128   GNMPNLTYGGTAKQYGTVDSATLIAESDYFVAANILVSNSAPRPDGKTAGGQAVALRISG  187

Query  611   DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
             DKA+FYNCKF+GFQDT+CD  + H +KDC ++GTVDF+FG+  S++L ++LR +      
Sbjct  188   DKAAFYNCKFFGFQDTICDDRHNHIFKDCVIQGTVDFIFGSGTSLYLKSELRALDDTGPT  247

Query  791   MVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             ++ A  R +  +   +SFVHC +TG      L R W  Y K I+AY+ + N + P+GW  
Sbjct  248   VIVAQARKTASDADLYSFVHCDITGTGSSTFLARAWMTYPKIIYAYSTMTNVVNPKGWDN  307

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
                +P+   T YFGEY NTGP +   GR
Sbjct  308   AM-HPEFDKTSYFGEYQNTGPKSDPKGR  334



>ref|XP_011014352.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=364

 Score =   315 bits (808),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/336 (47%), Positives = 220/336 (65%), Gaps = 6/336 (2%)
 Frame = +2

Query  65    METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
             M ++  +   +  +L+     V   D  PIPA+ S + +WF+ +V+PL   +  +DPAL 
Sbjct  1     MGSIAAIQCAMTAILLVSTT-VSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALE  59

Query  245   KAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
              AEA P  +KV +   G+FKT+++A+ +IP  NT+R I+ I  G+Y E++KI+  +PFVT
Sbjct  60    AAEAKPRTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERGKPFVT  119

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVA  595
               G P N+PTL    TA + GT+YSATL   +DYF A NI ++NSAPRP G+ + +QAVA
Sbjct  120   FLGSPSNKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIIKNSAPRPNGELKGEQAVA  179

Query  596   LTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIP  775
             L I+GDK++FYNC+  GFQDTLCD   RH +KDCY+EGTVD++FG+ KS++L T+L VI 
Sbjct  180   LRISGDKSAFYNCRLLGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIG  239

Query  776   GDQMAMVSAHGRNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIK  952
              +    ++AH RNSE EDTGFSFVHC+V G  +K A LGR W    + +F+YT + + + 
Sbjct  240   EENGNFITAHARNSEAEDTGFSFVHCKVDGTGAKGAYLGRAWQARPRVVFSYTTMSDVVN  299

Query  953   PEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPK  1060
             PEGW     +P+   T  FGEY   G GA   GR K
Sbjct  300   PEGWSN-NFHPERDQTALFGEYKCEGEGANPAGRAK  334



>ref|XP_003517875.1| PREDICTED: pectinesterase PPME1 [Glycine max]
 gb|KHN04070.1| Pectinesterase PPME1 [Glycine soja]
 gb|KHN32883.1| Pectinesterase PPME1 [Glycine soja]
 gb|KHN44801.1| Pectinesterase PPME1 [Glycine soja]
Length=369

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 212/324 (65%), Gaps = 4/324 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             V + V       V+  DTVPIPA K+Q+  W+  +V PL   +  VDPALV AE     +
Sbjct  12    VTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAKVV  71

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV +   G+FKTI +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P
Sbjct  72    KVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMP  131

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKAS  622
              L    TA Q GT+ SATL V SDYF A NI + N+APRP  K    QAVAL I+GDKA+
Sbjct  132   NLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAA  191

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
             FYNCK YGFQDT+CD  NRHF+KDC ++GT+D++FG+ KS++++T+LR +  + + ++ A
Sbjct  192   FYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVIVA  251

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R SE ED  +SFVHC VTG      LGR W  + + +FAY+ + + +   GW     +
Sbjct  252   QARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGWSN-NNH  310

Query  983   PKNGGTCYFGEYNNTGPGAKMDGR  1054
             P++  T  FGEY N+GPGA   GR
Sbjct  311   PEHDKTVRFGEYQNSGPGADPKGR  334



>ref|XP_006572809.1| PREDICTED: uncharacterized protein LOC100306177 isoform X1 [Glycine 
max]
Length=369

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 212/324 (65%), Gaps = 4/324 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             V + V       V+  DTVPIPA K+Q+  W+  +V PL   +  VDPALV AE     +
Sbjct  12    VTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAKVV  71

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV +   G+FKTI +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P
Sbjct  72    KVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMP  131

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKAS  622
              L    TA Q GT+ SATL V SDYF A NI + N+APRP  K    QAVAL I+GDKA+
Sbjct  132   NLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAA  191

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
             FYNCK YGFQDT+CD  NRHF+KDC ++GT+D++FG+ KS++++T+LR +  + + ++ A
Sbjct  192   FYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVIVA  251

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R SE ED  +SFVHC VTG      LGR W  + + +FAY+ + + +   GW     +
Sbjct  252   QARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGWSN-NNH  310

Query  983   PKNGGTCYFGEYNNTGPGAKMDGR  1054
             P++  T  FGEY N+GPGA   GR
Sbjct  311   PEHDKTVRFGEYQNSGPGADPKGR  334



>ref|XP_002318199.2| hypothetical protein POPTR_0012s11460g [Populus trichocarpa]
 gb|EEE96419.2| hypothetical protein POPTR_0012s11460g [Populus trichocarpa]
Length=364

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/336 (47%), Positives = 219/336 (65%), Gaps = 6/336 (2%)
 Frame = +2

Query  65    METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
             M ++  +   I  +L+     V   D  PIPA+ S + +WF+ +V+PL   +  +DPAL 
Sbjct  1     MGSIAAIQCAITAILLVSTT-VSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALE  59

Query  245   KAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
              AEA P  +KV +   G+FKT+++A+ +IP  NT+R I+ I  G+Y E++KI+  +PFVT
Sbjct  60    AAEAKPRTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERSKPFVT  119

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVA  595
               G P N+PTL    TA + GT+YSATL   +DYF A NI  +NSAPRP G+ + +QAVA
Sbjct  120   FLGSPSNKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIFKNSAPRPNGELKGEQAVA  179

Query  596   LTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIP  775
             L I+GDK++FYNC+  GFQDTLCD   RH +KDCY+EGTVD++FG+ KS++L T+L VI 
Sbjct  180   LRISGDKSAFYNCRLIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIG  239

Query  776   GDQMAMVSAHGRNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIK  952
              +    ++AH RNSE EDTGFSFVHC+V G  +K A LGR W    + +F+YT + + + 
Sbjct  240   DENGNFITAHARNSEAEDTGFSFVHCKVDGTGAKGAYLGRAWQARPRVVFSYTTMSSVVN  299

Query  953   PEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPK  1060
             PEGW     +P+   T  FGEY   G GA   GR K
Sbjct  300   PEGWSN-NFHPERDQTALFGEYKCEGEGANPAGRAK  334



>ref|XP_009136508.1| PREDICTED: putative pectinesterase 63 isoform X1 [Brassica rapa]
Length=364

 Score =   315 bits (806),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 222/330 (67%), Gaps = 6/330 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             L + I+ V++  P  V   D  PIP  K+++E WF  +V  L S +  +DPAL+ AEA P
Sbjct  8     LILTILLVVITWPV-VYGNDATPIPQNKNRIEQWFNNNVPSLASRKDTLDPALLTAEATP  66

Query  263   VYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV + G+  FKT+ EA+ ++P  N +R II +  G+Y E+V ID ++PF+TLYGDP 
Sbjct  67    RVIKVRQNGRGDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPN  126

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGD  613
               P L    TAA+ GT+ SATL VLSDYF A+NI V+NSAP P GKR   QA+++ I+G+
Sbjct  127   AMPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGN  186

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L+TQL V+ GD + +
Sbjct  187   KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRV  245

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++AH   S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   
Sbjct  246   ITAHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWH-E  304

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              T  +   T ++GEY  +GPG++ + R K+
Sbjct  305   NTQTERDKTVFYGEYKCSGPGSRKEKRVKY  334



>ref|XP_011033438.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=377

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/323 (48%), Positives = 214/323 (66%), Gaps = 5/323 (2%)
 Frame = +2

Query  98    VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
             +  ++     V   D  PIPA+ S +  WF+ +V+PL   +  +DPAL+ AEA P  +KV
Sbjct  24    ITAILLVSATVSSDDKSPIPADPSSLNKWFQDNVRPLADRKGTIDPALLAAEAKPRTIKV  83

Query  278   GK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
              K   G+FKT+++A+ +IP  N +R I+ I  G+Y E++KI+  +PFVT  G P N PTL
Sbjct  84    RKDGSGEFKTLKDAINSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGSPGNMPTL  143

Query  452   VAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFY  628
                 TA Q GT+YSATL   +DYF A NI ++NSAPRP G+ + +QAVAL I+GDK++FY
Sbjct  144   SFDGTARQYGTVYSATLEAEADYFVAANIIIKNSAPRPQGQLKGEQAVALRISGDKSAFY  203

Query  629   NCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHG  808
             NC+F GFQDTLCD   RH +KDCY+EGTVD++FG+ KS++L T+LRVI  ++   ++AH 
Sbjct  204   NCRFIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELRVIGDEKGNFITAHA  263

Query  809   RNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
             RN+E EDTGFSFVHC+V G  +K A LGR W    + +F+YT + + + PEGW     +P
Sbjct  264   RNNEAEDTGFSFVHCKVDGTGTKRAYLGRAWQQRPRVVFSYTTMSSVVNPEGWSN-NFHP  322

Query  986   KNGGTCYFGEYNNTGPGAKMDGR  1054
             +   T  FGEY   G GA    R
Sbjct  323   ERDHTALFGEYKCNGEGANPAAR  345



>ref|XP_007216116.1| hypothetical protein PRUPE_ppa018812mg [Prunus persica]
 gb|EMJ17315.1| hypothetical protein PRUPE_ppa018812mg [Prunus persica]
Length=375

 Score =   315 bits (807),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 217/328 (66%), Gaps = 8/328 (2%)
 Frame = +2

Query  95    IVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLK  274
             ++  ++         D+ PIP++ SQV SWF  +V+PL   +  +D ALV AE  P  +K
Sbjct  16    VIITILLAASTTAADDSTPIPSDGSQVGSWFDNNVKPLAERKGALDAALVTAEDGPKLIK  75

Query  275   VGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPT  448
             V K   G FKT+ +A+ +IP RNTKR +++I GG YNE++ I  ++PFVTLYG PKN PT
Sbjct  76    VMKDGSGNFKTLTDAINSIPERNTKRVVVYIGGGVYNEKINIPQNKPFVTLYGSPKNMPT  135

Query  449   LVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASF  625
             L+   TA + GT+YS TL V SDYF A NI V NSAP P G R   QAVAL I+GDKA+F
Sbjct  136   LMFDGTAEKYGTVYSGTLIVESDYFRAANIIVTNSAPEPDGIRSGAQAVALQISGDKAAF  195

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             YNCKF GFQDTL D+   HF+KDCY+EGTVDF+FG  KS++LNT++ V+  + + +++A 
Sbjct  196   YNCKFIGFQDTLYDYKGLHFFKDCYIEGTVDFIFGKGKSLYLNTEIHVLERN-ITVITAQ  254

Query  806   GRNSEKEDTGFSFVHCQVTGNSKV--AVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
              R++  ED GFSFVHC++TG + V    LGR W      +FAYT + N + PE W     
Sbjct  255   QRDA-LEDNGFSFVHCKITGTTYVRSTYLGRAWGSSPTVVFAYTDMANVVHPERWNDF-G  312

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             +P+     ++GE+ N+GPG+ + G+ ++
Sbjct  313   HPERSNNMFYGEFQNSGPGSNISGQARY  340



>ref|XP_002277202.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38546.3| unnamed protein product [Vitis vinifera]
Length=369

 Score =   315 bits (806),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 205/311 (66%), Gaps = 4/311 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D   IP++KSQ+  WFR S+Q  +  R  +DPALV+AE +   +KV K  GG F T+  A
Sbjct  27    DNAQIPSDKSQLAPWFRNSIQKYKLRRTTLDPALVEAEDSVKIIKVSKSGGGNFNTVMAA  86

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             V ++PA NT+R II+I GG+Y E++KID D+PF+T YG P++ P L    TAA+ GT+ S
Sbjct  87    VNSVPAGNTRRVIIWIGGGEYEEKIKIDRDKPFITFYGSPEDMPKLSFDGTAAEFGTVDS  146

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             ATL V SDYF AVNI V NS+PRP GKR   QAVAL ++GDKA+FYNC+  GFQDTLCD 
Sbjct  147   ATLIVESDYFMAVNIIVINSSPRPDGKRKGAQAVALRVSGDKAAFYNCRLIGFQDTLCDD  206

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
               RHF+  CYVEGTVD++FG+ KS++L+T+L        ++++A  RN E ED G+SFVH
Sbjct  207   RGRHFFHGCYVEGTVDYIFGSGKSLYLSTELHTKGDGGFSVITAQARNLESEDNGYSFVH  266

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C ++G      LGR W    K +F+YT++   + P GW     +P+     ++GEY   G
Sbjct  267   CTLSGTGGNTFLGRAWMSRPKVVFSYTFMSPVVSPLGWSN-NIHPERESLVFYGEYKCMG  325

Query  1031  PGAKMDGRPKF  1063
             PGA    R KF
Sbjct  326   PGADTSKRSKF  336



>ref|XP_007207766.1| hypothetical protein PRUPE_ppa026550mg [Prunus persica]
 gb|EMJ08965.1| hypothetical protein PRUPE_ppa026550mg [Prunus persica]
Length=371

 Score =   314 bits (805),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 216/327 (66%), Gaps = 4/327 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             +IV +++      +  D  P+PA+ SQV +WF  +V+  +  +  +DPALV AE     +
Sbjct  14    LIVTLILLTAAIAVANDDTPVPADYSQVNTWFNNNVKSYKERQGTLDPALVTAEVGQTVV  73

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV K   G+FKTI +AV +IPA NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  74    KVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPTNMP  133

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKAS  622
             TL  ++ A + GT+ SAT+   SDYF AVN+ ++NS+P+P      QQA+AL ++G K++
Sbjct  134   TLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSVGQQALALRVSGTKSA  193

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
              +NC+  GFQDTLCD    HF+KDC++EGTVDF+FG+ KS++LNT+L V+  ++M +++A
Sbjct  194   LFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGDNEMTVITA  253

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R+S  EDTG+SFVHC +TG      LGR W    + +FAYT +   I P GW   +  
Sbjct  254   QARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFAYTGMSEVITPAGW-NNKNR  312

Query  983   PKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             P+   T ++GEY  +GPG+ M GR K+
Sbjct  313   PERDSTVFYGEYKCSGPGSNMVGRVKY  339



>ref|XP_003516497.1| PREDICTED: pectinesterase PPME1 [Glycine max]
Length=369

 Score =   314 bits (805),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 212/324 (65%), Gaps = 4/324 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             V + V       V+  DTVPIPA K+Q+  W+  +V PL   +  +DPALV AE     +
Sbjct  12    VTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTMDPALVTAEEGAKVV  71

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV +   G+FKTI +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P
Sbjct  72    KVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMP  131

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKAS  622
              L    TA Q GT+ SATL V SDYF A NI + N+APRP  K    QAVAL I+GDKA+
Sbjct  132   NLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAA  191

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
             FYNCK YGFQDT+CD  NRHF+KDC ++GT+D++FG+ KS++++T+LR +  + + ++ A
Sbjct  192   FYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVIVA  251

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R SE ED  +SFVHC VTG      LGR W  + + +FAY+ + + +   GW     +
Sbjct  252   QARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGWSN-NNH  310

Query  983   PKNGGTCYFGEYNNTGPGAKMDGR  1054
             P++  T  FGEY N+GPGA   GR
Sbjct  311   PEHDKTVRFGEYQNSGPGADPKGR  334



>gb|AAG52566.1|AC010675_14 putative pectin methylesterase; 8433-9798 [Arabidopsis thaliana]
Length=338

 Score =   313 bits (802),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 212/309 (69%), Gaps = 7/309 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFKTIQEAVK  319
             D  PIP  K QV  WF A+V PL   RKG+DPALV AEAAP   ++  GG+FKT+ +A+K
Sbjct  6     DVTPIPEGKPQVAQWFNANVGPLAQ-RKGLDPALVAAEAAP---RIINGGEFKTLTDAIK  61

Query  320   TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSAT  499
             ++PA NTKR II +A G+Y E+V ID ++PF+TL G P   P +    TAA+ GT+ SA+
Sbjct  62    SVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGTVDSAS  121

Query  500   LYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTLCDHNN  676
             L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ A+FYNCKFYGFQDT+CD   
Sbjct  122   LIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTICDDTG  181

Query  677   RHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQ  856
              HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + +++AH   S +E +G+SFVHC+
Sbjct  182   NHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIAAHAGKSAEEKSGYSFVHCK  240

Query  857   VTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPG  1036
             VTG      LGR W  + K ++AYT + + + P GW   +T P +  T ++GEY  +GPG
Sbjct  241   VTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENKT-PAHDKTVFYGEYKCSGPG  299

Query  1037  AKMDGRPKF  1063
             +    R  F
Sbjct  300   SHKAKRVPF  308



>ref|XP_002318197.1| hypothetical protein POPTR_0012s12720g [Populus trichocarpa]
 gb|EEE96417.1| hypothetical protein POPTR_0012s12720g [Populus trichocarpa]
Length=364

 Score =   314 bits (804),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 157/336 (47%), Positives = 219/336 (65%), Gaps = 6/336 (2%)
 Frame = +2

Query  65    METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
             M ++  +   +  +L+     V   D  PIPA+ S + +WF+ +V+PL   +  +DPAL 
Sbjct  1     MGSIAAIQCALTAILLVSTT-VSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALE  59

Query  245   KAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
              AEA P  +KV +   G+FKT+++A+ +IP  NT+R I+ I  G+Y E++KI+  +PFVT
Sbjct  60    AAEAKPRTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERSKPFVT  119

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVA  595
               G P N+PTL    TA + GT+YSATL   +DYF A NI  +NSAPRP G+ + +QAVA
Sbjct  120   FLGSPSNKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIFKNSAPRPNGELKGEQAVA  179

Query  596   LTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIP  775
             L I+GDK++FYNC+  GFQDTLCD   RH +KDCY+EGTVD++FG+ KS++L T+L VI 
Sbjct  180   LRISGDKSAFYNCRLIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIG  239

Query  776   GDQMAMVSAHGRNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIK  952
              +    ++AH RNSE EDTGFSFVHC+V G  +K A LGR W    + +F+YT + + + 
Sbjct  240   DENGNFITAHARNSEAEDTGFSFVHCKVDGTGAKGAYLGRAWQARPRVVFSYTTMSSVVN  299

Query  953   PEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPK  1060
             PEGW     +P+   T  FGEY   G GA   GR K
Sbjct  300   PEGWSN-NFHPERDQTALFGEYKCEGEGANPAGRAK  334



>ref|XP_008234142.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   314 bits (804),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 214/331 (65%), Gaps = 5/331 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGV-IPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +N  +   L+     + +  D  P+PAE++QV +WF  +V+P    +  +DPAL  AEA 
Sbjct  10    VNAALTMTLILLTATIAMADDDTPVPAEQTQVNTWFNNNVKPYTEQKGTLDPALATAEAG  69

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                +KV K   GQFKTI +A+ +IPA NTKR I++I GG+Y E++ I  ++PFVT YG P
Sbjct  70    QTIIKVMKDGSGQFKTITDAINSIPAGNTKRVIVYIGGGEYEEKITIPRNKPFVTFYGSP  129

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITG  610
              N PTL    TA + GT+ SAT+   SDYF A N+  +NS+PRP GK    QAVAL ++G
Sbjct  130   TNMPTLTFGGTAQKYGTVNSATVIAESDYFMAANVIFKNSSPRPDGKAVGAQAVALRVSG  189

Query  611   DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
             +K++ YNCK  GFQDTLCD    HF+KDC++EGTVDF++G+ KS++LNT+L V+  + + 
Sbjct  190   NKSALYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNTELHVVGDNGLT  249

Query  791   MVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             +++A  R+S  +DTG+SFVHC++TG      LGR W      +FAYT +   I P GW  
Sbjct  250   VITAQARDSASDDTGYSFVHCKITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPVGWSN  309

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 P+   T ++GEY ++GPG+ + GR K+
Sbjct  310   -DNRPERDSTVFYGEYKSSGPGSSVAGRVKY  339



>emb|CAB87930.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
Length=342

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 211/310 (68%), Gaps = 5/310 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVG-KGGQFKTIQEAV  316
             D  PIP  K QV  WF   V PL   RKG+DPALV AEAAP  + V  KGG+FKT+ +A+
Sbjct  6     DLTPIPEGKPQVVQWFNTHVGPLAQ-RKGLDPALVAAEAAPRIINVNPKGGEFKTLTDAI  64

Query  317   KTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSA  496
             K++PA NTKR II +A G+Y E+V ID ++PF+TL G P   P +    TAA+ GT+ SA
Sbjct  65    KSVPAGNTKRVIIKMAHGEYREKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGTVDSA  124

Query  497   TLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTLCDHN  673
             +L +LSDYF AVNI V+N+AP P GK +  QA+++ I+G+ A+FYNCKFYGFQDT+CD  
Sbjct  125   SLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTICDDT  184

Query  674   NRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHC  853
               HF+KDCYVEGT DF+FG+  S++L TQL V+ GD + +++AH   S +E +G+SFVHC
Sbjct  185   GNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIAAHAGKSAEEKSGYSFVHC  243

Query  854   QVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGP  1033
             +VTG      LGR W  + K ++AYT + + + P GW   +T P +  T ++GEY  +GP
Sbjct  244   KVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENKT-PAHDKTVFYGEYKCSGP  302

Query  1034  GAKMDGRPKF  1063
             G+    R  F
Sbjct  303   GSHKAKRVPF  312



>ref|XP_008228727.1| PREDICTED: pectinesterase PPME1-like [Prunus mume]
Length=353

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/337 (44%), Positives = 216/337 (64%), Gaps = 7/337 (2%)
 Frame = +2

Query  62    CMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPAL  241
             C++    L V ++ +        +  D  P+PA+ SQV +WF  +V   +  +  +D AL
Sbjct  7     CLDVHAALTVTLILLTATI---AVADDDTPVPADHSQVNTWFNNNVNSYKEQQGMLDHAL  63

Query  242   VKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFV  415
             V AE     +KV K   G+FKTI + + +IPA NTKR I++I GG+YNE++ I  + PFV
Sbjct  64    VTAEVGQTIVKVMKDGSGEFKTITDVINSIPADNTKRVIMYIGGGEYNEKITIPRNIPFV  123

Query  416   TLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAV  592
             T YG P N PTL  A T  + GT+ SAT+   SDYF A N+ ++NS+PRP GK+  +QA+
Sbjct  124   TFYGSPTNMPTLTFAGTTQKYGTVDSATVIAESDYFVAANLIIKNSSPRPDGKKVGEQAL  183

Query  593   ALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVI  772
             AL ++G+K++ +NCK  GFQDTLCD    HF+KDC++EGTVDF+FG+ KS++LNT+L V+
Sbjct  184   ALRVSGNKSALFNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVL  243

Query  773   PGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIK  952
               ++M +++A  R+S  EDTG+SFVHC +TG      LGR W    + +FAYT +   I 
Sbjct  244   GNNEMTVITAQARDSALEDTGYSFVHCNITGTGNGTYLGRAWRTSPRVVFAYTSMFEVIT  303

Query  953   PEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             P GW   +  P+   T ++GEY  +GPG+ M GR K+
Sbjct  304   PAGW-NNKNRPERDSTVFYGEYKCSGPGSSMVGRVKY  339



>ref|XP_007206641.1| hypothetical protein PRUPE_ppa021246mg [Prunus persica]
 ref|XP_007206849.1| hypothetical protein PRUPE_ppa027083mg [Prunus persica]
 gb|EMJ07840.1| hypothetical protein PRUPE_ppa021246mg [Prunus persica]
 gb|EMJ08048.1| hypothetical protein PRUPE_ppa027083mg [Prunus persica]
Length=371

 Score =   313 bits (803),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 216/327 (66%), Gaps = 4/327 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             +IV +++      +  D  P+PA+ SQV +WF  +V+  +  +  +DPALV AE     +
Sbjct  14    LIVTLILLTATIAVANDDTPVPADYSQVNTWFNNNVKSYKERQGTLDPALVTAEVGQTVV  73

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV K   G+FKTI +AV +IPA NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  74    KVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPTNMP  133

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKAS  622
             TL  ++ A + GT+ SAT+   SDYF AVN+ ++NS+P+P      QQA+AL ++G K++
Sbjct  134   TLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSVGQQALALRVSGTKSA  193

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
              +NC+  GFQDTLCD    HF+KDC++EGTVDF+FG+ KS++LNT+L V+  ++M +++A
Sbjct  194   LFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGDNEMTVITA  253

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R+S  EDTG+SFVHC +TG      LGR W    + +FAYT +   I P GW   +  
Sbjct  254   QARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFAYTGMSEVITPAGW-NNKNR  312

Query  983   PKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             P+   T ++GEY  +GPG+ M GR K+
Sbjct  313   PERDSTVFYGEYKCSGPGSNMVGRVKY  339



>ref|XP_008234143.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 213/331 (64%), Gaps = 5/331 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGV-IPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +N  +   L+     + +  D  P+PA++SQV +WF  +V+P    +  +DPAL  AEA 
Sbjct  10    VNAALTMTLILLTATIAMADDDTPVPADQSQVNTWFNNNVKPYTEQQGTLDPALATAEAG  69

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                +KV K   GQFKTI +A+ +IPA NTKR I++I GG+Y E++ I  ++PFVT YG P
Sbjct  70    QTVIKVMKDGSGQFKTITDAINSIPAGNTKRVIVYIGGGEYEEKITIPRNKPFVTFYGSP  129

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITG  610
              N PTL    TA + GT+ SAT+   SDYF A N+  +NS+PRP GK    QAVAL ++G
Sbjct  130   TNMPTLTFGGTAQKYGTVNSATVIAESDYFMAANVIFKNSSPRPDGKAVGAQAVALRVSG  189

Query  611   DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
             +K++ YNCK  GFQDTLCD    HF+KDC++EGTVDF++G+ KS++LNT+L V+  + + 
Sbjct  190   NKSALYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNTRLHVVGDNGLT  249

Query  791   MVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             +++A  R+S  +DTG+SFVHC +TG      LGR W      +FAYT +   I P GW  
Sbjct  250   VITAQARDSASDDTGYSFVHCSITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPAGWSN  309

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 P+   T ++GEY ++GPG+ + GR K+
Sbjct  310   -DNRPERDSTVFYGEYKSSGPGSSVAGRVKY  339



>ref|XP_010038407.1| PREDICTED: putative pectinesterase 63 [Eucalyptus grandis]
 gb|KCW46225.1| hypothetical protein EUGRSUZ_K00113 [Eucalyptus grandis]
Length=372

 Score =   313 bits (801),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 211/331 (64%), Gaps = 5/331 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             L + I+ +L+      +  D +PIPA+KSQV +WF+ +VQ  ++ +  +DP L  AEA P
Sbjct  13    LAIAILSLLIALAQIAVSDDKIPIPADKSQVNAWFQQNVQAFEARKGTLDPNLEAAEAIP  72

Query  263   ---VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                + +     G FKT+ EA+ +IPA N++R I+ IAGG Y E++ I+  +PFVTLYG P
Sbjct  73    PKVIRVSQDGSGDFKTVTEAINSIPAGNSQRVIVSIAGGVYKEKITIERTKPFVTLYGSP  132

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITG  610
              + P L  + TA Q GT+ SA++ V SDYF   N+ + NSAPRP GK    QAVAL  +G
Sbjct  133   NDMPKLTYSGTAQQYGTVDSASIIVESDYFVGANLIIENSAPRPDGKAAGGQAVALRTSG  192

Query  611   DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
             DKA+FYNC+  GFQDTLCD    HF+KDCY+EGTVDF+FG+  SI+LNT+LRV+    ++
Sbjct  193   DKAAFYNCRMLGFQDTLCDDRGFHFFKDCYIEGTVDFIFGSGTSIYLNTELRVLGDSGLS  252

Query  791   MVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             +++A  R S  EDTG+S VHC +TG      LGR W P  + IF+YT + + I P GW  
Sbjct  253   VITAQARQSNTEDTGYSLVHCSITGTGNGTFLGRAWMPSPRVIFSYTDMSSVINPLGWSD  312

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                +P+   T  F EY  +G G+   GR KF
Sbjct  313   -NFHPERQRTVTFAEYKCSGEGSTPAGRAKF  342



>ref|XP_010666416.1| PREDICTED: pectinesterase 2-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   312 bits (800),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 222/329 (67%), Gaps = 7/329 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             LNV++   L+          T+ IP  +++V++WF++ ++P+   +  ++P++++AE   
Sbjct  5     LNVILASFLLVNITFTASAQTL-IPESEAEVDTWFQSVIKPISELKGTLEPSILEAENGG  63

Query  263   VY---LKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-D  430
             V    ++    G+FKTI +AVK +   NTKR II I  G+Y E+++++  + ++T YG D
Sbjct  64    VETLDVRQDGSGKFKTISDAVKHVKVGNTKRVIITIGPGEYREKIQLERMQSYITFYGTD  123

Query  431   PKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTIT  607
             PKNRPT+  A TAA+ G + SATL V SDYF A N+ + NSAPRP GK+   QA A+ I+
Sbjct  124   PKNRPTITFAGTAAEFGAVDSATLIVESDYFVAANLIISNSAPRPDGKKKGAQAAAIRIS  183

Query  608   GDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM  787
             GD+A+FYNCKF GFQ+T+CD    HF+KDCYVEGT DF+FG AKS++LNT+L VIPGD  
Sbjct  184   GDRAAFYNCKFTGFQNTICDDQGNHFFKDCYVEGTADFIFGEAKSLYLNTELHVIPGDGE  243

Query  788   AMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWM  967
             A+++AH R    ++ G+SFVHC+VTG    A+LG  WF  ++ +++Y  IG+ I+PEGW 
Sbjct  244   AIIAAHARKDLDDEGGYSFVHCKVTGTGGNAILGTAWFQAARVVYSYCAIGDVIRPEGWS  303

Query  968   GMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               +  P+   T YFGEY NTGPGA +  R
Sbjct  304   DNK-QPEYQKTTYFGEYKNTGPGADIKKR  331



>ref|XP_003634032.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38547.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   312 bits (800),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/311 (49%), Positives = 205/311 (66%), Gaps = 4/311 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D   IP++KSQ+  WFR S+Q  +  R  +DPALV+AE +   +KV K  GG F T+  A
Sbjct  26    DNAQIPSDKSQLAPWFRNSIQKYKLRRTTLDPALVEAEDSVKIIKVSKSGGGNFNTVMAA  85

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             V ++PA NT+R II+I GG Y E++KID ++PF+T YG P++ P L    TAA+ GT+ S
Sbjct  86    VNSVPAGNTQRVIIWIGGGVYEEKIKIDRNKPFITFYGSPEDMPKLSFDGTAAKFGTVDS  145

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             ATL V SDYF AVNI V NS+PRP GKR   QAVAL ++GDKA+FYNC+  GFQDTLCD 
Sbjct  146   ATLIVESDYFMAVNIIVINSSPRPDGKRKGAQAVALRVSGDKAAFYNCRLIGFQDTLCDD  205

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
               RHF+ +CYVEGTVD++FG+ KS++L+T+L        ++++A  RN E ED G+SFVH
Sbjct  206   RGRHFFHECYVEGTVDYIFGSGKSLYLSTELHTKGDGGFSVITAQARNLEWEDNGYSFVH  265

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C ++G      LGR W    + +F+YT++ + + P GW      P+     ++GEY   G
Sbjct  266   CTLSGTGGNTFLGRAWMSRPRVVFSYTFMSSVVSPLGWSD-NDQPERDSLVFYGEYKCMG  324

Query  1031  PGAKMDGRPKF  1063
             P A    RPKF
Sbjct  325   PAADTSKRPKF  335



>ref|XP_010666418.1| PREDICTED: pectinesterase 1-like [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   311 bits (798),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 217/332 (65%), Gaps = 11/332 (3%)
 Frame = +2

Query  77    RLLNVVIVCVLVFCPGGVIPLDT-VPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE  253
             R  N+++  + +     +  +D    IP   ++VE+WF   V+P+   +  ++P+++ AE
Sbjct  3     RKFNIILASLFLV----IFTIDAQTLIPENAAEVETWFSNVVKPISQAKGALEPSVIDAE  58

Query  254   AAPVY---LKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
                V    ++    G+FKTI +AVK +   N KR II I  G+Y E+VKI+  + ++T Y
Sbjct  59    NGGVETIDVRQDGSGKFKTISDAVKHVKVGNKKRVIITIGPGEYREKVKIERLQSYITFY  118

Query  425   G-DPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVAL  598
             G DPKNRPT+    TAAQ GT+ SATL V SDYF A N+ + NSAPRP GK +  QA A+
Sbjct  119   GTDPKNRPTITFGGTAAQYGTVDSATLIVESDYFVAANLIISNSAPRPNGKTKGGQAAAI  178

Query  599   TITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPG  778
              I+GD+++FYNCKF GFQDT+CD    HF+KDCY+EGTVDF+FG A+SI+LNT+L VIPG
Sbjct  179   RISGDRSAFYNCKFTGFQDTVCDDKGNHFFKDCYIEGTVDFIFGEARSIYLNTELHVIPG  238

Query  779   DQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPE  958
             D  AM++AH R ++    G+SFVHC+VTG   +AVLGR WFP ++ ++++  I N I+PE
Sbjct  239   DLEAMITAHARGNQDGVGGYSFVHCKVTGTGGIAVLGRAWFPAARVVYSFCDISNVIRPE  298

Query  959   GWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             GW   +       T YFGEY N G GA +  R
Sbjct  299   GWSDNKKAAYQ-TTVYFGEYKNKGTGADIKKR  329



>ref|XP_002309337.2| hypothetical protein POPTR_0006s20000g [Populus trichocarpa]
 gb|EEE92860.2| hypothetical protein POPTR_0006s20000g [Populus trichocarpa]
Length=365

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 211/311 (68%), Gaps = 5/311 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D  PIPA+ S +  WF+ +V+PL + +  +DPAL  AEA P  +KV K   G+FKT+++A
Sbjct  26    DKSPIPADPSSLNKWFQDNVRPLANRKGTIDPALKAAEAKPRTIKVRKDGSGEFKTLKDA  85

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IP  N +R I+ I  G+Y E++KI+  +PFVT  G P N PTL    TA + GT+YS
Sbjct  86    INSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGSPSNMPTLSFDGTARKYGTVYS  145

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             ATL   +DYF A NI ++NSAPRP G+ + +QAVAL I+GDK++FYNC+F GFQDTLCD 
Sbjct  146   ATLEAEADYFVAANIIIKNSAPRPKGQLKGEQAVALRISGDKSAFYNCRFIGFQDTLCDD  205

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
               RH +KDCY+EGTVD++FG+ KS++L T+L VI  ++   ++AH RN+E E+TGFSFVH
Sbjct  206   KGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDEKGNFITAHARNNEAENTGFSFVH  265

Query  851   CQVTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNT  1027
             C+V GN +K A LGR W    + +F+YT + + + PEGW     +P+   T  FGEY   
Sbjct  266   CKVDGNGTKRAYLGRAWQQRPRVVFSYTTMSSVVNPEGWSN-NFHPERDHTALFGEYKCK  324

Query  1028  GPGAKMDGRPK  1060
             G GA    R K
Sbjct  325   GEGANPAARAK  335



>ref|XP_007207707.1| hypothetical protein PRUPE_ppa025119mg [Prunus persica]
 gb|EMJ08906.1| hypothetical protein PRUPE_ppa025119mg [Prunus persica]
Length=371

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 147/327 (45%), Positives = 216/327 (66%), Gaps = 4/327 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             +IV +++      +  D  P+PA+ SQV +WF  +V+  +  +  +DPALV AE     +
Sbjct  14    LIVTLILLTAIIAVANDDTPVPADYSQVNTWFNNNVKSYKERQGTLDPALVTAEVGQTVV  73

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV K   G+FKTI +AV +IPA NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  74    KVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPTNMP  133

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKAS  622
             TL  ++ A + GT+ SAT+   SDYF AVN+ ++NS+P+P      QQA+AL ++G K++
Sbjct  134   TLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSVGQQALALRVSGTKSA  193

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
              +NC+  GFQDTLCD    HF+KDC++EGTVDF+FG+ KS++LNT+L V+  ++M +++A
Sbjct  194   LFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGDNEMTVITA  253

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R+S  EDTG+SFVHC +TG      LGR W    + +F+YT +   I P GW   +  
Sbjct  254   QARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFSYTGMSEVITPAGW-NNKNR  312

Query  983   PKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             P+   T ++GEY  +GPG+ M GR K+
Sbjct  313   PERDSTVFYGEYKCSGPGSNMVGRVKY  339



>ref|XP_002530224.1| Pectinesterase U1 precursor, putative [Ricinus communis]
 gb|EEF32171.1| Pectinesterase U1 precursor, putative [Ricinus communis]
Length=368

 Score =   311 bits (798),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 154/335 (46%), Positives = 209/335 (62%), Gaps = 3/335 (1%)
 Frame = +2

Query  65    METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
             M ++  +   I+ VL          DT  IP  +S + SWF A+V+P  S +  ++PAL 
Sbjct  5     MTSLDAIKCAIILVLAVLISTATSDDTEQIPESQSALNSWFEANVKPYASRKGTLNPALE  64

Query  245   KAEAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
              AEA P  +KV     G FKT+ +A+K+IP +NT+R I+ I  G Y E++ +D  +PFVT
Sbjct  65    AAEANPKTIKVRTDGSGDFKTVTDALKSIPVKNTQRVIVDIGPGVYTEKITVDIQKPFVT  124

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVAL  598
             LYG P   PTL    TA + GT  SATL V+SDYF A NI ++N+APRP GK   QAVAL
Sbjct  125   LYGSPNAMPTLAFGGTAKEYGTDDSATLIVMSDYFVAANIIIKNTAPRPNGKPQGQAVAL  184

Query  599   TITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPG  778
              + G KA+ YNC+  GFQDTLCD +  HF+KDCY+EGT+DF+FG  KSI+LN+ + V+  
Sbjct  185   RLWGSKAAIYNCRILGFQDTLCDDHGMHFFKDCYIEGTIDFIFGLGKSIYLNSIIHVVDD  244

Query  779   DQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPE  958
               + +++A   +  KEDTGF FVHC +TG+   A LGR W P  + +FAYT +G  I P 
Sbjct  245   KLLTVITAQAGSDPKEDTGFVFVHCSITGDGTGAFLGRAWMPMPRVVFAYTRMGKVIHPG  304

Query  959   GWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             GW     +P+   T  F EY +TGPG K + R K+
Sbjct  305   GWFN-NFHPERERTVSFAEYKSTGPGYKPNERVKY  338



>ref|XP_002321778.1| hypothetical protein POPTR_0015s12220g [Populus trichocarpa]
 gb|EEF05905.1| hypothetical protein POPTR_0015s12220g [Populus trichocarpa]
Length=362

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/335 (47%), Positives = 213/335 (64%), Gaps = 4/335 (1%)
 Frame = +2

Query  65    METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALV  244
             M T ++  +    +L+         DT PIP E S + SWF A+V+        +DPAL 
Sbjct  1     MSTGKVTGIAAFVILLLVSTTAGSKDTSPIPGEPSSLNSWFHANVKSYTQRNGTLDPALE  60

Query  245   KAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
              AEA P  ++V K   G FKT+  AV++I + NT+R I+ I  G YNE+++I+ ++PFVT
Sbjct  61    TAEAKPKTIRVRKDGSGDFKTLTGAVRSISSGNTQRVIVDIGSGVYNEKIQIEKEKPFVT  120

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVAL  598
               G   + PTL  A TA   GT+YSATL V SDYF A NI ++NS+PRP+GK  +QAVAL
Sbjct  121   FKGSASSMPTLTFAGTARVYGTVYSATLQVDSDYFVASNIIIKNSSPRPSGKLKEQAVAL  180

Query  599   TITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPG  778
              I GDKA+FYNC+  GFQDTLCD   RHF+KDCY+EGTVDF+FG+ KS++L T + V+  
Sbjct  181   RIGGDKAAFYNCRLIGFQDTLCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLGTAINVLAD  240

Query  779   DQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPE  958
               +A+++A  RN E +DTGFSFVHC+V G  K A LGR W    + +FA+T + + + P 
Sbjct  241   QGLAVITAQARNKE-DDTGFSFVHCKVNGIGKWAFLGRAWTERPRVVFAFTTMSSVVNPG  299

Query  959   GWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             GW   + +P+      FGEY   GPG+   GR KF
Sbjct  300   GWSDNQ-HPERDRIVSFGEYKCKGPGSNPSGRVKF  333



>ref|XP_008229317.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=375

 Score =   311 bits (797),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 215/328 (66%), Gaps = 8/328 (2%)
 Frame = +2

Query  95    IVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLK  274
             I+  ++         D+ PIPA+ SQV SWF  +V+PL   +  +D ALV AE  P  +K
Sbjct  16    IIITILLAANTTAADDSTPIPADGSQVGSWFDNNVKPLAECKGELDAALVTAEDGPKLIK  75

Query  275   VGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPT  448
             V K   G FKT+ +A+ +IP RNTKR +++I GG YNE++ I  ++PFVTLYG PKN PT
Sbjct  76    VMKDGSGNFKTLTDAINSIPERNTKRVVVYIGGGVYNEKINIPQNKPFVTLYGSPKNMPT  135

