BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25881_g1_i2 len=2195 path=[6972:0-621 7594:622-650 17605:651-668
7640:669-2060 9032:2061-2061 2020:2062-2095 17667:2096-2096
17668:2097-2097 9068:2098-2120 9091:2121-2153 16045:2154-2194]

Length=2195
                                                                      Score     E

ref|XP_009797628.1|  PREDICTED: laccase-3-like                          917   0.0      
ref|XP_009599788.1|  PREDICTED: laccase-3-like                          910   0.0      
ref|XP_009790079.1|  PREDICTED: laccase-3-like                          901   0.0      
ref|XP_009616771.1|  PREDICTED: laccase-3-like                          900   0.0      
ref|XP_004242502.1|  PREDICTED: laccase-3-like                          883   0.0      
ref|XP_006350924.1|  PREDICTED: laccase-3-like                          879   0.0      
ref|XP_006350864.1|  PREDICTED: laccase-3-like                          877   0.0      
ref|XP_004242503.1|  PREDICTED: laccase-3-like                          866   0.0      
ref|XP_011080750.1|  PREDICTED: laccase-3-like                          835   0.0      
ref|XP_011080832.1|  PREDICTED: laccase-3-like                          814   0.0      
emb|CDP09253.1|  unnamed protein product                                837   0.0      
emb|CDP09079.1|  unnamed protein product                                801   0.0      
ref|XP_002277722.1|  PREDICTED: laccase-12                              773   0.0      Vitis vinifera
ref|XP_010099447.1|  hypothetical protein L484_011146                   764   0.0      
ref|XP_002516345.1|  laccase, putative                                  751   0.0      Ricinus communis
emb|CBI15873.3|  unnamed protein product                                784   0.0      
ref|XP_010032957.1|  PREDICTED: laccase-13                              750   0.0      
emb|CDP09252.1|  unnamed protein product                                749   0.0      
ref|XP_004294763.1|  PREDICTED: laccase-3-like                          743   0.0      
ref|XP_010521986.1|  PREDICTED: laccase-3                               737   0.0      
ref|XP_007016999.1|  Laccase 3                                          735   0.0      
ref|XP_002319955.1|  laccase family protein                             735   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010685887.1|  PREDICTED: laccase-3-like                          734   0.0      
ref|XP_011021001.1|  PREDICTED: laccase-13-like                         734   0.0      
ref|XP_010542673.1|  PREDICTED: laccase-3-like                          733   0.0      
ref|XP_006425169.1|  hypothetical protein CICLE_v10030322mg             732   0.0      
gb|KDP45752.1|  hypothetical protein JCGZ_17359                         731   0.0      
ref|XP_003615861.1|  Laccase-like multicopper oxidase                   730   0.0      
ref|XP_009141050.1|  PREDICTED: laccase-3                               729   0.0      
ref|XP_006296399.1|  hypothetical protein CARUB_v10025575mg             728   0.0      
ref|XP_002881090.1|  hypothetical protein ARALYDRAFT_481932             727   0.0      
ref|XP_006488594.1|  PREDICTED: laccase-3-like                          727   0.0      
ref|XP_003518325.1|  PREDICTED: laccase-3-like                          726   0.0      
ref|XP_009144319.1|  PREDICTED: laccase-3                               726   0.0      
emb|CDX97838.1|  BnaC04g41010D                                          726   0.0      
ref|NP_180580.1|  laccase 3                                             725   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457861.1|  PREDICTED: laccase-3-like                          725   0.0      
ref|XP_009598627.1|  PREDICTED: laccase-12-like                         724   0.0      
ref|XP_011041833.1|  PREDICTED: laccase-13                              726   0.0      
ref|XP_006596443.1|  PREDICTED: laccase-3-like                          724   0.0      
ref|XP_011014542.1|  PREDICTED: laccase-3-like                          726   0.0      
ref|XP_006303628.1|  hypothetical protein CARUB_v10011512mg             723   0.0      
ref|XP_010264533.1|  PREDICTED: laccase-12                              723   0.0      
ref|XP_006410143.1|  hypothetical protein EUTSA_v10016445mg             722   0.0      
ref|XP_010475452.1|  PREDICTED: laccase-3-like                          722   0.0      
ref|XP_010414291.1|  PREDICTED: laccase-3                               722   0.0      