Query  449   LVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASF  625
             L+   TA + GT+YS TL V SDYF A NI V NSAP P G R   QAVAL I+GDKA+F
Sbjct  136   LMFDGTAEKYGTVYSGTLIVESDYFRAANIIVTNSAPEPDGIRSGAQAVALQISGDKAAF  195

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             YNCKF GFQDTL D+   HF+KDCY+EGTVDF+FG  KS++LNT++ VI  + + +++A 
Sbjct  196   YNCKFIGFQDTLYDYKGLHFFKDCYIEGTVDFIFGKGKSLYLNTEIHVIEHN-ITVITAQ  254

Query  806   GRNSEKEDTGFSFVHCQVTGNSKV--AVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
              R++  ED GFSFVHC++TG + V    LGR W      +FAYT + N + PE W     
Sbjct  255   QRDA-LEDNGFSFVHCKITGTTYVRGTYLGRAWGSSPTVVFAYTDMANVVHPERWNDF-G  312

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             +P+     ++GE+ N+ PG+ +  + ++
Sbjct  313   HPERSNNMFYGEFQNSSPGSNISRQARY  340



>ref|XP_010546425.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=362

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 212/313 (68%), Gaps = 5/313 (2%)
 Frame = +2

Query  125   GVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FK  298
              V+  D+ PIP ++++VE WF+A+V PL      +DPALV AEAAP  + V K G   FK
Sbjct  19    AVLAGDSTPIPEDRAEVEEWFKANVAPLAHRNATLDPALVAAEAAPRVITVSKNGDGDFK  78

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
             T++ A+K+IP  N +R II +  G+Y E+V ID ++PF+TLYG P   P L    TAA+ 
Sbjct  79    TLKAAIKSIPKGNQERVIIKMGPGEYREKVTIDRNKPFITLYGRPDAMPVLTYHGTAAKY  138

Query  479   GTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQD  655
             GT+ SA+L VLSDYF AVNI ++NSAP P GK +  QA+A+ I+G+KA+FYNC+F+GFQD
Sbjct  139   GTVDSASLIVLSDYFMAVNIILKNSAPMPDGKMKGAQALAMRISGNKAAFYNCEFHGFQD  198

Query  656   TLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTG  835
             TLCD    HF+KDCY+EGT DF+FG+  SI+LNTQL V+ G+ M +++A    +  + +G
Sbjct  199   TLCDDIGYHFFKDCYIEGTFDFIFGSGTSIYLNTQLNVV-GNGMRVITAQAGKTIADPSG  257

Query  836   FSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGE  1015
             +SFVHC+VTG      LGR W  + K ++AYT + +A+ P GW  + + P    + Y+GE
Sbjct  258   YSFVHCRVTGTGSEIYLGRAWMSHPKVVYAYTEMTSALNPTGWQ-LNSEPDRDSSVYYGE  316

Query  1016  YNNTGPGAKMDGR  1054
             Y   GPG+  + R
Sbjct  317   YKCYGPGSNTEER  329



>dbj|BAB09012.1| pectin methylesterase-like protein [Arabidopsis thaliana]
Length=364

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/338 (47%), Positives = 216/338 (64%), Gaps = 11/338 (3%)
 Frame = +2

Query  59    YCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPA  238
             Y    V +L VVI   +VF        D  PIP  K ++E WF  +V  L S +   DPA
Sbjct  5     YVSLIVTILLVVITSPVVFGN------DAAPIPENKGRIEQWFNTNVPSLASRKSTSDPA  58

Query  239   LVKAEAAPVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPF  412
             L+ AEA P  +KV + G+  FKTI EA+ ++ A NT+R II I  G Y E+V ID  +PF
Sbjct  59    LLTAEAKPRIIKVKQNGRGHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRSKPF  118

Query  413   VTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQA  589
             +TLYG P   P L    TAAQ GT+ SATL VLSDYF AVNI ++NSAP P GKR   QA
Sbjct  119   ITLYGHPNAMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIILKNSAPMPDGKRKGAQA  178

Query  590   VALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRV  769
             +++ I+G+KA+FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L TQL V
Sbjct  179   LSMRISGNKAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNV  238

Query  770   IPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAI  949
             + GD + +++AH   S  E +G+SFVHC+VTG      LGR W  + K ++AYT + + +
Sbjct  239   V-GDGIRVITAHAGKSAAEKSGYSFVHCKVTGTGTGIYLGRSWMSHPKVVYAYTDMSSVV  297

Query  950   KPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              P GW   R   ++  T ++GEY  TG G+  + R K+
Sbjct  298   NPSGWQENREAGRD-KTVFYGEYKCTGTGSHKEKRVKY  334



>ref|XP_006381893.1| hypothetical protein POPTR_0006s20010g [Populus trichocarpa]
 gb|ERP59690.1| hypothetical protein POPTR_0006s20010g [Populus trichocarpa]
Length=365

 Score =   310 bits (795),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/311 (49%), Positives = 211/311 (68%), Gaps = 5/311 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D  PIPA+ S +  WF+ +V+PL + +  +DPAL+ AEA P  +KV K   G+FKT+++A
Sbjct  26    DKSPIPADPSSLNKWFQDNVRPLANRKGTIDPALMAAEAKPRTIKVRKDGSGEFKTLKDA  85

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IP  N +R I+ I  G+Y E++KI+  +PFVT  G P N PTL    TA + GT+YS
Sbjct  86    INSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGSPSNMPTLSFDGTARKYGTVYS  145

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             ATL   +DYF A NI ++NSAPRP G+ + +QAVAL I+GDK++FYNC+F GFQDTLCD 
Sbjct  146   ATLEAEADYFVAANIIIKNSAPRPKGQLKGEQAVALRISGDKSAFYNCRFIGFQDTLCDD  205

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
               RH +KDCY+EGTVD++FG+ KS++L T+L VI  ++   ++AH RN+E E+TGFSFVH
Sbjct  206   KGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDEKGNFITAHARNNEAENTGFSFVH  265

Query  851   CQVTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNT  1027
             C+V G  +K A LGR W    + +F+YT + + + PEGW     +P+   T  FGEY   
Sbjct  266   CKVDGTGTKRAYLGRAWQQRPRVVFSYTTMSSVVNPEGWSN-NFHPERDHTALFGEYKCK  324

Query  1028  GPGAKMDGRPK  1060
             G GA    R K
Sbjct  325   GEGANPAARAK  335



>ref|XP_003517889.1| PREDICTED: pectinesterase PPME1-like [Glycine max]
Length=369

 Score =   309 bits (792),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/308 (49%), Positives = 203/308 (66%), Gaps = 4/308 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D VPIPA K Q+ +WF  +V PL   +  +DPALV AE     +KV +   G+FKTI +A
Sbjct  28    DNVPIPANKEQLGTWFSTNVGPLDQRKSTIDPALVAAEEGAKVVKVMQDGSGEFKTITDA  87

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + ++P  NTKR I+FI  G YNE++KI+  +PFVTLYG P+  P L    TA Q GT+ S
Sbjct  88    INSVPNGNTKRVIVFIGAGNYNEKIKIERTKPFVTLYGVPEKMPNLTFGGTAQQYGTVDS  147

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             ATL V SDYF A NI + N+APRP  K    QAVAL I+GDKA+FYNCK +GFQDT+CD 
Sbjct  148   ATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMFGFQDTICDD  207

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
              N+HF+KDC ++GT+D++FG+ KS++++T+LR +  + + ++ A  R SE ED  +SFVH
Sbjct  208   RNKHFFKDCLIQGTMDYIFGSGKSLYMSTELRTLGDNGITVIVAQARKSETEDNAYSFVH  267

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C VTG      LGR W  + + +FAY+ +   +   GW     +P++  T  FGEY NTG
Sbjct  268   CDVTGTGTGTFLGRAWMSHPRVVFAYSTMSGIVNKLGWSN-NNHPEHDKTVRFGEYQNTG  326

Query  1031  PGAKMDGR  1054
             PGA   GR
Sbjct  327   PGADPKGR  334



>ref|XP_007215602.1| hypothetical protein PRUPE_ppa007761mg [Prunus persica]
 gb|EMJ16801.1| hypothetical protein PRUPE_ppa007761mg [Prunus persica]
Length=356

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/311 (47%), Positives = 205/311 (66%), Gaps = 4/311 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D  P+PA++SQV +WF  +V+P    +  +DPAL  AEA    +KV K   GQFKTI +A
Sbjct  15    DDTPVPADQSQVNTWFNNNVKPYTERQGTLDPALATAEAGQTVIKVMKDGSGQFKTITDA  74

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IPA NTKR I++I  G+Y E++ I  ++PFVT YG P N PTL    TA + GT+ S
Sbjct  75    INSIPADNTKRVIVYIGEGEYEEKITIPRNKPFVTFYGSPTNMPTLTFTGTAQKYGTVNS  134

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             AT+ V SDYF A N+ ++NS+PRP GK    QAVAL ++G+K++ YNCK  GFQDTLCD 
Sbjct  135   ATVIVESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNKSALYNCKLIGFQDTLCDD  194

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
                HF+KDC++EGTVDF++G+ KS++LN +L V+  + + +++A  R+S  +DTG+SF H
Sbjct  195   KGNHFFKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVITAQARDSASDDTGYSFAH  254

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C +TG      LGR W      +FAYT +   I P GW     +P+   T ++GEY  +G
Sbjct  255   CNITGTGNGTYLGRAWRISPMVVFAYTSMSKVINPAGWSN-DNHPERDNTVFYGEYKCSG  313

Query  1031  PGAKMDGRPKF  1063
             PG+ + GR K+
Sbjct  314   PGSSVAGRVKY  324



>ref|XP_002511045.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51647.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=366

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/325 (46%), Positives = 205/325 (63%), Gaps = 3/325 (1%)
 Frame = +2

Query  95    IVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLK  274
             ++   +     VI  D  PIPA + Q+ SWF+A+V+P  S +  +DPAL  AE AP  +K
Sbjct  14    VIAATLLAATTVISDDATPIPAAEDQINSWFQANVKPFSSRKGTLDPALEAAETAPKRIK  73

Query  275   V--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPT  448
             V     G FK++ +A+K+IP+ N  R I+ I  G Y E+V ID  +PFVTL G     PT
Sbjct  74    VRLDGSGDFKSVTDALKSIPSGNEHRVIVDIGAGVYTEKVIIDRIKPFVTLLGSSNPMPT  133

Query  449   LVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFY  628
             L    TA + GT+YSATL V +DYF A NI ++N+APRP G+   QAVAL + GDK +FY
Sbjct  134   LQFDGTAKKYGTVYSATLTVEADYFVAANIIIKNTAPRPDGRAGAQAVALRVAGDKTAFY  193

Query  629   NCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHG  808
             NC+  GFQDT+CD   RHF+KDCY+EGTVDF+FG+ KS++L T L VI    M +++A  
Sbjct  194   NCRILGFQDTVCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLKTNLNVIKEKFMTVITAQA  253

Query  809   RNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPK  988
             +++  ED+GFSFVH  + G++  A LGR W    + +F+Y+ + N + P GW     +P+
Sbjct  254   KHTSSEDSGFSFVHSNIAGDATDAYLGRAWMEMPEVVFSYSKMSNVVIPAGWSNYN-HPE  312

Query  989   NGGTCYFGEYNNTGPGAKMDGRPKF  1063
                  +F EY  +GPGA   GR KF
Sbjct  313   REKNIFFAEYKCSGPGANPSGRAKF  337



>ref|XP_010662219.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
Length=373

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 203/312 (65%), Gaps = 5/312 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D + IP +K+Q+ +WF  +++  +  R  +DP LVKAE     +KV K  GG FKT+ +A
Sbjct  30    DDLQIPNDKTQLTAWFGRTIKNYKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             V ++P  N  R II+I GG Y E++KID  +PFVT YG P + P L    TAA+ GT+ S
Sbjct  90    VNSVPEGNAGRVIIWIGGGVYEEKIKIDRTKPFVTFYGSPDHMPMLSFDGTAAKYGTVDS  149

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             A+L V S YF  VNI V NS+P+P GKR   QAVAL I+GDKA+FYN K  GFQDTLCD 
Sbjct  150   ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM-AMVSAHGRNSEKEDTGFSFV  847
              NRHF+K CY+EGTVDF+FG+ KSIFL+T++  +    M  +++AH RN E EDTG+SFV
Sbjct  210   RNRHFFKKCYIEGTVDFIFGSGKSIFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  848   HCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNT  1027
             HC ++G      LGR W    K +F++TY+ + + P GW     +P      +FGEYN  
Sbjct  270   HCTISGTGSTTFLGRAWMDRPKVVFSHTYMSSVVNPLGWSN-NLHPDRDSMVFFGEYNCL  328

Query  1028  GPGAKMDGRPKF  1063
             GPGA M  R KF
Sbjct  329   GPGANMSRRAKF  340



>ref|XP_010457627.1| PREDICTED: putative pectinesterase 63 [Camelina sativa]
Length=365

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 215/333 (65%), Gaps = 11/333 (3%)
 Frame = +2

Query  74    VRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE  253
             V  L VVI   +VF        D  PIP  K  +E WF  +V  L S +  +DPAL+ AE
Sbjct  10    VTSLLVVITSPVVFAN------DAAPIPQNKGGIEQWFNTNVPSLASRKSTLDPALLAAE  63

Query  254   AAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG  427
             A P  +KV + G  QFKTI EA+K++ A NT R II +  G Y E+V ID ++PF+TLYG
Sbjct  64    AKPRIIKVEQNGRGQFKTITEAIKSVQAGNTGRVIIKVGPGVYKEKVTIDRNKPFITLYG  123

Query  428   DPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTI  604
              P   P L    TA + GT+ SATL VLSDYF A+NI V+NSAP P GK +  QA+++ I
Sbjct  124   HPNAMPVLTYDGTALRYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKMKGAQALSMRI  183

Query  605   TGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQ  784
             +G+KA+FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L TQL V+ GD 
Sbjct  184   SGNKAAFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDG  242

Query  785   MAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW  964
             + +++AH   + +E TG++FVHC+VTG      LGR W  + K ++AYT + + + P GW
Sbjct  243   IRVITAHAGKTAQEKTGYTFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVDPSGW  302

Query  965   MGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                R   ++  T ++GEY  TGPG+    R KF
Sbjct  303   QANRDIGRD-KTVFYGEYKCTGPGSLKAKRVKF  334



>ref|XP_010666417.1| PREDICTED: putative pectinesterase 63 [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 217/332 (65%), Gaps = 11/332 (3%)
 Frame = +2

Query  77    RLLNVVIVCVLVFCPGGVIPLDT-VPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE  253
             R LN+V+    +     +  +D    IP   ++VE+WF   V+P+   +  ++P++++AE
Sbjct  3     RKLNIVLASFFLV----IFRIDAQTLIPENPAEVETWFNNVVKPISQVKGALEPSVIEAE  58

Query  254   AAPVY---LKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLY  424
                V    ++    G+FKTI +AVK +   N KR II I  G+Y E+VKI+  + ++T Y
Sbjct  59    NGGVETIDVRQDGSGKFKTIADAVKHVKVGNKKRVIITIGPGEYREKVKIERLQSYITFY  118

Query  425   G-DPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVAL  598
             G DPKNRPT+  A TAAQ GT+ SATL V SDYF A N+ + NSAPRP GK +  QA A+
Sbjct  119   GTDPKNRPTITFAGTAAQYGTVDSATLIVESDYFVAANLIISNSAPRPDGKTKGGQAAAI  178

Query  599   TITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPG  778
              I+GD+++FYNCKF GFQDT+CD    HF+KDCY+EGTVDF+FG A+SI+LNT+L VIPG
Sbjct  179   RISGDRSAFYNCKFTGFQDTVCDDKGNHFFKDCYIEGTVDFIFGEARSIYLNTELHVIPG  238

Query  779   DQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPE  958
             D  AM++AH R ++    G+SFVHC+VTG    AVLGR WF  ++ ++++  I N I+PE
Sbjct  239   DLEAMITAHARGNQDGVGGYSFVHCKVTGTGSYAVLGRAWFAAARVVYSFCDISNVIRPE  298

Query  959   GWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             GW   +       T YFGEY N G GA +  R
Sbjct  299   GWSDNKKAAYQ-TTVYFGEYKNKGTGADIKKR  329



>gb|KEH38558.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 210/328 (64%), Gaps = 7/328 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +NV I+  L F    V+  D  PIPA ++Q+++WF  +V PL   +  +DP+LV AEAAP
Sbjct  10    INVAIIVAL-FTANVVLSDDLTPIPANRAQLDAWFNTNVGPLAQRKATLDPSLVAAEAAP  68

Query  263   VYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               + V + G+  FKTI +A+ +IP  N KR I+ I GG YNE++KI+  +PFVTLY  P 
Sbjct  69    KVITVMQDGKGDFKTITDAINSIPTGNNKRVIVKIGGGNYNEKIKIERTKPFVTLYAAPG  128

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
               P +    TAA+ GT+ SATL V SDYF A NI + NSAPRP G++  +QAVAL I+GD
Sbjct  129   TMPNITFGGTAAKYGTVDSATLIVESDYFVAANIMLSNSAPRPDGRKAGEQAVALRISGD  188

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             +A+FYNCK  GFQDT+CD  + HF+KDC ++GTVDF+FG+  S++L  +LR +      +
Sbjct  189   RAAFYNCKILGFQDTICDDRHNHFFKDCLIQGTVDFIFGSGTSLYLKNELRALGDAGPTV  248

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW-MG  970
             + A  R S  +   +SFVHC +TG      L R W  Y K I+AY+ + N + P+GW  G
Sbjct  249   IVAQARKSASDADLYSFVHCDITGTGTTTFLARAWMTYPKIIYAYSTMTNVVHPKGWDNG  308

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             M  +P+   T YFGEY NTGP +   GR
Sbjct  309   M--HPEFDKTSYFGEYQNTGPKSDPKGR  334



>emb|CDY23044.1| BnaC07g31430D [Brassica napus]
Length=451

 Score =   310 bits (794),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 218/328 (66%), Gaps = 5/328 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             L + I+ V++  P  V   D  PIP  K+++E WF  +V  L S +  +DPAL+ AEA P
Sbjct  8     LILTILLVVITWPV-VYGNDATPIPQNKNRIEQWFNTNVPSLASRKDKLDPALLTAEATP  66

Query  263   VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
                + G+G  F T+ EA+ ++P  N +R II +  G+Y E+V ID ++PF+TLYG+P   
Sbjct  67    RVRQNGRG-DFNTLTEAINSVPVGNNERVIIKLGHGEYKEKVTIDRNKPFITLYGNPNAM  125

Query  443   PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKA  619
             P L    TAA+ GT+ SATL VLSDYF A+NI V+NSAP P GKR   QA+++ I+G+KA
Sbjct  126   PVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNKA  185

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L+TQL V+ GD + +++
Sbjct  186   AFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRVIT  244

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             AH   S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW    T
Sbjct  245   AHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWH-ENT  303

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               +   T ++GEY  +GPG++   R K+
Sbjct  304   QTERDKTVFYGEYKCSGPGSRKKKRVKY  331



>ref|XP_006286828.1| hypothetical protein CARUB_v10003776mg [Capsella rubella]
 gb|EOA19726.1| hypothetical protein CARUB_v10003776mg [Capsella rubella]
Length=362

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 207/323 (64%), Gaps = 4/323 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             +I  ++ F    V+  D  PIPAEK+QVE WF+A+V+PL   +  +DP L  AEA+P  +
Sbjct  9     LIAFLVAFATPVVLADDITPIPAEKAQVEPWFKANVKPLSERKGTLDPLLEAAEASPRII  68

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  GG F TI  A+K+IP  N KR I+ +A G Y E+V ID  RPFVTL G P    
Sbjct  69    TVNQKGGGDFTTINAAIKSIPLENKKRVIVKLAPGVYKEKVTIDIGRPFVTLLGKPGAET  128

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    T+A+ GT+ SATL + + YF A N+++ N++P P      QA+A+ I GDKA+F
Sbjct  129   NLTFDGTSAKYGTVESATLIIWAQYFMAANLNLINTSPMPKPGTQGQALAMRINGDKAAF  188

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             YNC+FYGFQDTLCD    HF+K+CY+EGT DF+FG   S++LNTQL  + GD + +++AH
Sbjct  189   YNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  247

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
              R ++ E  G+SFVHC++TG+     LGR W  + K ++AYT + + + P GW   RT P
Sbjct  248   NRQNDNEQNGYSFVHCKITGDGTGIYLGRAWMSHPKVVYAYTEMTSVVNPSGWQENRT-P  306

Query  986   KNGGTCYFGEYNNTGPGAKMDGR  1054
              +  T ++GEY  TGPG+    R
Sbjct  307   AHDKTVFYGEYMCTGPGSHKAKR  329



>ref|XP_008449624.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
 ref|XP_008449625.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
 ref|XP_008449626.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
Length=368

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 201/303 (66%), Gaps = 5/303 (2%)
 Frame = +2

Query  143   TVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAV  316
             + PIP EKSQ+++WF  +V+PL   +  +DPALV AE     +KV   G   FKTI EA+
Sbjct  27    STPIPVEKSQIDAWFSQNVKPLADRKAELDPALVAAEENATIIKVMSDGTGDFKTITEAI  86

Query  317   KTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSA  496
              ++PA N KR +I I  G Y E++KID ++PFVTLYG PK  P L     AA+ GT+YSA
Sbjct  87    ASVPADNKKRVMISIGDGIYKEKLKIDRNKPFVTLYGSPKGMPKLTFDGDAAKFGTVYSA  146

Query  497   TLYVLSDYFSAVNIDVRNSAPRPTG-KRDQQAVALTITGDKASFYNCKFYGFQDTLCDHN  673
             TL V +DYF+A N+ + NS+PRP G ++  QA+A    G KA+ YNCKF GFQDTLCD +
Sbjct  147   TLIVEADYFTAANLVIENSSPRPDGVRKGAQALAARFMGTKAAIYNCKFTGFQDTLCDDD  206

Query  674   NRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHC  853
               HFYKDC+++GTVDF+FG   S+++NTQL V     +A+++AH R  E + +G+SFVHC
Sbjct  207   GLHFYKDCFIQGTVDFIFGKGTSLYVNTQLDVAGDGGLAVITAHSREQESDGSGYSFVHC  266

Query  854   QVTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
              +TG   K   LGR W P S+ +FAYT + + I PEGW  M+ +     T  FGEY  +G
Sbjct  267   SITGTGGKNTFLGRAWMPRSRVVFAYTTMADIIHPEGWNDMK-HAGFDKTVMFGEYKCSG  325

Query  1031  PGA  1039
             PG+
Sbjct  326   PGS  328



>emb|CBI38549.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 203/312 (65%), Gaps = 5/312 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D + IP +K+Q+ +WF  +++  +  R  +DP LVKAE     +KV K  GG FKT+ +A
Sbjct  30    DDLQIPNDKTQLTAWFGRTIKNYKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             V ++P  N  R II+I GG Y E++KID  +PFVT YG P + P L    TAA+ GT+ S
Sbjct  90    VNSVPEGNAGRVIIWIGGGVYEEKIKIDRTKPFVTFYGSPDHMPMLSFDGTAAKYGTVDS  149

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             A+L V S YF  VNI V NS+P+P GKR   QAVAL I+GDKA+FYN K  GFQDTLCD 
Sbjct  150   ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM-AMVSAHGRNSEKEDTGFSFV  847
              NRHF+K CY+EGTVDF+FG+ KSIFL+T++  +    M  +++AH RN E EDTG+SFV
Sbjct  210   RNRHFFKKCYIEGTVDFIFGSGKSIFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  848   HCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNT  1027
             HC ++G      LGR W    K +F++TY+ + + P GW     +P      +FGEYN  
Sbjct  270   HCTISGTGSTTFLGRAWMDRPKVVFSHTYMSSVVNPLGWSN-NLHPDRDSMVFFGEYNCL  328

Query  1028  GPGAKMDGRPKF  1063
             GPGA M  R KF
Sbjct  329   GPGANMSRRAKF  340



>ref|XP_004140272.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=364

 Score =   306 bits (785),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/304 (48%), Positives = 204/304 (67%), Gaps = 4/304 (1%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKV-GKG-GQFKTIQEAVKT  322
             +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV G G G FKTI EA+ +
Sbjct  27    VPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMGDGTGDFKTITEAIAS  86

Query  323   IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
             +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  87    VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLSFDGVASKYGTVYSATL  146

Query  503   YVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRH  682
              V +DYF A N+ + N++PRP G+++ QA+A    G K++FYNCKF+GFQDTLCD +  H
Sbjct  147   IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFFGFQDTLCDDDGLH  206

Query  683   FYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVT  862
              YKDC+++GTVDFVFG   S++LNT+L V+   Q A+++AH R  E + +G+SFVHC +T
Sbjct  207   LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  266

Query  863   GNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAK  1042
             GN K   LGR W P S+ IFAYT + + I PEGW  M+ +     T  FGEY  +GPGA 
Sbjct  267   GNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWNDMK-HAGFDKTVMFGEYKCSGPGAV  325

Query  1043  MDGR  1054
               GR
Sbjct  326   STGR  329



>ref|XP_007222175.1| hypothetical protein PRUPE_ppa007766mg [Prunus persica]
 ref|XP_007224100.1| hypothetical protein PRUPE_ppa015611mg [Prunus persica]
 gb|EMJ23374.1| hypothetical protein PRUPE_ppa007766mg [Prunus persica]
 gb|EMJ25299.1| hypothetical protein PRUPE_ppa015611mg [Prunus persica]
Length=356

 Score =   306 bits (784),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 203/311 (65%), Gaps = 4/311 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D  PIPA + QV +WF  +V+P    +  +DPAL  AEA    +KV K   GQFKTI +A
Sbjct  15    DDTPIPANQPQVNTWFNNNVKPYTERQGTLDPALATAEAGQTVIKVMKDGSGQFKTITDA  74

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IPA NTKR I++I  GKY E++ I  ++PFVT +G P N PTL  A TA + GT+ S
Sbjct  75    INSIPADNTKRVIVYIGEGKYEEKITIPRNKPFVTFFGSPTNMPTLTFAGTAQKYGTVNS  134

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             AT+ V SDYF A N+ ++NS+PRP GK    QAVAL ++G+K++ YNCK  GFQDT CD 
Sbjct  135   ATVIVESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNKSALYNCKLIGFQDTFCDD  194

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
                HF KDC++EGTVDF++G+ KS++LN +L V+  + + +++A  R+S  +DTG+SFVH
Sbjct  195   KGNHFLKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVITAQARDSSSDDTGYSFVH  254

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C++TG      LGR W      +FAYT +   I P GW     +P+   T ++GEY  +G
Sbjct  255   CKITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPAGWSD-DNHPERDNTVFYGEYKCSG  313

Query  1031  PGAKMDGRPKF  1063
             PG+   GR K+
Sbjct  314   PGSSAAGRVKY  324



>ref|XP_006399226.1| hypothetical protein EUTSA_v10013913mg [Eutrema salsugineum]
 gb|ESQ40679.1| hypothetical protein EUTSA_v10013913mg [Eutrema salsugineum]
Length=361

 Score =   306 bits (784),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 211/332 (64%), Gaps = 9/332 (3%)
 Frame = +2

Query  83    LNVVIVCVLV-FCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +++ IV   V F    V+  DT PIP ++SQ+  WF+ +V P    +  +DPAL  AEA+
Sbjct  4     ISLAIVAFFVAFASPVVLATDTAPIPEDRSQIPEWFKTNVAPYSQRKGTLDPALDAAEAS  63

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                + V +  GG FKTI EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P
Sbjct  64    RQVITVDQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQP  123

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGD  613
              +   L    TAAQ GT+ SATL + SDYF A N+ ++N++P P      QA+A+ I GD
Sbjct  124   GSETVLTYHGTAAQYGTVESATLIIWSDYFMAANLIIKNTSPMPKPGSQGQALAMRINGD  183

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FY+CKF+GFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +
Sbjct  184   KAAFYSCKFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++AH R SE E  G++FVHC+VTG      LGR W  + K I+A+T + + + P GW   
Sbjct  243   ITAHARESENEQNGYTFVHCKVTGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGW---  299

Query  974   RTNPKNG--GTCYFGEYNNTGPGAKMDGRPKF  1063
             + N ++G   T ++GEY   GPG+ ++ R  F
Sbjct  300   KENLQHGYDKTVFYGEYKCFGPGSHLEKRVPF  331



>ref|XP_009362807.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=368

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 219/331 (66%), Gaps = 7/331 (2%)
 Frame = +2

Query  86    NVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPV  265
             +++I+ +++      I  DT+PIP++ SQV SWF  +V+     +  +DPALV AE AP 
Sbjct  13    SLMIITIILTSSTAAIADDTIPIPSDSSQVASWFDNNVKTYNVRKSTLDPALVAAEHAPQ  72

Query  266   YLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V +  GG FKTI +A+ +IPA NTKR  ++I GG YNE++ I  ++PFVTLYG PK+
Sbjct  73    VINVMQDGGGNFKTITDAINSIPAGNTKRVFVYIKGGVYNEKITIPHNKPFVTLYGSPKS  132

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDK  616
              P +    TA + GT+YS TL V SDYF AVN+ + NSAP P G R+  QAVAL I+G+K
Sbjct  133   MPNITFDGTAQKYGTVYSGTLIVESDYFKAVNLVIINSAPEPDGIREGAQAVALQISGNK  192

Query  617   ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMV  796
             A+FYNCK  G+QDTL D+   H +KDC+++GTVDF+FG  KS++LNT++ V+  + + ++
Sbjct  193   AAFYNCKMIGYQDTLYDYKGLHLFKDCFIQGTVDFIFGKGKSLYLNTEIHVVERN-LTVI  251

Query  797   SAHGRNSEKEDTGFSFVHCQVTGNS--KVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             +A  R+S  ED+GFSFVHC++TG +  +   LGR W      + AYT I + + PE W  
Sbjct  252   TAQQRDSASEDSGFSFVHCKITGTTYARRTYLGRAWGSSPNVVVAYTDIADIVHPERWSD  311

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                +P+     ++GEYNN G G+ + G+ ++
Sbjct  312   F-GHPERESNLFYGEYNNWGQGSNITGQARY  341



>gb|EYU20154.1| hypothetical protein MIMGU_mgv1a008641mg [Erythranthe guttata]
Length=367

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 217/341 (64%), Gaps = 10/341 (3%)
 Frame = +2

Query  65    MET----VRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVD  232
             MET    +  LN V+V VL+  P       + PIPA+ SQ+ SWF  +V    S +  + 
Sbjct  1     METKSSYIFTLNAVLVTVLLSLPVARSGGGSEPIPADASQINSWFNKNVGDAASRKATLA  60

Query  233   PALVKAEAAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDR  406
             P L  AEA P  +KV     G FKTI +AVK+IP  N  R I+ I  GKY E+V +  ++
Sbjct  61    PELAAAEANPKVIKVRADGSGDFKTINDAVKSIPDGNKNRVIVSIGPGKYKEKVTVGANK  120

Query  407   PFVTLYGDPKNRPTLVAATTAAQV-GTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-D  580
             PFVTL GD  N PT+V   TA +  G +YSATL   SDYFSAVN+ V N+APRP GK  D
Sbjct  121   PFVTLRGDAGNMPTIVYDDTAKKSKGVVYSATLSAESDYFSAVNLKVVNTAPRPDGKMVD  180

Query  581   QQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQ  760
              QAVAL I G  AS YNCK YGFQDTL D   +HFYKDCY+EGT DF++G+A SI+LNT+
Sbjct  181   AQAVALKIIGKYASIYNCKLYGFQDTLFDDKGKHFYKDCYIEGTYDFIWGSAASIYLNTE  240

Query  761   LRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIG  940
             L +I GD +A+++A+ R++  E  G+ F HC+VTG   +  LGR W+PY++ ++A++ +G
Sbjct  241   LHIISGDPLAVIAANARSASAEPNGYVFAHCKVTGTGAMGYLGRSWYPYARVVYAFSDLG  300

Query  941   NAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             +A+ P+GW       K+  T YFGEYNN G   K D R  F
Sbjct  301   DAVNPDGW--YTGTGKDNKTVYFGEYNNKGSAGKFDKRASF  339



>ref|XP_010523318.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=364

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/328 (47%), Positives = 207/328 (63%), Gaps = 5/328 (2%)
 Frame = +2

Query  89    VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY  268
             V ++ VL   P  V+  D  PIP  K QV  WF A VQP    +  +DPAL  AE++P  
Sbjct  9     VALLMVLASPPPAVLANDVTPIPENKGQVNPWFNAQVQPFSRRKATLDPALAAAESSPRV  68

Query  269   LKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
             ++V K  GG F T+  A+ +IP+ N +R II +  G+Y E+V I   +PFVTLYG P   
Sbjct  69    IRVNKNGGGDFNTLTAAINSIPSGNARRVIIKLGPGEYREKVTIGRTKPFVTLYGQPNAM  128

Query  443   PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQ-QAVALTITGDKA  619
             P L     A Q GT  SATL VLSDYF+AVNI V+N+AP+P  +RD  QA+A+ I+G+KA
Sbjct  129   PVLTFNGKATQYGTFNSATLIVLSDYFTAVNIIVKNTAPKPDPRRDDGQALAMRISGNKA  188

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +FYNCKFYGFQDTLCD    HF+KDCYVEGT DF+FGN  S+++ T +  + G+ + ++S
Sbjct  189   AFYNCKFYGFQDTLCDDTGNHFFKDCYVEGTFDFIFGNGTSLYIGTLIHAV-GNGIRVIS  247

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             A G  S K+ +G+SFVHC+VTG  +   LGR W  + K I+AYT + + + P GW    T
Sbjct  248   AQGAQSAKDPSGYSFVHCKVTGEGEGIYLGRAWRTHPKVIYAYTEMTSVVNPAGWQN-NT  306

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                   T ++GEY   GPG+  + R  F
Sbjct  307   EKARQKTVFYGEYKCFGPGSHQEKRVPF  334



>ref|XP_010452709.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 205/323 (63%), Gaps = 4/323 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             +I  ++VF P  V+  D  PIPAEK+QVE WF+A+VQP  + R  +DPAL  AEA+P  +
Sbjct  9     LIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPALEAAEASPRII  68

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  GG F +I  A+K+IP  N  R II +A G Y E+V +D  RPFVTL G P    
Sbjct  69    TVNQKGGGDFTSINAAIKSIPVGNKIRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPGAET  128

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    T+A+ GT+ SATL V + YF A N+ + N+AP P      QA+A+ I  DKA+F
Sbjct  129   NLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQGQALAMRINADKAAF  188

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             YNC+FYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +++AH
Sbjct  189   YNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  247

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
              R +  + +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   R   
Sbjct  248   NRQNSNDQSGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPSGWQENRVR-  306

Query  986   KNGGTCYFGEYNNTGPGAKMDGR  1054
             ++  T ++GEY  TGPG+    R
Sbjct  307   EHDKTVFYGEYMCTGPGSHKAKR  329



>emb|CAN66682.1| hypothetical protein VITISV_005088 [Vitis vinifera]
Length=373

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 202/312 (65%), Gaps = 5/312 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D + IP +K+Q+ +WF  +++  +  R  +DP LVKAE     +KV K  GG FKT+ +A
Sbjct  30    DDLQIPNDKTQLTAWFGRTIKNHKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             V ++P  N  R II+  GG Y E++KID  +PFVT YG P   P L    TAA+ GT+ S
Sbjct  90    VNSVPXGNXXRVIIWXGGGVYEEKIKIDRTKPFVTFYGSPDXMPMLSFDGTAAKYGTVDS  149

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             A+L V S YF  VNI V NS+P+P GKR   QAVAL I+GDKA+FYN K  GFQDTLCD 
Sbjct  150   ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM-AMVSAHGRNSEKEDTGFSFV  847
              NRHF+K+CY+EGTVDF+FG+ KS+FL+T++  +    M  +++AH RN E EDTG+SFV
Sbjct  210   RNRHFFKECYIEGTVDFIFGSGKSLFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  848   HCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNT  1027
             HC ++G      LGR W    K +F++TY+ + + P GW     +P      +FGEYN  
Sbjct  270   HCTISGTGSTTFLGRAWMDRPKVVFSHTYMSSVVNPLGWSN-NLHPDRDSMVFFGEYNCL  328

Query  1028  GPGAKMDGRPKF  1063
             GPGA M  R KF
Sbjct  329   GPGANMSRRAKF  340



>ref|XP_008219199.1| PREDICTED: pectinesterase PPME1-like [Prunus mume]
Length=374

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 204/311 (66%), Gaps = 4/311 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D  P+PA++ QV +WF  +V+P    +  +DPAL  AEA    +KV K   GQFKTI +A
Sbjct  33    DDTPVPADQPQVNTWFNNNVKPYTERQGTLDPALATAEAGQTVIKVMKDGSGQFKTITDA  92

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IPA NTKR I++I  G+Y E++ I  ++PFVT +G P N PTL  A TA + GT+ S
Sbjct  93    INSIPADNTKRVIVYIGEGEYEEKITIPRNKPFVTFFGSPTNMPTLTFAGTAQKYGTVNS  152

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             AT+   SDYF A N+ ++NS+PRP GK    QAVAL ++G+K++ YNCK  GFQDTLCD 
Sbjct  153   ATVIAESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNKSALYNCKLIGFQDTLCDD  212

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
                HF+KDC++EGTVDF++G+ KS++LN +L V+  + + +++A  R+S  +DTG+SFVH
Sbjct  213   KGNHFFKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVITAQARDSASDDTGYSFVH  272

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C++TG      LGR W      +FAYT +   I P GW      P+   T ++GEY  +G
Sbjct  273   CKITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPAGWSN-DNRPERDNTVFYGEYKCSG  331

Query  1031  PGAKMDGRPKF  1063
             PG+   GR K+
Sbjct  332   PGSSAAGRVKY  342



>gb|KGN48071.1| hypothetical protein Csa_6G428040 [Cucumis sativus]
Length=339

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/304 (48%), Positives = 203/304 (67%), Gaps = 4/304 (1%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKV-GKG-GQFKTIQEAVKT  322
             +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV G G G FKTI EA+ +
Sbjct  2     VPVDKTQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMGDGTGDFKTITEAIAS  61

Query  323   IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
             +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  62    VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLSFDGVASKYGTVYSATL  121

Query  503   YVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRH  682
              V +DYF A N+ + N++PRP G+++ QA+A    G K++FYNCKF GFQDTLCD +  H
Sbjct  122   IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFLGFQDTLCDDDGLH  181

Query  683   FYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVT  862
              YKDC+++GTVDFVFG   S++LNT+L V+   Q A+++AH R  E + +G+SFVHC +T
Sbjct  182   LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  241

Query  863   GNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAK  1042
             GN K   LGR W P S+ IFAYT + + I PEGW  M+ +     T  FGEY  +GPGA 
Sbjct  242   GNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWNDMK-HAGFDKTVMFGEYKCSGPGAV  300

Query  1043  MDGR  1054
               GR
Sbjct  301   STGR  304



>gb|KGN48072.1| hypothetical protein Csa_6G428290 [Cucumis sativus]
Length=368

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/332 (44%), Positives = 213/332 (64%), Gaps = 6/332 (2%)
 Frame = +2

Query  74    VRLLNVVIVCVLVFCPG--GVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKG-VDPALV  244
             +R+  + I  ++ F      ++ + +  +P +K+Q+E+WF  +V+P     K  +DPA+V
Sbjct  3     LRMDALAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAVV  62

Query  245   KAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
              AE     +KV   G   FKT+ EA+ ++P  N  R +I+I  G Y E++ I+ ++PF+T
Sbjct  63    AAEGNVTIVKVMSDGTGDFKTVTEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFIT  122

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVAL  598
             L G PKN PTL     A++ GT+YSATL V +DYF A N+ + N++PRP G+++ QA+A 
Sbjct  123   LCGTPKNVPTLTFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNGRKEAQALAA  182

Query  599   TITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPG  778
                G K++FYNCKF GFQDTLCD +  H YKDC+++GTVDFVFG   S++LNT+L V+  
Sbjct  183   RFRGTKSAFYNCKFLGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGE  242

Query  779   DQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPE  958
              Q A+++AH R  E + +G+SFVHC +TGN K   LGR W P S+ IFAYT + + I PE
Sbjct  243   GQFAVITAHSREQEADASGYSFVHCSITGNGKDTFLGRAWMPRSRVIFAYTSMIDIIHPE  302

Query  959   GWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             GW  M+ +     T  FGEY  +GPGA   GR
Sbjct  303   GWNDMK-HAGFDKTVMFGEYKCSGPGAVSTGR  333



>ref|XP_006485036.1| PREDICTED: pectinesterase PPME1-like [Citrus sinensis]
Length=370

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 203/307 (66%), Gaps = 4/307 (1%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTI  325
             IP EKSQ+ESWF A+V+P    +  +DPAL  A+A    +KV +   G+FKTI +A+ +I
Sbjct  34    IPPEKSQIESWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDAINSI  93

Query  326   PARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLY  505
             P  NTKR I+ I  G+Y E++KID  +PF+T YG P   P +    TA + GT+ SATL 
Sbjct  94    PQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDSATLI  153

Query  506   VLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDHNNRH  682
             V SDYF AVNI + NS+PRP GKR+  QAVAL I+G KA+FYNCK  GFQDTLCD    H
Sbjct  154   VESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDDRGNH  213

Query  683   FYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVT  862
             F+KDC+++GTVDF+FG+ KS++L+T+LR +    + +++AH R SE ED GF+FVHC + 
Sbjct  214   FFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVHCTIE  273

Query  863   GNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAK  1042
             G+     LGR W    + ++AYT +GN +   GW      P+   T ++GEY  +GPGA 
Sbjct  274   GSGNGTYLGRAWKNSPRVVYAYTTMGNVVNRAGWSD-NFRPERRQTVFYGEYKCSGPGAS  332

Query  1043  MDGRPKF  1063
                R ++
Sbjct  333   PAERVEY  339



>gb|KFK27921.1| hypothetical protein AALP_AA8G447400 [Arabis alpina]
Length=364

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/328 (47%), Positives = 214/328 (65%), Gaps = 5/328 (2%)
 Frame = +2

Query  89    VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY  268
             +VI  ++V     V   D  PIP  K  +E WF+ +V  L S +  +D AL+ AE AP  
Sbjct  9     IVIALLVVVTSPVVFGNDASPIPENKFGIEQWFKTNVPSLASRKGTLDQALLIAETAPRV  68

Query  269   LKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
             +KV K G+  FKTI EA+K++   NT+R II I  G Y E++ ID ++PF+TLYG P   
Sbjct  69    IKVKKNGRGHFKTITEAIKSVREGNTRRVIIKIGPGVYKEKITIDRNKPFITLYGHPNAM  128

Query  443   PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKA  619
             P L    TA Q GT+ SATL V+SDYF AVNI V+NSAP P GK +  QA+++ I+G+KA
Sbjct  129   PVLTYDGTALQYGTVDSATLIVMSDYFMAVNIIVKNSAPMPDGKMKGAQALSMRISGNKA  188

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L+TQL V+ GD + +++
Sbjct  189   AFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLHVV-GDGIRVIT  247

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             AH   +  E++G++FVHC VTG      LGR W  Y K ++AYT + + + P GW   R 
Sbjct  248   AHAGKATVENSGYTFVHCTVTGTGTGIYLGRAWMSYPKVVYAYTDMSSVVNPSGWQENRE  307

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               ++  T ++GEY  TG G+  + R KF
Sbjct  308   TGQD-KTVFYGEYKCTGTGSHKEKRVKF  334



>ref|XP_006437032.1| hypothetical protein CICLE_v10031872mg [Citrus clementina]
 gb|ESR50272.1| hypothetical protein CICLE_v10031872mg [Citrus clementina]
Length=370

 Score =   304 bits (779),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 203/307 (66%), Gaps = 4/307 (1%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTI  325
             IP EKSQ+ESWF A+V+P    +  +DPAL  A+A    +KV +   G+FKTI +A+ +I
Sbjct  34    IPPEKSQIESWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDAINSI  93

Query  326   PARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLY  505
             P  NTKR I+ I  G+Y E++KID  +PF+T YG P   P +    TA + GT+ SATL 
Sbjct  94    PQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDSATLI  153

Query  506   VLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDHNNRH  682
             V SDYF AVNI + NS+PRP GKR+  QAVAL I+G KA+FYNCK  GFQDTLCD    H
Sbjct  154   VESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDDRGNH  213

Query  683   FYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVT  862
             F+KDC+++GTVDF+FG+ KS++L+T+LR +    + +++AH R SE ED GF+FVHC + 
Sbjct  214   FFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVHCTIE  273

Query  863   GNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAK  1042
             G+     LGR W    + ++AYT +GN +   GW      P+   T ++GEY  +GPGA 
Sbjct  274   GSGNGTYLGRAWKNSPRVVYAYTTMGNVVNRAGWSD-NFRPERRQTVFYGEYKCSGPGAS  332

Query  1043  MDGRPKF  1063
                R ++
Sbjct  333   PAERVEY  339



>ref|XP_004156059.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
 gb|KGN48070.1| hypothetical protein Csa_6G428030 [Cucumis sativus]
Length=370

 Score =   304 bits (778),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 201/308 (65%), Gaps = 7/308 (2%)
 Frame = +2

Query  149   PIPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVK  319
             PIP EKSQ+  WF  +V+P     K  +DPAL  AE     +KV   G   FKT+ EA+ 
Sbjct  29    PIPVEKSQLAGWFTENVKPFAVRNKAELDPALATAEENATVIKVMSDGTGNFKTVTEAIA  88

Query  320   TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSA  496
             ++PA N KR +I+I  G Y E++KID ++PFVTLYG DPKN P L     AA+ GT+YSA
Sbjct  89    SVPADNKKRVVIWIGVGVYKEKLKIDRNKPFVTLYGSDPKNMPKLTFDGDAAKYGTVYSA  148

Query  497   TLYVLSDYFSAVNIDVRNSAPRPTG-KRDQQAVALTITGDKASFYNCKFYGFQDTLCDHN  673
             TL V +DYF+A N+ + NS+PRP G ++  QA+A    G KA+ YNCKF GFQDTLCD +
Sbjct  149   TLIVEADYFTAANLIIENSSPRPDGVRKGAQALAARFMGTKAAIYNCKFLGFQDTLCDDD  208

Query  674   NRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHC  853
               HFYKDC+++GTVDF+FG   S++LNTQL V     +A+++AH R  E + +G+SFVHC
Sbjct  209   GLHFYKDCFIQGTVDFIFGKGTSLYLNTQLDVAGDGGLAVITAHSREQEADTSGYSFVHC  268

Query  854   QVTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
              +TG   K   LGR W P S+ +FAYT I + I PEGW  M+ +     T  FGEY  +G
Sbjct  269   SITGTGGKNTYLGRAWMPRSRVVFAYTTIADIIHPEGWNDMK-HAGFDKTVMFGEYKCSG  327

Query  1031  PGAKMDGR  1054
             PGA   GR
Sbjct  328   PGAVSTGR  335



>ref|XP_010491360.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 203/323 (63%), Gaps = 4/323 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             +I  ++VF P  V+  D  PIPAEK+QVE WF+A+VQP  + R  +DP L  AEA+P  +
Sbjct  9     LIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPDLEAAEASPRII  68

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  GG F +I  A+K+IP  N  R II +A G Y E+V +D  RPFVTL G P    
Sbjct  69    TVNQKGGGDFTSINAAIKSIPVGNKVRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPGAET  128

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    T+A+ GT+ SATL V + YF A N+ + N+AP P      QA+A+ I  DKA+F
Sbjct  129   NLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQGQALAMRINADKAAF  188

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             YNC+FYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +++AH
Sbjct  189   YNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  247

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
              R +  + +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   R   
Sbjct  248   NRQNSNDQSGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPSGWQENRVRA  307

Query  986   KNGGTCYFGEYNNTGPGAKMDGR  1054
              +  T ++GEY  TGPG+    R
Sbjct  308   HD-KTVFYGEYMCTGPGSHKAKR  329



>ref|XP_008449623.1| PREDICTED: putative pectinesterase 63 [Cucumis melo]
Length=369

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/341 (45%), Positives = 217/341 (64%), Gaps = 10/341 (3%)
 Frame = +2

Query  56    EYCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKG-VD  232
             +YC+  +RL   ++            PL    IP EKSQ++ W+  +V+   +  K  +D
Sbjct  2     KYCINALRLTRWIMFLEAFAAILAASPL----IPTEKSQLDEWYWENVKAFGNRNKAELD  57

Query  233   PALVKAEAAPVYLKV-GKG-GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDR  406
             P LV AE +   +KV G G G FKTI EA++++P  NTKR +I+I GG Y E++KID ++
Sbjct  58    PELVAAEESATVIKVRGDGSGDFKTIAEAIESVPIGNTKRIVIWIGGGVYKEKLKIDRNK  117

Query  407   PFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTG-KRDQ  583
             PFVTLYG P N P L     A++ GT+YSATL V +DYF+A N+ + NS+PRP G ++  
Sbjct  118   PFVTLYGSPNNMPNLTFDGDASKYGTVYSATLIVEADYFTAANLVIENSSPRPDGVRKGA  177

Query  584   QAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQL  763
             QA+A  I G+KA+ YNCKF GFQDTLCD +  H YKDC+++GTVDF+FG   S++LNTQL
Sbjct  178   QALAARIRGNKAAIYNCKFIGFQDTLCDDDGLHLYKDCFIQGTVDFIFGKGTSLYLNTQL  237

Query  764   RVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTIFAYTYIG  940
              V+    + +++AH R+ E + +G+SFVHC +TG   +   LGR W P S+ +FAYT + 
Sbjct  238   DVVGNGGLGVIAAHSRDQESDGSGYSFVHCSITGTGGRNTYLGRAWRPRSRVVFAYTTMA  297

Query  941   NAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             + I PEGW  M     +  T  FGEY   GPG+K   R K+
Sbjct  298   DIIHPEGWNDMNHFGYD-KTVLFGEYKCWGPGSKSSERVKY  337



>ref|XP_004140273.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=364

 Score =   303 bits (776),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/304 (47%), Positives = 201/304 (66%), Gaps = 4/304 (1%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKT  322
             +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV   G   FKT+ EA+ +
Sbjct  27    VPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMSDGTGDFKTVTEAIAS  86

Query  323   IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
             +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  87    VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLTFDGVASKYGTVYSATL  146

Query  503   YVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRH  682
              V +DYF A N+ + N++PRP G+++ QA+A    G K++FYNCKF GFQDTLCD +  H
Sbjct  147   IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFLGFQDTLCDDDGLH  206

Query  683   FYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVT  862
              YKDC+++GTVDFVFG   S++LNT+L V+   Q A+++AH R  E + +G+SFVHC +T
Sbjct  207   LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  266

Query  863   GNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAK  1042
             GN K   LGR W P S+ IFAYT + + I PEGW  M+ +     T  FGEY  +GPG+ 
Sbjct  267   GNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWNDMK-HAGFDKTVMFGEYKCSGPGSV  325

Query  1043  MDGR  1054
               GR
Sbjct  326   STGR  329



>ref|XP_007153340.1| hypothetical protein PHAVU_003G027000g [Phaseolus vulgaris]
 gb|ESW25334.1| hypothetical protein PHAVU_003G027000g [Phaseolus vulgaris]
Length=369

 Score =   303 bits (777),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/335 (44%), Positives = 214/335 (64%), Gaps = 10/335 (3%)
 Frame = +2

Query  59    YCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPA  238
             YC   V L+ V +   +V      +P D  P+P++K+++ SWF+++V  L+  +  +DP 
Sbjct  7     YCSIKVTLMVVFLTTQVV------LPDDDTPMPSDKTELGSWFQSNVGTLRKRKGSLDPK  60

Query  239   LVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPF  412
             LV AE     +KV +   G++KTI +A+++IP+ NT R I++I  G Y+E++ ++  +PF
Sbjct  61    LVAAEEGAKVVKVMQDGSGEYKTISDALRSIPSGNTMRVILYIGPGNYHEKITVEKTKPF  120

Query  413   VTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQA  589
             VT YG P N P L    TA Q GT+ SATL VLSDYF A NI + NSAPRP       QA
Sbjct  121   VTFYGKPGNMPNLTYDGTARQYGTVDSATLIVLSDYFVAANIIISNSAPRPDENSVGGQA  180

Query  590   VALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRV  769
             VAL I+GDKA+FYNC+ YG+QDTL D  NRHF+KDC ++G VD++FG+ KS+++N ++R 
Sbjct  181   VALRISGDKATFYNCELYGYQDTLLDDANRHFFKDCLIQGYVDYIFGSGKSLYVNCEIRT  240

Query  770   IPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAI  949
             +  +    ++A  R +++ED GFSFVHC++TG      LGR WF YS  IFAY  + N  
Sbjct  241   LGDEGFTFITAQARKNKQEDNGFSFVHCELTGTGSDTYLGRAWFGYSTVIFAYCNMANIF  300

Query  950   KPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               + W     +P+   T YFGEY N GPG+ + GR
Sbjct  301   NKQAWSD-NNHPEFDKTLYFGEYKNRGPGSDVRGR  334



>ref|XP_010423211.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 204/323 (63%), Gaps = 4/323 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             +I  ++VF P  V+  D  PIPAEK+QVE WF+A+VQP  + R  +DP L  AEA+P  +
Sbjct  9     LIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPDLEAAEASPRII  68

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  GG F ++  A+K+IP  N  R II +A G Y E+V +D  RPFVTL G P    
Sbjct  69    TVNQKGGGDFTSVNAAIKSIPVGNKIRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPGAET  128

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    T+A+ GT+ SATL V + YF A N+ + N+AP P      QA+A+ I  DKA+F
Sbjct  129   NLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQGQALAMRINADKAAF  188

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             YNC+FYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +++AH
Sbjct  189   YNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAH  247

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
              R +  + +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   R   
Sbjct  248   NRQNSNDQSGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPSGWQENRVR-  306

Query  986   KNGGTCYFGEYNNTGPGAKMDGR  1054
             ++  T ++GEY  TGPG+    R
Sbjct  307   EHDKTVFYGEYMCTGPGSHKAKR  329



>gb|KFK25128.1| hypothetical protein AALP_AA8G069700 [Arabis alpina]
Length=361

 Score =   302 bits (774),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 208/328 (63%), Gaps = 8/328 (2%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             ++  ++VF    V+  DT PIP ++S++  WF  +V P    +  +DPAL  AEA+ + +
Sbjct  8     IVAFLVVFASPVVLATDTDPIPEDRSKIPQWFHTNVAPYSKRKGTLDPALDAAEASRLII  67

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  GG FKTI EAVK+IPA N  R II +A G YNE+V ID  RPFVTL G P    
Sbjct  68    TVNQQGGGNFKTINEAVKSIPAGNKNRVIIKLAPGIYNEKVTIDIARPFVTLLGQPGAET  127

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    TAA+ GT+ SATL V SDYF A N+ ++N+AP P      QA+A+ I GDKA+F
Sbjct  128   VLTYHGTAAKYGTVESATLIVWSDYFMAANLVIKNTAPMPKPGSQGQALAMRINGDKAAF  187

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             YNC+FYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNT+L  + GD + +++A 
Sbjct  188   YNCRFYGFQDTLCDDKGTHFFKDCYIEGTYDFIFGRGASLYLNTKLHAV-GDGLRVITAQ  246

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
             GR S+ E  G++FVHC+VTG      LGR W  + K I+A+T + + + P GW   + N 
Sbjct  247   GRQSDNEQNGYTFVHCKVTGTGNGIYLGRSWMSHPKVIYAFTEMTSVVNPSGW---KENL  303

Query  986   KNG--GTCYFGEYNNTGPGAKMDGRPKF  1063
              +G   T Y+GEY   G G+ ++ R  F
Sbjct  304   LHGYDKTVYYGEYKCFGAGSHLEKRVPF  331



>ref|XP_009362793.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=363

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 213/327 (65%), Gaps = 4/327 (1%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             ++  ++  ++      +  D  P+PA  SQV +WF  +V+P    +K +DPA+V AEA  
Sbjct  3     VHAALIMTILLSATIAMADDNTPVPAALSQVNTWFNNNVKPYTQRQKTLDPAVVTAEAGQ  62

Query  263   VYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV + G+  FKT+ +A+ +IPA NTKR I++I  G+Y E++ I  ++PFVTLYG P 
Sbjct  63    KVIKVMQDGKGNFKTVTDAINSIPAGNTKRVIVYIGTGEYKEKITIPRNKPFVTLYGSPT  122

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
             N P L    TA + GT+ SAT+   SDYF A N++++NS+PRP GKR   QAVAL ++G+
Sbjct  123   NMPILTFDGTAQKYGTVNSATIIAESDYFVAANLNIKNSSPRPDGKRVGAQAVALRVSGN  182

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+ YNCK +GFQDTLCD    H +KDCY+EGTVDF++G+ KS++LNT+L V+  + + +
Sbjct  183   KAALYNCKLFGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDNGITV  242

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R+S+ EDTG+SFVHC++TG      LGR W    + ++AYT +   + P GW   
Sbjct  243   ITAQARDSDSEDTGYSFVHCKITGTGIGTYLGRAWRARPQVVYAYTNMTKVVNPAGWSND  302

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               + ++  T  +GEY   GPG+  + +
Sbjct  303   NHSERD-KTVSYGEYKCMGPGSSKNNK  328



>gb|KDO57708.1| hypothetical protein CISIN_1g039631mg [Citrus sinensis]
Length=369

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/311 (48%), Positives = 203/311 (65%), Gaps = 4/311 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D   IP EKSQ+ SWF A+V+P    +  +DPAL  A+A    +KV +   G+FKTI +A
Sbjct  29    DGAVIPPEKSQIGSWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDA  88

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IP  NTKR I+ I  G+Y E++KID  +PF+T YG P   P +    TA + GT+ S
Sbjct  89    INSIPQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDS  148

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             ATL V SDYF AVNI + NS+PRP GKR+  QAVAL I+G KA+FYNCK  GFQDTLCD 
Sbjct  149   ATLIVESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDD  208

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
                HF+KDC+++GTVDF+FG+ KS++L+T+LR +    + +++AH R SE ED GF+FVH
Sbjct  209   RGNHFFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVH  268

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C + G+     LGR W    + ++AYT +GN +   GW      P+   T ++GEY  +G
Sbjct  269   CTIEGSGNGTYLGRAWKNSPRVVYAYTTMGNVVNRAGWSD-NFRPERRQTVFYGEYKCSG  327

Query  1031  PGAKMDGRPKF  1063
             PGA    R ++
Sbjct  328   PGASPAERVEY  338



>emb|CDP21978.1| unnamed protein product, partial [Coffea canephora]
Length=263

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 189/264 (72%), Gaps = 4/264 (2%)
 Frame = +2

Query  74   VRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE  253
            + L   ++   L+F P  V+  DTVP PA+K+Q+ SWF  +VQPL S +  +DPALV AE
Sbjct  1    MALNKAILFSTLLFIPL-VLSDDTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALVAAE  59

Query  254  AAP--VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG  427
            A P  + LK    G+FKTI +A+ +IP  NT R II +  G Y E++KI+ ++PF+T+ G
Sbjct  60   ANPRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFITIIG  119

Query  428  DPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTI  604
            DP N PTLV    AA+ GT+ SATL V SDYF+A N+ + NSAPRP G  +  QA+A+ I
Sbjct  120  DPNNMPTLVFDGNAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALAVRI  179

Query  605  TGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQ  784
             GDKASFYNCKF GFQDTLCD   +H +KDCY+EGTVDF+FGN KSI+LN +L VIPGDQ
Sbjct  180  GGDKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIPGDQ  239

Query  785  MAMVSAHGRNSEKEDTGFSFVHCQ  856
             A ++A  R+++ EDTG+SFVHC+
Sbjct  240  QAWITAQARHTDAEDTGYSFVHCK  263



>ref|XP_006289803.1| hypothetical protein CARUB_v10003407mg [Capsella rubella]
 gb|EOA22701.1| hypothetical protein CARUB_v10003407mg [Capsella rubella]
Length=362

 Score =   301 bits (771),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 208/329 (63%), Gaps = 9/329 (3%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVI-PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +++ +V  LVF    V+   DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEA+
Sbjct  5     ISMFVVAFLVFFASSVVLATDTDPIPENRAQISQWFQTNVKPYSQRKGTLDPALDAAEAS  64

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                + V +  GG FKT+ EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P
Sbjct  65    RRVITVNQKGGGNFKTLNEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQP  124

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGD  613
                  L    TAA+ GT+ SATL + S+YF A N+ +RN+AP P      QA+A+ I GD
Sbjct  125   GAETVLTYHGTAAKYGTVESATLIIWSEYFQAANLIIRNTAPMPKPGTQGQALAMRINGD  184

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KASFYNC+FYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +
Sbjct  185   KASFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  243

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++AHGR +  + +G++F HC++TG      LGR W  + K I+A+T + + + P GW   
Sbjct  244   ITAHGRQNANDQSGYTFAHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGW---  300

Query  974   RTNPKNG--GTCYFGEYNNTGPGAKMDGR  1054
             R N   G   T ++GEY   GPG+ ++ R
Sbjct  301   RENLNKGYDKTVFYGEYKCFGPGSHVEKR  329



>ref|XP_010546117.1| PREDICTED: pectinesterase PPME1-like isoform X2 [Tarenaya hassleriana]
Length=348

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 209/308 (68%), Gaps = 8/308 (3%)
 Frame = +2

Query  128   VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG-QFKTI  304
             V+  D  PIP  + QV+ WF  +V+ L   +  +DPAL  AEA P+ + V KGG QF+T+
Sbjct  7     VLASDATPIPEARGQVDQWFATNVKALSQRKGTLDPALEAAEAKPLVITVNKGGGQFRTL  66

Query  305   QEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGT  484
              EA+++IPA N++R II +  G+Y E+V ID ++PF+TL G+PK+ P +    TAA+ GT
Sbjct  67    TEALRSIPAGNSRRVIIRMGPGEYREKVTIDRNKPFITLLGNPKSMPVITFDGTAAKYGT  126

Query  485   IYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTL  661
             + SATL VLSDYF A+N+ V+N+AP P GK +  QA+A+ I+G+KA+FYNCKFYG+QDT+
Sbjct  127   VDSATLIVLSDYFMAINVIVKNTAPAPDGKTKGAQALAMRISGNKAAFYNCKFYGYQDTV  186

Query  662   CDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFS  841
             CD    HF+KDCY+EGT DF+FG+  S++L TQL V+ GD + +++A    S  + +G+S
Sbjct  187   CDDTGSHFFKDCYIEGTFDFIFGSGTSLYLRTQLHVV-GDGIRVITAQAGKSTADQSGYS  245

Query  842   FVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP--KNGGTCYFGE  1015
             FVHC+VTG  +   LGR W  + K ++AYT + + + P GW     NP      T ++GE
Sbjct  246   FVHCRVTGTGEGIYLGRAWMTHPKVVYAYTEMTSVVNPSGW---HHNPDISRDKTVFYGE  302

Query  1016  YNNTGPGA  1039
             Y   GPG+
Sbjct  303   YKCYGPGS  310



>ref|XP_010546116.1| PREDICTED: pectinesterase PPME1-like isoform X1 [Tarenaya hassleriana]
Length=363

 Score =   301 bits (771),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 209/308 (68%), Gaps = 8/308 (3%)
 Frame = +2

Query  128   VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG-QFKTI  304
             V+  D  PIP  + QV+ WF  +V+ L   +  +DPAL  AEA P+ + V KGG QF+T+
Sbjct  22    VLASDATPIPEARGQVDQWFATNVKALSQRKGTLDPALEAAEAKPLVITVNKGGGQFRTL  81

Query  305   QEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGT  484
              EA+++IPA N++R II +  G+Y E+V ID ++PF+TL G+PK+ P +    TAA+ GT
Sbjct  82    TEALRSIPAGNSRRVIIRMGPGEYREKVTIDRNKPFITLLGNPKSMPVITFDGTAAKYGT  141

Query  485   IYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTL  661
             + SATL VLSDYF A+N+ V+N+AP P GK +  QA+A+ I+G+KA+FYNCKFYG+QDT+
Sbjct  142   VDSATLIVLSDYFMAINVIVKNTAPAPDGKTKGAQALAMRISGNKAAFYNCKFYGYQDTV  201

Query  662   CDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFS  841
             CD    HF+KDCY+EGT DF+FG+  S++L TQL V+ GD + +++A    S  + +G+S
Sbjct  202   CDDTGSHFFKDCYIEGTFDFIFGSGTSLYLRTQLHVV-GDGIRVITAQAGKSTADQSGYS  260

Query  842   FVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP--KNGGTCYFGE  1015
             FVHC+VTG  +   LGR W  + K ++AYT + + + P GW     NP      T ++GE
Sbjct  261   FVHCRVTGTGEGIYLGRAWMTHPKVVYAYTEMTSVVNPSGW---HHNPDISRDKTVFYGE  317

Query  1016  YNNTGPGA  1039
             Y   GPG+
Sbjct  318   YKCYGPGS  325



>ref|XP_008234141.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=367

 Score =   301 bits (770),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/327 (45%), Positives = 211/327 (65%), Gaps = 8/327 (2%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             + + +++F     +  D  P+ A++SQV +WF  +V+P  + R  +DPAL  AEA    +
Sbjct  14    LTMTLILFTATITMADDHTPVLADQSQVNTWFNNNVKPYTARRGTLDPALATAEAGQKVI  73

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV K   GQFKTI +A       NTKR I++I GG+YNE++ I  ++PFVT YG P N P
Sbjct  74    KVMKDGSGQFKTITDAX----XXNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGSPANMP  129

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKAS  622
             TL  A T+ + GT+ SAT+   SDYF A N+ ++NS+PRP GKR   QAVAL ++G+K++
Sbjct  130   TLTFAGTSQKYGTVNSATVIAESDYFVASNVIIKNSSPRPDGKRVGAQAVALRVSGNKSA  189

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
              YNCK  GFQDTLCD    H +KDC++EGTVDF++G+ KS++LNT+L V+  + + +++A
Sbjct  190   LYNCKLIGFQDTLCDDRGNHLFKDCFIEGTVDFIWGSGKSLYLNTELHVLGDNGLTVITA  249

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R+S  EDTG+SFVHC++TG      LGR W      ++AYT +   I P GW     +
Sbjct  250   QARDSASEDTGYSFVHCKITGTGSGTYLGRAWRTNPMVVYAYTSMTKVINPAGWSD-DNH  308

Query  983   PKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             P+   T ++GEY  +GPG+   GR K+
Sbjct  309   PERDSTVFYGEYKCSGPGSSAAGRVKY  335



>ref|XP_009363888.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=363

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/303 (47%), Positives = 200/303 (66%), Gaps = 4/303 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKTIQEA  313
             D  PIP++ SQ+ +WF  +V+P    +  +DPA+V AEA    +KV + G+  FKTI +A
Sbjct  22    DNAPIPSDHSQINTWFNNNVKPYTERQSTLDPAIVTAEAGQTVIKVMQDGKGDFKTITDA  81

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IPA NTKR I+ I GG+YNE++ I  ++PFVTLYG P N P L    TA + GT+ S
Sbjct  82    INSIPAGNTKRVIVHIGGGEYNEKITIPRNKPFVTLYGSPTNMPNLTFDGTAQKYGTVNS  141

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             AT+   SDYF A+N+ ++NS+PRP GKR   QAVAL ++G+ ++ YNCK  GFQDTLCD 
Sbjct  142   ATVIAESDYFIAINLLIKNSSPRPDGKRVGAQAVALRVSGNNSALYNCKLVGFQDTLCDD  201

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
                H +KDCY+EGTVDF++G+ KS++LNT+L V+    + +++A  R+S  EDTG+SFVH
Sbjct  202   RGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVITAQARDSASEDTGYSFVH  261

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C VTG      LGR W    + ++AYT +   + P GW     +P+   T  +GEY   G
Sbjct  262   CNVTGIGSGTYLGRAWRVRPQVVYAYTSMTEVVNPAGWSN-DNHPERDNTVSYGEYKCMG  320

Query  1031  PGA  1039
             PG+
Sbjct  321   PGS  323



>ref|XP_002511043.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51645.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=364

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 203/325 (62%), Gaps = 6/325 (2%)
 Frame = +2

Query  98    VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
             +  +V     V   DT PIP   S +  WF A+V+PL   +  +DPAL  AEA P  +KV
Sbjct  15    ILAIVLAANTVSSDDTTPIPEAASGIAGWFSANVKPLADRKGTLDPALEAAEANPKTIKV  74

Query  278   --GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
                  G+FKTI +AVK+IP+ NT+R I+ I  G YNE++ I+ D+PFVT  G P N  T+
Sbjct  75    RLDGSGEFKTIADAVKSIPSGNTQRVIVDIGPGTYNEKITIERDKPFVTFLG-PSNMATI  133

Query  452   VAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFY  628
                 TA + GT+YSATL V S+YF A N+ ++N+APRP GK    QA+A+   G KA+FY
Sbjct  134   AFGGTAHEYGTVYSATLQVESEYFIAANLIIQNTAPRPDGKTPGAQALAVRTGGSKAAFY  193

Query  629   NCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHG  808
               K  GFQDTLCD    HF+KDCY+EGTVDF+FG+ KSI+LNT++ V+   +  +++A  
Sbjct  194   KVKMLGFQDTLCDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTEINVLTDAEPTVITAQA  253

Query  809   RNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPK  988
             R    EDTGFSFVHC V G    A LGR W    + +FAYT +   + PEGW     +P+
Sbjct  254   RQG-SEDTGFSFVHCSVGGTGTGAHLGRAWMEAPRVVFAYTAMTGVVNPEGW-SSNNHPE  311

Query  989   NGGTCYFGEYNNTGPGAKMDGRPKF  1063
                   FGEY NTGPGA  DGR K+
Sbjct  312   REAKVVFGEYKNTGPGAAPDGRVKY  336



>gb|KHG24685.1| Pectinesterase PPME1 -like protein [Gossypium arboreum]
Length=369

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/327 (45%), Positives = 209/327 (64%), Gaps = 8/327 (2%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             + V +L+F P  V    + PIPA+KSQ+ +WF   ++ ++     +DP LV+AE  P  +
Sbjct  16    ICVSILLFAPIIV----SQPIPADKSQINAWFNGIIKSVKERGNTLDPELVEAETKPRII  71

Query  272   KV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
             KV  G GG+F TI +A++++P+ NTKR I+ I  G Y E+++I+ ++PF+TL GDPK  P
Sbjct  72    KVMQGGGGEFDTITKAIESVPSGNTKRVIVSIGPGSYKEKIRIERNKPFITLLGDPKKMP  131

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKAS  622
              L    TA Q GT+ SATL     YF   N+++ N+APRP GK    QAVAL ++GD+++
Sbjct  132   NLTFDGTAKQFGTVDSATLITECSYFVGANLNILNTAPRPDGKMVGAQAVALRVSGDRSA  191

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
             FYNCK  GFQDTLCD    HF+KDC++ GTVDF+FG+ KS++LNT++ V     + +++A
Sbjct  192   FYNCKIIGFQDTLCDDRGNHFFKDCHIRGTVDFIFGSGKSLYLNTEIFVEGDPGLTVITA  251

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R S  EDTG+SFVH  ++G +K A LGR W    + ++AYT +GN I P GW      
Sbjct  252   QARESSSEDTGYSFVHGSISGTAKNAFLGRAWKSSPRVVYAYTEMGNVINPVGW-SHNVQ  310

Query  983   PKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             P+   T Y+GEY  TG GA    R  F
Sbjct  311   PERAKTVYYGEYKCTGQGANPKTREPF  337



>ref|XP_007038214.1| Pectinesterase isoform 2, partial [Theobroma cacao]
 gb|EOY22715.1| Pectinesterase isoform 2, partial [Theobroma cacao]
Length=314

 Score =   297 bits (761),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 202/315 (64%), Gaps = 15/315 (5%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +   I  +LV  P  V+  ++ PIP +KSQ+++WF A+++P  +    +DPAL KAE A 
Sbjct  11    VGAAICTILVLAPV-VLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAA  69

Query  263   VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV K   G F TI +A+ ++P+ NTKR II I GG Y E+++ID  +PF+T YGDP+
Sbjct  70    HIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPR  129

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
             N P L    TA Q GT+ SATL V SDYF A NI ++N+APRP G     QAV+L I+GD
Sbjct  130   NMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGD  189

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FYNCK  GFQDTLCD    HF+KDCY+ GTVDF+FG+ KS++L           + +
Sbjct  190   KAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLG----------VTV  239

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R S  E+TG+SFVHC VTG +  A LGR W    + +FAYT + + I P GW   
Sbjct  240   ITAQARESSSENTGYSFVHCTVTGTASGAYLGRAWKTSPRVVFAYTNMSSVIHPLGWSD-  298

Query  974   RTNPKNGGTCYFGEY  1018
               +P+   T +FGEY
Sbjct  299   NLHPERAKTVFFGEY  313



>gb|KDP39968.1| hypothetical protein JCGZ_03499 [Jatropha curcas]
Length=358

 Score =   298 bits (764),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 210/325 (65%), Gaps = 14/325 (4%)
 Frame = +2

Query  98    VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
             +  +VF    V   D VPIP  +++V +WF A+V+PL   +  +D  L  AEA P  +KV
Sbjct  15    IIAIVFTAITVSSDDAVPIPEAEAEVNAWFEANVKPLADRKGTLDGNLEAAEATPKTIKV  74

Query  278   GK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
                  G+FKTI +AVK+IPA+NT+R I+ I  G Y E++ ++ ++ FV+  G P+ +  +
Sbjct  75    SADGSGEFKTITDAVKSIPAKNTQRVIVDIGPGTYTEKITVEKEKGFVSFIGVPE-KTII  133

Query  452   VAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFY  628
               A TA + GT+YSATL V SD+F        N+AP P G R   QAVA  I G+ ASFY
Sbjct  134   EFAGTAHEYGTVYSATLQVESDFF--------NTAPPPDGVRPGAQAVAFRIGGNMASFY  185

Query  629   NCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHG  808
             NC+F GFQDT+CD    HF+KDCY+EGTVDF+FG+ KSI+LNTQL VI    M ++ A  
Sbjct  186   NCRFIGFQDTICDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTQLEVIQDKDMTVIVAQA  245

Query  809   RNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPK  988
             R +  E+TGFSFVHC +TG +K A LGR W P  K IFAY+ I + I PEGW   + +P+
Sbjct  246   RGN-AEETGFSFVHCSITGKAKGAFLGRAWMPAPKAIFAYSTISDVICPEGWSNNQ-HPE  303

Query  989   NGGTCYFGEYNNTGPGAKMDGRPKF  1063
                  +FGEY NTGPGA ++GR KF
Sbjct  304   REPEIFFGEYKNTGPGAAIEGRVKF  328



>ref|XP_008338559.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=370

 Score =   299 bits (765),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 142/334 (43%), Positives = 214/334 (64%), Gaps = 8/334 (2%)
 Frame = +2

Query  62    CMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPAL  241
             CM    +++  ++  ++      +  D  P+PA  SQV +WF  +V+P    +K +DPA+
Sbjct  7     CM----VVHAALIMTILLSATIAMADDNTPVPAALSQVNTWFNNNVKPYTQRQKTLDPAV  62

Query  242   VKAEAAPVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFV  415
             V AEA    +KV + G+  FKT+ +A+ +IPA NTKR I++I  G+Y E++ I  ++PFV
Sbjct  63    VTAEAGQKVIKVMQDGKGNFKTVTDAINSIPAGNTKRVIVYIGSGEYKEKITIPRNKPFV  122

Query  416   TLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAV  592
             TLYG P N P L    TA + GT+ SAT+   SDYF A N+ ++NS+PRP GKR   QAV
Sbjct  123   TLYGSPTNMPILTFDGTAQKYGTVNSATVIAESDYFVAANLIIKNSSPRPDGKRVGAQAV  182

Query  593   ALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVI  772
             AL ++G+KA+ YNCK +GFQDTLCD    H +KDCY+EGTVDF++G+ KS++LN +L V+
Sbjct  183   ALRVSGNKAALYNCKLFGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNXELHVL  242

Query  773   PGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIK  952
               + + +++A  R+S+ EDTG+SFVHC++TG      LGR W    + ++AYT +   + 
Sbjct  243   GDNGITVITAQARDSDSEDTGYSFVHCKITGTGIGTYLGRAWRARPQVVYAYTNMTKVVN  302

Query  953   PEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             P GW     + ++  T  +GEY   GPG+  + +
Sbjct  303   PAGWSNDNHSERD-KTVSYGEYKCMGPGSSKNNK  335



>ref|XP_009130989.1| PREDICTED: probable pectinesterase 50 [Brassica rapa]
Length=361

 Score =   298 bits (762),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/329 (46%), Positives = 205/329 (62%), Gaps = 9/329 (3%)
 Frame = +2

Query  83    LNVVIVCVLV-FCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +++ IV  LV F    V+  DT PIP ++SQ+  WF+ +V P    +  +DP+L  AE A
Sbjct  4     ISLTIVAFLVAFASPVVLATDTAPIPEDRSQIPQWFQTNVAPYSQRKGTLDPSLEAAETA  63

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                + V +  G  FKTI EA+K+IP  N  R +I +A G YNE+V ID  RPF+TL G P
Sbjct  64    RQVITVNQKGGANFKTINEAIKSIPTGNKNRVVIKLAPGVYNEKVTIDVARPFITLLGQP  123

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGD  613
              +   L    TAAQ GT+ SATL V SDYF A N+ ++N+AP P      QA+A+ I GD
Sbjct  124   GSETILTYHGTAAQYGTVESATLIVWSDYFLAANLIIKNTAPMPKPGAQGQALAMRINGD  183

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FY+CKFYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +
Sbjct  184   KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R S+ E  G++FVHC++TG      LGR W  + K I+A+T + + + P GW   
Sbjct  243   ITAQARQSDTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMSSVVNPAGW---  299

Query  974   RTNPKNG--GTCYFGEYNNTGPGAKMDGR  1054
             R N   G   T ++GEY   GPG+  + R
Sbjct  300   RENFNRGYDKTVFYGEYKCFGPGSHQEKR  328



>gb|KDP39971.1| hypothetical protein JCGZ_03502 [Jatropha curcas]
Length=548

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 207/325 (64%), Gaps = 6/325 (2%)
 Frame = +2

Query  98    VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
             +  +VF    V   D  PIP  +++V + F A+V+PL   +  ++  L  AEA P  +KV
Sbjct  15    IIAIVFTATTVTSDDAAPIPEAEAEVNACFEANVKPLADRKGTLNADLEAAEATPKTIKV  74

Query  278   --GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
                  G+FKTI EAVK IPA+N +R I+ I  G Y E++ ++ D+PFV+  G P+ +  +
Sbjct  75    RADGSGEFKTITEAVKRIPAKNAQRVIVDIGPGTYTEKITVEKDKPFVSFVGVPE-KTII  133

Query  452   VAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFY  628
               A TA + GT+YSATL V SD+F    + ++N+AP P GKR   QAVA  I G  +SFY
Sbjct  134   EFAGTAHEYGTVYSATLQVESDFFVGSGLVIKNTAPAPDGKRPGAQAVAFRIAGSMSSFY  193

Query  629   NCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHG  808
             NC+F GFQDT+CD    HF+KDCYVEGTVDF+FG+ KSI+LNTQL V+   +M ++ A  
Sbjct  194   NCRFIGFQDTICDDKGFHFFKDCYVEGTVDFIFGSGKSIYLNTQLEVLQDKEMTVIVAQA  253

Query  809   RNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPK  988
             R +  EDTGFSFVHC V G +K A LGR W P  K +FAY+ I   I PEGW     +P+
Sbjct  254   RGN-AEDTGFSFVHCSVAGKAKGAYLGRAWMPAPKAVFAYSTISEVICPEGWSN-NEHPE  311

Query  989   NGGTCYFGEYNNTGPGAKMDGRPKF  1063
                  +FGE+ N+GPGA  DGR KF
Sbjct  312   REPEIFFGEFKNSGPGAAADGRVKF  336



>ref|XP_002511044.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF51646.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=366

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 216/332 (65%), Gaps = 4/332 (1%)
 Frame = +2

Query  74    VRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAE  253
             + +++ VI  +L+     VI  D  PIPA ++QV SWF+A+V+   S +  +DPAL+ AE
Sbjct  8     IAIIHYVIAAILL-AATTVISDDATPIPAAENQVNSWFQANVKHFSSRKGTLDPALLAAE  66

Query  254   AAPVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG  427
             AAP  +KV     G FK++ +A+K+IP+ N  R I+ I  G Y E+V ID  +PFVTL G
Sbjct  67    AAPKRIKVRLDGSGDFKSVTDALKSIPSGNEHRVIVDIGCGVYTEKVTIDRIKPFVTLLG  126

Query  428   DPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTIT  607
               K+ PTL  A TA + GT+YSATL V +DYF A NI ++N+APRP G+   QAVAL + 
Sbjct  127   SSKHMPTLQFAGTAKKYGTVYSATLTVEADYFVAANIIIKNTAPRPDGRAGAQAVALRVA  186

Query  608   GDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM  787
             GDKA+FYNC+  GFQDT+CD   RHF+KDCY+EGTVDF+FG+ KS++L T L VI    M
Sbjct  187   GDKAAFYNCRILGFQDTVCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLKTHLNVIKEKFM  246

Query  788   AMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWM  967
              +++A  +++  ED+GFSFVH  +TG++  A LGR W    + +F+Y+ +   + P GW 
Sbjct  247   TVITAQAKHTSSEDSGFSFVHSSITGDATDAYLGRAWMEMPEVVFSYSKMSKVVIPAGWS  306

Query  968   GMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                 +P+      F EY  +GPGA   GR KF
Sbjct  307   NY-NHPEREKNILFAEYKCSGPGANPSGRVKF  337



>ref|XP_010452708.1| PREDICTED: probable pectinesterase 50 [Camelina sativa]
Length=361

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 206/329 (63%), Gaps = 9/329 (3%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVI-PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +++ +V  LVF    V+   DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEA+
Sbjct  4     MSMSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSQRKGKLDPALDAAEAS  63

Query  260   PVYLKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
              + + V    GG FKTI EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P
Sbjct  64    RLIITVRYTGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQP  123

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGD  613
                  L    TAA+ GT+ SATL V SDYF A N+ +RN+AP P      QA+A+ I GD
Sbjct  124   GAETVLTYHGTAAKYGTVESATLIVWSDYFQAANLIIRNTAPMPKPGSQGQALAMRINGD  183