ref|XP_010486989.1|  PREDICTED: laccase-3-like                          721   0.0      
ref|XP_003537321.1|  PREDICTED: laccase-3-like                          721   0.0      
ref|XP_007142103.1|  hypothetical protein PHAVU_008G252800g             721   0.0      
gb|KFK21959.1|  hypothetical protein AALP_AAs48252U000800               720   0.0      
ref|XP_004490661.1|  PREDICTED: laccase-3-like                          719   0.0      
ref|XP_008232145.1|  PREDICTED: laccase-13                              719   0.0      
gb|KHN02112.1|  Laccase-3                                               719   0.0      
ref|XP_010510393.1|  PREDICTED: laccase-3-like                          719   0.0      
ref|XP_002326089.1|  hypothetical protein POPTR_0019s14530g             719   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004145307.1|  PREDICTED: laccase-3-like                          719   0.0      
ref|XP_009771638.1|  PREDICTED: laccase-12-like                         719   0.0      
ref|XP_010045386.1|  PREDICTED: laccase-3-like                          719   0.0      
ref|XP_002315131.1|  hypothetical protein POPTR_0010s19090g             718   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007206448.1|  hypothetical protein PRUPE_ppa003408mg             718   0.0      
ref|XP_003552931.1|  PREDICTED: laccase-3-like                          717   0.0      
ref|XP_010257021.1|  PREDICTED: laccase-12-like                         717   0.0      
ref|XP_010685889.1|  PREDICTED: laccase-3-like                          716   0.0      
ref|XP_008457330.1|  PREDICTED: laccase-3                               716   0.0      
ref|XP_009611705.1|  PREDICTED: laccase-12-like                         715   0.0      
ref|XP_006435828.1|  hypothetical protein CICLE_v10031070mg             715   0.0      
ref|XP_009354572.1|  PREDICTED: laccase-3-like                          713   0.0      
ref|XP_008384707.1|  PREDICTED: laccase-3-like                          712   0.0      
ref|XP_010685886.1|  PREDICTED: laccase-3-like                          712   0.0      
ref|XP_009763768.1|  PREDICTED: laccase-12-like                         712   0.0      
ref|XP_008354603.1|  PREDICTED: laccase-3-like                          711   0.0      
gb|KHN46117.1|  Laccase-3                                               710   0.0      
gb|KDP44695.1|  hypothetical protein JCGZ_01195                         711   0.0      
ref|XP_009788692.1|  PREDICTED: laccase-12-like                         711   0.0      
ref|XP_008355071.1|  PREDICTED: laccase-3-like                          711   0.0      
ref|XP_010535350.1|  PREDICTED: laccase-13                              711   0.0      
ref|XP_004307691.1|  PREDICTED: laccase-5-like                          711   0.0      
ref|XP_011015318.1|  PREDICTED: laccase-12-like                         711   0.0      
ref|XP_002273875.2|  PREDICTED: laccase-12                              710   0.0      Vitis vinifera
gb|KDO44836.1|  hypothetical protein CISIN_1g008066mg                   709   0.0      
ref|XP_002520797.1|  laccase, putative                                  708   0.0      Ricinus communis
ref|XP_009763769.1|  PREDICTED: laccase-12-like                         707   0.0      
ref|XP_008374344.1|  PREDICTED: laccase-12-like                         707   0.0      
ref|XP_011076646.1|  PREDICTED: laccase-12                              707   0.0      
ref|XP_004307184.1|  PREDICTED: laccase-12-like                         706   0.0      
gb|ABK92474.1|  unknown                                                 705   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002520796.1|  laccase, putative                                  706   0.0      Ricinus communis
ref|XP_007008849.1|  Laccase 12                                         705   0.0      
ref|XP_010452665.1|  PREDICTED: laccase-13-like isoform X1              704   0.0      
ref|XP_009343306.1|  PREDICTED: laccase-3-like                          704   0.0      
ref|XP_009594351.1|  PREDICTED: laccase-12-like                         704   0.0      
ref|XP_010067566.1|  PREDICTED: laccase-5                               704   0.0      
ref|XP_008369303.1|  PREDICTED: laccase-12-like                         704   0.0      
ref|XP_006353418.1|  PREDICTED: laccase-12-like                         704   0.0      
ref|XP_010491316.1|  PREDICTED: laccase-13 isoform X1                   703   0.0      