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FY+CKFYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +
Sbjct  184   KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R+S  E  G++FVHC++TG      LGR W  + K I+A+T + + + P GW   
Sbjct  243   ITAQSRSSANEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGW---  299

Query  974   RTNPKNG--GTCYFGEYNNTGPGAKMDGR  1054
             R N   G   T ++GEY   GPG+ +  R
Sbjct  300   RKNFNRGYDKTVFYGEYKCFGPGSHVAKR  328



>emb|CDX81050.1| BnaC03g03040D [Brassica napus]
Length=361

 Score =   296 bits (759),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 204/329 (62%), Gaps = 9/329 (3%)
 Frame = +2

Query  83    LNVVIVCVLV-FCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +++ IV  L+ F    V+  DT PIP ++SQ+  WF+ +V P    +  +DPAL  AE A
Sbjct  4     ISLTIVAFLIAFASPVVLATDTAPIPEDRSQIPQWFQTNVAPYSQRKGTLDPALEAAETA  63

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                + V +  G  FKTI EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P
Sbjct  64    RQIITVNQKGGANFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDVARPFVTLLGQP  123

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGD  613
              +   L    TAAQ GT+ SATL V SDYF A N+ ++N+AP P      QA+A+ I GD
Sbjct  124   GSETILTYHGTAAQYGTVESATLIVWSDYFLAANLIIKNTAPMPKPGAQGQALAMRINGD  183

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FY+CKFYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +
Sbjct  184   KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R S+ E  G++FVHC++TG      LGR W  + K I+A+T + + + P GW   
Sbjct  243   ITAQARQSDTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMSSVVNPAGW---  299

Query  974   RTNPKNG--GTCYFGEYNNTGPGAKMDGR  1054
             R N   G   T ++GEY   G G+  + R
Sbjct  300   RENFNRGYDKTVFYGEYKCFGAGSHQEKR  328



>ref|XP_010109161.1| Pectinesterase PPME1 [Morus notabilis]
 gb|EXC21090.1| Pectinesterase PPME1 [Morus notabilis]
Length=359

 Score =   296 bits (757),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 205/325 (63%), Gaps = 5/325 (2%)
 Frame = +2

Query  98    VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
             +  ++     V+  D   +P  K+Q+ SWF  +V+P+   +  +DPALV AE     + V
Sbjct  7     LLTILLSVAAVLGSDYSAVPPNKAQLHSWFNQNVRPVNERKSTLDPALVAAEQGRRVITV  66

Query  278   GKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
              K G   FK I +A+ ++P+ N KR II I  G+Y E++ ID  + FVTLYG+P  +PTL
Sbjct  67    RKDGTGNFKRITDAINSVPSNNNKRVIIKIGPGEYREKITIDRTKRFVTLYGNPNAKPTL  126

Query  452   VAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFY  628
                 TA Q GT+ S TL  L+DYF A N+ ++N+AP+P GKR   QA AL I+GDK++ Y
Sbjct  127   SYGGTAEQYGTVDSGTLIALADYFVAANLIIKNTAPKPDGKRKGAQASALRISGDKSAVY  186

Query  629   NCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHG  808
             NC+  GFQDT+CD    HF+KDCY+EGTVDF+FG+  SI+LNT+L V+    + +++A  
Sbjct  187   NCRILGFQDTICDDRGYHFFKDCYIEGTVDFIFGSGTSIYLNTELHVVQDSGIEVITAQA  246

Query  809   RNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPK  988
             R S  ++TG+SF+HC VTG      LGR W    K ++ YT +GNAI P+GW     +P+
Sbjct  247   RQSN-DNTGYSFLHCAVTGTGSNTFLGRAWMSRPKVVYIYTNMGNAINPQGWSD-NFHPE  304

Query  989   NGGTCYFGEYNNTGPGAKMDGRPKF  1063
                T ++GEY N+G GA M  R K+
Sbjct  305   RDSTVFYGEYKNSGSGANMVKRVKY  329



>ref|XP_010491359.1| PREDICTED: probable pectinesterase 50 [Camelina sativa]
Length=361

 Score =   296 bits (757),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 207/329 (63%), Gaps = 9/329 (3%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVI-PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +++ +V  LVF    V+   DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEA+
Sbjct  4     MSMSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSMRKGKLDPALDAAEAS  63

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
              + + V +  GG FKTI EA+K+IP  N  R II +A G YNE+V +D  RPF+TL G P
Sbjct  64    RLIITVNQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTVDIARPFITLLGQP  123

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGD  613
                  L    TAA+ GT+ SATL V +DYF A N+ +RN+AP P      QA+A+ I GD
Sbjct  124   GAETVLTYHGTAAKYGTVESATLIVWADYFQAANLIIRNTAPMPKPGSQGQALAMRINGD  183

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FY+CKFYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +
Sbjct  184   KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R+S  E  G++FVHC++TG      LGR W  + K I+A+T + + + P GW   
Sbjct  243   ITAQSRSSANEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGW---  299

Query  974   RTNPKNG--GTCYFGEYNNTGPGAKMDGR  1054
             R N   G   T ++GEY   GPG+ +  R
Sbjct  300   RENFNRGYDKTVFYGEYKCFGPGSHVAKR  328



>ref|XP_004174112.1| PREDICTED: pectinesterase PPME1-like, partial [Cucumis sativus]
Length=309

 Score =   294 bits (752),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/278 (49%), Positives = 191/278 (69%), Gaps = 3/278 (1%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKV-GKG-GQFKTIQEAVKT  322
            +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV G G G FKTI EA+ +
Sbjct  27   VPVDKTQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMGDGTGDFKTITEAIAS  86

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
            +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  87   VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLSFDGVASKYGTVYSATL  146

Query  503  YVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRH  682
             V +DYF A N+ + N++PRP G+++ QA+A    G K++FYNCKF+GFQDTLCD +  H
Sbjct  147  IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFFGFQDTLCDDDGLH  206

Query  683  FYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVT  862
             YKDC+++GTVDFVFG   S++LNT+L V+   Q A+++AH R  E + +G+SFVHC +T
Sbjct  207  LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  266

Query  863  GNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMR  976
            GN K   LGR W P S+ IFAYT + + I PEGW  M+
Sbjct  267  GNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWNDMK  304



>ref|XP_006572810.1| PREDICTED: uncharacterized protein LOC100306177 isoform X2 [Glycine 
max]
Length=328

 Score =   295 bits (754),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/294 (49%), Positives = 195/294 (66%), Gaps = 3/294 (1%)
 Frame = +2

Query  92   VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
            V + V       V+  DTVPIPA K+Q+  W+  +V PL   +  VDPALV AE     +
Sbjct  12   VTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAKVV  71

Query  272  KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
            KV +   G+FKTI +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P
Sbjct  72   KVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMP  131

Query  446  TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKAS  622
             L    TA Q GT+ SATL V SDYF A NI + N+APRP  K    QAVAL I+GDKA+
Sbjct  132  NLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAA  191

Query  623  FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
            FYNCK YGFQDT+CD  NRHF+KDC ++GT+D++FG+ KS++++T+LR +  + + ++ A
Sbjct  192  FYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVIVA  251

Query  803  HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW  964
              R SE ED  +SFVHC VTG      LGR W  + + +FAY+ + + +   GW
Sbjct  252  QARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGW  305



>ref|XP_010523329.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=362

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 203/311 (65%), Gaps = 5/311 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D  PIP  K+Q++ WFRA+V PL   +  +DPALV AEAAP  ++V K  GG FKT+  A
Sbjct  24    DATPIPQNKAQLQQWFRANVAPLAQRKGSLDPALVAAEAAPRVIRVNKNGGGDFKTLNAA  83

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IPA NTKR II +  G+Y E+V ID ++PFVTLYG P   P L    TAA+ GT+ S
Sbjct  84    INSIPAGNTKRVIIKLGPGEYREKVTIDRNKPFVTLYGQPNAMPVLTYDGTAAKYGTVDS  143

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             AT  VLSDYF AVN+  +NSAP P G+ +  QA+A  ++G+KA+FYNCKFYG+QDT+CD 
Sbjct  144   ATFIVLSDYFMAVNVIFKNSAPMPDGRMKGAQALAARVSGNKAAFYNCKFYGYQDTVCDD  203

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
                HF+KDCY+EGT DF+FG+  S++LNTQL V+ G+ + +++A    S  + +G+ F H
Sbjct  204   IGNHFFKDCYIEGTFDFIFGSGTSLYLNTQLNVV-GNGIRVITAEAGKSVSDPSGYVFAH  262

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
              +VTG      LGR W  + K ++AYT + + + P GW    + P    T ++ EY   G
Sbjct  263   SRVTGTGTGIYLGRAWMSHPKVVYAYTEMTSIVAPAGWQ-QNSIPGRDKTVFYREYKCYG  321

Query  1031  PGAKMDGRPKF  1063
             PG+ +  R  F
Sbjct  322   PGSNIAKRVPF  332



>ref|XP_010423208.1| PREDICTED: probable pectinesterase 50 isoform X1 [Camelina sativa]
 ref|XP_010423209.1| PREDICTED: probable pectinesterase 50 isoform X2 [Camelina sativa]
Length=361

 Score =   295 bits (755),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/327 (46%), Positives = 205/327 (63%), Gaps = 5/327 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVI-PLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +++ +V  LVF    V+   DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEA+
Sbjct  4     MSMSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSQRKGKLDPALDAAEAS  63

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
              + + V +  GG FKTI EA+K+IP  N  R II +A G YNE+V +D  RPFVTL G  
Sbjct  64    RLIITVNQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTVDIARPFVTLLGQL  123

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGD  613
                  L    TAA+ GT+ SATL V SDYF A N+ +RN+AP P      QA+A+ I GD
Sbjct  124   GAETVLTYHGTAAKYGTVESATLIVWSDYFQAANLIIRNTAPMPKPGSQGQALAMRINGD  183

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FY+CKFYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +
Sbjct  184   KAAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  242

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R+S  E  G++FVHC++TG      LGR W  + K I+A+T + + + P GW   
Sbjct  243   ITAQSRSSANEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWR-E  301

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               N K   T ++GEY   GPG+ +  R
Sbjct  302   NFNRKYDKTVFYGEYKCFGPGSHVAKR  328



>ref|NP_196360.1| putative pectinesterase 50 [Arabidopsis thaliana]
 sp|Q9LY17.1|PME50_ARATH RecName: Full=Probable pectinesterase 50; Short=PE 50; AltName: 
Full=Pectin methylesterase 50; Short=AtPME50; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87932.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AED91156.1| putative pectinesterase 50 [Arabidopsis thaliana]
Length=361

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 203/325 (62%), Gaps = 8/325 (2%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             V+  ++VF    V+  DT PIP  ++Q+  WF+ +V+P    +  +DPAL  AEAA   +
Sbjct  8     VVAFLVVFASPVVLATDTDPIPENRAQIPQWFKTNVKPYSQRKGTLDPALEAAEAARQII  67

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  G  FKT+ EA+K+IP  N  R II +A G YNE+V ID  RPF+TL G P    
Sbjct  68    TVNQKGGANFKTLNEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFITLLGQPGAET  127

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    TAAQ GT+ SATL V ++YF A ++ ++N+AP P      QA+A+ I  DKA+F
Sbjct  128   VLTYHGTAAQYGTVESATLIVWAEYFQAAHLTIKNTAPMPKPGSQGQALAMRINADKAAF  187

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             Y+C+F+GFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +++A 
Sbjct  188   YSCRFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAQ  246

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
             GR S  E  G++FVHC+VTG      LGR W  + K ++A+T + + + P GW   R N 
Sbjct  247   GRQSATEQNGYTFVHCKVTGTGTGIYLGRSWMSHPKVVYAFTEMTSVVNPSGW---RENL  303

Query  986   KNG--GTCYFGEYNNTGPGAKMDGR  1054
               G   T ++GEY   GPG+ ++ R
Sbjct  304   NRGYDKTVFYGEYKCFGPGSHLEKR  328



>ref|XP_002871271.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47530.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/325 (45%), Positives = 204/325 (63%), Gaps = 8/325 (2%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             V+  ++VF    V+  DT PIP  ++Q+  WF+A+V+P    +  +DPAL  AEAA   +
Sbjct  8     VVAFLVVFASPLVLATDTDPIPETRAQIPQWFKANVKPYSQRKGTLDPALEAAEAARQII  67

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  G  FKTI EA+K+IP  N  R II +A G YNE+V ID  RPFVTL G P    
Sbjct  68    TVNQKGGANFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQPGAET  127

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    TAA+ GT+ SATL V ++YF A ++ ++N+AP P      QA+A+ I  DKA+F
Sbjct  128   VLTYHGTAAKYGTVESATLIVWAEYFLAAHLTIKNTAPMPKPGSQGQALAMRINADKAAF  187

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             Y+C+F+GFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +++A 
Sbjct  188   YSCRFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAQ  246

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
             GR S  E  G++FVHC+VTG      LGR W  + K ++A+T + + + P GW   R N 
Sbjct  247   GRQSANEQNGYTFVHCKVTGTGTGIYLGRSWMSHPKVVYAFTEMTSVVNPSGW---RENL  303

Query  986   KNG--GTCYFGEYNNTGPGAKMDGR  1054
               G   T ++GEY   GPG+ ++ R
Sbjct  304   NRGYDKTVFYGEYKCFGPGSHLEKR  328



>ref|XP_004140274.1| PREDICTED: probable pectinesterase 48-like [Cucumis sativus]
Length=373

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 211/340 (62%), Gaps = 9/340 (3%)
 Frame = +2

Query  59    YCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRK-GVDP  235
             YC   +R+   ++    +     +I   +  IP EKS+++ W+   V+      K  +D 
Sbjct  3     YCNNALRVTRWIL---FLEVSAAIILAASHMIPTEKSELDGWYSEHVKSFNKRDKMKLDS  59

Query  236   ALVKAEAAPVYLKV-GKG-GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRP  409
              LV AE     +KV G G G FKTI EA++++PA NTKR +I+I GG Y E++KID ++P
Sbjct  60    ELVAAEENATVIKVRGDGSGDFKTITEAIESVPACNTKRVVIWIGGGVYKEKLKIDRNKP  119

Query  410   FVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQ  586
             FVTLYG P N P L     A++ GT+YSATL V +DYF+A N+ + NS+PRP GKR  +Q
Sbjct  120   FVTLYGSPNNMPNLTFDGDASKYGTVYSATLTVEADYFTAANLIIENSSPRPDGKRKGEQ  179

Query  587   AVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLR  766
             A+A  I G+K + YNCKF GFQDTLCD    H YKDC+++GTVDFVFG   S++LNTQL 
Sbjct  180   ALAARIWGNKVAIYNCKFIGFQDTLCDDRGLHLYKDCFIQGTVDFVFGKGTSLYLNTQLD  239

Query  767   VIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTIFAYTYIGN  943
             V+    + +++AH R  E E +GFSFVHC +TG   +   LGR W P S+ +FAYT + +
Sbjct  240   VVVDGGLGVIAAHSREQESECSGFSFVHCSITGTGGRNTYLGRAWRPRSRVVFAYTTMAD  299

Query  944   AIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              I P+GW  M  N     T  FGEY  +G G+    R ++
Sbjct  300   IIHPKGWNDM-DNFGYDKTVSFGEYKCSGLGSNFSKRVQY  338



>gb|KFK25127.1| hypothetical protein AALP_AA8G069600 [Arabis alpina]
Length=363

 Score =   294 bits (753),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 148/325 (46%), Positives = 204/325 (63%), Gaps = 6/325 (2%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQP--LQSGRKGVDPALVKAEAAPV  265
             ++  ++VF    V+  D  PIPA+K+QVE WF+  V+P  ++ GR  +DPAL  AE AP 
Sbjct  8     MVAFLIVFAFPVVLADDVTPIPADKAQVEPWFKTHVKPFSVRRGRGILDPALEAAEVAPR  67

Query  266   YLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
              + V    GG FK+I EA+K+IP  NTKR II +A G Y+E+V ID  RPFVTL G P  
Sbjct  68    TITVNPKGGGNFKSINEAIKSIPTGNTKRVIIKLAPGVYHEKVTIDVGRPFVTLLGKPGA  127

Query  440   RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKA  619
                L    TAA+ GT+ SATL V +  F A N+++ N+ P P      QA+A+ I GDKA
Sbjct  128   ETNLTYDGTAAKFGTVESATLIVWATNFIAANLNIINTNPMPKAGTQGQALAMRINGDKA  187

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +FY C+FYGFQDTLCD    HF+K CY+EGT DF+FG   S++LNT L  + GD + +++
Sbjct  188   AFYRCRFYGFQDTLCDDRGNHFFKGCYIEGTYDFIFGRGASLYLNTHLHAV-GDGLRVIT  246

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             AH R S  E +G++FVHC+VTG      LGR W  + K ++AYT + + + P GW   R 
Sbjct  247   AHNRQSNNEQSGYAFVHCKVTGVGTGIYLGRSWMSHPKVVYAYTEMSSVVNPSGWAENRQ  306

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGR  1054
                +  T ++GEY   GPG++ + R
Sbjct  307   RAHD-KTVFYGEYQCKGPGSQKEKR  330



>gb|KDP39969.1| hypothetical protein JCGZ_03500 [Jatropha curcas]
Length=404

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/307 (48%), Positives = 202/307 (66%), Gaps = 6/307 (2%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP--VYLKVGKGGQFKTIQEAVKTI  325
             +P  +++V +WF A+V+PL   +  ++  L  AEA P  + ++    G+FKTI +AVK+I
Sbjct  1     MPEAEAEVNAWFEANVKPLADRKGTLNADLEAAEATPKTITVRADGSGEFKTITDAVKSI  60

Query  326   PARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLY  505
             PA+N +R I+ I  G Y E++ ++ D+PFV+  G P+ +  +  A TA + GT+YSATL 
Sbjct  61    PAKNAQRVIVDIGPGTYTEKITVEKDKPFVSFVGVPE-KTIIEFAGTAHEYGTVYSATLQ  119

Query  506   VLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDHNNRH  682
             V SD+F    + ++N+AP P GKR   QAVA  I G  +SFYNC+F GFQDT+CD    H
Sbjct  120   VESDFFVGSGLVIKNTAPAPDGKRPGAQAVAFRIAGSMSSFYNCRFIGFQDTICDDKGFH  179

Query  683   FYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVT  862
             F+KDCYVEGTVDF+FG+ KSI+LNTQL V+   +M ++ A  R +  EDTGFSFVHC V 
Sbjct  180   FFKDCYVEGTVDFIFGSGKSIYLNTQLEVLQDKEMTVIVAQARGN-AEDTGFSFVHCSVA  238

Query  863   GNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAK  1042
             G +K A LGR W P  K +FAY+ I   I PEGW     +P+     +FGE+ N+GPGA 
Sbjct  239   GKAKGAYLGRAWMPAPKAVFAYSTISEVICPEGWSN-NEHPEREPEIFFGEFKNSGPGAA  297

Query  1043  MDGRPKF  1063
              DGR KF
Sbjct  298   ADGRVKF  304


 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 32/55 (58%), Gaps = 1/55 (2%)
 Frame = +2

Query  899   FPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              P  K IFAY+ I   I PEGW     +P+     +FGE+ N+GPGA  DGR KF
Sbjct  321   MPAPKAIFAYSTISEVICPEGWSN-NEHPEREPEIFFGEFKNSGPGAAPDGRAKF  374



>ref|XP_002277388.2| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38548.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 150/327 (46%), Positives = 203/327 (62%), Gaps = 6/327 (2%)
 Frame = +2

Query  95    IVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLK  274
             +V   +  P  V+  D   IP +  Q+ SWF   +Q     R  +DP LVKAE     +K
Sbjct  16    MVFFFLVLPSTVLA-DDPQIPDDAIQLASWFNDVIQSHNLRRTTLDPVLVKAEERVKIIK  74

Query  275   VGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPT  448
             V KGG   F  +  AV ++PA NT+R II+I GG Y E++KID  +PF+T YG P + P 
Sbjct  75    VSKGGGGNFNKVMAAVDSVPAGNTQRVIIWIGGGVYEEKIKIDRSKPFITFYGSPDDMPM  134

Query  449   LVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASF  625
             L    TAA+ GT+ SATL V SDYF AVNI V NS+PRP G+R+  QAVA+ ++GDKA+F
Sbjct  135   LSFDGTAAKFGTVDSATLIVESDYFMAVNIIVINSSPRPEGRRNGGQAVAVRVSGDKAAF  194

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVI-PGDQMAMVSA  802
             YNCK  GFQDTLCD   RHF+  CY+EGTVDF+FG+ KS++L+T+L     G + ++++A
Sbjct  195   YNCKLVGFQDTLCDDRGRHFFHGCYIEGTVDFIFGSGKSLYLSTELHAKGAGGEFSVITA  254

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               R  E ED G+SFVHC+V+G+     LGR W    + +F+YT +   + P GW     +
Sbjct  255   QARKLESEDNGYSFVHCRVSGSGSNTYLGRAWMSRPRVVFSYTNMSTVVHPLGWSD-NFH  313

Query  983   PKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             P+     ++GEY   GPGA    R KF
Sbjct  314   PERDSLVFYGEYKCMGPGANTSKRAKF  340



>ref|XP_004169214.1| PREDICTED: probable pectinesterase 48-like [Cucumis sativus]
 gb|KGN48073.1| hypothetical protein Csa_6G428540 [Cucumis sativus]
Length=373

 Score =   294 bits (752),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 211/340 (62%), Gaps = 9/340 (3%)
 Frame = +2

Query  59    YCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRK-GVDP  235
             YC   +R+   ++    +     +I   +  IP EKS+++ W+   V+      K  +D 
Sbjct  3     YCNNALRVTRWIL---FLEVSAAIILAASHMIPTEKSELDGWYSEHVKSFNKRDKMKLDS  59

Query  236   ALVKAEAAPVYLKV-GKG-GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRP  409
              LV AE     +KV G G G FKTI EA++++PA NTKR +I+I GG Y E++KID ++P
Sbjct  60    ELVAAEENATVIKVRGDGSGDFKTITEAIESVPACNTKRVVIWIGGGVYKEKLKIDRNKP  119

Query  410   FVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQ  586
             FVTLYG P N P L     A++ GT+YSATL V +DYF+A N+ + NS+PRP GKR  +Q
Sbjct  120   FVTLYGSPNNMPNLTFDGDASKYGTVYSATLTVEADYFTAANLIIENSSPRPDGKRKGEQ  179

Query  587   AVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLR  766
             A+A  I G+K + YNCKF GFQDTLCD    H YKDC+++GTVDF+FG   S++LNTQL 
Sbjct  180   ALAARIWGNKVAIYNCKFIGFQDTLCDDRGLHLYKDCFIQGTVDFIFGGGTSLYLNTQLD  239

Query  767   VIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTIFAYTYIGN  943
             V+    + +++AH R  E E +GFSFVHC +TG   +   LGR W P S+ +FAYT + +
Sbjct  240   VVVDGGLGVIAAHSREQESECSGFSFVHCSITGTGGRNTYLGRAWRPRSRVVFAYTTMAD  299

Query  944   AIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              I P+GW  M  N     T  FGEY  +G G+    R ++
Sbjct  300   IIHPKGWNDM-DNFGYDKTVSFGEYKCSGLGSNFSKRVQY  338



>ref|XP_002511042.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51644.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=364

 Score =   291 bits (746),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 155/325 (48%), Positives = 204/325 (63%), Gaps = 6/325 (2%)
 Frame = +2

Query  98    VCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKV  277
             +  +V     V   DT P+P   S +  WF A+V+PL   +  +DPAL  AEA P  +KV
Sbjct  15    IVAIVLTATIVSSADTTPMPDAASGIAGWFSANVKPLADRKGTLDPALEAAEANPKTIKV  74

Query  278   --GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
                  G+FKTI +AVK+IP+ NT+R I+ I  G Y E++ I+ D+PFVT  G P N  T+
Sbjct  75    RLDGSGEFKTITDAVKSIPSGNTQRVIVDIGPGTYKEKITIERDKPFVTFLG-PPNMATI  133

Query  452   VAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFY  628
                 TA + GT+YSATL V S+YF A N+ ++N+APRP GKR   QA+A+ I G KA+FY
Sbjct  134   AFGGTAQEFGTVYSATLQVESEYFIAANLIIQNTAPRPDGKRPGAQALAVRIGGSKAAFY  193

Query  629   NCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHG  808
               K  GFQDTLCD    HF+KDCY+EGTVDF+FG+ KSI+LNT++ V+   +  +++A  
Sbjct  194   KVKMLGFQDTLCDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTEINVLTDAEPTVITAQA  253

Query  809   RNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPK  988
             R    EDTGFSFVHC V G    A+LGR W    + +FAYT +   + PEGW     +P+
Sbjct  254   RQG-SEDTGFSFVHCSVGGTGTGALLGRAWMEAPRVVFAYTAMTGVVNPEGW-SSNNHPE  311

Query  989   NGGTCYFGEYNNTGPGAKMDGRPKF  1063
                   FGEY NTGPGA   GR KF
Sbjct  312   REAKVVFGEYKNTGPGAAPAGRVKF  336



>emb|CAN78808.1| hypothetical protein VITISV_030725 [Vitis vinifera]
Length=368

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/302 (48%), Positives = 193/302 (64%), Gaps = 5/302 (2%)
 Frame = +2

Query  170   QVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTK  343
             Q+ SWF   +Q     R  +DP LVKAE     +KV KGG   F  +  AV ++PA NT+
Sbjct  11    QLASWFNDXIQSHNLRRTTLDPVLVKAEERVKIIKVSKGGGGNFNKVMAAVDSVPAGNTQ  70

Query  344   RYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYF  523
             R II+I GG Y E++KID  +PF+T YG P + P L    TAA+ GT+ SATL V SDYF
Sbjct  71    RVIIWIGGGVYEEKIKIDRSKPFITFYGSPDDMPMLSFDGTAAKFGTVDSATLIVESDYF  130

Query  524   SAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCY  700
              AVNI V NS+PRP G+R+  QAVA+ ++GDKA+FYNCK  GFQDTLCD   RHF+  CY
Sbjct  131   MAVNIIVINSSPRPEGRRNGGQAVAVRVSGDKAAFYNCKLVGFQDTLCDDRGRHFFHGCY  190

Query  701   VEGTVDFVFGNAKSIFLNTQLRVI-PGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKV  877
             +EGTVDF+FG+ KS++L+T+L     G + ++++A  R  E ED G+SFVHC+V+G+   
Sbjct  191   IEGTVDFIFGSGKSLYLSTELHAKGAGGEFSVITAQARKLESEDNGYSFVHCRVSGSGSN  250

Query  878   AVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRP  1057
               LGR W    + +F+YT +   + P GW     +P+     ++GEY   GPGA    R 
Sbjct  251   TYLGRAWMSRPRVVFSYTNMSTVVHPLGWSD-NFHPERDSLVFYGEYKCMGPGANTSKRA  309

Query  1058  KF  1063
             KF
Sbjct  310   KF  311



>ref|XP_007204487.1| hypothetical protein PRUPE_ppa019696mg [Prunus persica]
 gb|EMJ05686.1| hypothetical protein PRUPE_ppa019696mg [Prunus persica]
Length=368

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/311 (45%), Positives = 199/311 (64%), Gaps = 7/311 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D   +  +  QV +WF  +V P +  +  +DPALV AE     +KV K   G+FKTI  A
Sbjct  30    DETLVVTDHPQVNTWFNNNVNPYKERQGTLDPALVTAEVGQTVVKVMKDRSGEFKTITGA  89

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             V +IP  NTKR I++I GG+YNE++ I  ++ FVT YG P N PTL  A TA + GT+ S
Sbjct  90    VNSIPVDNTKRVIVYIGGGEYNEKITIPRNKSFVTFYGSPTNIPTLTFAGTAQKYGTVDS  149

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             AT+   SDYF A N+ ++NS+P+P GKR  +QA+AL ++G+K++ +NC+  GFQDTLCD 
Sbjct  150   ATVIAESDYFVAANLIIKNSSPKPDGKRVGEQALALRVSGNKSALFNCRLIGFQDTLCDD  209

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
                HF++DC++EGTVDF+FG+ KS++L   L V+  ++M ++ A  RNS  EDTG+SFVH
Sbjct  210   KGNHFFQDCFIEGTVDFIFGSGKSLYL---LHVLGNNEMTVIIAQARNSASEDTGYSFVH  266

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C +TG      LGR W    + +FAYT +   I P  W   +  PK   T ++GEY  +G
Sbjct  267   CNITGTGNGTYLGRAWRTSPRVVFAYTSMSEVITPADW-NNKNRPKRDRTVFYGEYKCSG  325

Query  1031  PGAKMDGRPKF  1063
             P + M GR K+
Sbjct  326   PASSMVGRVKY  336



>ref|XP_007204920.1| hypothetical protein PRUPE_ppa026195mg, partial [Prunus persica]
 gb|EMJ06119.1| hypothetical protein PRUPE_ppa026195mg, partial [Prunus persica]
Length=332

 Score =   289 bits (739),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 197/304 (65%), Gaps = 7/304 (2%)
 Frame = +2

Query  161   EKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPAR  334
             +  QV +WF  +V P +  +  +DPALV AE     +KV K   G+FKTI  AV +IP  
Sbjct  1     DHPQVNTWFNNNVNPYKERQGTLDPALVTAEVGQTVVKVMKDRSGEFKTITGAVNSIPVD  60

Query  335   NTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLS  514
             NTKR I++I GG+YNE++ I  ++ FVT YG P N PTL  A TA + GT+ SAT+   S
Sbjct  61    NTKRVIVYIGGGEYNEKITIPRNKSFVTFYGSPTNIPTLTFAGTAQKYGTVDSATVIAES  120

Query  515   DYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYK  691
             DYF A N+ ++NS+P+P GKR  +QA+AL ++G+K++ +NC+  GFQDTLCD    HF++
Sbjct  121   DYFVAANLIIKNSSPKPDGKRVGEQALALRVSGNKSALFNCRLIGFQDTLCDDKGNHFFQ  180

Query  692   DCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNS  871
             DC++EGTVDF+FG+ KS++L   L V+  ++M ++ A  RNS  EDTG+SFVHC +TG  
Sbjct  181   DCFIEGTVDFIFGSGKSLYL---LHVLGNNEMTVIIAQARNSASEDTGYSFVHCNITGTG  237

Query  872   KVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDG  1051
                 LGR W    + +FAYT +   I P  W   +  PK   T ++GEY  +GP + M G
Sbjct  238   NGTYLGRAWRTSPRVVFAYTSMSEVITPADW-NNKNRPKRDRTVFYGEYKCSGPASSMVG  296

Query  1052  RPKF  1063
             R K+
Sbjct  297   RVKY  300



>ref|NP_196359.1| putative pectinesterase 49 [Arabidopsis thaliana]
 sp|Q9LY18.1|PME49_ARATH RecName: Full=Probable pectinesterase 49; Short=PE 49; AltName: 
Full=Pectin methylesterase 49; Short=AtPME49; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87931.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AAM63813.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AAO22596.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO50592.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AED91155.1| putative pectinesterase 49 [Arabidopsis thaliana]
Length=361

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 204/327 (62%), Gaps = 5/327 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTV-PIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +++ +V +LVF    V+  D + PIPA+++Q+  WF A+V+P    R  +DP L  AEA+
Sbjct  4     ISLALVALLVFFASPVVLADDITPIPADRAQIPQWFMANVKPFSQRRGTLDPELEAAEAS  63

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                + V +  GG FKTI  A+K+IP  N  R II +A G Y+E+V +D  RP+VTL G P
Sbjct  64    RRVIIVNQNGGGDFKTINAAIKSIPLANKNRVIIKLAPGIYHEKVTVDVGRPYVTLLGKP  123

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGD  613
                  L  A TAA+ GT+ SATL V +  F A N+++ N++P P      QA+A+ I GD
Sbjct  124   GAETNLTYAGTAAKYGTVESATLIVWATNFLAANLNIINTSPMPKPGTQGQALAMRINGD  183

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FYNC+FYGFQDTLCD    HF+K+CY+EGT DF+FG   S++L TQL  + GD + +
Sbjct  184   KAAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLTTQLHAV-GDGLRV  242

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++AH R S  E  G+SFVHC+VTG      LGR W  + K +++YT + + + P GW   
Sbjct  243   IAAHNRQSTTEQNGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYSYTEMSSVVNPSGWQEN  302

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             R    +  T ++GEY  TGPG+    R
Sbjct  303   RVRAHD-KTVFYGEYMCTGPGSHKAKR  328



>ref|XP_009136509.1| PREDICTED: putative pectinesterase 63 isoform X2 [Brassica rapa]
Length=338

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 209/328 (64%), Gaps = 28/328 (9%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             L + I+ V++  P  V   D  PIP  K+++E WF  +V+  Q+GR              
Sbjct  8     LILTILLVVITWPV-VYGNDATPIPQNKNRIEQWFNNNVR--QNGR--------------  50

Query  263   VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
                     G FKT+ EA+ ++P  N +R II +  G+Y E+V ID ++PF+TLYGDP   
Sbjct  51    --------GDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPNAM  102

Query  443   PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKA  619
             P L    TAA+ GT+ SATL VLSDYF A+NI V+NSAP P GKR   QA+++ I+G+KA
Sbjct  103   PVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNKA  162

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L+TQL V+ GD + +++
Sbjct  163   AFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRVIT  221

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             AH   S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW    T
Sbjct  222   AHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWH-ENT  280

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               +   T ++GEY  +GPG++ + R K+
Sbjct  281   QTERDKTVFYGEYKCSGPGSRKEKRVKY  308



>ref|XP_002871270.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47529.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 203/327 (62%), Gaps = 5/327 (2%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTV-PIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             +++ +V +LVF    V+  D + PIPA+++ +  WF+A+V+P    R  +DP L  AEA+
Sbjct  4     ISLSLVALLVFFASPVVLADDITPIPADRALISQWFKANVKPFSQRRGTLDPDLEAAEAS  63

Query  260   PVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
                + V +  GG FKTI  A+K+IP  N  R II +A G Y+E+V ID  RPFVTL G P
Sbjct  64    RRVITVNQNGGGDFKTINAAIKSIPLANKNRVIIKLAPGIYHEKVTIDIGRPFVTLLGKP  123

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGD  613
                  L    TAA+ GT+ SATL V +  F A N+++ N++P P      QA+A+ I GD
Sbjct  124   GAETNLTYDGTAAKYGTVESATLIVWATNFLAANLNIINTSPMPKPGTQGQALAMRINGD  183

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+FYNC+FYGFQDTLCD    HF+K+CY+EGT DF+FG   S++L TQL  + GD + +
Sbjct  184   KAAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLTTQLHAV-GDGLRV  242

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++AH R S  E  G+SFVHC+VTG      LGR W  + K +++YT + + + P GW   
Sbjct  243   IAAHNRQSTNEQNGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYSYTEMSSVVNPSGWQEN  302

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             R    +  T ++GEY  TGPG+    R
Sbjct  303   RVRAHD-KTVFYGEYMCTGPGSHKAKR  328



>gb|KDP22496.1| hypothetical protein JCGZ_26327 [Jatropha curcas]
Length=651

 Score =   296 bits (759),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/311 (48%), Positives = 198/311 (64%), Gaps = 5/311 (2%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
             D  PIP +KSQV+SWF A V+PL S +  ++  L  AEA P  +KV +   G FKTI +A
Sbjct  315   DATPIPPDKSQVQSWFAAHVKPLASRKGTLNSTLEAAEAKPKTIKVRQDGSGNFKTITDA  374

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             V ++PA+N +R II I  G Y E+V I  ++PF+T  G PK   TL    TAA+ GT+YS
Sbjct  375   VNSVPAKNAQRVIIDIGPGVYTEKVTIPREKPFITFRGPPK-MATLQFGGTAAKYGTVYS  433

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             ATL V S++F A N+ ++N+AP+P GKR   QAVAL       +FYN +  GFQDTLCD 
Sbjct  434   ATLQVESEFFVAANLIIKNTAPQPDGKRKGAQAVALRTGASMQAFYNVRLLGFQDTLCDD  493

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
                HF+KDCY+EGTVDF+FG+ KSI+LNTQL V+      +++A  R  E ED G+SFVH
Sbjct  494   KGFHFFKDCYIEGTVDFIFGSGKSIYLNTQLYVLEEKDAQIITAQAREKEGEDIGYSFVH  553

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C + G    A LGR W    + +FAY+ + + + PEGW     +P+     YFGE+ NTG
Sbjct  554   CDIKGVGNRAFLGRAWMAMPRVVFAYSSMSSVVHPEGWSN-NNHPEREKNLYFGEFKNTG  612

Query  1031  PGAKMDGRPKF  1063
             PG+   GR KF
Sbjct  613   PGSNPKGRAKF  623



>gb|KHN28380.1| Putative pectinesterase 48, partial [Glycine soja]
Length=313

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/279 (51%), Positives = 189/279 (68%), Gaps = 4/279 (1%)
 Frame = +2

Query  227   VDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
             VDPALV AE     +KV +   G+FKTI +A+K+IP+ NTKR II+I  G YNE++KI+ 
Sbjct  1     VDPALVTAEEGAKVVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEK  60

Query  401   DRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-  577
              +PFVTLYG P+  P L    TA Q GT+ SATL V SDYF A NI + N+APRP  K  
Sbjct  61    TKPFVTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTP  120

Query  578   DQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNT  757
               QAVAL I+GDKA+FYNCK YGFQDT+CD  NRHF+KDC ++GT+D++FG+ KS++++T
Sbjct  121   GGQAVALRISGDKAAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVST  180

Query  758   QLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYI  937
             +LR +  + + ++ A  R SE ED  +SFVHC VTG      LGR W  + + +FAY+ +
Sbjct  181   ELRTLGDNGITVIVAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNM  240

Query  938   GNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
              + +   GW     +P++  T  FGEY N+GPGA   GR
Sbjct  241   SDIVNKLGWSN-NNHPEHDKTVRFGEYQNSGPGADPKGR  278



>ref|XP_002866448.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42707.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 205/336 (61%), Gaps = 33/336 (10%)
 Frame = +2

Query  59    YCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPA  238
             Y    V +L VVI   +VF        D  PIP  K ++E WF  +V+  Q+GR      
Sbjct  5     YVSLIVTILLVVITSPVVFGN------DAAPIPENKGRIEQWFNTNVK--QNGR------  50

Query  239   LVKAEAAPVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
                             G FKTI EA+ ++ A NT+R II I  G Y E+V ID ++PF+T
Sbjct  51    ----------------GHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRNKPFIT  94

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVA  595
             LYG P   P L    TAAQ GT+ SATL VLSDYF AVNI V+NSAP P GKR   QA++
Sbjct  95    LYGHPNAMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKRKGAQALS  154

Query  596   LTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIP  775
             + I+G+KA+FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L TQL V+ 
Sbjct  155   MRISGNKAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-  213

Query  776   GDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKP  955
             GD + +++AH   S  E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P
Sbjct  214   GDGIRVITAHAGKSAAEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNP  273

Query  956   EGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              GW   R   ++  T ++GEY  TG G+  + R K+
Sbjct  274   SGWQENREAGRD-KTVFYGEYKCTGTGSHKEKRVKY  308



>ref|XP_009125689.1| PREDICTED: probable pectinesterase 50 [Brassica rapa]
 emb|CDY55180.1| BnaAnng13710D [Brassica napus]
Length=361

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/323 (43%), Positives = 198/323 (61%), Gaps = 4/323 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             ++  ++ F    V+  DT PIP  ++Q+  WF+ +V P    +  +DPAL  AEAA + +
Sbjct  8     IVAFIVAFILPVVLATDTAPIPEVRAQIPQWFKTNVAPYSQRKGTLDPALDAAEAARIIV  67

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  G  FK+I EA+K+IP  N KR II +A G Y E+V +D  RPFVTL G P ++ 
Sbjct  68    TVNQKGGANFKSINEAIKSIPIGNKKRVIIKLAPGIYTEKVTVDVGRPFVTLLGQPGSQT  127

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    TAAQ GT+ SATL + SDYF A N+ ++N++P P      QA+A+ I GD A+F
Sbjct  128   VLTYHGTAAQYGTVESATLIIWSDYFMAANLIIKNTSPMPKPGSQGQALAMRINGDYAAF  187

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             Y C FYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNT+L  + GD + +++A 
Sbjct  188   YTCSFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTKLHAV-GDGLRVITAQ  246

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
              R S  E  G++FVHC++TG      LGR W  + K I+A+T + + + P GW     N 
Sbjct  247   SRQSNTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWR-ENFNR  305

Query  986   KNGGTCYFGEYNNTGPGAKMDGR  1054
                 T ++GEY   GPG+  + R
Sbjct  306   AYDKTVFYGEYKCFGPGSHQEKR  328



>emb|CDY14045.1| BnaC02g01620D [Brassica napus]
Length=361

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/323 (43%), Positives = 198/323 (61%), Gaps = 4/323 (1%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYL  271
             ++  ++ F    V+  DT PIP  ++Q+  WF+ +V P    +  +DPAL  AEAA + +
Sbjct  8     IVAFIVAFVLPVVLATDTAPIPEVRAQIPQWFKTNVAPYSQRKGTLDPALDAAEAARIIV  67

Query  272   KVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRP  445
              V +  G  FK+I EA+K+IP  N KR II +A G Y E+V +D  RPFVTL G P ++ 
Sbjct  68    TVNQKGGANFKSINEAIKSIPIGNKKRVIIKLAPGIYTEKVTVDVGRPFVTLLGQPGSQT  127

Query  446   TLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASF  625
              L    TAAQ GT+ SATL V SDYF A N+ ++N++P P      QA+A+ I GD A+F
Sbjct  128   VLTYHGTAAQYGTVESATLIVWSDYFMAANLIIKNTSPMPKPGSQGQALAMRINGDYAAF  187

Query  626   YNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAH  805
             Y C FYGFQDTLCD    HF+KDCY+EGT DF+FG   S++LNT+L  + GD + +++A 
Sbjct  188   YTCSFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTKLHAV-GDGLRVITAQ  246

Query  806   GRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNP  985
              R S  E  G++FVHC++TG      LGR W  + K ++A+T + + + P GW     N 
Sbjct  247   SRQSNTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVVYAFTEMTSVVNPSGWR-ENFNR  305

Query  986   KNGGTCYFGEYNNTGPGAKMDGR  1054
                 T ++GEY   GPG+  + R
Sbjct  306   AYDKTVFYGEYKCFGPGSHQEKR  328



>ref|XP_010109162.1| putative pectinesterase 50 [Morus notabilis]
 gb|EXC21091.1| putative pectinesterase 50 [Morus notabilis]
Length=361

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 211/333 (63%), Gaps = 11/333 (3%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             +   ++ +LV     V+    VPIP  ++QV +WF  +++P    +  +DP LVKAE   
Sbjct  3     VQAALLTILVATATVVLANGDVPIPENEAQVNTWFNQNIRPFGERKGTLDPNLVKAEEGV  62

Query  263   VYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGD-P  433
               ++V K G   FK I +A+KTIPA NTKR II I  G+Y+E+V ID+++P+V+L G  P
Sbjct  63    KIIRVRKDGSEDFKKIADAIKTIPAWNTKRVIIDIGPGEYHEKVLIDYNQPYVSLVGSSP  122

Query  434   KNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTG-KRDQQAVALTITG  610
             K+RPT+    TA Q GT+ SAT+ VL+ YF A N+  +NSAPRP   K+D QA+A  I G
Sbjct  123   KDRPTITYGATAKQYGTVDSATVIVLAPYFVAANLIFKNSAPRPDPYKKDGQALAFRING  182

Query  611   DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
             DKA+F+N KF GFQDTLCD    HF+KDCY+EGTVDF+FG   S++LN  L VI    + 
Sbjct  183   DKAAFFNSKFIGFQDTLCDDRGYHFFKDCYIEGTVDFIFGRGTSLYLNADLFVIGDKGLT  242

Query  791   MVSAHGRNSEKEDTGFSFVHCQV--TGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW  964
             +++A GR  ++  TG+SFVH ++  TGNS    LGR W   +K ++ YTY+ N I+P GW
Sbjct  243   VITAQGR-GDRVSTGYSFVHSRIEGTGNS-TTFLGRPWGDKTKVVYTYTYMSNVIQPGGW  300

Query  965   MGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                    KN    Y+GEY + GPG+    R KF
Sbjct  301   SDNSQTSKN---FYYGEYKSVGPGSSKGKRAKF  330



>ref|NP_200976.1| putative pectinesterase 63 [Arabidopsis thaliana]
 sp|Q9FKF3.2|PME63_ARATH RecName: Full=Putative pectinesterase 63; Short=PE 63; AltName: 
Full=Pectin methylesterase 63; Short=AtPME63; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED97505.1| putative pectinesterase 63 [Arabidopsis thaliana]
Length=338

 Score =   285 bits (729),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 151/336 (45%), Positives = 204/336 (61%), Gaps = 33/336 (10%)
 Frame = +2

Query  59    YCMETVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPA  238
             Y    V +L VVI   +VF        D  PIP  K ++E WF  +V+  Q+GR      
Sbjct  5     YVSLIVTILLVVITSPVVFGN------DAAPIPENKGRIEQWFNTNVK--QNGR------  50

Query  239   LVKAEAAPVYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
                             G FKTI EA+ ++ A NT+R II I  G Y E+V ID  +PF+T
Sbjct  51    ----------------GHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRSKPFIT  94

Query  419   LYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVA  595
             LYG P   P L    TAAQ GT+ SATL VLSDYF AVNI ++NSAP P GKR   QA++
Sbjct  95    LYGHPNAMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIILKNSAPMPDGKRKGAQALS  154

Query  596   LTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIP  775
             + I+G+KA+FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L TQL V+ 
Sbjct  155   MRISGNKAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-  213

Query  776   GDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKP  955
             GD + +++AH   S  E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P
Sbjct  214   GDGIRVITAHAGKSAAEKSGYSFVHCKVTGTGTGIYLGRSWMSHPKVVYAYTDMSSVVNP  273

Query  956   EGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              GW   R   ++  T ++GEY  TG G+  + R K+
Sbjct  274   SGWQENREAGRD-KTVFYGEYKCTGTGSHKEKRVKY  308



>gb|EPS69429.1| hypothetical protein M569_05334, partial [Genlisea aurea]
Length=305

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/299 (46%), Positives = 201/299 (67%), Gaps = 12/299 (4%)
 Frame = +2

Query  80   LLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEA  256
            LL++++V  +        P D + IPA+KSQ+++WF  +V     G+K  +  A+  AEA
Sbjct  8    LLHLLLVTAVYIARSE--PEDEL-IPADKSQLDTWFNRNV-----GQKATLSTAVADAEA  59

Query  257  APVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGD  430
                + V K   G+FKTI +A+K++P  N  R +I I  G Y E+++I+  +P VTLYGD
Sbjct  60   KTTVISVSKDGSGKFKTIGDALKSVPENNKNRVVIHIGPGNYTEKIRIERSKPHVTLYGD  119

Query  431  PKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTIT  607
            PKN P LV   +AA+V  I SATL V  DYFSAVN+ + NS+PRP GK +  QA AL  +
Sbjct  120  PKNMPVLVYGESAAKVNIIESATLIVEGDYFSAVNLVIVNSSPRPDGKIKLAQAAALRTS  179

Query  608  GDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM  787
            GD ASFYNC+F+GFQDT+ D   RH +KDCY+EGTVDF+ G+ +S++LNT++ VIPG+ M
Sbjct  180  GDGASFYNCRFHGFQDTILDDAGRHLFKDCYIEGTVDFICGSGQSLYLNTEVHVIPGEPM  239

Query  788  AMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW  964
              ++AH R +  +  G+SFVHC++TG  + A LGR W+PY++ I++Y+ + + + P GW
Sbjct  240  GFITAHARKTTGDPGGYSFVHCRITGAGETAYLGRPWYPYARVIYSYSQLSDVVNPSGW  298



>ref|XP_006280767.1| hypothetical protein CARUB_v10026738mg [Capsella rubella]
 gb|EOA13665.1| hypothetical protein CARUB_v10026738mg [Capsella rubella]
Length=338

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/328 (45%), Positives = 204/328 (62%), Gaps = 28/328 (9%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             L V I+ V++  P  V   D  PIP  K ++E WF  +V+  Q+GR              
Sbjct  8     LIVTILLVVITSPV-VFGNDAAPIPQNKGRIEQWFNTNVK--QNGR--------------  50

Query  263   VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
                     G FKTI EA+K++   NT+R II +  G Y E+V ID  +PF+TLYG P   
Sbjct  51    --------GHFKTITEAIKSVGEGNTRRVIIKVGPGVYKEKVTIDRSKPFITLYGHPNAM  102

Query  443   PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKA  619
             P L    TAAQ GT+ SATL VLSDYF AVNI V+NSAP P GK+   QA+++ I+G+KA
Sbjct  103   PVLTYDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKKKGAQALSMRISGNKA  162

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L TQL V+ GD + +++
Sbjct  163   AFYNCKFYGYQDTVCDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIRVIA  221

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             A    S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   R 
Sbjct  222   AQAGKSAEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWQENRE  281

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               ++  T ++GEY  +GPG+  + R K+
Sbjct  282   TERD-KTVFYGEYKCSGPGSHKEKRVKY  308



>ref|XP_010252431.1| PREDICTED: putative pectinesterase 63 [Nelumbo nucifera]
Length=370

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/323 (45%), Positives = 208/323 (64%), Gaps = 14/323 (4%)
 Frame = +2

Query  128   VIPLDTVPIPAEKSQVESWFRASVQPL----QSGRKGVD----PALVKAEAAPVYLKVGK  283
             VI + +  +   +++++ W +  +Q      +  R+GVD    PAL  AEA+   +KV K
Sbjct  21    VIEVPSTALSQGETEIDRWIQKHIQAYVARKEELREGVDTALEPALKAAEASRRVIKVRK  80

Query  284   --GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVA  457
                G F+T+ EA+ TIPA NTKR I++I  G + E++K++  +PFVT +  PK++PTLV 
Sbjct  81    NGAGDFRTVTEAISTIPAGNTKRTIVWIGPGVFEEKIKVNRSQPFVTFFALPKDKPTLVY  140

Query  458   ATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKASFYNC  634
               TA   GT+ SA++ V SDYF AVNI  +NSAP P GKR+  QAVA+ I+GD A+FY C
Sbjct  141   HGTAKDYGTVDSASVIVESDYFMAVNIIFKNSAPEPDGKREGAQAVAMRISGDMAAFYGC  200

Query  635   KFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRN  814
              F GFQDTLCD   RHF+KDCY+EGTVD++FGN KSI+LNT+L  +  ++ A ++A  R 
Sbjct  201   SFIGFQDTLCDDKGRHFFKDCYIEGTVDYIFGNGKSIYLNTELHSV-SNRTAFITAQARE  259

Query  815   SEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNG  994
                +D+G+SF+HC++TGN +   LGR W    + ++AYTY+G  +K EGW       ++ 
Sbjct  260   RVDDDSGYSFIHCKITGNGET-YLGRAWKDRGRVVYAYTYMGTHVKAEGWSNFGVASRD-  317

Query  995   GTCYFGEYNNTGPGAKMDGRPKF  1063
              T ++GEY   GPGA    R  F
Sbjct  318   KTVFYGEYECKGPGAATKRRVPF  340



>ref|XP_008376964.1| PREDICTED: probable pectinesterase 48 [Malus domestica]
Length=316

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 130/278 (47%), Positives = 185/278 (67%), Gaps = 3/278 (1%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKTIQEA  313
            D  PIP++ SQ+ +WF  + +P    +  +DPA+V AEA    +KV + G+  FKT+ +A
Sbjct  29   DNTPIPSDHSQINTWFDNNXKPYTERQSTLDPAVVTAEAGQTVIKVMQDGKGDFKTVTDA  88

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IPA NTKR I+   GG+YNE++ I  ++PFVTLYG P N P L    TA + GT+ S
Sbjct  89   INSIPAGNTKRVIVHXGGGEYNEKIXIPRNKPFVTLYGSPXNMPNLTFDGTAQKYGTVNS  148

Query  494  ATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
            AT+   SDYF A N+ ++NS+PRP GKR   QAVAL ++G+ ++ YNCK  GFQDTLCD 
Sbjct  149  ATVIAESDYFVAANLLIKNSSPRPDGKRVGAQAVALRVSGNNSALYNCKLVGFQDTLCDD  208

Query  671  NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
               H +KDCY+EGTVDF++G+ KS++LNT+L V+    + +++A  R+S  EDTG+SFVH
Sbjct  209  RGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVITAQARDSASEDTGYSFVH  268

Query  851  CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW  964
            C +TG      LGR W    + ++AYT +   + P GW
Sbjct  269  CNITGIGSGTYLGRAWRVRPQVVYAYTSMTEVVNPAGW  306



>ref|XP_009363892.1| PREDICTED: probable pectinesterase 48 [Pyrus x bretschneideri]
Length=355

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/303 (45%), Positives = 194/303 (64%), Gaps = 4/303 (1%)
 Frame = +2

Query  140   DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKTIQEA  313
             D  PIP++ SQ+ +WF  +V+P    +  +DPA+  AEA    +KV + G+  FKT+ +A
Sbjct  14    DNTPIPSDHSQINTWFNNNVKPYTERQSTLDPAVATAEAGQTVIKVMQDGKGDFKTVTDA  73

Query  314   VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
             + +IPA NTKR I+ I  G+YNE++ I  ++PFVTLYG P     L  A TA + GT+ S
Sbjct  74    INSIPAGNTKRVIVHIGRGEYNEKITIPQNKPFVTLYGSPTKMSNLTFAGTAQKYGTVNS  133

Query  494   ATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
             AT+    DYF A N+ ++NS+PRP GKR   QAVAL ++G+ ++ YNCK  GFQDTLCD 
Sbjct  134   ATVIAEFDYFIATNLLIKNSSPRPDGKRVGAQAVALRVSGNNSALYNCKLVGFQDTLCDD  193

Query  671   NNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVH  850
                H +KDCY+EGTVDF++G+ KS++LNT+L V+    + +++A  R+S  EDTG+SFVH
Sbjct  194   RGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVITAQARDSASEDTGYSFVH  253

Query  851   CQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTG  1030
             C VTG      LGR W    + ++AYT +   + P GW     +P+   T  +GEY    
Sbjct  254   CNVTGIGSGTYLGRAWRVRPQVVYAYTSMTEVVNPAGWSN-DNHPERDNTVSYGEYKCMD  312

Query  1031  PGA  1039
             PG+
Sbjct  313   PGS  315



>emb|CDY02121.1| BnaA03g40460D [Brassica napus]
Length=302

 Score =   279 bits (713),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 200/314 (64%), Gaps = 28/314 (9%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
             L + I+ V++  P  V   D  PIP  K+++E WF  +V+  Q+GR              
Sbjct  8     LILTILLVVITWPV-VYGNDATPIPQNKNRIEQWFNNNVR--QNGR--------------  50

Query  263   VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
                     G FKT+ EA+ ++P  N +R II +  G+Y E+V ID ++PF+TLYGDP   
Sbjct  51    --------GDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPNAM  102

Query  443   PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDKA  619
             P L    TAA+ GT+ SATL VLSDYF A+NI V+NSAP P GKR   QA+++ I+G+KA
Sbjct  103   PVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNKA  162

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +FYNCKFYG+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L+TQL V+ GD + +++
Sbjct  163   AFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRVIT  221

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             AH   S +E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW    T
Sbjct  222   AHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWH-KNT  280

Query  980   NPKNGGTCYFGEYN  1021
               +   T ++GEYN
Sbjct  281   QTERDKTVFYGEYN  294



>ref|XP_004174171.1| PREDICTED: probable pectinesterase 49-like, partial [Cucumis 
sativus]
Length=286

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/260 (48%), Positives = 176/260 (68%), Gaps = 3/260 (1%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKT  322
            +P +K+Q+E+WF  +V+P     K  +DPA+V AE     +KV   G   FKT+ EA+ +
Sbjct  27   VPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMSDGTGDFKTVTEAIAS  86

Query  323  IPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATL  502
            +P  N  R +I+I  G Y E++ I+ ++PF+TL G PKN PTL     A++ GT+YSATL
Sbjct  87   VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLTFDGVASKYGTVYSATL  146

Query  503  YVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRH  682
             V +DYF A N+ + N++PRP G+++ QA+A    G K++FYNCKF GFQDTLCD +  H
Sbjct  147  IVEADYFVAANLIIENTSPRPNGRKEAQALAARFRGTKSAFYNCKFLGFQDTLCDDDGLH  206

Query  683  FYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVT  862
             YKDC+++GTVDFVFG   S++LNT+L V+   Q A+++AH R  E + +G+SFVHC +T
Sbjct  207  LYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSIT  266

Query  863  GNSKVAVLGRGWFPYSKTIF  922
            GN K   LGR W P S+ IF
Sbjct  267  GNGKDTFLGRAWMPRSRVIF  286



>ref|XP_004289004.1| PREDICTED: pectinesterase PPME1-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/318 (44%), Positives = 202/318 (64%), Gaps = 17/318 (5%)
 Frame = +2

Query  152   IPAEKSQVESWF---------RASVQPLQSGRKGV--DPALVKAEAAPVYLKVGKGG--Q  292
             IP  ++ ++ W          R +V   +S   G   D  L  AE A   ++V K G   
Sbjct  29    IPENEADLDDWIVRNMREYDKRKAVLNTRSDVPGTHFDTELAAAEDAGRVIRVKKDGTGD  88

Query  293   FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAA  472
             FKT+ +AVK+IP  N +R +++I GG+Y E++ ++  +PFVT YGD  + P++    TAA
Sbjct  89    FKTVTDAVKSIPTGNKRRVVVWIGGGEYREKILVEMTKPFVTFYGDKNDMPSITYDGTAA  148

Query  473   QVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTG-KRDQQAVALTITGDKASFYNCKFYGF  649
               GT  SAT+ V SDYF AVNI   NSAP P G ++D QAVA+ I+GDKA+FYNCKF GF
Sbjct  149   VYGTWNSATVAVESDYFVAVNIAFVNSAPMPDGIRKDAQAVAMRISGDKAAFYNCKFMGF  208

Query  650   QDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKED  829
             QDTLCD   RHF+KDC+++GTVDF+FGN KS++L + L  +  + + +++AHGR+  ++D
Sbjct  209   QDTLCDDKGRHFFKDCFIQGTVDFIFGNGKSLYLKSTLNSV-ANGVGVITAHGRSEAQDD  267

Query  830   TGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYF  1009
             TGFSFV+C + G     +LGR W   ++ +FAYTY+GN +  +GW     N +   T Y+
Sbjct  268   TGFSFVYCTIKGTGDT-LLGRAWRGRARVVFAYTYMGNLVDRKGWSDYNDNTR-ASTVYY  325

Query  1010  GEYNNTGPGAKMDGRPKF  1063
             GEY  +GPG+  + R K+
Sbjct  326   GEYKCSGPGSSSNERVKY  343



>ref|XP_004140271.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=353

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/307 (47%), Positives = 187/307 (61%), Gaps = 22/307 (7%)
 Frame = +2

Query  149   PIPAEKSQVESWFRASVQPLQSGRKG-VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVK  319
             PIP EKSQ+  WF  +V+P     K  +DPAL  AE     +KV   G   FKT+ EA+ 
Sbjct  29    PIPVEKSQLAGWFTENVKPFAVRNKAELDPALATAEENATVIKVMSDGTGNFKTVTEAIA  88

Query  320   TIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-DPKNRPTLVAATTAAQVGTIYSA  496
             ++PA N KR +I+I  G Y E++KID ++PFVTLYG DPKN P L     AA+ GT+YSA
Sbjct  89    SVPADNKKRVVIWIGVGVYKEKLKIDRNKPFVTLYGSDPKNMPKLTFDGDAAKYGTVYSA  148

Query  497   TLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNN  676
             TL V +DYF+A N+ +  +  +                 KA+ YNCKF GFQDTLCD + 
Sbjct  149   TLIVEADYFTAANLIIEKNNIK----------------TKAAIYNCKFLGFQDTLCDDDG  192

Query  677   RHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQ  856
              H YKDC+++GTVDFVFG   S++LNTQL V     +A V+AH R  E + +G+SFVHC 
Sbjct  193   LHLYKDCFIQGTVDFVFGKGTSLYLNTQLDVAGDGGLAGVTAHSREQEADTSGYSFVHCS  252

Query  857   VTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGP  1033
             +TG   K   LGR W P S+ +FAYT I + I PEGW  M+ +     T  FGEY  +GP
Sbjct  253   ITGTGGKNTYLGRAWMPRSRVVFAYTTIADIIHPEGWNDMK-HAGFDKTVMFGEYKCSGP  311

Query  1034  GAKMDGR  1054
             GA   GR
Sbjct  312   GAVSTGR  318



>ref|XP_006381567.1| hypothetical protein POPTR_0006s13930g [Populus trichocarpa]
 gb|ERP59364.1| hypothetical protein POPTR_0006s13930g [Populus trichocarpa]
Length=375

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/313 (46%), Positives = 196/313 (63%), Gaps = 14/313 (4%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGR----KGV-----DPALVKAEAAPVYLKVGKGG--QFK  298
             +PA+ S+V++W   ++      +    KG+     D  L  AE     ++V K G   F 
Sbjct  31    VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDELLASAEDRLRLIRVAKDGFADFT  90

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
             TI +A++TIP  N +R II I GG+Y E++ I  ++PF+T YGDP + P +V   TA+Q 
Sbjct  91    TISDALETIPKDNKRRTIIQIGGGEYWEKITIKCNKPFITFYGDPMDIPRIVFNGTASQY  150

Query  479   GTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQ-QAVALTITGDKASFYNCKFYGFQD  655
             GTIYSAT+ V SDYF AVN+   NSAP P   R   QAV++ I+GDKA+F+NCKF GFQD
Sbjct  151   GTIYSATVAVESDYFMAVNVAFVNSAPLPNVNRTGGQAVSMRISGDKAAFHNCKFIGFQD  210

Query  656   TLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTG  835
             TLCD   RHF+KDCYV GTVDF+FGN KS++LNT +  +  +   +++A  R    ED+G
Sbjct  211   TLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIDSV-AEGTGVITAQAREHVTEDSG  269

Query  836   FSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGE  1015
             F+F+HC +TG      LGR W    + +FAYTY+G+ I  EGW   +  P+  GT Y+GE
Sbjct  270   FTFIHCNLTGLGNNTYLGRAWKQRPRVVFAYTYMGHLINDEGWSTWKF-PEREGTVYYGE  328

Query  1016  YNNTGPGAKMDGR  1054
             Y   GPG+   GR
Sbjct  329   YKCAGPGSSSFGR  341



>ref|XP_007204919.1| hypothetical protein PRUPE_ppa020130mg [Prunus persica]
 gb|EMJ06118.1| hypothetical protein PRUPE_ppa020130mg [Prunus persica]
Length=350

 Score =   273 bits (697),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 135/331 (41%), Positives = 199/331 (60%), Gaps = 26/331 (8%)
 Frame = +2

Query  83    LNVVIVCVLVFCPGGVIPL--DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEA  256
             ++  +   L+  P  +I +  D  P+PA+ SQV +WF  +V P +  +  +DP LV  E 
Sbjct  10    VHAALTMTLLILPTAIIAVADDDTPVPADHSQVNTWFNNNVNPYKERQGTLDPTLVTDEV  69

Query  257   APVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGD  430
                 +KV K   G+FKTI +AV +IP  NTK  I++I GG+YNE++ I  ++PF+T YG 
Sbjct  70    GQTVIKVMKDGSGEFKTITDAVNSIPTNNTKHVIVYIGGGEYNEKITIPRNKPFITFYGS  129

Query  431   PKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITG  610
             P N PTL  A TA + GT+ SAT+ V SDYF A N  ++             A+AL + G
Sbjct  130   PTNMPTLTFAGTAQKYGTVDSATVIVESDYFVAANFIIK-------------ALALRVLG  176

Query  611   DKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMA  790
             +K++ +NC+  GFQDTLCD    +F+KDC++EGTVDF+FG+ KS++LNT+L V+  ++M 
Sbjct  177   NKSALFNCRLIGFQDTLCDDKGNYFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNNEMT  236

Query  791   MVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             +++   R+S  EDTG+SF++C +TG      LGR W    + +FAYT +   I   GW  
Sbjct  237   VITTQARDSASEDTGYSFLYCNITGTGNGTYLGRAWRTSPRVVFAYTSMSEVITSAGW--  294

Query  971   MRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                N KN       +Y  +GPG+ M GR K+
Sbjct  295   ---NDKNRPE----QYKCSGPGSSMVGRVKY  318



>gb|KDP33954.1| hypothetical protein JCGZ_07525 [Jatropha curcas]
Length=374

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 198/316 (63%), Gaps = 14/316 (4%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKG--------VDPALVKAEAAPVYLKVGKG---GQFK  298
             +P E S++ SW   +++     +          +D  LV AE     + V K      F+
Sbjct  31    VPIEYSKLRSWVSDNIKDFNRHKSEDSEGTPIVLDERLVAAEDGVRVITVAKNSTVADFE  90

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
             TI +A+ ++P  NT R II+I GG+Y E++ ++  +PF+TLYG+  + P +V   TA+  
Sbjct  91    TITDAINSVPVNNTARRIIWIRGGEYWEKITVNVSKPFITLYGEAADMPMIVFNGTASVY  150

Query  479   GTIYSATLYVLSDYFSAVNIDVRNSAPRP-TGKRDQQAVALTITGDKASFYNCKFYGFQD  655
             GTIYSAT+ V SDYF AVN+   N+AP P       QAVA+ I+GDKA+FYNCKF GFQD
Sbjct  151   GTIYSATVAVESDYFMAVNVVFLNAAPMPDVNITGAQAVAMRISGDKAAFYNCKFVGFQD  210

Query  656   TLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTG  835
             TLCD   RHF+KDCYV GTVDF+FGN KS++LNT +  +  ++  +++A GR + +E++G
Sbjct  211   TLCDDRGRHFFKDCYVVGTVDFIFGNGKSLYLNTTIESV-ANETGVITAQGRENTEEESG  269

Query  836   FSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGE  1015
             F+F+HC +TG      LGR W    + +FAYTY+G+ I   GW   + +P++  T Y+GE
Sbjct  270   FTFIHCNLTGIGNNTYLGRAWKVRPRVVFAYTYMGSIINGAGWSTGK-HPESNETAYYGE  328

Query  1016  YNNTGPGAKMDGRPKF  1063
             Y   GPGA  DGR K+
Sbjct  329   YMCKGPGASSDGRVKY  344



>ref|XP_002277518.1| PREDICTED: putative pectinesterase 63 isoform X2 [Vitis vinifera]
Length=379

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 207/330 (63%), Gaps = 15/330 (5%)
 Frame = +2

Query  107   LVFCPGGVIPLDTVPIPAEKSQVESWFRASV----QPLQSGRKGV----DPALVKAEAAP  262
             ++F P  V+   T  IP++ S++++W   ++    Q +   +KG+    DP LV AEA  
Sbjct  23    MIFIPA-VVSDKTKHIPSDTSKLDAWIATNIREYRQRIWESKKGLHSSLDPILVAAEAEV  81

Query  263   VYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV K G   FKTI +A+ +IP  N KR +I+I GG+Y E++ ID  +PF+TLYG   
Sbjct  82    NVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEYWEKITIDRSKPFITLYGSTA  141

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
             + P++    TA + GT+ SAT+ V SDYF AVNI   NSAP P GKR   QAVA+ I+GD
Sbjct  142   DMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVNSAPMPDGKRVGAQAVAMRISGD  201

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+F+NC F GFQDTLCD   RHF+KDC ++GTVDF+FG+ KS++LNT ++ +    + +
Sbjct  202   KAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGDGKSLYLNTMIQSV-AKGVGV  260

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R +  + +GF+FVHC ++G+     LGR W    + +FAYTY+G  I  EGW   
Sbjct  261   ITAQARENVADTSGFAFVHCNISGSGDT-YLGRAWRLRPRVVFAYTYMGTLINGEGWSD-  318

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               +     T Y+GEY   GPGA   GR KF
Sbjct  319   NLHADRDKTVYYGEYMCEGPGATPSGRVKF  348



>emb|CBI27759.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 207/330 (63%), Gaps = 15/330 (5%)
 Frame = +2

Query  107   LVFCPGGVIPLDTVPIPAEKSQVESWFRASV----QPLQSGRKGV----DPALVKAEAAP  262
             ++F P  V+   T  IP++ S++++W   ++    Q +   +KG+    DP LV AEA  
Sbjct  35    MIFIPA-VVSDKTKHIPSDTSKLDAWIATNIREYRQRIWESKKGLHSSLDPILVAAEAEV  93

Query  263   VYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV K G   FKTI +A+ +IP  N KR +I+I GG+Y E++ ID  +PF+TLYG   
Sbjct  94    NVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEYWEKITIDRSKPFITLYGSTA  153

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
             + P++    TA + GT+ SAT+ V SDYF AVNI   NSAP P GKR   QAVA+ I+GD
Sbjct  154   DMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVNSAPMPDGKRVGAQAVAMRISGD  213

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+F+NC F GFQDTLCD   RHF+KDC ++GTVDF+FG+ KS++LNT ++ +    + +
Sbjct  214   KAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGDGKSLYLNTMIQSV-AKGVGV  272

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
             ++A  R +  + +GF+FVHC ++G+     LGR W    + +FAYTY+G  I  EGW   
Sbjct  273   ITAQARENVADTSGFAFVHCNISGSGDT-YLGRAWRLRPRVVFAYTYMGTLINGEGWSD-  330

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
               +     T Y+GEY   GPGA   GR KF
Sbjct  331   NLHADRDKTVYYGEYMCEGPGATPSGRVKF  360



>ref|XP_011039979.1| PREDICTED: putative pectinesterase 63 [Populus euphratica]
Length=375

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 196/316 (62%), Gaps = 14/316 (4%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGR----KGV-----DPALVKAEAAPVYLKVGKGG--QFK  298
             +PA+ S+V++W   ++      +    KG+     D  L  AE     ++V K G   F 
Sbjct  31    VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDELLASAEDRLRLIRVAKDGFADFT  90

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
             TI +A++TI   N +R II I GG+Y E++ I  ++PFVT YGDP + P +V   TA+Q 
Sbjct  91    TISDALETIQKDNKRRIIIQIGGGEYWEKITIKCNKPFVTFYGDPMDIPRIVFNGTASQY  150

Query  479   GTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQ-QAVALTITGDKASFYNCKFYGFQD  655
             GTIYSAT+ V SDYF AVN+   NSAP P   R   QAVA+ I+GDKA+F+NCKF GFQD
Sbjct  151   GTIYSATVAVESDYFMAVNVAFVNSAPMPNVNRTGGQAVAMRISGDKAAFHNCKFIGFQD  210

Query  656   TLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTG  835
             TLCD   RHF+KDCYV GTVDF+FGN KS++LNT +  +  +   +++A  R    ED+G
Sbjct  211   TLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIASV-AEGTGVITAQAREHVTEDSG  269

Query  836   FSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGE  1015
             F+F+HC +TG      LGR W    + +FAYTY+G+ I  EGW   +  P+  GT Y+GE
Sbjct  270   FTFIHCNLTGFGNDTYLGRAWKQRPRVVFAYTYMGHLINDEGWSTWKF-PEREGTVYYGE  328

Query  1016  YNNTGPGAKMDGRPKF  1063
             Y   GPG+   GR  +
Sbjct  329   YKCAGPGSSSFGRVSY  344



>ref|XP_010483849.1| PREDICTED: putative pectinesterase 63 [Camelina sativa]
Length=309

 Score =   270 bits (691),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/260 (50%), Positives = 180/260 (69%), Gaps = 3/260 (1%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G FKTI EA+K++ A NT R II +  G Y E+V ID ++PF+TLYG P   P L    T
Sbjct  22    GHFKTITEAIKSVQAGNTGRVIIKVGPGVYKEKVTIDRNKPFITLYGHPNAMPVLTYDGT  81

Query  467   AAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFY  643
             A + GT+ SATL VLSDYF A+NI V+N+AP P GK +  QA+++ I+G+KA+FYNCKFY
Sbjct  82    ALRYGTVDSATLIVLSDYFMAINIIVKNNAPMPDGKMKGAQALSMRISGNKAAFYNCKFY  141

Query  644   GFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEK  823
             G+QDT+CD    HF+KDCY+EGT DF+FG+ +S++L TQL V+ GD + +++AH   S +
Sbjct  142   GYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIRVITAHAGKSAQ  200

Query  824   EDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTC  1003
             E +G+SFVHC+VTG      LGR W  + K ++AYT + + + P GW   R   ++  T 
Sbjct  201   EKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWQENRDTGRD-KTV  259

Query  1004  YFGEYNNTGPGAKMDGRPKF  1063
             ++GEY  TGPG++ + R KF
Sbjct  260   FYGEYKCTGPGSRKEKRVKF  279



>ref|XP_008242288.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=370

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/313 (44%), Positives = 199/313 (64%), Gaps = 13/313 (4%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGV------DPALVKAEAAPVYLKVGKGG--QFKTIQ  307
             IP   SQ+++W   +++   + RK        D  L+ AE A   + V K G   FKT+ 
Sbjct  32    IPPHLSQLDTWIVHNIRDY-ANRKATQATLRFDSKLLSAEYAVKIITVKKDGTGDFKTVT  90

Query  308   EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTI  487
             +AV +IP+ NT+R ++FI GG+Y E++ +D  RPFVT YGD  + P++    TA + GT 
Sbjct  91    DAVNSIPSWNTRRVVVFIRGGEYREKILVDASRPFVTFYGDKNDVPSITFDGTALKYGTW  150

Query  488   YSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLC  664
              SAT+ V +DYF AVNI   NSAP P G R   QAVA+ I+GDKA+F+NC+F GFQDTLC
Sbjct  151   DSATVAVDADYFVAVNIAFVNSAPMPDGNRPGAQAVAMRISGDKAAFHNCRFIGFQDTLC  210

Query  665   DHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSF  844
             D   RHF+KDCY++GTVDF+FGN KS++LN ++  +  + M +++AH R    +D+GF+F
Sbjct  211   DDRGRHFFKDCYIQGTVDFIFGNGKSLYLNNRIHSV-ANGMGVITAHAREDAADDSGFAF  269

Query  845   VHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNN  1024
             VHC +TG      LGR W   ++ +FAYT +G+ I  +GW     + ++  T Y+GEY  
Sbjct  270   VHCNITGTGDT-FLGRAWRDRARVVFAYTNMGSLINSQGWSDAMHSERD-KTVYYGEYKC  327

Query  1025  TGPGAKMDGRPKF  1063
              GPG+   GR K+
Sbjct  328   MGPGSSSTGRVKY  340



>ref|XP_010259713.1| PREDICTED: pectinesterase PPME1-like [Nelumbo nucifera]
Length=336

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/291 (48%), Positives = 190/291 (65%), Gaps = 12/291 (4%)
 Frame = +2

Query  206   LQSGRKGVDPALVKAEAAPVYLKVG--KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYN  379
             L  G   +D AL  AE +   +KV     G+FKT+ +A+K+IP  N +R +I I  G+Y 
Sbjct  22    LPIGGDSLDAALADAEKSKKVIKVNLDGSGEFKTVTDALKSIPTDNKERVVISIGPGEYV  81

Query  380   ERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAP  559
             E++ +D  +PF+T YG P+N PTL    TA + GT+ SA++ VL+DYF A NI ++NSAP
Sbjct  82    EKITVD--KPFITFYGSPQNMPTLSFGGTAHEYGTVDSASVMVLADYFVAANIIMKNSAP  139

Query  560   RPTGK---RDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFG  730
              PTG+      QAVA+ ++GDKA+FYNC+F GFQDTL  +  RH++KDCYVEGTVDFVFG
Sbjct  140   IPTGQFRFNGGQAVAMRVSGDKAAFYNCRFIGFQDTLLAYKGRHYFKDCYVEGTVDFVFG  199

Query  731   NAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYS  910
               K++F+NT++R I  +++ M+ A  R +  ED GFSFVHC+VTG   +  LGR WFPY 
Sbjct  200   GGKTLFMNTEIRSI-SNELVMIVAQARKNASEDNGFSFVHCKVTGTGDI-YLGRPWFPYG  257

Query  911   KTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             + IFA+T +   + P GW        N    YF EY NTGPG+  D RP +
Sbjct  258   RIIFAFTDMCAQVNPLGWHEGAFPTTN---VYFVEYKNTGPGSNTDKRPAW  305



>ref|XP_011016271.1| PREDICTED: putative pectinesterase 63 [Populus euphratica]
Length=375

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 195/316 (62%), Gaps = 14/316 (4%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGR----KGV-----DPALVKAEAAPVYLKVGKGG--QFK  298
             +PA+ S+V++W   ++      +    KG+     D  L  AE     ++V K G   F 
Sbjct  31    VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDELLASAEDRLRLIRVAKDGFADFT  90

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
             TI +A++TI   N +R II I GG+Y E++ I  ++PFVT YGDP + P +V   TA+Q 
Sbjct  91    TISDALETIQKDNKRRIIIQIGGGEYWEKITIKCNKPFVTFYGDPMDIPRIVFNGTASQY  150

Query  479   GTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQ-QAVALTITGDKASFYNCKFYGFQD  655
             GTIYSAT+ V SDYF AVN+   NSAP P   R   QAVA+ I+GDKA+F+NCKF GFQD
Sbjct  151   GTIYSATVAVESDYFMAVNVAFVNSAPMPNVNRTGGQAVAMRISGDKAAFHNCKFIGFQD  210

Query  656   TLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTG  835
             TLCD   RHF+KDCYV GTVDF+FGN KS++LNT +  +  +   +++A  R    ED+G
Sbjct  211   TLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIASV-AEGTGVITAQAREHVTEDSG  269

Query  836   FSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGE  1015
             F+F+HC +TG      LGR W      +FAYTY+G+ I  EGW   +  P+  GT Y+GE
Sbjct  270   FTFIHCNLTGFGNDTYLGRAWKQRPSVVFAYTYMGHLINDEGWSTWKF-PEREGTVYYGE  328

Query  1016  YNNTGPGAKMDGRPKF  1063
             Y   GPG+   GR  +
Sbjct  329   YKCAGPGSSSFGRVSY  344



>ref|XP_007202075.1| hypothetical protein PRUPE_ppa005976mg [Prunus persica]
 gb|EMJ03274.1| hypothetical protein PRUPE_ppa005976mg [Prunus persica]
Length=434

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 201/313 (64%), Gaps = 13/313 (4%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGV------DPALVKAEAAPVYLKVGKGG--QFKTIQ  307
             IP   SQ+++W   +++   + RK        D  L+ AE A   + V K G   FKT+ 
Sbjct  96    IPPHLSQLDTWIVHNMRDY-ANRKATQVTLRFDSKLLSAEYAFKIITVKKDGTGDFKTVT  154

Query  308   EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTI  487
             +AV +IP+ N +R ++FI GG+Y E++ +D  RPFVT YGD  + P++    TA + GT 
Sbjct  155   DAVNSIPSWNKRRVVVFIDGGEYREKILVDVSRPFVTFYGDKNDVPSITFDGTALKYGTW  214

Query  488   YSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLC  664
              SAT+ + +DYF AVNI   NSAP P GKR   QAVA+ I+GDKA+F++C+F GFQDTLC
Sbjct  215   DSATVAIEADYFVAVNIAFVNSAPMPDGKRPGAQAVAMRISGDKAAFHSCRFIGFQDTLC  274

Query  665   DHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSF  844
             D   RHF+KDCY++GTVDF+FGN KS++LN ++  +  + M +++AH R    +D+GF+F
Sbjct  275   DDRGRHFFKDCYIQGTVDFIFGNGKSLYLNNRIHSV-ANGMGVITAHAREDAADDSGFAF  333

Query  845   VHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNN  1024
             VHC +TG      LGR W   ++ +FAYTY+G+ I  +GW   + + ++  T Y+GEY  
Sbjct  334   VHCNITGTGDT-FLGRAWRDRARVVFAYTYMGSLIDSQGWSDAKHSERD-KTVYYGEYKC  391

Query  1025  TGPGAKMDGRPKF  1063
              GPG+   GR K+
Sbjct  392   MGPGSSSTGRVKY  404



>gb|KHN15646.1| Putative pectinesterase 63 [Glycine soja]
Length=296

 Score =   269 bits (688),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 174/257 (68%), Gaps = 2/257 (1%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G+FKTI +A+ ++P  NTKR I+FI  G YNE++KI+  +PFVTLYG P+  P L    T
Sbjct  6     GEFKTITDAINSVPNGNTKRVIVFIGAGNYNEKIKIERTKPFVTLYGVPEKMPNLTFGGT  65

Query  467   AAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFY  643
             A Q GT+ SATL V SDYF A NI + N+APRP  K    QAVAL I+GDKA+FYNCK +
Sbjct  66    AQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMF  125

Query  644   GFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEK  823
             GFQDT+CD  N+HF+KDC ++GT+D++FG+ KS++++T+LR +  + + ++ A  R SE 
Sbjct  126   GFQDTICDDRNKHFFKDCLIQGTMDYIFGSGKSLYMSTELRTLGDNGITVIVAQARKSET  185

Query  824   EDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTC  1003
             ED  +SFVHC VTG      LGR W  + + +FAY+ +   +   GW     +P++  T 
Sbjct  186   EDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSTMSGIVNKLGWSN-NNHPEHDKTV  244

Query  1004  YFGEYNNTGPGAKMDGR  1054
              FGEY NTGPGA   GR
Sbjct  245   RFGEYQNTGPGADPKGR  261



>gb|KHN47850.1| Putative pectinesterase 63 [Glycine soja]
Length=300

 Score =   269 bits (687),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/261 (50%), Positives = 177/261 (68%), Gaps = 6/261 (2%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G+FKTI +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    T
Sbjct  6     GEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGT  65

Query  467   AAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFY  643
             A Q GT+ SATL V SDYF A NI + N+APRP  K    QAVAL I+GDKA+FYNCK Y
Sbjct  66    AQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMY  125

Query  644   GFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIF----LNTQLRVIPGDQMAMVSAHGR  811
             GFQDT+CD  NRHF+KDC ++GT+D++FG+ KS++    ++T+LR +  + + ++ A  R
Sbjct  126   GFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVVSKISTELRTLGDNGITVIVAQAR  185

Query  812   NSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKN  991
              SE ED  +SFVHC VTG      LGR W  + + +FAY+ + + +   GW     +P++
Sbjct  186   KSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGWSN-NNHPEH  244

Query  992   GGTCYFGEYNNTGPGAKMDGR  1054
               T  FGEY N+GPGA   GR
Sbjct  245   DKTVRFGEYQNSGPGADPKGR  265



>ref|XP_009123158.1| PREDICTED: probable pectinesterase 49 [Brassica rapa]
Length=295