ref|XP_004240885.1|  PREDICTED: laccase-5-like                          703   0.0      
ref|XP_008363777.1|  PREDICTED: laccase-12-like                         703   0.0      
ref|XP_009343324.1|  PREDICTED: laccase-3-like                          702   0.0      
ref|XP_007218932.1|  hypothetical protein PRUPE_ppa003349mg             702   0.0      
ref|XP_004239961.1|  PREDICTED: laccase-12-like                         702   0.0      
ref|XP_002871251.1|  laccase-13 precursor                               702   0.0      
ref|XP_008233819.1|  PREDICTED: laccase-12-like                         701   0.0      
ref|XP_008363776.1|  PREDICTED: laccase-12-like                         701   0.0      
ref|XP_010692917.1|  PREDICTED: laccase-12                              701   0.0      
ref|XP_006355638.1|  PREDICTED: laccase-12-like                         701   0.0      
gb|EYU43442.1|  hypothetical protein MIMGU_mgv1a003472mg                701   0.0      
ref|XP_002312186.2|  laccase family protein                             701   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004500522.1|  PREDICTED: laccase-12-like                         700   0.0      
ref|XP_009628839.1|  PREDICTED: laccase-12-like isoform X2              700   0.0      
ref|XP_007146836.1|  hypothetical protein PHAVU_006G074000g             700   0.0      
gb|KDP44694.1|  hypothetical protein JCGZ_01194                         700   0.0      
ref|XP_006289181.1|  hypothetical protein CARUB_v10002622mg             699   0.0      
ref|NP_196158.1|  laccase 12                                            698   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355635.1|  PREDICTED: laccase-5-like                          699   0.0      
ref|XP_004307187.1|  PREDICTED: laccase-12-like                         699   0.0      
ref|XP_006487674.1|  PREDICTED: laccase-3-like                          699   0.0      
ref|NP_196330.3|  laccase 13                                            698   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423249.1|  PREDICTED: laccase-13-like isoform X1              698   0.0      
ref|XP_003616702.1|  Laccase                                            697   0.0      
ref|XP_004500523.1|  PREDICTED: laccase-12-like                         697   0.0      
gb|EYU20068.1|  hypothetical protein MIMGU_mgv1a020620mg                696   0.0      
ref|XP_006355742.1|  PREDICTED: laccase-12-like                         697   0.0      
ref|XP_009391695.1|  PREDICTED: laccase-3-like                          697   0.0      
ref|XP_010491317.1|  PREDICTED: laccase-13 isoform X2                   697   0.0      
ref|XP_010031156.1|  PREDICTED: laccase-12-like                         697   0.0      
ref|XP_006431538.1|  hypothetical protein CICLE_v10003240mg             696   0.0      
ref|XP_004239957.1|  PREDICTED: laccase-12-like                         696   0.0      
ref|XP_011004316.1|  PREDICTED: laccase-12-like                         696   0.0      
ref|XP_006355637.1|  PREDICTED: laccase-12-like                         696   0.0      
ref|XP_004239959.1|  PREDICTED: laccase-12                              696   0.0      
ref|XP_011084865.1|  PREDICTED: laccase-12-like                         696   0.0      
ref|XP_009369225.1|  PREDICTED: laccase-5-like                          694   0.0      
ref|XP_002871156.1|  hypothetical protein ARALYDRAFT_487334             695   0.0      
ref|XP_004239958.1|  PREDICTED: laccase-12-like                         694   0.0      
ref|XP_009804480.1|  PREDICTED: laccase-12-like isoform X1              695   0.0      
ref|XP_009122370.1|  PREDICTED: laccase-13 isoform X1                   692   0.0      
ref|XP_010534627.1|  PREDICTED: laccase-5                               692   0.0      
ref|XP_006287390.1|  hypothetical protein CARUB_v10000596mg             692   0.0      
emb|CDX70010.1|  BnaA10g23590D                                          692   0.0      
ref|XP_010491073.1|  PREDICTED: laccase-12-like                         690   0.0      
emb|CDX99004.1|  BnaC09g48310D                                          689   0.0      
ref|XP_003544045.1|  PREDICTED: laccase-5-like                          689   0.0      
ref|XP_009386858.1|  PREDICTED: laccase-3-like                          689   0.0      
ref|XP_010452444.1|  PREDICTED: laccase-12-like                         688   0.0      
ref|XP_006367545.1|  PREDICTED: laccase-5-like                          688   0.0      