 Score =   268 bits (685),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 171/257 (67%), Gaps = 2/257 (1%)
 Frame = +2

Query  284   GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAAT  463
             GG FKTI EA+K+IP  NTKR II +A G Y+E+V +D  RPFVTL G P     L    
Sbjct  8     GGDFKTINEAIKSIPIGNTKRVIIKLAPGVYHEKVTVDVGRPFVTLMGKPGAETNLTFDG  67

Query  464   TAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFY  643
             TA++ GT+ SATL + + YF A N+ V+N+AP P      QA+A+ I GDKA+FYNC+FY
Sbjct  68    TASKFGTMESATLIIWAKYFVAANLHVKNTAPMPKAGTQGQALAMRINGDKAAFYNCRFY  127

Query  644   GFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEK  823
             GFQDTLCD    HF+KDCY+EGT DF+FG   S++LNTQL  + GD + +++AH R SE 
Sbjct  128   GFQDTLCDDIGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVITAHNRQSEN  186

Query  824   EDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTC  1003
             +  G+SFVHC++TG      LGR W  + K ++AYT + + + P GW   R N +N  T 
Sbjct  187   QQNGYSFVHCKITGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPTGWQENR-NRENDKTV  245

Query  1004  YFGEYNNTGPGAKMDGR  1054
             ++GEY  TGPG+  + R
Sbjct  246   FYGEYMCTGPGSHKEKR  262



>ref|XP_006474682.1| PREDICTED: putative pectinesterase 63-like [Citrus sinensis]
Length=369

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 195/316 (62%), Gaps = 15/316 (5%)
 Frame = +2

Query  152   IPAEKSQVESW-------FRASVQPLQSGRKG--VDPALVKAEAAPVYLKVGKGGQ--FK  298
             IP + S++E+W       F      L  G+    VD  L  AE     + V K G+  FK
Sbjct  27    IPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAAAEDGFRVITVRKDGRGDFK  86

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
             T+ +AVK+IP+ NT+R ++ I GG+Y E++ ++  + FVT +GDP + P +V   TA   
Sbjct  87    TVTDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTFFGDPFDMPKIVFNGTALHF  146

Query  479   GTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQD  655
             GT+ SAT+ V SDYF A N+   NSAP P GKR   QAVA+ I+GDKA+F+NCKF G+QD
Sbjct  147   GTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAMRISGDKAAFHNCKFMGYQD  206

Query  656   TLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTG  835
             TLCD   RHF+KDCY++GTVDF+FGN KS++L T + V   + + +++A  R    +D+G
Sbjct  207   TLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTI-VSVANGLGVITAQAREQVNDDSG  265

Query  836   FSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGE  1015
             F+FVHC +TG+     LGR W    + +FAYTY+G  I  +GW       +N  T Y+GE
Sbjct  266   FTFVHCNITGSGDT-YLGRAWKERPRVVFAYTYMGTLINSQGWAAGE-QAQNHKTVYYGE  323

Query  1016  YNNTGPGAKMDGRPKF  1063
             Y   GPGA   GR KF
Sbjct  324   YKCMGPGASSSGRVKF  339



>ref|XP_010656088.1| PREDICTED: putative pectinesterase 63 isoform X1 [Vitis vinifera]
Length=382

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 148/333 (44%), Positives = 209/333 (63%), Gaps = 18/333 (5%)
 Frame = +2

Query  107   LVFCPGGVIPLDTVPIPAEKSQVESWFRASV----QPLQSGRKGV----DPALVKAEAAP  262
             ++F P  V+   T  IP++ S++++W   ++    Q +   +KG+    DP LV AEA  
Sbjct  23    MIFIPA-VVSDKTKHIPSDTSKLDAWIATNIREYRQRIWESKKGLHSSLDPILVAAEAEV  81

Query  263   VYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
               +KV K G   FKTI +A+ +IP  N KR +I+I GG+Y E++ ID  +PF+TLYG   
Sbjct  82    NVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEYWEKITIDRSKPFITLYGSTA  141

Query  437   NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNID--VR-NSAPRPTGKR-DQQAVALTI  604
             + P++    TA + GT+ SAT+ V SDYF AVNI   VR NSAP P GKR   QAVA+ I
Sbjct  142   DMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVVRTNSAPMPDGKRVGAQAVAMRI  201

Query  605   TGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQ  784
             +GDKA+F+NC F GFQDTLCD   RHF+KDC ++GTVDF+FG+ KS++LNT ++ +    
Sbjct  202   SGDKAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGDGKSLYLNTMIQSV-AKG  260

Query  785   MAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW  964
             + +++A  R +  + +GF+FVHC ++G+     LGR W    + +FAYTY+G  I  EGW
Sbjct  261   VGVITAQARENVADTSGFAFVHCNISGSGDT-YLGRAWRLRPRVVFAYTYMGTLINGEGW  319

Query  965   MGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                  +     T Y+GEY   GPGA   GR KF
Sbjct  320   SD-NLHADRDKTVYYGEYMCEGPGATPSGRVKF  351



>ref|XP_010259712.1| PREDICTED: pectinesterase PPME1-like [Nelumbo nucifera]
Length=337

 Score =   267 bits (683),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 179/262 (68%), Gaps = 10/262 (4%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G+FKT+ EA+K+IP  N +R +I I  G+Y E++ +D  +PF+T YG P+N PTL    T
Sbjct  52    GEFKTVTEALKSIPKYNKERVVISIGPGEYVEKITVD--KPFITFYGSPQNMPTLSFDGT  109

Query  467   AAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGK---RDQQAVALTITGDKASFYNCK  637
             A + GT+ SA++ VL++YF AVNI ++NSAP PTGK      QAVA+ ++GDKA+FYNC+
Sbjct  110   AHEYGTVDSASVMVLANYFVAVNIIMKNSAPIPTGKFRFNGGQAVAMRVSGDKAAFYNCR  169

Query  638   FYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNS  817
             F GFQDTL  +  RH++KDCYVEGTVDFVFG  K++F+NT++R +  +++ M+ A  R +
Sbjct  170   FIGFQDTLLAYKGRHYFKDCYVEGTVDFVFGGGKTLFMNTEIRSV-SNELVMIVAQARKN  228

Query  818   EKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGG  997
               ED GFSFVHC VTG   +  LGR WFPY + IFA+T +   + P GW        N  
Sbjct  229   ASEDNGFSFVHCNVTGTGDI-YLGRPWFPYGRIIFAFTELCAQVNPLGWHEGAVPTTN--  285

Query  998   TCYFGEYNNTGPGAKMDGRPKF  1063
               YF EY NTGPG+ +D RP +
Sbjct  286   -VYFVEYKNTGPGSNIDKRPAW  306



>ref|XP_007219211.1| hypothetical protein PRUPE_ppa017319mg, partial [Prunus persica]
 gb|EMJ20410.1| hypothetical protein PRUPE_ppa017319mg, partial [Prunus persica]
Length=270

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/279 (49%), Positives = 174/279 (62%), Gaps = 29/279 (10%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            D+ PIPA+ SQV SWF  +V+PL   +  +D A+V AE  P  +KV K   G FKT+ EA
Sbjct  7    DSTPIPADGSQVGSWFDNNVKPLTERKGTLDAAIVTAEDGPKLIKVMKDGSGNFKTLTEA  66

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP RNTKR +++I GG YNE++KI  ++PFVTLYG P N P L    TA + GT+YS
Sbjct  67   INSIPERNTKRVVVYIGGGVYNEKIKIPQNKPFVTLYGSPNNMPNLTFDGTAQKYGTVYS  126

Query  494  ATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHN  673
             TL V SDYF A NI V     RP    D QAVAL I+GDKASFYNCKF+GFQDTL D+ 
Sbjct  127  GTLIVESDYFRAANIIVTPDGIRP----DAQAVALQISGDKASFYNCKFFGFQDTLYDYK  182

Query  674  NRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHC  853
              HF+KDCY++GTVDF+FG  KS++L                     S  ED  FSFVHC
Sbjct  183  GLHFFKDCYIQGTVDFIFGKGKSLYL---------------------SASEDNEFSFVHC  221

Query  854  QVTGNSKV--AVLGRGWFPYSKTIFAYTYIGNAIKPEGW  964
            ++TG + V    LGR W      +FAYT + + + PE W
Sbjct  222  KITGTTYVRGTYLGRAWGSSPTVVFAYTDMADVVHPERW  260



>ref|XP_006452876.1| hypothetical protein CICLE_v10010655mg [Citrus clementina]
 gb|ESR66116.1| hypothetical protein CICLE_v10010655mg [Citrus clementina]
Length=369

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/316 (45%), Positives = 196/316 (62%), Gaps = 15/316 (5%)
 Frame = +2

Query  152   IPAEKSQVESW-------FRASVQPLQSGRKG--VDPALVKAEAAPVYLKVGKGGQ--FK  298
             IP + S++E+W       F      L  G+    VD  L  AE     + V K G+  FK
Sbjct  27    IPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAAAEDGFRVITVRKDGRGDFK  86

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
             TI +AVK+IP+ NT+R ++ I GG+Y E++ ++  + FVT +GDP + P +V   TA   
Sbjct  87    TITDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTFFGDPFDMPKIVFNGTALHF  146

Query  479   GTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQD  655
             GT+ SAT+ V SDYF A N+   NSAP P GKR   QAVA+ I+GDKA+F+NCKF G+QD
Sbjct  147   GTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAMRISGDKAAFHNCKFIGYQD  206

Query  656   TLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTG  835
             TLCD   RHF+KDCY++GTVDF+FGN KS++L T + V   + + +++A  R    +D+G
Sbjct  207   TLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTI-VSVANGLGVITAQAREQVNDDSG  265

Query  836   FSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGE  1015
             F+FVHC +TG+     LGR W    + +FAYTY+G  I  +GW     + ++  T Y+GE
Sbjct  266   FTFVHCNITGSGDT-YLGRAWKERPRVLFAYTYMGTLINSQGWAAGE-HSQSHKTVYYGE  323

Query  1016  YNNTGPGAKMDGRPKF  1063
             Y   GPGA   GR KF
Sbjct  324   YKCMGPGASSSGRVKF  339



>gb|KDO73799.1| hypothetical protein CISIN_1g047018mg [Citrus sinensis]
Length=369

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 196/316 (62%), Gaps = 15/316 (5%)
 Frame = +2

Query  152   IPAEKSQVESW-------FRASVQPLQSGRKG--VDPALVKAEAAPVYLKVGKGGQ--FK  298
             IP + S++E+W       F      L  G+    VD  L  AE     + V K G+  FK
Sbjct  27    IPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAAAEDGFRVITVRKDGRGDFK  86

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQV  478
             T+ +AVK+IP+ NT+R ++ I GG+Y E++ ++  + FVT +GDP + P +V   TA   
Sbjct  87    TVTDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTFFGDPFDMPKIVFNGTALHF  146

Query  479   GTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQD  655
             GT+ SAT+ V SDYF A N+   NSAP P GKR   QAVA+ I+GDKA+F+NCKF G+QD
Sbjct  147   GTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAMRISGDKAAFHNCKFIGYQD  206

Query  656   TLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTG  835
             TLCD   RHF+KDCY++GTVDF+FGN KS++L T + V   + + +++A  R    +D+G
Sbjct  207   TLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTI-VSVANGLGVITAQAREQVNDDSG  265

Query  836   FSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGE  1015
             F+FVHC +TG+     LGR W    + +FAYTY+G  I  +GW     + ++  T Y+GE
Sbjct  266   FTFVHCNITGSGDT-YLGRAWKERPRVLFAYTYMGTLINSQGWAAGE-HSQSHKTVYYGE  323

Query  1016  YNNTGPGAKMDGRPKF  1063
             Y   GPGA   GR KF
Sbjct  324   YKCMGPGASSSGRVKF  339



>ref|XP_008391732.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=365

 Score =   265 bits (677),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 138/313 (44%), Positives = 196/313 (63%), Gaps = 13/313 (4%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGV------DPALVKAEAAPVYLKVGKGG--QFKTIQ  307
             IP   SQ++SW   +++   + RK        D  L+ AE     + V K G  QF+T+ 
Sbjct  27    IPPNFSQLDSWIXHNMRDY-ANRKATQXTLRFDAQLLSAEEIVRIITVRKDGTGQFRTVT  85

Query  308   EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTI  487
             +AV +IP+ NT+R ++FI GG Y E+V +D  +PFVT YGD  + P++    TA + GT 
Sbjct  86    DAVNSIPSGNTRRVVVFIGGGVYTEKVLVDASKPFVTFYGDQNDVPSITFDGTALKYGTW  145

Query  488   YSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLC  664
              S+T+ V SDYF AVNI   NSAP P G R   QAVA+ I+GDKA+F+NC+F GFQDTL 
Sbjct  146   NSSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLL  205

Query  665   DHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSF  844
             D   RHF+KDC+V+GTVDF+FGN KS++LN  +  +  + M +++AH R + ++D+GF+F
Sbjct  206   DDRGRHFFKDCHVQGTVDFIFGNGKSLYLNNTIHSV-ANGMGVITAHARENVEDDSGFAF  264

Query  845   VHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNN  1024
             VHC +TG      LGR W    + +FAY Y+G+ I  +GW       ++  T Y+GEY  
Sbjct  265   VHCNITGTGDT-FLGRAWRERPRVVFAYAYMGSLINKQGWSDYMHTERD-KTVYYGEYKC  322

Query  1025  TGPGAKMDGRPKF  1063
              GPG+   GR K+
Sbjct  323   MGPGSSSSGRVKY  335



>ref|XP_009343360.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=366

 Score =   265 bits (678),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 137/313 (44%), Positives = 197/313 (63%), Gaps = 13/313 (4%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGV------DPALVKAEAAPVYLKVGKGG--QFKTIQ  307
             IP   SQ++SW   +++   + RK        D  L+ AE     + V K G  QF+T+ 
Sbjct  28    IPPNFSQLDSWIAHNMRGY-TNRKATQATLRFDAQLLSAEEIVRIITVRKDGTGQFRTVT  86

Query  308   EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTI  487
             +AV +IP+ NT+R ++FI GG Y E++ +D  +PFVT YGD  + P++    TA + GT 
Sbjct  87    DAVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTW  146

Query  488   YSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLC  664
              S+T+ V SDYF AVNI   NSAP P G R   QAVA+ I+GDKA+F+NC+F GFQDTL 
Sbjct  147   NSSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLL  206

Query  665   DHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSF  844
             D   RHF+KDC+++GTVDF+FGN KS++LN  +  +  + M +++AH R + ++D+GF+F
Sbjct  207   DDRGRHFFKDCHIQGTVDFIFGNGKSLYLNNTIHSV-ANGMGVITAHARANVEDDSGFAF  265

Query  845   VHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNN  1024
             VHC +TG      LGR W    + +FAYTY+G+ I  +GW       ++  T Y+GEY  
Sbjct  266   VHCNITGTGDT-FLGRAWRERPRVVFAYTYMGSLIDKQGWSDYMHTERD-KTVYYGEYKC  323

Query  1025  TGPGAKMDGRPKF  1063
              GPG+   GR K+
Sbjct  324   MGPGSSSSGRVKY  336



>ref|XP_008450966.1| PREDICTED: putative pectinesterase 63 [Cucumis melo]
Length=394

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/332 (41%), Positives = 201/332 (61%), Gaps = 12/332 (4%)
 Frame = +2

Query  98    VCVLVFCPGGV-IPLDTVPIPAEKSQVESWFRASVQPL------QSGRKGVDPALVKAEA  256
             + +L+  P  V +   T  IPA+ S+++ W   +++        ++G K +D  L +AE 
Sbjct  24    LIILITIPSTVLVEARTKTIPADSSKLDEWIAHNMREYNDRKMNETGIKALDRRLAEAED  83

Query  257   APVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGD  430
                 + V K G+  F TI EA+++IP+ N +R +++I GG Y E++ ID  +PFVTLYG 
Sbjct  84    CVRLITVRKDGRGNFSTITEAIESIPSGNRRRVVVWIGGGVYREKITIDASKPFVTLYGQ  143

Query  431   PKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTIT  607
                RP +    TA++ GT+ SAT+ V SDYF AVN+   NSAP P  G    QAVA+ I+
Sbjct  144   KGKRPVITFDGTASEFGTVKSATVAVESDYFVAVNLTFVNSAPMPELGGTGGQAVAMRIS  203

Query  608   GDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM  787
             GDKA+F+ C F GFQDTLCD   RHF++DCY++GTVDF+FGN KS++L T +  +  + +
Sbjct  204   GDKAAFHECHFIGFQDTLCDDRGRHFFRDCYIQGTVDFIFGNGKSLYLKTTINSV-AEGI  262

Query  788   AMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWM  967
              +++A  R    +++GF+F +C +TG      LGR W   ++ +FAYTY+G  I  EGW 
Sbjct  263   GVITAQAREDATDESGFTFAYCNITGTGNT-YLGRAWKERTRVVFAYTYMGTLINTEGWS  321

Query  968   GMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                   +   + Y+GEY   GPGA   GR K+
Sbjct  322   DKMHGSQPRKSMYYGEYKCKGPGATSSGRVKY  353



>ref|XP_009348900.1| PREDICTED: putative pectinesterase 63 isoform X1 [Pyrus x bretschneideri]
Length=366

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 134/312 (43%), Positives = 199/312 (64%), Gaps = 11/312 (4%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQ---PLQSGRKGV--DPALVKAEAAPVYLKVGKGG--QFKTIQE  310
             IP   SQ++SW   +++    L++ +  +  D  ++ AE     + V K G  QF+T+ +
Sbjct  28    IPPNFSQLDSWIAHNMRGYTNLKATQATLRFDAQILSAEEIVRIITVRKDGTGQFRTVTD  87

Query  311   AVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIY  490
             AV +IP+ NT+R ++FI GG Y E++ +D  +PFVT YGD  + P++    TA + GT  
Sbjct  88    AVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  147

Query  491   SATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCD  667
             S+T+ V SDYF AVNI   NSAP P G R   QAVA+ I+GDKA+F+NC+F GFQDTL D
Sbjct  148   SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  207

Query  668   HNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFV  847
                RHF+KDC+++GTVDF+FGN KS++LN  +  +  + M +++AH R + ++D+GF+FV
Sbjct  208   DRGRHFFKDCHIQGTVDFIFGNGKSLYLNNMIHSV-ANGMGVITAHARENVEDDSGFAFV  266

Query  848   HCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNT  1027
             HC +TG      LGR W    + +FAYTY+G+ I  +GW       ++  T ++GEY   
Sbjct  267   HCNITGTGD-TFLGRAWRERPRVVFAYTYMGSLIDKQGWSDYMHTERD-KTVFYGEYKCM  324

Query  1028  GPGAKMDGRPKF  1063
             GPG+   GR K+
Sbjct  325   GPGSSSSGRVKY  336



>ref|XP_004144054.1| PREDICTED: probable pectinesterase 50-like [Cucumis sativus]
 ref|XP_004159358.1| PREDICTED: probable pectinesterase 50-like [Cucumis sativus]
 gb|KGN66331.1| Pectinesterase [Cucumis sativus]
Length=394

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 194/321 (60%), Gaps = 11/321 (3%)
 Frame = +2

Query  128   VIPLDTVPIPAEKSQVESWFRASVQPL------QSGRKGVDPALVKAEAAPVYLKVGKGG  289
             V+   T  IPA+ S+++ W   +++        ++G K +D  L +AE     + V K G
Sbjct  35    VVEAHTKTIPADSSKLDEWIGHNMKEYNDRKTNETGIKALDRRLAEAEDCVQLITVRKDG  94

Query  290   Q--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAAT  463
             +  F TI EA+ +IP+ N +R +++I GG Y E++ ID  +PFVTLYG    RP +    
Sbjct  95    RGNFSTITEAIDSIPSGNRRRVVVWIGGGVYREKITIDASKPFVTLYGQKGKRPMITFDG  154

Query  464   TAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKASFYNCKF  640
             TA++ GT+ SAT+ V SDYF AVN+   NSAP P  G    QAVA+ I+GDKA+F+ C F
Sbjct  155   TASEFGTVKSATVAVESDYFVAVNLTFVNSAPMPELGGTGGQAVAMRISGDKAAFHGCHF  214

Query  641   YGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSE  820
              GFQDTLCD   RHF+KDCYV+GTVDF+FGN KS++L T +  +  +   +++A  R   
Sbjct  215   IGFQDTLCDDRGRHFFKDCYVQGTVDFIFGNGKSLYLKTTINSV-AEGTGVITAQAREDA  273

Query  821   KEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGT  1000
              +++GF+F +C +TG      LGR W   ++ +FAYTY+G  I  EGW       +   +
Sbjct  274   TDESGFTFAYCNITGTGDT-YLGRAWKERTRVVFAYTYMGTLINTEGWSDKMHGSQPRKS  332

Query  1001  CYFGEYNNTGPGAKMDGRPKF  1063
              Y+GEY   GPGA   GR K+
Sbjct  333   MYYGEYKCKGPGATPSGRVKY  353



>ref|XP_008344163.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=324

 Score =   259 bits (662),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 130/281 (46%), Positives = 182/281 (65%), Gaps = 6/281 (2%)
 Frame = +2

Query  230   DPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFD  403
             D  L+ AE     + V K G  QF+T+ +AV +IP+ NT+R ++FI GG Y E+V +D  
Sbjct  17    DAQLLSAEEIVRIITVRKDGTGQFRTVTDAVNSIPSGNTRRVVVFIGGGVYTEKVLVDAS  76

Query  404   RPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-D  580
             +PFVT YGD  + P++    TA + GT  S+T+ V SDYF AVNI   NSAP P G R  
Sbjct  77    KPFVTFYGDQNDVPSITFDGTALKYGTWNSSTVAVESDYFVAVNIAFVNSAPMPDGIRPG  136

Query  581   QQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQ  760
              QAVA+ I+GDKA+F+NC+F GFQDTL D   RHF+KDC+V+GTVDF+FGN KS++LN  
Sbjct  137   AQAVAMRISGDKAAFHNCRFIGFQDTLLDDRGRHFFKDCHVQGTVDFIFGNGKSLYLNNT  196

Query  761   LRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIG  940
             +  +  + M +++AH R + ++D+GF+FVHC +TG      LGR W    + +FAY Y+G
Sbjct  197   IHSV-ANGMGVITAHARENVEDDSGFAFVHCNITGTGDT-FLGRAWRERPRVVFAYAYMG  254

Query  941   NAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             + I  +GW       ++  T Y+GEY   GPG+   GR K+
Sbjct  255   SLINKQGWSDYMHTERD-KTVYYGEYKCMGPGSSSSGRVKY  294



>ref|XP_002516214.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46216.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=378

 Score =   255 bits (652),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 134/339 (40%), Positives = 202/339 (60%), Gaps = 20/339 (6%)
 Frame = +2

Query  101   CVLVFCPG-GVIPL---DTVPIPAEKSQVESWFRASVQPLQSGRKGV---------DPAL  241
             C++ F  G  ++P     +  +P + S++++W   ++    + +  +         +  L
Sbjct  12    CLIAFILGLQLLPAANSHSKQVPKDISKLKTWVADNINQFNNRKSDLSERIPRIILNKRL  71

Query  242   VKAEAAPVYLKVGKG----GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRP  409
               AE++   + V K       F++I +A+ +IP  N +R II+I GG+Y E++ I+  +P
Sbjct  72    ADAESSVRVITVAKRDDQFADFQSISDAIDSIPINNKQRRIIWIKGGEYFEKITINTSKP  131

Query  410   FVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRP-TGKRDQQ  586
             F+TLYGDP + P +V   TAA+ GT+YSAT+ V S YF AVNI   NSAP P   K   Q
Sbjct  132   FITLYGDPGDMPKIVFNGTAARYGTVYSATVAVESKYFMAVNIAFVNSAPMPDVNKTGAQ  191

Query  587   AVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLR  766
             AVA+ I+GDKA+F+NCKF GFQDTLCD   RH ++DCY+ GTVDF+FGN KS++LNT + 
Sbjct  192   AVAMRISGDKAAFHNCKFVGFQDTLCDDRGRHVFRDCYIVGTVDFIFGNGKSLYLNTTIE  251

Query  767   VIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNA  946
              +      +++A  R S  + + F+F+HC +TG      LGR W    + +FAY Y+G+ 
Sbjct  252   TV-AQGTGVITAQARESVTDSSEFTFIHCNLTGIGNNTYLGRAWKERPRVVFAYAYMGSL  310

Query  947   IKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             I   GW   + +P++  T Y+GEY   GPGA   GR K+
Sbjct  311   INAAGWSTGK-HPESNETVYYGEYKCKGPGAFSSGRVKY  348



>gb|KHG22980.1| Pectinesterase PPME1 -like protein [Gossypium arboreum]
Length=363

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/332 (39%), Positives = 197/332 (59%), Gaps = 22/332 (7%)
 Frame = +2

Query  89    VVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVY  268
             V+ + +L+F P  V    + PIP +KSQVE+WF   ++P++   K +DP LV+A   P  
Sbjct  15    VICISILLFAPIVV----SQPIPVDKSQVETWFNDIIKPVKERGKTLDPELVEAGTEPRI  70

Query  269   LKV--GKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
             ++V  G GG+F TI + ++++P+ N K  II I  G Y E+++I+ ++PF+TL GDPKN 
Sbjct  71    IRVMQGGGGEFNTITKTIESVPSGNGKHVIISIGPGSYKEKIRIERNKPFITLVGDPKNM  130

Query  443   PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKA  619
             P L    T  Q GT+  A   + S YF   N+++ N+ PRP GK    QAVAL ++GD++
Sbjct  131   PNLTFDGTVKQYGTVDGAAFIIESSYFVGANLNIVNTPPRPDGKMVGAQAVALRVSGDRS  190

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRV---IPGD-QM  787
             +FYNCK  GFQD L D    HF+KDC++ GTVDF+F +   ++LN+++ V   + GD +M
Sbjct  191   AFYNCKIIGFQDILFDDRGNHFFKDCHIRGTVDFIFRSGTFLYLNSEIFVEGDLEGDPEM  250

Query  788   AMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWM  967
             A+++   R S  EDTG+SF H ++T  +    LGR W    + +++YT +   + P    
Sbjct  251   AVITIQARKSSSEDTGYSFAHGRITETANDVFLGRAWKSSLRVVYSYTEMDEIVHP----  306

Query  968   GMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
                     G T Y+GEY  TG  +    R KF
Sbjct  307   -------GGCTVYYGEYKCTGKASTPATREKF  331



>ref|XP_007154546.1| hypothetical protein PHAVU_003G127700g [Phaseolus vulgaris]
 gb|ESW26540.1| hypothetical protein PHAVU_003G127700g [Phaseolus vulgaris]
Length=343

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 174/267 (65%), Gaps = 9/267 (3%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-----DPKNRPTL  451
             G F+T+ EAV +IP+ N +R +++I  G+Y E+V +D  +PFVT YG     D    P +
Sbjct  48    GDFRTVTEAVNSIPSGNKRRVVVWIGMGEYREKVTVDRSKPFVTFYGERNESDSHTMPII  107

Query  452   VAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFY  628
                 TA + GT+ SAT+ V SDYF AVN+   NS+PRP       QA+A+ I+GDKA+FY
Sbjct  108   TYHATALKYGTVDSATVAVDSDYFVAVNVAFVNSSPRPDENSVGAQALAMRISGDKAAFY  167

Query  629   NCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHG  808
             NCKF  FQDTLCD   RHF+KDCY++G+ DF+FGN KSI+L +++  +    +++++A G
Sbjct  168   NCKFVSFQDTLCDDKGRHFFKDCYIQGSYDFIFGNGKSIYLRSRIESV-AKGLSVITAQG  226

Query  809   RNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWM-GMRTN  982
             R S  EDTGF+F+HC +TG+ ++   LGR W    + +FAYTY+ + I+  GW     + 
Sbjct  227   RESIGEDTGFTFLHCNITGSGNRNTYLGRAWRKSPRVVFAYTYMASLIRARGWFTNQLSQ  286

Query  983   PKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             PK+  T Y+GEY  TG GA   GR KF
Sbjct  287   PKSNNTIYYGEYKCTGAGAVSSGRVKF  313



>ref|XP_009402033.1| PREDICTED: putative pectinesterase 63 [Musa acuminata subsp. 
malaccensis]
Length=394

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 179/282 (63%), Gaps = 6/282 (2%)
 Frame = +2

Query  227   VDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
             ++P L + E +   + V K   G F+TI +A+K+IP+ NT R +I I  G Y E++ +D 
Sbjct  86    LEPLLAETERSGRVVTVRKDGNGDFRTITDAIKSIPSGNTARTVIKIGPGVYREKILVDQ  145

Query  401   DRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKR  577
              RP+VT YG P   PT+    TAA+ GT  SAT+ V S YF A N+   N+AP P  G +
Sbjct  146   SRPYVTFYGQPGAMPTISFDGTAARYGTANSATVAVESSYFVASNVIFENTAPMPVDGVQ  205

Query  578   DQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNT  757
               QAVA+ I+GD A+FYNCKFYG+QDTLCD   RHF+K+C++ GTVDF+FGN +SI+ N 
Sbjct  206   GAQAVAMRISGDMAAFYNCKFYGYQDTLCDDTGRHFFKNCFIRGTVDFIFGNGRSIYQNC  265

Query  758   QLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYI  937
             ++  +  D +A ++A  R++  + +GFSF+HC +TG    A L R W   S+ +F+YT++
Sbjct  266   EIESV-ADNVAYITAQARSNISDKSGFSFIHCNITGTGN-AFLSRAWREMSRVVFSYTHM  323

Query  938   GNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
             G  I P GW       +N  T YFGEY   GPGA  DGR K+
Sbjct  324   GRLIDPRGWDNKGVAGRN-RTVYFGEYKCLGPGAVTDGRVKY  364



>ref|XP_009348902.1| PREDICTED: putative pectinesterase 63 isoform X2 [Pyrus x bretschneideri]
Length=335

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/279 (44%), Positives = 183/279 (66%), Gaps = 10/279 (4%)
 Frame = +2

Query  152  IPAEKSQVESWFRASVQ---PLQSGRKGV--DPALVKAEAAPVYLKVGKGG--QFKTIQE  310
            IP   SQ++SW   +++    L++ +  +  D  ++ AE     + V K G  QF+T+ +
Sbjct  28   IPPNFSQLDSWIAHNMRGYTNLKATQATLRFDAQILSAEEIVRIITVRKDGTGQFRTVTD  87

Query  311  AVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIY  490
            AV +IP+ NT+R ++FI GG Y E++ +D  +PFVT YGD  + P++    TA + GT  
Sbjct  88   AVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  147

Query  491  SATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCD  667
            S+T+ V SDYF AVNI   NSAP P G R   QAVA+ I+GDKA+F+NC+F GFQDTL D
Sbjct  148  SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  207

Query  668  HNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFV  847
               RHF+KDC+++GTVDF+FGN KS++LN  +  +  + M +++AH R + ++D+GF+FV
Sbjct  208  DRGRHFFKDCHIQGTVDFIFGNGKSLYLNNMIHSV-ANGMGVITAHARENVEDDSGFAFV  266

Query  848  HCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW  964
            HC +TG      LGR W    + +FAYTY+G+ I  +GW
Sbjct  267  HCNITGTGD-TFLGRAWRERPRVVFAYTYMGSLIDKQGW  304



>ref|XP_010243601.1| PREDICTED: pectinesterase PPME1-like, partial [Nelumbo nucifera]
Length=341

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/265 (48%), Positives = 180/265 (68%), Gaps = 13/265 (5%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G FKT+ +A+ +IPA N  R ++ I  G+Y E++K+D ++PFVT YG P + PTL    T
Sbjct  54    GDFKTMTDAINSIPAGNKDRIVLSIGPGEYVEKIKVDGNKPFVTFYGAPGSMPTLSFHGT  113

Query  467   AAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQ---AVALTITGDKASFYNCK  637
             + + GT+ SA++ VLSDYF A NI  +N+AP P+G+   Q   AVA+ I+GD A+FYNCK
Sbjct  114   SGEYGTVDSASVIVLSDYFVAANIIFKNTAPPPSGQGSGQGGQAVAMRISGDMAAFYNCK  173

Query  638   FYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNS  817
             F GFQDTL D   RH++KDCY+EGTVDF+FG+ KS+++NT+L  +  D +A+++A  R S
Sbjct  174   FIGFQDTLLDDKGRHYFKDCYIEGTVDFIFGSGKSLYMNTELHSVAKD-LAVITAQARKS  232

Query  818   EKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGW---MGMRTNPK  988
             + ED G+SFVHC VTG   +  LGR WFP+ K IFA T + + + P GW   +G+ T+  
Sbjct  233   DSEDDGYSFVHCTVTGTGDI-YLGRPWFPFGKVIFANTELCDKVNPVGWHVGVGVATD--  289

Query  989   NGGTCYFGEYNNTGPGAKMDGRPKF  1063
                  +F EY NTGPG+  D RP +
Sbjct  290   ---NVFFVEYQNTGPGSNTDKRPTW  311



>ref|NP_001234964.1| uncharacterized protein LOC100306177 precursor [Glycine max]
 gb|ACU14235.1| unknown [Glycine max]
Length=248

 Score =   241 bits (616),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 156/218 (72%), Gaps = 3/218 (1%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKT  301
            V+  DTVPIPA K+Q+  W+  +V PL   +  VDPALV AE     +KV +   G++KT
Sbjct  24   VLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAKVVKVMQDGSGEYKT  83

Query  302  IQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG  481
            I +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    TA Q G
Sbjct  84   ITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGTAQQYG  143

Query  482  TIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDT  658
            T+ SATL V SDYF A NI + N+APRP  K    QAVAL I+GDKA+FYNCK YGFQDT
Sbjct  144  TVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMYGFQDT  203

Query  659  LCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVI  772
            +CD  NRHF+KDC ++ T+D++FG+ KS++++T+LR +
Sbjct  204  ICDDRNRHFFKDCLIQSTMDYIFGSGKSLYVSTELRTL  241



>ref|XP_006843862.1| hypothetical protein AMTR_s00007p00264370 [Amborella trichopoda]
 gb|ERN05537.1| hypothetical protein AMTR_s00007p00264370 [Amborella trichopoda]
Length=365

 Score =   244 bits (623),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 178/278 (64%), Gaps = 5/278 (2%)
 Frame = +2

Query  227   VDPALVKAEAAPVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
             ++ AL  AE     L V K G   + T+Q AV +IP  NT+RYI+ I  G Y E+V +  
Sbjct  54    MEDALAVAENGTKVLVVCKDGSCDYGTLQAAVDSIPVGNTQRYILKIKPGLYKEKVNVPR  113

Query  401   DRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD  580
              +PFVT  GDP N PT+     +A+ GT  SAT+ V +DYF A+N+   NS+PRP    +
Sbjct  114   TKPFVTFLGDPINMPTISYNGNSAKYGTWNSATVIVEADYFIAMNVIFENSSPRPKDGEE  173

Query  581   QQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQ  760
              QAVAL I+GDKA+FY C+F GFQDTLCD   RH +K+C+++GTVDF+FG A+S++ N +
Sbjct  174   GQAVALRISGDKAAFYRCRFIGFQDTLCDDVGRHLFKNCFIQGTVDFIFGAARSLYSNCE  233

Query  761   LRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIG  940
             +  +   + A ++A  R+SE ++ GFSFV+C++TG  + A L R W  YS+ IFA TY+G
Sbjct  234   INSVATGRTA-ITAQARSSESDEGGFSFVNCKITGTGQ-ATLSRAWRKYSRVIFARTYMG  291

Query  941   NAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             N I   GW       ++  T ++GEY   GPGA MDGR
Sbjct  292   NLIDKLGWDNHGYTDRD-QTVFYGEYQCFGPGATMDGR  328



>ref|XP_007038215.1| Pectin lyase-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY22716.1| Pectin lyase-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
Length=293

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 164/244 (67%), Gaps = 4/244 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +   I  +LV  P  V+  ++ PIP +KSQ+++WF A+++P  +    +DPAL KAE A 
Sbjct  11   VGAAICTILVLAPV-VLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAA  69

Query  263  VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV K   G F TI +A+ ++P+ NTKR II I GG Y E+++ID  +PF+T YGDP+
Sbjct  70   HIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPR  129

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
            N P L    TA Q GT+ SATL V SDYF A NI ++N+APRP G     QAV+L I+GD
Sbjct  130  NMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGD  189

Query  614  KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
            KA+FYNCK  GFQDTLCD    HF+KDCY+ GTVDF+FG+ KS++LNT L V     + +
Sbjct  190  KAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLNTVLYVDGQKGVTV  249

Query  794  VSAH  805
            ++A 
Sbjct  250  ITAQ  253



>ref|XP_003541318.1| PREDICTED: putative pectinesterase 63-like [Glycine max]
Length=347

 Score =   242 bits (617),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 173/273 (63%), Gaps = 15/273 (5%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-------DPKNR-  442
             G F+T+ +AV +IP+ N +R +++I  G Y E++ +D  +PFVT YG       D  +R 
Sbjct  46    GDFRTVTDAVNSIPSGNKRRVVVWIGRGVYREKITVDRSKPFVTFYGERNGNDNDNDSRD  105

Query  443   --PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
               P +    TA + GT+ SAT+ V +DYF AVN+   NS+PRP       QA+A+ I+GD
Sbjct  106   IMPIITYDATALRYGTVDSATVAVDADYFVAVNVAFVNSSPRPEENSVGAQALAMRISGD  165

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+F+NCKF GFQDTLCD   RHF+KDCY++GT DF+FGN KSI+L + +  +  + +++
Sbjct  166   KAAFFNCKFIGFQDTLCDDKGRHFFKDCYIQGTYDFIFGNGKSIYLRSTIESV-ANGLSV  224

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSK-VAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             ++A GR S  EDTGF+F+HC +TG+      LGR W    + +FAYTY+G+ I  +GW  
Sbjct  225   ITAQGRESMAEDTGFTFLHCNITGSGNGNTYLGRAWKKSPRVVFAYTYMGSLINTQGWFN  284

Query  971   MRT--NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              +      N  T Y+GEY   GPGA   GR KF
Sbjct  285   NQVAHAKSNNQTIYYGEYRCMGPGAVSSGRVKF  317



>ref|XP_007038216.1| Pectin lyase-like superfamily protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY22717.1| Pectin lyase-like superfamily protein, putative isoform 4 [Theobroma 
cacao]
Length=283

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 162/249 (65%), Gaps = 4/249 (2%)
 Frame = +2

Query  83   LNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAP  262
            +   I  +LV  P  V+  ++ PIP +KSQ+++WF A+++P  +    +DPAL KAE A 
Sbjct  11   VGAAICTILVLAPV-VLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAA  69

Query  263  VYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPK  436
              +KV K   G F TI +A+ ++P+ NTKR II I GG Y E+++ID  +PF+T YGDP+
Sbjct  70   HIIKVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPR  129

Query  437  NRPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
            N P L    TA Q GT+ SATL V SDYF A NI ++N+APRP G     QAV+L I+GD
Sbjct  130  NMPNLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGD  189

Query  614  KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
            KA+FYNCK  GFQDTLCD    HF+KDCY+ GTVDF+FG+ KS++L   +       +  
Sbjct  190  KAAFYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLGVTVITAQNCFLRR  249

Query  794  VSAHGRNSE  820
            +   G+ S+
Sbjct  250  IQVQGKRSK  258



>gb|KEH25488.1| pectinesterase [Medicago truncatula]
Length=338

 Score =   237 bits (604),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/287 (42%), Positives = 180/287 (63%), Gaps = 13/287 (5%)
 Frame = +2

Query  224   GVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKID  397
             G+D  L +AEA PV +KV K    +FKTIQEA+ +IP +N +R I+ IA G Y E++ + 
Sbjct  26    GLDFKLRQAEANPVIIKVSKDASSKFKTIQEALNSIPPQNNRRVIVSIAAGVYREKILVK  85

Query  398   FDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAVNIDVRNSA  556
                PF+T  GDP ++P ++   TA  +G       T+ SAT+ V SDYF AVN+  +N+A
Sbjct  86    L--PFITFLGDPTDQPIVIGNDTAHDIGGDGKPLRTLNSATVAVDSDYFIAVNMKFQNTA  143

Query  557   PRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNA  736
                 G  D QAVAL  +G+K++FYNC FYGFQDTL DH   H++++C+++G+VDF+FG+ 
Sbjct  144   SPRIGSNDDQAVALRTSGNKSAFYNCSFYGFQDTLYDHQGLHYFENCFIQGSVDFIFGHG  203

Query  737   KSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKT  916
             +S++    ++ I  ++M  ++A  R+ E  ++GFS  +    G+ KV  LGR W  YS+ 
Sbjct  204   RSLYEGCIIKSI-AEKMGFITAQDRSKESMESGFSIQNSHAIGSGKV-YLGRPWGVYSRV  261

Query  917   IFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRP  1057
             I++YT + N I P+GW     N     T Y+GEY  TG G+ + GRP
Sbjct  262   IYSYTSMDNLIFPQGWDDTMDNQNRSLTVYYGEYKCTGLGSNLAGRP  308



>ref|XP_007145123.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
 gb|ESW17117.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
Length=370

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/292 (44%), Positives = 178/292 (61%), Gaps = 12/292 (4%)
 Frame = +2

Query  206   LQSGRKGVDPALVKAEAAPVYLKVGKGGQ--FKTIQEAVKTIPARNTKRYIIFIAGGKYN  379
             L+S  K  D  L +AE+  V + V + G   FKTI EA+ +IP RNT R I+ I+ G Y 
Sbjct  52    LKSKWKVADLKLRQAESNKVIITVSQDGSADFKTISEALNSIPPRNTMRVIVSISPGVYR  111

Query  380   ERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQ-------VGTIYSATLYVLSDYFSAVNI  538
             E+V I    PF+TL G+  N PT+    TA+        +GT +SAT+ V + YF A+NI
Sbjct  112   EKVMIPRTMPFITLSGEAGNPPTITGNDTASASKRNGTPLGTFHSATVAVDASYFVAINI  171

Query  539   DVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVD  718
                NSAP   G+R +Q VAL I+G KA+FYNC F G QDTL DH   HF+ +C ++G+VD
Sbjct  172   KFENSAPHEIGRRGEQGVALRISGTKAAFYNCSFNGAQDTLYDHKGLHFFHNCSIQGSVD  231

Query  719   FVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGW  898
             F+FG A+S++ N  L      ++A ++A  R +   D+GFSF +C VTG+ KV  LGR W
Sbjct  232   FIFGYARSLYQNCYLNSTT-KKVASITAQKRTNSSLDSGFSFQNCTVTGSGKV-YLGRAW  289

Query  899   FPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               YS+ +F+YTY+ N + P+GW     + K     Y+GEY  +GPGA M GR
Sbjct  290   GDYSRVVFSYTYMDNLVLPKGWSDW-GDQKRDSRVYYGEYMCSGPGANMAGR  340



>gb|KHN07870.1| Putative pectinesterase 63 [Glycine soja]
Length=337

 Score =   233 bits (595),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 171/273 (63%), Gaps = 16/273 (6%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYG-------DPKNR-  442
             G F T+  AV +IP+ N +R +++I  G Y E++ +D  +PFVT YG       D  +R 
Sbjct  37    GDFTTVT-AVNSIPSGNKRRVVVWIGRGVYREKITVDRSKPFVTFYGERNGNDNDNDSRD  95

Query  443   --PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGD  613
               P +    TA + GT+ SAT+ V +DYF AVN+   NS+PRP       QA+A+ I+GD
Sbjct  96    IMPIITYDATALRYGTVDSATVAVDADYFVAVNVAFVNSSPRPEENSVGAQALAMRISGD  155

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
             KA+F+NCKF GFQDTLCD   RHF+KDCY++GT DF+FGN KSI+L + +  +  + +++
Sbjct  156   KAAFFNCKFIGFQDTLCDDKGRHFFKDCYIQGTYDFIFGNGKSIYLRSTIESV-ANGLSV  214

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSK-VAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMG  970
             ++A GR S  EDTGF+F+HC +TG+      LGR W    + +FAYTY+G+ I  +GW  
Sbjct  215   ITAQGRESMAEDTGFTFLHCNITGSGNGNTYLGRAWKKSPRVVFAYTYMGSLINTQGWFN  274

Query  971   MRT--NPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              +      N  T Y+GEY   GPGA   GR KF
Sbjct  275   NQVAHAKSNNQTIYYGEYRCMGPGAVSSGRVKF  307



>gb|KHG12918.1| putative pectinesterase 53 -like protein [Gossypium arboreum]
Length=377

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 189/340 (56%), Gaps = 22/340 (6%)
 Frame = +2

Query  92    VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVK--------  247
             +IV VLV C            P  +++ E W   + +  +S R   D +LV         
Sbjct  11    LIVLVLVICNYSSTT-SASSNPGSETEFEKWLGWNARNHRSKRLAADRSLVMSVLDDNLV  69

Query  248   -AEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVT  418
              AE   V + V +   G FKTI EA+ +IP RNT+R I+ I  G Y E++ I    PF+T
Sbjct  70    IAEKNNVMINVSRDGSGDFKTINEALNSIPLRNTRRVILVIKPGIYREKITIPRTMPFIT  129

Query  419   LYGDPKNRPTLVAATTAAQ-------VGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR  577
               GD  N PT+    TA+        + T  SAT+ V ++YF A+NI   N+ P   G +
Sbjct  130   FQGDANNPPTITGNDTASSSSKDGRPLKTFQSATVAVDANYFVAINIKFENTVPHTIGSK  189

Query  578   DQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNT  757
               QAVA+ I+G KA+FYNC FYG QDTL DH   H++ +C+++G+VDF+FG  +S++ N 
Sbjct  190   GGQAVAVRISGTKAAFYNCSFYGDQDTLYDHKGLHYFNNCFIQGSVDFIFGYGRSLYENC  249

Query  758   QLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTIFAYTY  934
              L  I   ++A ++A  R+S    +GFSF    VTGN + +  LGR W  YS+ +F+YT+
Sbjct  250   YLNSI-AKKVASLTAQKRSSASMASGFSFKDSVVTGNGTGLVYLGRAWGEYSRVVFSYTF  308

Query  935   IGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             +   ++P+GW     NPK     Y+GEY  +GPGA + GR
Sbjct  309   MDKVVRPQGWSDW-GNPKRDDRAYYGEYKCSGPGANLTGR  347



>ref|XP_008338574.1| PREDICTED: pectinesterase PPME1-like [Malus domestica]
Length=233

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/225 (49%), Positives = 153/225 (68%), Gaps = 3/225 (1%)
 Frame = +2

Query  86   NVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPV  265
            +++I+ +L+      I  DT+PIP++ SQV SWF  +V+     +  +DPALV AE AP 
Sbjct  6    SLMIITILLTSSTAAIADDTIPIPSDSSQVASWFDNNVKTYNERKSTLDPALVAAEHAPQ  65

Query  266  YLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKN  439
             +KV +  GG FKTI +A+ +IPA NTKR  ++I GG YNE++ I  ++PFVT YG PK+
Sbjct  66   VIKVMQDGGGNFKTITDAINSIPAGNTKRMFVYIKGGVYNEKITIPHNKPFVTFYGSPKS  125

Query  440  RPTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPTGKRD-QQAVALTITGDK  616
             P +    TA + GT+YS TL V SDYF AVN+ + NSAP P G R+  QAVA+ I+G+K
Sbjct  126  MPNITFDGTAQKYGTVYSGTLIVESDYFRAVNLVIINSAPEPDGIREGAQAVAVQISGNK  185

Query  617  ASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFL  751
            A+FYNCK  G+QDTL D+   H  KDC+++GTVDF+F   K ++L
Sbjct  186  AAFYNCKMIGYQDTLYDYKGLHLXKDCFIQGTVDFIFRKGKXLYL  230



>ref|XP_003609956.1| Pectinesterase [Medicago truncatula]
 gb|AES92153.1| pectinesterase [Medicago truncatula]
Length=345

 Score =   228 bits (582),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 119/280 (43%), Positives = 173/280 (62%), Gaps = 18/280 (6%)
 Frame = +2

Query  227   VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
             ++  L  AE     ++V K G   F T+ +AVK+IP+ N +R +++I  G+Y E++ +D 
Sbjct  40    LEEHLTAAETTVRVVRVRKDGTGDFTTVTDAVKSIPSGNKRRVVVWIGMGEYREKITVDR  99

Query  401   DRPFVTLYGDPKNR-----PTLVAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRP  565
              + FVT YG+   +     P +    TA + GT+ SAT+ V +DYF AVN+   NS+P P
Sbjct  100   SKRFVTFYGERNGKDNDMMPIITYDATALRYGTLDSATVAVDADYFVAVNVAFVNSSPMP  159

Query  566   TGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKS  742
                    QA+A+ I+GDKA+FYNCKF GFQDTLCD   +HF+KDC+++GT DF+FGN KS
Sbjct  160   DENSVGGQALAMRISGDKAAFYNCKFIGFQDTLCDDYGKHFFKDCFIQGTYDFIFGNGKS  219

Query  743   IFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGN-SKVAVLGRGWFPYSKTI  919
             I+LN   R      + +++A GR    +DTGF+FVHC +TG+  +   LGRGW    + +
Sbjct  220   IYLNRLQR-----GLNVITAQGRERMSDDTGFTFVHCNITGSGHRNTYLGRGWRRSPRVV  274

Query  920   FAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGA  1039
             FAYTY+ + +   GW    +N     T +FGEY  +GPGA
Sbjct  275   FAYTYMDSVVNSRGWYHHGSNE----TIFFGEYKCSGPGA  310



>ref|XP_001769271.1| predicted protein [Physcomitrella patens]
 gb|EDQ65983.1| predicted protein [Physcomitrella patens]
Length=370

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/337 (40%), Positives = 184/337 (55%), Gaps = 20/337 (6%)
 Frame = +2

Query  80    LLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAA  259
             L+ V +VC      G      +  +P  + +V + F + VQ +       + A   A  A
Sbjct  11    LVTVALVCSAEPAQG------SQKVPETREEVIASFASWVQRVGEKHAAWERAAKTATTA  64

Query  260   PVYL-KVGK---------GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRP  409
               +  KVG+          G FKT+ EA+ +IP  +     I +  G YNERV I   + 
Sbjct  65    DEFASKVGETVIVVDQSGAGNFKTVNEALNSIPEHSKSPVTIKVNAGTYNERVVIPKSKE  124

Query  410   FVTLYGDPKNRPTLVAATTAAQVGTIY-SATLYVLSDYFSAVNIDVRNSAPRPTGKRDQQ  586
             F+TL G  ++   + A+  A   GT Y SAT  V + +F+A NI   NS+P P G   QQ
Sbjct  125   FITLQGAGRDVTKITASNAAGNSGTTYTSATFGVSAPHFTARNISFENSSPPPDGGAQQQ  184

Query  587   AVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLR  766
             AVAL  TGD  +FY C FYG QDTL DH  RHF+KD  + GTVDF+FG+ KS++ N +LR
Sbjct  185   AVALRTTGDMNAFYGCAFYGHQDTLYDHRGRHFFKDTLIVGTVDFIFGDGKSLYKNCELR  244

Query  767   VIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAV-LGRGWFPYSKTIFAYTYIGN  943
             V+P    ++ +A  R S  EDTG+SFV+C+VTG+    V LGR W PYS+ IFA+T   N
Sbjct  245   VLPSSGGSL-TAQKRLSGSEDTGYSFVNCKVTGSGPPQVYLGRAWGPYSRVIFAFTEFAN  303

Query  944   AIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
              IKPEGW     +P    T ++G Y   GPGA    R
Sbjct  304   IIKPEGWYNW-GDPSREKTVFYGMYKCFGPGASSPSR  339



>ref|XP_009414379.1| PREDICTED: probable pectinesterase 53 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=388

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 183/310 (59%), Gaps = 15/310 (5%)
 Frame = +2

Query  164   KSQVESWFRASV---QPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIP  328
             K Q  + FR S    +P   G + +D  L KAEAA V   V + G   +++I+EA+ TIP
Sbjct  48    KQQSAATFRPSFVFGEPGVVGPRAIDLKLSKAEAAAVRYIVSQDGTGNYRSIREAIGTIP  107

Query  329   ARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TI  487
               NT+R I+ I  G Y E++ I    PF+TL GDP + P +    TAA++G       T 
Sbjct  108   LHNTRRVILEIRPGIYREKIVIPKSMPFITLLGDPASPPIISGNDTAAKMGDNGRALKTF  167

Query  488   YSATLYVLSDYFSAVNIDVRNSAPRP-TGKRDQQAVALTITGDKASFYNCKFYGFQDTLC  664
              S T+ V S++F A  I   N+AP P  G+R  QAVA+ ++GDKA+FYNC FYG QDTL 
Sbjct  168   RSPTVAVNSNFFLAAYIQFENTAPVPDVGQRGGQAVAVRVSGDKAAFYNCSFYGEQDTLY  227

Query  665   DHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSF  844
             DH   H++K+C+++G+VDF+FG  +S++ N  L  +   ++A ++A  RN    ++GFSF
Sbjct  228   DHKGLHYFKNCFIQGSVDFIFGYGRSLYENCYLNSV-AKKVAALTAQKRNMASMESGFSF  286

Query  845   VHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNN  1024
             V   +TG S +  LGR W  +S+ +F+YT++   + P+GW   R +       Y+GE+  
Sbjct  287   VRSTITG-SGLVYLGRAWGDHSRVVFSYTFMDKVVIPQGWNSWRIHRPEASGVYYGEFQC  345

Query  1025  TGPGAKMDGR  1054
              GPGA   GR
Sbjct  346   GGPGANWTGR  355



>ref|XP_009414378.1| PREDICTED: probable pectinesterase 53 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=389

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 185/311 (59%), Gaps = 16/311 (5%)
 Frame = +2

Query  164   KSQVESWFRASV---QPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIP  328
             K Q  + FR S    +P   G + +D  L KAEAA V   V + G   +++I+EA+ TIP
Sbjct  48    KQQSAATFRPSFVFGEPGVVGPRAIDLKLSKAEAAAVRYIVSQDGTGNYRSIREAIGTIP  107

Query  329   ARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TI  487
               NT+R I+ I  G Y E++ I    PF+TL GDP + P +    TAA++G       T 
Sbjct  108   LHNTRRVILEIRPGIYREKIVIPKSMPFITLLGDPASPPIISGNDTAAKMGDNGRALKTF  167

Query  488   YSATLYVLSDYFSAVNIDVRNSAPRP-TGKRDQQAVALTITGDKASFYNCKFYGFQDTLC  664
              S T+ V S++F A  I   N+AP P  G+R  QAVA+ ++GDKA+FYNC FYG QDTL 
Sbjct  168   RSPTVAVNSNFFLAAYIQFENTAPVPDVGQRGGQAVAVRVSGDKAAFYNCSFYGEQDTLY  227

Query  665   DHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSF  844
             DH   H++K+C+++G+VDF+FG  +S++ N  L  +   ++A ++A  RN    ++GFSF
Sbjct  228   DHKGLHYFKNCFIQGSVDFIFGYGRSLYENCYLNSV-AKKVAALTAQKRNMASMESGFSF  286

Query  845   VHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN-PKNGGTCYFGEYN  1021
             V   +TG S +  LGR W  +S+ +F+YT++   + P+GW   R + P+     Y+GE+ 
Sbjct  287   VRSTITG-SGLVYLGRAWGDHSRVVFSYTFMDKVVIPQGWNSWRIHRPEARSGVYYGEFQ  345

Query  1022  NTGPGAKMDGR  1054
               GPGA   GR
Sbjct  346   CGGPGANWTGR  356



>ref|XP_007219703.1| hypothetical protein PRUPE_ppa024066mg, partial [Prunus persica]
 gb|EMJ20902.1| hypothetical protein PRUPE_ppa024066mg, partial [Prunus persica]
Length=330

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 177/309 (57%), Gaps = 42/309 (14%)
 Frame = +2

Query  152   IPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTI  325
             +PA+ SQV +WF  +V+P  +    +D  L  AEA+   +KV K G  QFKTI +AV + 
Sbjct  27    LPADHSQVNTWFNNNVKPYTARNGTLDSTLAMAEASQKVIKVNKDGRGQFKTIADAVNSN  86

Query  326   PARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYSATLY  505
             P  NTKR I++I GG YNE++ I  ++PFVT YG P    TL  A TA + GT+ S T+ 
Sbjct  87    PVGNTKRVIVYI-GGVYNEKITIPQNKPFVTFYGSPTTMSTLTFAGTAQKYGTVDSTTVI  145

Query  506   VLSDYF-SAVNIDVR-NSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDTLCDHNN  676
               SDYF +A+ + +R NS+PRP GKR  +QA+AL ++ +K++ +NC+  GFQDTLCD   
Sbjct  146   AESDYFVAAITLLLRYNSSPRPDGKRVGEQALALRVSSNKSALFNCRLIGFQDTLCDDRG  205

Query  677   RHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQ  856
              HF+KDC++EGT                L V+  ++M +++A  R+S  EDTG SFVHC 
Sbjct  206   NHFFKDCFIEGT----------------LHVLGNNEMTVITAQARDSTSEDTGDSFVHCN  249

Query  857   VTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPG  1036
             +T       LG+ W    + +FAYT I                    T ++GEY  + PG
Sbjct  250   ITEIGNGTYLGKVWRTSPRVVFAYTSI--------------------TVFYGEYKCSSPG  289

Query  1037  AKMDGRPKF  1063
             + M  R K+
Sbjct  290   SSMVERVKY  298



>ref|XP_003530551.1| PREDICTED: probable pectinesterase 53-like isoform X1 [Glycine 
max]
 ref|XP_006584808.1| PREDICTED: probable pectinesterase 53-like isoform X2 [Glycine 
max]
 gb|KHN16649.1| Putative pectinesterase 53 [Glycine soja]
Length=375

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 174/315 (55%), Gaps = 7/315 (2%)
 Frame = +2

Query  119   PGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFK  298
             PG  +  +   +   + Q   W +       S  +     L  +    V  K GKGG F 
Sbjct  34    PGNGLSTNMTRVEFSEQQFMKWVKFVGGLKHSVFRTAKNKLFPSHTLHVSKKHGKGG-FS  92

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQ-  475
             +IQ A+ ++P  N  R +I +  G Y E+V I   + FVT+ G+  ++  +    TA   
Sbjct  93    SIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSFVTIQGEGADKTIVQWGDTAQSQ  152

Query  476   -VGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKASFYNCKFYGF  649
              +GT  SAT  V S YF A NI  +N+AP P  G   +Q VAL I+ D A F  CKF G 
Sbjct  153   PLGTYGSATFAVNSPYFIAKNITFKNTAPIPAPGAVGKQGVALRISADTAVFLGCKFLGA  212

Query  650   QDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKED  829
             QDTL DH  RH+YKDCY+EG+VDF+FGNA S+F    +  I       ++A GRNS  ED
Sbjct  213   QDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAI-AQLTGALTAQGRNSLLED  271

Query  830   TGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYF  1009
             TGFSFVHC+VTG S    LGR W P+S+ +FAYTY+ N I P+GW     +P    T ++
Sbjct  272   TGFSFVHCKVTG-SGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWYNW-GDPNREMTVFY  329

Query  1010  GEYNNTGPGAKMDGR  1054
             G+Y  TGPGA   GR
Sbjct  330   GQYKCTGPGASYAGR  344



>ref|XP_001769817.1| predicted protein [Physcomitrella patens]
 gb|EDQ65379.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   221 bits (563),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 166/275 (60%), Gaps = 11/275 (4%)
 Frame = +2

Query  257   APVYLKVGKG-GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDP  433
             A +Y+   +G G F T+Q A+  +P  N +R  I +A G Y E++ +   +P+VT+ G  
Sbjct  51    AVIYVNRKRGVGHFTTVQAAIDHVPVNNDRRVHIIVAPGVYKEKIVVPSSKPYVTILGGG  110

Query  434   KNRPTLVAATTA-------AQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQA  589
              N   L    TA       A++GT +SA+L V + YF A NI ++N+A  P  G   +QA
Sbjct  111   WNNTILQWNDTADCADKEGAKLGTYWSASLAVEAQYFIARNITIKNTASMPAAGAAGKQA  170

Query  590   VALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRV  769
             VAL +TGD A+FY C+F   QDTL DH  RH++KDCY+EG++DFVFGN +S++ +  L  
Sbjct  171   VALRVTGDTAAFYGCRFMSTQDTLYDHVGRHYFKDCYIEGSIDFVFGNGRSLYESCHLHA  230

Query  770   IPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAI  949
             +P      V+A  R +  E TGFSF++C++TG S +  LGR W  Y++ +++YTY+ N I
Sbjct  231   LPRTTFGSVAAQKRGNVSEQTGFSFLNCKITG-SGLLYLGRAWGSYARVVYSYTYMDNII  289

Query  950   KPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
              P GW     +P+   T  FG+Y   GPGAK  GR
Sbjct  290   VPAGWSNW-NDPRRNKTVIFGQYKCFGPGAKQTGR  323



>ref|XP_003524409.1| PREDICTED: probable pectinesterase 53-like [Glycine max]
Length=375

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/315 (41%), Positives = 175/315 (56%), Gaps = 7/315 (2%)
 Frame = +2

Query  119   PGGVIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFK  298
             PG  +  +   +   + Q   W +       S  +  +  L  +    V  K GKGG F 
Sbjct  34    PGNGLSTNMTRVEFSEQQFMKWVKFVGGLKHSVFRTANNKLFPSHTLHVSKKHGKGG-FS  92

Query  299   TIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQ-  475
             +IQ A+ ++P  N  R +I +  G Y E+V I   + F+T+ G+  ++  +    TA   
Sbjct  93    SIQAAIDSLPFINVVRVVIKVHAGVYTEKVNISPFKSFITIQGEGADKTIVQWGDTAQSQ  152

Query  476   -VGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKASFYNCKFYGF  649
              +GT  SAT  V S YF A NI  +N+AP P  G   +Q VAL I+ D A F  CKF G 
Sbjct  153   PLGTYGSATFAVNSAYFIAKNITFKNTAPIPAPGAVGKQGVALRISADTAVFQGCKFLGA  212

Query  650   QDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKED  829
             QDTL DH  RH+YKDCY+EG+VDF+FGNA S+F    +  I       ++A GR+S  ED
Sbjct  213   QDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAI-AQLTGALTAQGRSSLLED  271

Query  830   TGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYF  1009
             TGFSFVHC+VTG S    LGR W P+S+ +FAYTY+ N I P+GW     +P    T ++
Sbjct  272   TGFSFVHCKVTG-SGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWYNW-GDPNREMTVFY  329

Query  1010  GEYNNTGPGAKMDGR  1054
             G+Y  TGPGA   GR
Sbjct  330   GQYKCTGPGASYAGR  344



>gb|ACU13228.1| unknown [Glycine max]
Length=218

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 136/195 (70%), Gaps = 3/195 (2%)
 Frame = +2

Query  128  VIPLDTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKT  301
            V+  DTVPIPA K+Q+  W+  +V PL   +  +DPALV AE     +KV +   G+FKT
Sbjct  24   VLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTMDPALVTAEEGAKVVKVMQDGSGEFKT  83

Query  302  IQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG  481
            I +A+K+IP+ NTKR II+I  G YNE++KI+  +PFVTLYG P+  P L    TA Q G
Sbjct  84   ITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLTFGGTAQQYG  143

Query  482  TIYSATLYVLSDYFSAVNIDVRNSAPRPTGKR-DQQAVALTITGDKASFYNCKFYGFQDT  658
            T+ SATL V SDYF A NI + N+APRP  K    QAVAL I+GDKA+FYNCK YGFQDT
Sbjct  144  TVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYNCKMYGFQDT  203

Query  659  LCDHNNRHFYKDCYV  703
            +CD  NRHF+KDC +
Sbjct  204  ICDDRNRHFFKDCLI  218



>ref|XP_007051206.1| Pectinesterase [Theobroma cacao]
 gb|EOX95363.1| Pectinesterase [Theobroma cacao]
Length=388

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 196/362 (54%), Gaps = 36/362 (10%)
 Frame = +2

Query  65    METVRLLNV------VIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQPLQS----  214
             M  VRLL        +++ ++VFC        T   P  ++  + W    V+  +S    
Sbjct  1     MTFVRLLMASEYYFQLVLFLIVFC--NFYLKTTSSNPGSETDHDKWLSWHVRNHKSKQIF  58

Query  215   ----------GRKG--VDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYI  352
                       G KG  +D  L  AE   V + VG+   G F+TI EA+ +IP+RN++R I
Sbjct  59    WQAESLIQSPGAKGRVLDDELRMAEMNKVRINVGQDGSGDFRTINEALSSIPSRNSRRVI  118

Query  353   IFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVL  511
             + I  G Y E+V I    PF+T  GD  N PT+    TA+  G       T  SAT+ V 
Sbjct  119   LVIKPGIYREKVVIPRTLPFITFLGDASNPPTITGNDTASGPGKDGMPLKTFQSATVAVD  178

Query  512   SDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYK  691
             ++YF A+N+   N+ P   G R  QAVAL I+G KA+FYNC FYG QDTL DH   H+  
Sbjct  179   ANYFVAINMKFENTVPHQIGSRGGQAVALRISGTKAAFYNCSFYGDQDTLYDHKGLHYLN  238

Query  692   DCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNS  871
             +C+++G+VDF+FG  +S++ N  +  I   ++A ++A  R++    +GFSF  C VTG+S
Sbjct  239   NCFIQGSVDFIFGYGRSLYENCTVNSI-SKKVASLTAQKRSNASLASGFSFKDCVVTGSS  297

Query  872   KVAV-LGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMD  1048
                V LGR W  YS+ +F+YT++   + P+GW     + K   + Y+GEY  +GPGA   
Sbjct  298   PGMVYLGRAWGDYSRVVFSYTFMDRVVLPQGWSDW-GDRKRDASVYYGEYKCSGPGANFT  356

Query  1049  GR  1054
             GR
Sbjct  357   GR  358



>ref|XP_010276487.1| PREDICTED: probable pectinesterase 53 isoform X1 [Nelumbo nucifera]
Length=392

 Score =   219 bits (559),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 174/290 (60%), Gaps = 12/290 (4%)
 Frame = +2

Query  221   KGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
             KG+D  L KAE   V ++V + G   + +IQEA+  IP +NT+R I+ I  G Y E++ I
Sbjct  72    KGLDTKLKKAELNKVRVRVSQDGTGDYSSIQEALDDIPLKNTRRVILEINPGVYREKILI  131

Query  395   DFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAVNIDVRNS  553
                +PF+T  GD  N PT+    TA+  G       T  SAT+ V +DYF A+NI   N+
Sbjct  132   PRSQPFITFLGDSANPPTITGNDTASGTGRDGKPLKTFQSATVGVNADYFVAINIIFENT  191

Query  554   APRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGN  733
             AP   G   +QAVAL I+G+KA+F+NC FYG QDTL DH   H++ +C+++G+VDF+FG 
Sbjct  192   APHDIGSTGEQAVALRISGNKAAFHNCSFYGSQDTLYDHKGLHYFNNCFIQGSVDFIFGY  251

Query  734   AKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSK  913
              +S++ N  L  I   ++A ++A  R +    +GFSF    VTG S +  LGR W   S+
Sbjct  252   GRSLYENCYLNSIS-KKVASLTAQKRTNISLSSGFSFKDSVVTG-SGLVYLGRAWGDRSR  309

Query  914   TIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              IF+YTY+   + P+GW     + K   + Y+GEY  +GPGA + GR ++
Sbjct  310   VIFSYTYMDKVVLPQGWSDW-GDQKRESSVYYGEYKCSGPGANLTGRVRW  358



>gb|KDP28296.1| hypothetical protein JCGZ_14067 [Jatropha curcas]
Length=375

 Score =   219 bits (557),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/285 (41%), Positives = 172/285 (60%), Gaps = 12/285 (4%)
 Frame = +2

Query  227   VDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
             +D  L KAE   V + V + G   F TI +A+K+IP+RNT+R II I  G Y E++ I  
Sbjct  59    LDDKLRKAEMNSVRITVNQNGPGDFNTIGDAIKSIPSRNTRRVIIAIKPGVYREKISIPR  118

Query  401   DRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAVNIDVRNSAP  559
               PF+T  G+  + P +    TA+  G       T  SAT+ V ++YF A+NI   N+AP
Sbjct  119   TLPFITFLGESSDPPIITGNDTASVNGKDGMPLKTFQSATVAVDANYFVAINIIFENTAP  178

Query  560   RPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAK  739
                G R  QAVAL I+G KA+FY+C FYG QDTL DH   H++ +C+++G+VDF+FG+ +
Sbjct  179   HEIGSRGGQAVALRISGTKAAFYSCSFYGNQDTLYDHKGLHYFNNCFIQGSVDFIFGSGR  238

Query  740   SIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTI  919
             S++ N +L  +   ++A ++A  RN+   ++GFSF  C VTG S +  LGR W  YS+ +
Sbjct  239   SLYQNCRLNSVT-KKVASLTAQKRNNSSLESGFSFKDCVVTG-SGLVYLGRAWGDYSRVV  296

Query  920   FAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             F+YTY+   + P+GW     + K     ++GEY  +GPGA   GR
Sbjct  297   FSYTYMEKVVLPQGWNDW-GDQKRDARVFYGEYKCSGPGANYTGR  340



>ref|XP_006349162.1| PREDICTED: probable pectinesterase 53-like [Solanum tuberosum]
Length=386

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 174/306 (57%), Gaps = 18/306 (6%)
 Frame = +2

Query  182   WFRASVQ------PLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARN  337
             W + S++      P       +DP L+ AE   + + V +   G F TI+EA+ +IP  N
Sbjct  53    WMQESIKHKKQHAPPAPVSSSLDPKLIYAEMNKMIISVSQDGSGNFNTIKEALASIPLYN  112

Query  338   TKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGT-------IYSA  496
              +R I+ I  G Y E++ I    PFVT  GD  N P +    TA+  GT         SA
Sbjct  113   KRRVILDIKPGVYREKINIPRSLPFVTFRGDSSNPPRITGNDTASATGTGGTPLKTFQSA  172

Query  497   TLYVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNN  676
             T+ V +DYF A+N+   N+AP   G   +QAVAL I+G+KA+FYNC FYG QDTL DH  
Sbjct  173   TVSVDADYFIAINVIFENTAPHVVGTAGEQAVALRISGNKAAFYNCSFYGSQDTLYDHKG  232

Query  677   RHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQ  856
              H++ +C+++G+VDF+FG  +S++ N QL  +   ++A ++A  R +    +GFSF +  
Sbjct  233   LHYFNNCFIQGSVDFIFGYGRSLYENCQLNSV-AKKVASLTAQKRTNSSILSGFSFKNST  291

Query  857   VTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPG  1036
             +TG   V  LGR W  YS+ IF+YTY+ N + P GW       ++    Y+GEY  +GPG
Sbjct  292   ITGTGSV-YLGRAWGDYSRVIFSYTYMDNIVLPLGWNDWGKTIRD-SRVYYGEYRCSGPG  349

Query  1037  AKMDGR  1054
             A M GR
Sbjct  350   ANMTGR  355



>ref|XP_010276488.1| PREDICTED: probable pectinesterase 53 isoform X2 [Nelumbo nucifera]
Length=391

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 173/290 (60%), Gaps = 13/290 (4%)
 Frame = +2

Query  221   KGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
             KG+D  L KAE   V ++V + G   + +IQEA+  IP +NT+R I+ I  G Y E++ I
Sbjct  72    KGLDTKLKKAELNKVRVRVSQDGTGDYSSIQEALDDIPLKNTRRVILEINPGVYREKILI  131

Query  395   DFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAVNIDVRNS  553
                +PF+T  GD  N PT+    TA+  G       T  SAT+ V +DYF A+NI   N+
Sbjct  132   PRSQPFITFLGDSANPPTITGNDTASGTGRDGKPLKTFQSATVGVNADYFVAINIIFENT  191

Query  554   APRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGN  733
             AP   G   +QAVAL I+G+KA+F+NC FYG QDTL DH   H++ +C+++G+VDF+FG 
Sbjct  192   APHDIGSTGEQAVALRISGNKAAFHNCSFYGSQDTLYDHKGLHYFNNCFIQGSVDFIFGY  251

Query  734   AKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSK  913
              +S++ N  L  I   ++A ++A  R +    +GFSF    VTG S +  LGR W   S+
Sbjct  252   GRSLYENCYLNSIS-KKVASLTAQKRTNISLSSGFSFKDSVVTG-SGLVYLGRAWGDRSR  309

Query  914   TIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGRPKF  1063
              IF+YTY+   + P+GW       +   + Y+GEY  +GPGA + GR ++
Sbjct  310   VIFSYTYMDKVVLPQGWSDWGDQKRE--SVYYGEYKCSGPGANLTGRVRW  357



>emb|CBI27989.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/269 (43%), Positives = 163/269 (61%), Gaps = 11/269 (4%)
 Frame = +2

Query  272   KVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTL  451
             K    G F++IQ+A+ ++P+ N  R +I +  G Y E+V I   + F+T+ G   ++  +
Sbjct  19    KNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPAFKSFITIEGAGADKTVV  78

Query  452   VAATTAAQVG-------TIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTIT  607
                 TA  +G       T  SAT  V S YF A NI  +N+ P P  G   +QAVA  I+
Sbjct  79    QWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPAPGAVGKQAVAFRIS  138

Query  608   GDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQM  787
             GD A+F  CKF G QDTL DH  RH+YKDCY+EG+VDF+FGNA S+F    +  I  +  
Sbjct  139   GDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQNTG  198

Query  788   AMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWM  967
             A+ +A GR+S  EDTGFSFV+C+VTG+  +  LGR W P+S+ +FAYTY+ + I P+GW 
Sbjct  199   AL-TAQGRSSLLEDTGFSFVNCKVTGSGAL-FLGRAWGPFSRVVFAYTYMDDIIIPKGWY  256

Query  968   GMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
                 +P    T ++G+Y  TGPGA   GR
Sbjct  257   NW-GDPSREMTVFYGQYKCTGPGAAFAGR  284



>gb|ACU18534.1| unknown [Glycine max]
Length=217

 Score =   211 bits (538),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 135/189 (71%), Gaps = 3/189 (2%)
 Frame = +2

Query  140  DTVPIPAEKSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEA  313
            DTVPIPA K+Q+ +WF  +V PL   +  +DPALV AE     +KV +   G+FKTI +A
Sbjct  28   DTVPIPAHKAQLGTWFSTNVGPLDQRKSTMDPALVAAEEGAKVVKVMQDGSGEFKTITDA  87

Query  314  VKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGTIYS  493
            + +IP+ NTKR I++I  G YNE++KI+  +PF+TLYG P+  P L    TA + GT+ S
Sbjct  88   INSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPFITLYGVPEKMPNLTFGRTALKYGTVDS  147

Query  494  ATLYVLSDYFSAVNIDVRNSAPRPTGK-RDQQAVALTITGDKASFYNCKFYGFQDTLCDH  670
            ATL V S+YF A NI + NSAPRP GK +  QAVAL I+GDKA+FYNCKF+GFQDT+ D 
Sbjct  148  ATLIVESNYFVAANIIISNSAPRPDGKIQGGQAVALRISGDKAAFYNCKFFGFQDTIYDD  207

Query  671  NNRHFYKDC  697
             NRHF+KDC
Sbjct  208  RNRHFFKDC  216



>ref|XP_004503496.1| PREDICTED: probable pectinesterase 53-like [Cicer arietinum]
Length=385

 Score =   216 bits (551),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 166/275 (60%), Gaps = 16/275 (6%)
 Frame = +2

Query  263   VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
             VY + GKGG F +IQ A+ ++P  N  R +I +  G Y E+V I   + F+T+ G   ++
Sbjct  85    VYKQSGKGG-FSSIQAAIDSLPFINLVRVVIKVHAGVYTEKVNIPALKAFITIEGAGADK  143

Query  443   PTLVAATTAAQ----------VGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQA  589
              T+V     AQ          +GT  SAT  V S YF A N+  +N+AP P  G   +QA
Sbjct  144   -TIVQWGDTAQTPNPAAKGQTLGTYGSATFAVNSPYFIAKNMTFKNTAPVPAPGAVGKQA  202

Query  590   VALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRV  769
             VAL I+ D A F  CKF G QDTL DH  RH+YKDCY+EG+VDF+FGNA S+F    +  
Sbjct  203   VALRISADTAIFVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHA  262

Query  770   IPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAI  949
             I  +  A+ +A GR+S  EDTGFSFVHC+VTG S    LGR W P+S+ +FAYTY+ N I
Sbjct  263   IAINTGAL-TAQGRSSLLEDTGFSFVHCKVTG-SGALYLGRAWGPFSRVVFAYTYMDNII  320

Query  950   KPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
              P+GW     +P    T ++G+Y  TGPGA   GR
Sbjct  321   IPKGWYNW-GDPNREMTVFYGQYKCTGPGASYAGR  354



>emb|CAN63186.1| hypothetical protein VITISV_037092 [Vitis vinifera]
Length=379

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 172/305 (56%), Gaps = 12/305 (4%)
 Frame = +2

Query  164   KSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFKTIQEAVKTIPARNTK  343
             + Q   W R       S  K     L  + A  V  K    G F++IQ+A+ ++P+ N  
Sbjct  50    EQQFMKWVRFVGSLRHSMFKAAKNKLFPSYAITVN-KNSAAGDFRSIQDAIDSLPSINLV  108

Query  344   RYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATL  502
             R +I +  G Y E+V I   + F+T+ G   ++  +    TA  +G       T  SAT 
Sbjct  109   RVVIKVHAGVYTEKVNIPXFKSFITIEGAGADKTVVQWGDTARTIGEKGQPIGTFNSATF  168

Query  503   YVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNR  679
              V S YF A NI  +N+ P P  G   +QAVA  I+GD A+F  CKF G QDTL DH  R
Sbjct  169   AVNSLYFIAKNITFKNTTPVPAPGAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGR  228

Query  680   HFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQV  859
             H+YKDCY+EG+VDF+FGNA S+F    +  I  +  A+ +A GR+S  EDTGFSFV+C+V
Sbjct  229   HYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQNTGAL-TAQGRSSLLEDTGFSFVNCKV  287

Query  860   TGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGA  1039
             TG S    LGR W P+S+ +FAYTY+ + I P+GW     +P    T ++G+Y  TGPGA
Sbjct  288   TG-SGALFLGRAWGPFSRVVFAYTYMDDIIIPKGWYNW-GDPSREMTVFYGQYKCTGPGA  345

Query  1040  KMDGR  1054
                GR
Sbjct  346   AFAGR  350



>ref|XP_010656255.1| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
Length=379

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 172/305 (56%), Gaps = 12/305 (4%)
 Frame = +2

Query  164   KSQVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGGQFKTIQEAVKTIPARNTK  343
             + Q   W R       S  K     L  + A  V  K    G F++IQ+A+ ++P+ N  
Sbjct  50    EQQFMKWVRFVGSLRHSMFKAAKNKLFPSYAITVN-KNSAAGDFRSIQDAIDSLPSINLV  108

Query  344   RYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATL  502
             R +I +  G Y E+V I   + F+T+ G   ++  +    TA  +G       T  SAT 
Sbjct  109   RVVIKVHAGVYTEKVNIPAFKSFITIEGAGADKTVVQWGDTARTIGEKGQPIGTFNSATF  168

Query  503   YVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNR  679
              V S YF A NI  +N+ P P  G   +QAVA  I+GD A+F  CKF G QDTL DH  R
Sbjct  169   AVNSLYFIAKNITFKNTTPVPAPGAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGR  228

Query  680   HFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQV  859
             H+YKDCY+EG+VDF+FGNA S+F    +  I  +  A+ +A GR+S  EDTGFSFV+C+V
Sbjct  229   HYYKDCYIEGSVDFIFGNALSLFEGCHVHAIAQNTGAL-TAQGRSSLLEDTGFSFVNCKV  287

Query  860   TGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGA  1039
             TG S    LGR W P+S+ +FAYTY+ + I P+GW     +P    T ++G+Y  TGPGA
Sbjct  288   TG-SGALFLGRAWGPFSRVVFAYTYMDDIIIPKGWYNW-GDPSREMTVFYGQYKCTGPGA  345

Query  1040  KMDGR  1054
                GR
Sbjct  346   AFAGR  350



>ref|XP_003630703.1| Pectinesterase [Medicago truncatula]
 gb|AET05179.1| pectinesterase [Medicago truncatula]
Length=381

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 160/274 (58%), Gaps = 14/274 (5%)
 Frame = +2

Query  263   VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
             VY    KGG F +IQ A+ ++P  N  R +I +  G Y E+V I   + F+T+ G   ++
Sbjct  81    VYKHSSKGG-FSSIQAAIDSLPFINLVRVVIKVHAGVYTEKVSIPALKSFITIQGAGADK  139

Query  443   PTLVAATTA---------AQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAV  592
               +    TA           +GT  SAT  V S YF A NI  +N+AP P  G   +Q V
Sbjct  140   TIVQWGDTALTPNPGAKGQTLGTYGSATFAVNSPYFIAKNITFKNTAPIPKPGAVGKQGV  199

Query  593   ALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVI  772
             AL I+ D A F  CKF G QDTL DH  RH+YKDCY+EG+VDF+FGNA S+F    +  I
Sbjct  200   ALRISADTAMFLGCKFLGAQDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAI  259

Query  773   PGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIK  952
                 +  ++A GRNS  EDTGFSFVHC+VTG S    LGR W P+S+ +FAYTY+ N I 
Sbjct  260   -AQNIGALTAQGRNSLLEDTGFSFVHCKVTG-SGALYLGRAWGPFSRVVFAYTYMDNIII  317

Query  953   PEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             P+GW     +P    T ++G+Y  TGPGA   GR
Sbjct  318   PKGWYNW-GDPNREMTVFYGQYKCTGPGASYAGR  350



>ref|XP_003632380.2| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
 emb|CAN79461.1| hypothetical protein VITISV_042494 [Vitis vinifera]
 emb|CBI36991.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/293 (40%), Positives = 169/293 (58%), Gaps = 12/293 (4%)
 Frame = +2

Query  203   PLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKY  376
             P   G K +D  L KAE   V + V + G   + TI +A+ TIP  NT+R I+ I  G Y
Sbjct  62    PSGGGGKALDIKLSKAEMNKVTMTVSQDGTADYTTISDALHTIPLYNTRRVILVIKPGVY  121

Query  377   NERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAVN  535
              E+V +    PFVT  GD  + PT+    TA+ +G       T  SAT+ V ++YF A+N
Sbjct  122   REKVTVPRALPFVTFLGDASDPPTITGNDTASVIGRNGVPLKTFQSATVGVDANYFVAIN  181