gb|KDO50911.1|  hypothetical protein CISIN_1g039963mg                   688   0.0      
gb|KHN04792.1|  Laccase-5                                               688   0.0      
emb|CDX93188.1|  BnaC04g47080D                                          687   0.0      
ref|XP_003519418.1|  PREDICTED: laccase-5-like                          687   0.0      
ref|XP_003538485.1|  PREDICTED: laccase-5-like                          687   0.0      
ref|XP_010423473.1|  PREDICTED: laccase-12                              686   0.0      
ref|XP_008799813.1|  PREDICTED: laccase-3                               687   0.0      
ref|XP_010087027.1|  hypothetical protein L484_012271                   687   0.0      
ref|XP_007163585.1|  hypothetical protein PHAVU_001G246700g             686   0.0      
ref|XP_010543702.1|  PREDICTED: laccase-12                              686   0.0      
ref|XP_006411293.1|  hypothetical protein EUTSA_v10016439mg             686   0.0      
ref|XP_011015306.1|  PREDICTED: laccase-12-like                         686   0.0      
ref|XP_011004433.1|  PREDICTED: laccase-12-like                         685   0.0      
ref|XP_010922645.1|  PREDICTED: laccase-3-like                          685   0.0      
emb|CDP13965.1|  unnamed protein product                                684   0.0      
ref|XP_006399003.1|  hypothetical protein EUTSA_v10015589mg             684   0.0      
ref|XP_004241090.2|  PREDICTED: laccase-12-like isoform X1              684   0.0      
ref|NP_181568.1|  laccase 5                                             684   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792257.1|  PREDICTED: laccase-3-like                          684   0.0      
ref|XP_009141888.1|  PREDICTED: laccase-5-like                          683   0.0      
ref|XP_002315130.1|  hypothetical protein POPTR_0010s19080g             684   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_001044679.1|  Os01g0827300                                       682   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDX70152.1|  BnaA10g25010D                                          682   0.0      
ref|XP_006644937.1|  PREDICTED: laccase-3-like                          681   0.0      
ref|XP_006828131.1|  hypothetical protein AMTR_s00023p00051360          682   0.0      
ref|XP_007141728.1|  hypothetical protein PHAVU_008G220300g             682   0.0      
ref|NP_001236616.1|  diphenol oxidase laccase precursor                 681   0.0      
ref|XP_002881718.1|  hypothetical protein ARALYDRAFT_903327             681   0.0      
ref|XP_009125599.1|  PREDICTED: laccase-12                              680   0.0      
emb|CDX98841.1|  BnaC09g49940D                                          680   0.0      
emb|CDY04949.1|  BnaAnng01310D                                          680   0.0      
ref|XP_004491004.1|  PREDICTED: laccase-5-like                          680   0.0      
ref|XP_006293898.1|  hypothetical protein CARUB_v10022891mg             680   0.0      
ref|XP_010508873.1|  PREDICTED: laccase-5-like                          678   0.0      
emb|CDY52925.1|  BnaA04g29320D                                          678   0.0      
ref|XP_009122149.1|  PREDICTED: laccase-12                              677   0.0      
emb|CDY14115.1|  BnaC02g02320D                                          676   0.0      
ref|XP_009343323.1|  PREDICTED: laccase-3-like                          676   0.0      
ref|XP_008343632.1|  PREDICTED: laccase-12-like                         676   0.0      
ref|XP_009407324.1|  PREDICTED: laccase-3-like                          674   0.0      
emb|CAN75316.1|  hypothetical protein VITISV_024159                     674   0.0      Vitis vinifera
emb|CDX74795.1|  BnaA05g05410D                                          674   0.0      
ref|XP_009143220.1|  PREDICTED: laccase-5                               674   0.0      
gb|EPS73068.1|  hypothetical protein M569_01687                         673   0.0      
gb|KFK36912.1|  hypothetical protein AALP_AA4G189000                    674   0.0      
ref|XP_002456566.1|  hypothetical protein SORBIDRAFT_03g038550          673   0.0      Sorghum bicolor [broomcorn]
ref|XP_010921047.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-3-like     673   0.0      
gb|KGN65840.1|  hypothetical protein Csa_1G533470                       671   0.0      
ref|XP_010517456.1|  PREDICTED: laccase-5-like                          672   0.0      