Query  536   IDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTV  715
             I   N+AP   G    QAVAL I+G KA+FYNC FYG QDTL DH   H++ +C+++G+V
Sbjct  182   IKFENTAPHVIGSAGGQAVALRISGTKAAFYNCSFYGSQDTLYDHTGLHYFNNCFIQGSV  241

Query  716   DFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRG  895
             DF+FG  +S++ N  L  +   ++A ++A  R++    +GFSF  C VTG+  V  LGR 
Sbjct  242   DFIFGYGRSLYENCSLNSV-AKKVASLTAQKRSTSSMASGFSFKDCVVTGSGTV-YLGRA  299

Query  896   WFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             W  YS+ +F+YT++   + P+GW       K     Y+GEY  +GPGA +  R
Sbjct  300   WGDYSRVVFSYTFMDKLVLPQGWSDW-GKKKLDSRVYYGEYKCSGPGANLTAR  351



>gb|KCW58194.1| hypothetical protein EUGRSUZ_H00909 [Eucalyptus grandis]
Length=386

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 170/289 (59%), Gaps = 12/289 (4%)
 Frame = +2

Query  215   GRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERV  388
             G+K VD  L KAE + +   V + G   ++T+ EA+ +IPA NT+R I+ +  G Y E++
Sbjct  71    GKKVVDWKLWKAEMSKIRKTVSQDGTGDYRTVSEALNSIPAFNTRRVILVVKPGIYREKI  130

Query  389   KIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAVNIDVR  547
              +     FVT  GD  + PT+    TA+  G       T  SAT+ V +DYF A+N+   
Sbjct  131   NVPRQMSFVTFLGDSTSPPTITGNDTASVTGRGGTPLKTFQSATVAVDADYFVAINVKFE  190

Query  548   NSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVF  727
             N+AP   G   +QAVAL I+G KA+FYNC F G QDTL DH   H++ +C+++G+VDF+F
Sbjct  191   NTAPHEVGSLGEQAVALRISGTKAAFYNCSFIGNQDTLYDHKGLHYFNNCFIQGSVDFIF  250

Query  728   GNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPY  907
             G  +S++ N  L  +   ++A ++A  R +    +GFSF +  +TG S +  LGR W  Y
Sbjct  251   GYGRSLYENCHLNSVT-KKVASLTAQKRTNASLASGFSFKNSTITG-SGLLYLGRAWGDY  308

Query  908   SKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             S+ IF+YT++   + P+GW     +PK     Y+GEY  +GPGA   GR
Sbjct  309   SRVIFSYTFMDRVVAPQGWSDW-GDPKRDARVYYGEYKCSGPGANTTGR  356



>ref|XP_004229371.1| PREDICTED: probable pectinesterase 53 [Solanum lycopersicum]
Length=387

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/284 (41%), Positives = 167/284 (59%), Gaps = 12/284 (4%)
 Frame = +2

Query  230   DPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFD  403
             DP L+ AE   + + V + G   F TI+EA+ TIP  N +R I+ I  G Y E++ I   
Sbjct  76    DPKLIYAEMNKMIITVSQDGSSNFNTIKEALATIPLYNKRRVILDIKPGVYREKINIPRS  135

Query  404   RPFVTLYGDPKNRPTLVAATTAAQ-------VGTIYSATLYVLSDYFSAVNIDVRNSAPR  562
              PFVT  GD  N P +    TA+        + T  SAT+ V +DYF A+N+   N+AP 
Sbjct  136   SPFVTFRGDSSNPPRITGNDTASATRTGGTPLKTFQSATVSVDADYFIAINVIFENTAPH  195

Query  563   PTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKS  742
               G   +QAVAL I+G+KA+FYNC FYG QDTL DH   H++ +C+++G+VDF+FG  +S
Sbjct  196   VVGTAGEQAVALRISGNKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQGSVDFIFGYGRS  255

Query  743   IFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIF  922
             ++ N QL  +   ++A ++A  R +    +GFSF +  +TG   V  LGR W  YS+ IF
Sbjct  256   LYENCQLNSV-AKKVASLTAQKRTNSSILSGFSFKNSTITGTGSV-YLGRAWGDYSRVIF  313

Query  923   AYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             +YTY+ N + P GW       ++    Y+GEY  +GPGA + GR
Sbjct  314   SYTYMDNIVLPLGWNDWGKTTRD-SRVYYGEYRCSGPGANITGR  356



>ref|XP_006371972.1| hypothetical protein POPTR_0018s06820g [Populus trichocarpa]
 gb|ERP49769.1| hypothetical protein POPTR_0018s06820g [Populus trichocarpa]
Length=422

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/267 (46%), Positives = 160/267 (60%), Gaps = 13/267 (5%)
 Frame = +2

Query  281   KGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAA  460
               G F TIQEA+ ++P  N  R II I  G Y E+V I   + F+T+ G   +  T+V  
Sbjct  131   SAGDFTTIQEAIDSLPFINLVRVIIKIRAGVYKEKVNIPPLKSFITMEGAGADN-TIVQW  189

Query  461   TTAAQ--------VGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGD  613
                AQ        +GT  SAT  V S +F A NI  +N+AP P  G   QQAVAL I+ D
Sbjct  190   GDTAQTPGARGQPMGTYSSATFAVNSPFFVAKNITFKNTAPLPAPGAMGQQAVALRISAD  249

Query  614   KASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAM  793
              A+F  CKF G QDTL DH  RH+YKDCY+EG+VDF+FGN  S+F    +  I     A+
Sbjct  250   TAAFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGLSLFEGCHVHAIAQFTGAL  309

Query  794   VSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGM  973
              +A GR+S  EDTGFSFV+C+VTG+  +  LGR W P+S+ +FAYTY+ N I P+GW   
Sbjct  310   -TAQGRSSLLEDTGFSFVNCKVTGSGAL-YLGRAWGPFSRVVFAYTYMDNIIIPKGWYNW  367

Query  974   RTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               +P    T ++G+Y  TGPGA   GR
Sbjct  368   -GDPNRELTVFYGQYKCTGPGASFAGR  393



>ref|XP_010069754.1| PREDICTED: probable pectinesterase 53 isoform X2 [Eucalyptus 
grandis]
Length=409

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 170/289 (59%), Gaps = 12/289 (4%)
 Frame = +2

Query  215   GRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERV  388
             G+K VD  L KAE + +   V + G   ++T+ EA+ +IPA NT+R I+ +  G Y E++
Sbjct  94    GKKVVDWKLWKAEMSKIRKTVSQDGTGDYRTVSEALNSIPAFNTRRVILVVKPGIYREKI  153

Query  389   KIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAVNIDVR  547
              +     FVT  GD  + PT+    TA+  G       T  SAT+ V +DYF A+N+   
Sbjct  154   NVPRQMSFVTFLGDSTSPPTITGNDTASVTGRGGTPLKTFQSATVAVDADYFVAINVKFE  213

Query  548   NSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVF  727
             N+AP   G   +QAVAL I+G KA+FYNC F G QDTL DH   H++ +C+++G+VDF+F
Sbjct  214   NTAPHEVGSLGEQAVALRISGTKAAFYNCSFIGNQDTLYDHKGLHYFNNCFIQGSVDFIF  273

Query  728   GNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPY  907
             G  +S++ N  L  +   ++A ++A  R +    +GFSF +  +TG S +  LGR W  Y
Sbjct  274   GYGRSLYENCHLNSVT-KKVASLTAQKRTNASLASGFSFKNSTITG-SGLLYLGRAWGDY  331

Query  908   SKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             S+ IF+YT++   + P+GW     +PK     Y+GEY  +GPGA   GR
Sbjct  332   SRVIFSYTFMDRVVAPQGWSDW-GDPKRDARVYYGEYKCSGPGANTTGR  379



>ref|XP_010679463.1| PREDICTED: probable pectinesterase 53 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 124/346 (36%), Positives = 190/346 (55%), Gaps = 32/346 (9%)
 Frame = +2

Query  104   VLVFCPGGVIPLDTVPIPA----EKSQVESWFRASVQPLQSGR-----------------  220
             +L F P   I L  + + +     + + ESW   +VQ  +  R                 
Sbjct  8     LLPFIPLFFISLHHISLWSLATDPQQEYESWLNWNVQNHRQRRPHTLPQPNTAATPAGPS  67

Query  221   KGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
             K +D  L  AE   V L V + G   ++TI EA+  IP RNT+R I+ I+ G Y E++ I
Sbjct  68    KDLDVKLKNAETNKVRLTVNQNGTGDYRTITEAIDNIPLRNTRRVILDISPGIYREKIHI  127

Query  395   DFDRPFVTLYGDPKNRPTLVAATTAA------QVGTIYSATLYVLSDYFSAVNIDVRNSA  556
                +PF++  GD  N PT+    TA+       + T  SAT+ V +DYF A+NI   N+A
Sbjct  128   PKTKPFISFVGDSSNPPTITGNDTASVTHDGTPLHTFQSATVAVDADYFVALNIIFENTA  187

Query  557   PRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNA  736
                 GK  +QAVAL I+G KASFY   FYG QDTL DH   H++++C+++G+VDF+FG  
Sbjct  188   THEVGKAGEQAVALRISGTKASFYEASFYGSQDTLYDHKGLHYFRNCFIQGSVDFIFGYG  247

Query  737   KSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKT  916
             +S + N  +  I   ++A V+A  R+    ++GFSF  C+VTG S +  LGR W  YS+ 
Sbjct  248   RSFYENCTINSI-AKKVASVTAQKRSKSSMESGFSFKDCKVTG-SGLVYLGRAWGDYSRV  305

Query  917   IFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             +++++++   + P GW     + ++  + Y+GEY  +GPG+ M GR
Sbjct  306   VYSFSFLDKLVLPLGWNNWGKSNRD-KSVYYGEYKCSGPGSNMTGR  350



>ref|XP_002320279.2| hypothetical protein POPTR_0014s11240g [Populus trichocarpa]
 gb|EEE98594.2| hypothetical protein POPTR_0014s11240g [Populus trichocarpa]
Length=381

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 119/299 (40%), Positives = 178/299 (60%), Gaps = 13/299 (4%)
 Frame = +2

Query  188   RASVQ-PLQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIF  358
             +++VQ P   G+  +D  L +AE   V + V +   G+FKTI+EA+ +IP  NT+R II 
Sbjct  56    KSTVQTPGADGKLVLDGKLRQAEMNSVRVTVSQDGNGEFKTIKEAINSIPPYNTRRVIIA  115

Query  359   IAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSD  517
             I  G Y E++ I    PFVT  GD    PT+    TA+  G       T  SAT+ V ++
Sbjct  116   IKPGVYREKIFIPRTFPFVTFLGDSSEPPTITGNDTASVSGKDGKPLRTYQSATVAVDAN  175

Query  518   YFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDC  697
             YF A+++   N+AP   G + +QAVAL I+G KA+FYNC F+G QDTL DH   H++ +C
Sbjct  176   YFVAISMKFENTAPHVIGTKQEQAVALRISGTKAAFYNCSFFGDQDTLYDHKGLHYFNNC  235

Query  698   YVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKV  877
             +++G+VDF+FG+ +S + N  L  +   ++A ++A  R++    +GFSF    +TG S +
Sbjct  236   FIQGSVDFIFGSGRSFYENCHLNSV-AKKVASLTAQKRSNSSLASGFSFKDSTITG-SGL  293

Query  878   AVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               LGR W  YS+ IF+YT++   I P+GW     + +     Y+GEY  TGPGA + GR
Sbjct  294   IYLGRAWGDYSRVIFSYTFMDKIILPQGWNDW-GDQRRDSRVYYGEYKCTGPGANLTGR  351



>ref|XP_004495886.1| PREDICTED: probable pectinesterase 53-like [Cicer arietinum]
Length=380

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 110/304 (36%), Positives = 173/304 (57%), Gaps = 11/304 (4%)
 Frame = +2

Query  170   QVESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTK  343
             Q ++     ++ L +  +G+D  L +AE+  V + V + G   FKTI EA+ +IP  NT+
Sbjct  41    QKKTILENKLKVLSATEQGLDLKLRQAESKIVRITVNQNGTADFKTITEAINSIPLNNTR  100

Query  344   RYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATL  502
             RYI+ IA G Y E++ I   +PF+T  GD  +RPT+    T   +G       T  ++T+
Sbjct  101   RYIVSIAPGTYREKITIPKKKPFITFLGDAMDRPTITGNDTKGMIGRDGTELKTFNTSTV  160

Query  503   YVLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRH  682
              V + YF A+NI+  N+A      +++Q VAL ++ +K +FYNC FYG QDTL DH   H
Sbjct  161   AVEARYFIAININFENTARHDNASKEEQGVALRVSANKTAFYNCSFYGAQDTLYDHKGLH  220

Query  683   FYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVT  862
             ++K+C ++GTVDF+FG  +S + N  +      +  + +     +    +GFSF + +VT
Sbjct  221   YFKNCLIKGTVDFIFGYGRSFYENCHIHSTTKTKSYITAQRRSKNTSMASGFSFKNSKVT  280

Query  863   GNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAK  1042
             G+ +   LGR W  YS+ +F+YTY+ N I PEGW       +     Y+GEY  +GPG+ 
Sbjct  281   GSGQT-YLGRPWGNYSRVVFSYTYMDNTILPEGWSDWNHEHRYLN-AYYGEYKCSGPGSN  338

Query  1043  MDGR  1054
             +  R
Sbjct  339   LSER  342



>ref|XP_003591360.1| Pectinesterase [Medicago truncatula]
 gb|AES61611.1| pectinesterase [Medicago truncatula]
Length=347

 Score =   213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 173/287 (60%), Gaps = 12/287 (4%)
 Frame = +2

Query  221   KGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
             +G+DP L KAE+  V LKV + G  QFK+I EA+ +I   N +R II IA G Y E++ +
Sbjct  34    QGLDPKLKKAESNKVRLKVSQDGSAQFKSITEALNSIQPYNIRRVIISIAPGYYREKIVV  93

Query  395   DFDRPFVTLYGDPKNRPTL-------VAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNS  553
                 PF+T  GD ++ PT+       V  +  AQ+ T  SAT+ V + YF A+NI+  N+
Sbjct  94    PKTLPFITFLGDVRDPPTITGNDTQSVTGSDGAQLRTFNSATVAVNASYFMAININFENT  153

Query  554   APRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGN  733
             A  P G + +QAVA+ ITG+K +FYNC F G QDTL DH   H++ +C ++G+VDF+ G+
Sbjct  154   ASFPIGSKVEQAVAVRITGNKTAFYNCTFSGVQDTLYDHKGLHYFNNCTIKGSVDFICGH  213

Query  734   AKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSK  913
              KS++    +R I  + M  ++A   ++   D+GFSF +  V G+     LGR W  YS+
Sbjct  214   GKSLYEGCTIRSI-ANNMTSITAQSGSNPSYDSGFSFKNSMVIGDGPT-YLGRPWGNYSQ  271

Query  914   TIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
              +F+YTY+ N++ P+GW     + K     Y+GEY  +GPG+   GR
Sbjct  272   VVFSYTYMDNSVLPKGWEDW-NDTKRYMNAYYGEYKCSGPGSNTAGR  317



>gb|AFK35509.1| unknown [Medicago truncatula]
Length=371

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 173/287 (60%), Gaps = 12/287 (4%)
 Frame = +2

Query  221   KGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKI  394
             +G+DP L KAE+  V LKV + G  QFK+I EA+ +I   N +R II IA G Y E++ +
Sbjct  58    QGLDPKLKKAESNKVRLKVSQDGSAQFKSITEALNSIQPYNIRRVIISIAPGYYREKIVV  117

Query  395   DFDRPFVTLYGDPKNRPTL-------VAATTAAQVGTIYSATLYVLSDYFSAVNIDVRNS  553
                 PF+T  GD ++ PT+       V  +  AQ+ T  SAT+ V + YF A+NI+  N+
Sbjct  118   PKTLPFITFLGDVRDPPTITGNDTQSVTGSDGAQLRTFNSATVAVNASYFMAININFENT  177

Query  554   APRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGN  733
             A  P G + +QAVA+ ITG+K +FYNC F G QDTL DH   H++ +C ++G+VDF+ G+
Sbjct  178   ASFPIGSKVEQAVAVRITGNKTAFYNCTFSGVQDTLYDHKGLHYFNNCTIKGSVDFICGH  237

Query  734   AKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSK  913
              KS++    +R I  + M  ++A   ++   D+GFSF +  V G+     LGR W  YS+
Sbjct  238   GKSLYEGCTIRSI-ANNMTSITAQSGSNPSYDSGFSFKNSMVIGDGP-TYLGRPWGNYSQ  295

Query  914   TIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
              +F+YTY+ N++ P+GW     + K     Y+GEY  +GPG+   GR
Sbjct  296   VVFSYTYMDNSVLPKGWEDW-NDTKRYMNAYYGEYKCSGPGSNTAGR  341



>ref|XP_008801747.1| PREDICTED: probable pectinesterase 53 [Phoenix dactylifera]
Length=386

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/355 (35%), Positives = 188/355 (53%), Gaps = 31/355 (9%)
 Frame = +2

Query  65    METVRLLNVVIVCVLVFCPGGVIPLDTVPIPAEKSQVESWFRASVQP-------------  205
             + T  LL +V++   +       PL + P   E+ +   W   +VQ              
Sbjct  5     LHTNSLLPLVLLTFFLLPS---TPLSSYP-NNERDEFMKWISWNVQNHKRTVALQLNSNS  60

Query  206   --LQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGK  373
               L  G + +D  L KAEAA     V +   G +K+I+EA+ +IP  NT+R I+ I  G 
Sbjct  61    GVLHGGSRSLDMKLAKAEAAATRYIVSQNGSGSYKSIREAIDSIPLHNTRRVILEIRSGI  120

Query  374   YNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAV  532
             Y E++ I     F+T  G+  + P +    TAA  G       T +S T+ V ++YF A 
Sbjct  121   YREKIVIPKSMSFITFLGNGASPPVITGNDTAATRGKDGVPLNTFHSPTVAVNANYFVAA  180

Query  533   NIDVRNSAPRP-TGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEG  709
             NI   N+AP P  G    QAVAL I+GDKA+FYNC FYG QDTL DH   H++ +C+++G
Sbjct  181   NIKFENTAPYPEVGTTGGQAVALRISGDKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQG  240

Query  710   TVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLG  889
             +VDF+FG  +S++ N  L  I   ++A ++A   + +  ++GFSF+   +TG S +  LG
Sbjct  241   SVDFIFGYGRSLYENCYLNSIT-KRVASLAAQKGSLKTMESGFSFLRSTITG-SGLVYLG  298

Query  890   RGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             R W  +S+ +F+YTY+   + PEGW             Y+GEY  +GPGA   GR
Sbjct  299   RAWGDHSRVVFSYTYMDKVVIPEGWNSWGIQRPETSGVYYGEYQCSGPGANWTGR  353



>ref|XP_009787978.1| PREDICTED: probable pectinesterase 53 isoform X1 [Nicotiana sylvestris]
Length=393

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/303 (39%), Positives = 171/303 (56%), Gaps = 15/303 (5%)
 Frame = +2

Query  182   WFRASVQPLQS---GRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKR  346
             W + SV+  +        +DP L  AE   + + V + G   FKTI+EA+ +IP  N +R
Sbjct  64    WMQESVRNRKQQVPSSSSLDPRLRNAELNKILISVNQEGIGNFKTIKEALASIPVYNKRR  123

Query  347   YIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVGT-------IYSATLY  505
              I+ I  G Y E++ I    PFVT  GD  + P +    TAA  GT         SAT+ 
Sbjct  124   VILDIKPGVYREKINIPRSLPFVTFRGDSSDPPRITGNDTAAAAGTDGRPLKTFQSATVS  183

Query  506   VLSDYFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHF  685
             V +DYF A+N+   N+A    G   +QAVAL I+G+KA+FY+C FYG QDTL DH   H+
Sbjct  184   VDADYFVAINVIFENTAAHVVGSVGEQAVALRISGNKAAFYDCSFYGSQDTLYDHKGLHY  243

Query  686   YKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTG  865
             + +C+V+G+VDF+FG  +S++ N  L  +   ++A ++A  R +    +GFSF +  +TG
Sbjct  244   FNNCFVQGSVDFIFGYGRSLYENCHLNSV-AKKVASLTAQKRTNSSILSGFSFKNSTITG  302

Query  866   NSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKM  1045
                V  LGR W  YS+ IF+YTY+   + P GW       ++    Y+GEY  +GPGA M
Sbjct  303   TGSV-YLGRAWGDYSRVIFSYTYMDEIVLPLGWSDWGKTSRD-SRVYYGEYRCSGPGANM  360

Query  1046  DGR  1054
              GR
Sbjct  361   TGR  363



>gb|KEH27219.1| pectinesterase [Medicago truncatula]
Length=379

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 159/264 (60%), Gaps = 11/264 (4%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G F TIQ A+ ++P+ N  R +I +  G Y E+V I   + F+T+ GD  +   +    T
Sbjct  90    GDFDTIQNAIDSLPSINLVRVVIKVHAGVYTEKVNIPPLKSFITIEGDGADTTIVQWGDT  149

Query  467   AAQ-------VGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKAS  622
             AA        +GT  SAT  V S YF A NI  +N+ P P  G   +QAVA  I+ D AS
Sbjct  150   AATPGPRGNPLGTYGSATFAVNSPYFIAKNITFKNTFPLPAPGAIGKQAVAFRISADTAS  209

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
             F  C+F G QDTL DH  RH+YKDCY+EG+VDF+FGNA S+F    +  I  +  A+ +A
Sbjct  210   FLGCRFLGAQDTLYDHIGRHYYKDCYIEGSVDFIFGNALSLFEGCHVHAIARNTGAL-TA  268

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
              GR+S  +DTGFSFV+C+VTG S    LGR W P+S+ +FAYTY+ N I P+GW     +
Sbjct  269   QGRSSMLQDTGFSFVNCKVTG-SGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWYNW-GD  326

Query  983   PKNGGTCYFGEYNNTGPGAKMDGR  1054
             P    T ++G+Y  TGPGA   GR
Sbjct  327   PNREMTVFYGQYKCTGPGASFAGR  350



>ref|XP_004969916.1| PREDICTED: probable pectinesterase 53-like [Setaria italica]
Length=403

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/321 (41%), Positives = 180/321 (56%), Gaps = 26/321 (8%)
 Frame = +2

Query  149   PIPAEKSQ---VESWFRASVQPLQSGRKGVDPALVKAEAAPVY-LKVGKG---GQFKTIQ  307
             P PA  ++   +E  F   V+ + + R       + A A P Y L V K    G F TIQ
Sbjct  61    PFPANATRAEMIERQFMEWVRYMGALRHSTFQHAL-ARAFPSYSLVVDKNPAFGDFTTIQ  119

Query  308   EAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTL-----------YGDPKNRPTLV  454
              A+ ++PA N  R +I +  G Y E+V I   R F+TL           +GD  + PT  
Sbjct  120   AAIDSLPAINLVRVVIRVNAGTYTEKVTISAMRAFITLEGAGADSTIVQWGDTADSPT--  177

Query  455   AATTAAQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKASFYN  631
                    +GT  SAT  V + YF A NI  +N++P P  G   +QAVAL ++ D A+F  
Sbjct  178   -GPKGRPLGTFNSATFAVNAQYFLARNITFKNTSPVPKPGATGKQAVALRVSADNAAFVG  236

Query  632   CKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGR  811
             CKF G QDTL DH+ RH+YK+CY+EG+VDF+FGNA S++ +  +  I  D  A+ +A  R
Sbjct  237   CKFLGAQDTLYDHSGRHYYKECYIEGSVDFIFGNALSLYEDCHVHAIARDYGAL-TAQNR  295

Query  812   NSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKN  991
              S  EDTGFSFV+C+VTG+  +  LGR W  +S+ +FAYTY+ N I P GW     +P  
Sbjct  296   QSMLEDTGFSFVNCRVTGSGAL-YLGRAWGTFSRVVFAYTYMDNIIIPRGWYNW-GDPNR  353

Query  992   GGTCYFGEYNNTGPGAKMDGR  1054
               T ++G+Y  TGPGA   GR
Sbjct  354   ELTVFYGQYKCTGPGASYAGR  374



>ref|XP_010914653.1| PREDICTED: probable pectinesterase 53 [Elaeis guineensis]
Length=386

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/293 (40%), Positives = 170/293 (58%), Gaps = 12/293 (4%)
 Frame = +2

Query  206   LQSGRKGVDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYN  379
             L  G + +D  L KAEAA V   V +   G +K+I+EA+ +IP  NT+R I+ I  G Y 
Sbjct  63    LGGGPRALDVKLAKAEAAAVRYIVSQDGSGNYKSIREAIDSIPLHNTRRVILEIRPGIYR  122

Query  380   ERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAVNI  538
             E++ I     FVT  G+  + P +    TAA  G       T +S T+ V ++YF A NI
Sbjct  123   EKIVIPKSMSFVTFLGNGTSPPVITGNDTAATRGKDGVPLNTFHSPTVAVNANYFIAANI  182

Query  539   DVRNSAPRP-TGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTV  715
                N+AP P  G    QAVAL I+GDKA+FYNC FYG QDTL DH   H++ +C+++G+V
Sbjct  183   KFENTAPYPEVGTMGGQAVALRISGDKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQGSV  242

Query  716   DFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRG  895
             DF+FG  +S++ N  L  I   ++A ++A   + +  ++GFSFV   +TG S +  LGR 
Sbjct  243   DFIFGYGRSLYENCYLNSI-AKRVASLTAQKGSIKTMESGFSFVRSAITG-SGLVYLGRA  300

Query  896   WFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             W  +S+ +F+YT++   + PEGW   R         Y+GEY  +GPGA   GR
Sbjct  301   WGDHSRVVFSYTFMDKVVIPEGWNSWRIQQPETSGVYYGEYQCSGPGANWTGR  353



>gb|AFK39158.1| unknown [Medicago truncatula]
Length=381

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 122/274 (45%), Positives = 159/274 (58%), Gaps = 14/274 (5%)
 Frame = +2

Query  263   VYLKVGKGGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNR  442
             VY    KGG F +IQ A+ ++P  N  R +I +  G Y E+V I   + F+T+ G   ++
Sbjct  81    VYKHSSKGG-FSSIQAAIDSLPFINLVRVVIKVHAGVYTEKVSIPALKSFITIQGAGADK  139

Query  443   PTLVAATTA---------AQVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAV  592
               +    TA           +GT  SAT  V S YF A NI  +N+AP P  G   +Q V
Sbjct  140   TIVQWGDTALTPNPGAKGQTLGTYGSATFAVNSPYFIAKNITFKNTAPIPKPGAVGKQGV  199

Query  593   ALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVI  772
             AL I+ D A F  CKF G QDTL DH   H+YKDCY+EG+VDF+FGNA S+F    +  I
Sbjct  200   ALRISADTAMFLGCKFLGAQDTLYDHIGGHYYKDCYIEGSVDFIFGNALSLFEGCHVHAI  259

Query  773   PGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIK  952
                 +  ++A GRNS  EDTGFSFVHC+VTG S    LGR W P+S+ +FAYTY+ N I 
Sbjct  260   -AQNIGALTAQGRNSLLEDTGFSFVHCKVTG-SGALYLGRAWGPFSRVVFAYTYMDNIII  317

Query  953   PEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             P+GW     +P    T ++G+Y  TGPGA   GR
Sbjct  318   PKGWYNW-GDPNREMTVFYGQYKCTGPGASYAGR  350



>ref|XP_010094410.1| putative pectinesterase 53 [Morus notabilis]
 gb|EXB55991.1| putative pectinesterase 53 [Morus notabilis]
Length=381

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 167/285 (59%), Gaps = 12/285 (4%)
 Frame = +2

Query  227   VDPALVKAEAAPVYLKVGK--GGQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDF  400
             +D  L KAE   + + V +   G F TI +A+  IP RNT+R II I  G Y E++ I  
Sbjct  69    LDERLKKAEMNKMRIAVSQDGSGDFTTISQALNAIPPRNTRRVIINIKPGVYREKINIPR  128

Query  401   DRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSDYFSAVNIDVRNSAP  559
               PFVTL+GD  + PT+    TA+  G       T  SAT+ V ++YF A+NI   N+AP
Sbjct  129   SMPFVTLFGDADDPPTITGNDTASGTGKNGKPLRTFQSATVAVEANYFVALNIKFENTAP  188

Query  560   RPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAK  739
                G R  QAVA+ I+G KA+FYNC FYG QDTL DH   H++ +C+++G+VDF+FG  +
Sbjct  189   HVVGFRKGQAVAVRISGSKAAFYNCSFYGTQDTLYDHKGLHYFYNCFIQGSVDFIFGYGR  248

Query  740   SIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTI  919
             S +    L      ++A ++A  R +   ++GFSF    VTG+ ++  LGR W  YS+ +
Sbjct  249   SFYEKCYLHST-AKKVAFLTAQKRTTSSLESGFSFKDSVVTGSGQL-YLGRAWGDYSRVV  306

Query  920   FAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
             F+YT++   + P+GW     + K     Y+GEY  +GPGA + GR
Sbjct  307   FSYTFMDKIVLPQGWSDW-GDQKRDSQVYYGEYKCSGPGANLKGR  350



>ref|XP_011040796.1| PREDICTED: probable pectinesterase 53 [Populus euphratica]
Length=399

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 121/299 (40%), Positives = 174/299 (58%), Gaps = 13/299 (4%)
 Frame = +2

Query  188   RASVQ-PLQSGRKGVDPALVKAEAAPVYLKVGKGG--QFKTIQEAVKTIPARNTKRYIIF  358
             +++VQ P   G+  +D  L +AE   V + V + G   FKTI EA  +IP  NT+R II 
Sbjct  56    KSTVQTPGADGKFVLDGKLRQAEMNSVRVTVSQDGTGDFKTITEATNSIPPYNTRRVIIA  115

Query  359   IAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQVG-------TIYSATLYVLSD  517
             I  G Y E++ I    PFVT  GD    PT+    TA+  G       T  SAT+ V ++
Sbjct  116   IKPGVYREKIFIPRTMPFVTFLGDSSEPPTITGNDTASVSGKDGKPLRTYQSATVAVDAN  175

Query  518   YFSAVNIDVRNSAPRPTGKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNRHFYKDC  697
             YF A+++   N+AP   G +  QAVAL I+G KA+FYNC FYG QDTL DH   H++ +C
Sbjct  176   YFVAISMKFENTAPHVIGTKQGQAVALRISGTKAAFYNCSFYGNQDTLYDHKGLHYFNNC  235

Query  698   YVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQVTGNSKV  877
             +++G+VDF+FG+ +S + N  L  I   ++A ++A  R++    +GFSF    +TG S +
Sbjct  236   FIQGSVDFIFGSGRSFYENCHLNSI-AKKVASLTAQKRSNSSLASGFSFKDSTITG-SGL  293

Query  878   AVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGAKMDGR  1054
               LGR W  YS+ IF+YT++   I P+GW     + +     Y+GEY  TGPGA + GR
Sbjct  294   IYLGRAWGDYSRVIFSYTFMDKIILPQGWNDW-GDQRRDSRVYYGEYQCTGPGANLTGR  351



>ref|XP_007152966.1| hypothetical protein PHAVU_004G175200g [Phaseolus vulgaris]
 gb|ESW24960.1| hypothetical protein PHAVU_004G175200g [Phaseolus vulgaris]
Length=381

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 173/305 (57%), Gaps = 16/305 (5%)
 Frame = +2

Query  176   ESWFRASVQPLQSGRKGVDPALVKAEAAPVYLKVGKG---GQFKTIQEAVKTIPARNTKR  346
             E  F   V  + S +  V  A+     A   L V K    G F +IQEA+ ++P  N  R
Sbjct  52    EEQFMKWVNFVGSLKHSVFKAVKNKLVASYTLHVDKDPSVGDFTSIQEAIDSLPFINLVR  111

Query  347   YIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATTAAQ--------VGTIYSATL  502
              +I +  G Y E+V I   + ++T+ GD     T+V  +  AQ        +GT  SAT 
Sbjct  112   VVIKVHAGVYTEKVNIPAFKSYITIEGDGAEE-TIVKWSDTAQTPGSNGRPLGTYGSATF  170

Query  503   YVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKASFYNCKFYGFQDTLCDHNNR  679
              V S YF A NI  +N+ P P  G   +QAVAL I+ D A+F  CKF G QDTL DH  R
Sbjct  171   AVNSPYFIAKNITFQNTTPVPAPGAIGKQAVALRISADTAAFVGCKFLGAQDTLYDHVGR  230

Query  680   HFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSAHGRNSEKEDTGFSFVHCQV  859
             H+YKDCY+EG+VDF+FGN+ S+F    +  I  +  A V+A GR+S  EDTGFSFV+C+V
Sbjct  231   HYYKDCYIEGSVDFIFGNSLSLFEGCHVHAIAQNTGA-VTAQGRSSMLEDTGFSFVNCKV  289

Query  860   TGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTNPKNGGTCYFGEYNNTGPGA  1039
             TG S    LGR W P+S+ +FAYTY+ N I P+GW     +P    T ++G+Y  TG GA
Sbjct  290   TG-SGALYLGRAWGPFSRVVFAYTYMDNIIIPKGWYNW-GDPNREMTVFYGQYKCTGAGA  347

Query  1040  KMDGR  1054
                GR
Sbjct  348   SFAGR  352



>emb|CDY68784.1| BnaCnng60500D, partial [Brassica napus]
Length=294

 Score =   209 bits (532),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 161/265 (61%), Gaps = 13/265 (5%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G F  IQ+A+ ++P  N  R +I +  G Y E+V I   + F+T+ G+  ++ T+V    
Sbjct  5     GDFTKIQDAIDSLPLINLVRVVIKVHAGVYKEKVNIPPMKAFITIEGEGADK-TIVQWGD  63

Query  467   AAQ--------VGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKA  619
              AQ        +GT  SA+  V S +F A NI  +N+ P P  G   +QAVAL ++ D A
Sbjct  64    TAQTHDPRGNPMGTFNSASFAVNSPFFVAKNITFKNTTPVPLPGAVGKQAVALRVSADNA  123

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +F+ CK  G QDTL DH  RH+YKDCY+EG+VDF+FGNA S++    +  I  D++  V+
Sbjct  124   AFFGCKMLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSLYEGCHVHAI-ADKLGAVT  182

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             A GR+S  EDTGFSFV C+VTG + V  LGR W P+S+ +FAYTY+ N I P+GW     
Sbjct  183   AQGRSSVLEDTGFSFVKCKVTG-TGVLYLGRAWGPFSRVVFAYTYMDNIILPKGWYNW-G  240

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGR  1054
             +P    T ++G+Y  TG GA   GR
Sbjct  241   DPSREMTVFYGQYKCTGAGANYAGR  265



>ref|XP_011009863.1| PREDICTED: probable pectinesterase 53 [Populus euphratica]
Length=381

 Score =   211 bits (538),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 159/265 (60%), Gaps = 13/265 (5%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G F TIQEA+ ++P  N  R II I  G Y E+V I   + F+T+ G   +  T+V    
Sbjct  92    GDFTTIQEAIDSLPFINLVRVIIKIRAGVYKEKVNIPPLKSFITIEGAGADN-TIVQWGD  150

Query  467   AAQ--------VGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKA  619
              AQ        +GT  SAT  V S +F A NI  +N+AP P  G   +QAVAL I+ D A
Sbjct  151   TAQTPGARGQPMGTYSSATFAVNSPFFVAKNITFKNTAPLPAPGAMGKQAVALRISADTA  210

Query  620   SFYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVS  799
             +F  CKF G QDTL DH  RH+YKDCY+EG+VDF+FGN  S+F    +  I     A+ +
Sbjct  211   AFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGLSLFEGCHVHAIAQFTGAL-T  269

Query  800   AHGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRT  979
             A GR+S  EDTGFSFV+C+VTG S    LGR W P+S+ +FAYTY+   I P+GW     
Sbjct  270   AQGRSSLLEDTGFSFVNCKVTG-SGALYLGRAWGPFSRVVFAYTYMDGIIIPKGWYNW-G  327

Query  980   NPKNGGTCYFGEYNNTGPGAKMDGR  1054
             +P    T ++G+Y  TGPGA+  GR
Sbjct  328   DPNRELTVFYGQYKCTGPGARFAGR  352



>ref|XP_006353578.1| PREDICTED: probable pectinesterase 53-like [Solanum tuberosum]
Length=376

 Score =   211 bits (537),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 154/264 (58%), Gaps = 11/264 (4%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G F +IQEA+ ++P  N  R +I I  G Y E+V I   + F+T+ G+  +   +    T
Sbjct  87    GDFTSIQEAIDSLPFINLIRVVIKIHAGIYTEKVNISPFKSFITIEGEGADNTIIQYGDT  146

Query  467   AAQVG-------TIYSATLYVLSDYFSAVNIDVRNSAP-RPTGKRDQQAVALTITGDKAS  622
             A  +G       T  SAT  V S YF A NI  +N+ P  P G   +QAVA  I+ D A+
Sbjct  147   AQTIGPNGKPLGTFGSATFAVNSPYFQAKNITFKNTTPVPPPGAIGKQAVAFRISADTAA  206

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
             F  CKF G QDTL DH  RH+YKDCY+EG+VDF+FGN  S F    L  I       V+A
Sbjct  207   FVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSFFEGCHLHAI-AQVTGAVTA  265

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
              GR+S  EDTGFSFV+C+VTG S    LGR W P+S+ IFAYTY+ N I P+GW     +
Sbjct  266   QGRSSMLEDTGFSFVNCKVTG-SGALYLGRAWGPFSRVIFAYTYMDNIIIPKGWHNW-GD  323

Query  983   PKNGGTCYFGEYNNTGPGAKMDGR  1054
             P    T ++G+Y  +GPGA   GR
Sbjct  324   PLREMTVFYGQYKCSGPGASFAGR  347



>ref|XP_004251642.1| PREDICTED: probable pectinesterase 53 [Solanum lycopersicum]
Length=378

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 154/264 (58%), Gaps = 11/264 (4%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G F +IQEA+ ++P  N  R +I I  G Y E+V I   + F+T+ G+  +   +    T
Sbjct  89    GDFTSIQEAIDSLPFINLIRVVIKIHAGIYTEKVNIPPFKSFITIEGEGADNTIIQYGDT  148

Query  467   AAQVG-------TIYSATLYVLSDYFSAVNIDVRNSAP-RPTGKRDQQAVALTITGDKAS  622
             A  +G       T  SAT  V S YF A NI  +N+ P  P G   +QAVA  I+ D A+
Sbjct  149   AQTIGPNGKPLGTFGSATFAVNSPYFQAKNITFKNTTPVPPPGAIGKQAVAFRISADTAA  208

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
             F  CKF G QDTL DH  RH+YKDCY+EG+VDF+FGN  S F    L  I       V+A
Sbjct  209   FVGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLSFFEGCHLHAI-AQVTGAVTA  267

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
              GR+S  EDTGFSFV+C+VTG S    LGR W P+S+ IFAYTY+ N I P+GW     +
Sbjct  268   QGRSSMLEDTGFSFVNCKVTG-SGALYLGRAWGPFSRVIFAYTYMDNIIIPKGWHNW-GD  325

Query  983   PKNGGTCYFGEYNNTGPGAKMDGR  1054
             P    T ++G+Y  +GPGA   GR
Sbjct  326   PLREMTVFYGQYKCSGPGASFAGR  349



>ref|XP_009399936.1| PREDICTED: probable pectinesterase 68 [Musa acuminata subsp. 
malaccensis]
Length=344

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/259 (43%), Positives = 157/259 (61%), Gaps = 10/259 (4%)
 Frame = +2

Query  287   GQFKTIQEAVKTIPARNTKRYIIFIAGGKYNERVKIDFDRPFVTLYGDPKNRPTLVAATT  466
             G F ++QEAV ++P  NTKR II I  G Y E+V +   +P+VT  G  +N   +     
Sbjct  51    GDFLSVQEAVDSVPENNTKRVIIHIHAGCYIEKVVVPATKPYVTFQGAGRNVTVIEWHDR  110

Query  467   AA-------QVGTIYSATLYVLSDYFSAVNIDVRNSAPRPT-GKRDQQAVALTITGDKAS  622
             A+       Q+ T  +A++ V +++FSA NI  +N+AP P  G    QA A  I+GDKA 
Sbjct  111   ASDRGPNGQQLRTYNTASVTVFANHFSAKNISFKNTAPAPMPGMEGWQAAAFRISGDKAY  170

Query  623   FYNCKFYGFQDTLCDHNNRHFYKDCYVEGTVDFVFGNAKSIFLNTQLRVIPGDQMAMVSA  802
             F+ C FYG QDTLCD   RH++KDCY+EG++DF+FGN +S++ + QL  I  ++   V+A
Sbjct  171   FFGCGFYGAQDTLCDDAGRHYFKDCYIEGSIDFIFGNGRSMYKDCQLHSI-ANRFGSVAA  229

Query  803   HGRNSEKEDTGFSFVHCQVTGNSKVAVLGRGWFPYSKTIFAYTYIGNAIKPEGWMGMRTN  982
               RNS  E TGF+FV+C+VTG+ K+ V GR    YS+ +FAYTY  + + P GW     N
Sbjct  230   QDRNSPCERTGFAFVNCRVTGSGKLYV-GRAMGQYSRIVFAYTYFDDVVAPGGWDDWNHN  288

Query  983   PKNGGTCYFGEYNNTGPGA  1039
                  T +FG Y   GPGA
Sbjct  289   SNKNKTAFFGVYRCYGPGA  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2460719396736