emb|CAA74104.1|  laccase                                                672   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010505765.1|  PREDICTED: laccase-5                               672   0.0      
ref|XP_010931307.1|  PREDICTED: laccase-3-like                          671   0.0      
gb|KHN40112.1|  Laccase-3                                               667   0.0      
emb|CDM84828.1|  unnamed protein product                                669   0.0      
ref|XP_008804167.1|  PREDICTED: laccase-3-like                          669   0.0      
ref|XP_004970425.1|  PREDICTED: laccase-3-like                          666   0.0      
gb|EMT06365.1|  Laccase-3                                               665   0.0      
ref|XP_003564513.1|  PREDICTED: laccase-3                               665   0.0      
gb|EEC71732.1|  hypothetical protein OsI_04280                          666   0.0      Oryza sativa Indica Group [Indian rice]
tpg|DAA57028.1|  TPA: putative laccase family protein                   665   0.0      
ref|NP_001148479.1|  L-ascorbate oxidase precursor                      665   0.0      Zea mays [maize]
emb|CDY18869.1|  BnaC04g04810D                                          664   0.0      
ref|NP_001183899.1|  putative laccase family protein precursor          662   0.0      
ref|XP_003600994.1|  Laccase                                            662   0.0      
ref|XP_008441484.1|  PREDICTED: laccase-12                              662   0.0      
ref|XP_009417976.1|  PREDICTED: laccase-3-like                          661   0.0      
ref|XP_008359050.1|  PREDICTED: laccase-3-like                          660   0.0      
ref|XP_010322117.1|  PREDICTED: laccase-12-like isoform X2              659   0.0      
emb|CDY10719.1|  BnaA05g12170D                                          657   0.0      
ref|XP_004138412.1|  PREDICTED: laccase-12-like                         658   0.0      
ref|XP_010424027.1|  PREDICTED: laccase-3-like                          655   0.0      
gb|AFV52377.1|  laccase                                                 654   0.0      
gb|AFV52378.1|  laccase                                                 653   0.0      
gb|KFK25107.1|  hypothetical protein AALP_AA8G066900                    671   0.0      
gb|AFV52382.1|  laccase                                                 649   0.0      
ref|XP_004978572.1|  PREDICTED: putative laccase-17-like                647   0.0      
ref|XP_002312187.2|  hypothetical protein POPTR_0008s07380g             644   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003558123.1|  PREDICTED: laccase-3                               646   0.0      
ref|XP_002448873.1|  hypothetical protein SORBIDRAFT_05g000680          645   0.0      Sorghum bicolor [broomcorn]
gb|AFV52384.1|  laccase                                                 642   0.0      
gb|AAK37826.1|AF132122_1  laccase                                       642   0.0      Pinus taeda
gb|AFV52383.1|  laccase                                                 641   0.0      
ref|XP_004977611.1|  PREDICTED: laccase-23-like                         642   0.0      
gb|ABR17539.1|  unknown                                                 639   0.0      Picea sitchensis
gb|EMS46935.1|  Laccase-3                                               640   0.0      
ref|XP_003579045.1|  PREDICTED: laccase-23-like                         637   0.0      
ref|XP_010452666.1|  PREDICTED: laccase-13-like isoform X2              632   0.0      
ref|XP_002468016.1|  hypothetical protein SORBIDRAFT_01g038130          637   0.0      Sorghum bicolor [broomcorn]
ref|NP_001145891.1|  putative laccase family protein precursor          637   0.0      Zea mays [maize]
emb|CBW38080.1|  laccase-like multicopper oxidase                       635   0.0      
gb|KHG22243.1|  Laccase-5 -like protein                                 630   0.0      
gb|EMT02387.1|  hypothetical protein F775_52333                         632   0.0      
gb|KHG11797.1|  Laccase-12 -like protein                                628   0.0      
ref|XP_009628838.1|  PREDICTED: laccase-12-like isoform X1              632   0.0      
ref|NP_001065948.1|  Os12g0108000                                       630   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010423250.1|  PREDICTED: laccase-13-like isoform X2              626   0.0      
gb|AAK37824.1|AF132120_1  laccase                                       629   0.0      Pinus taeda
gb|AET79245.1|  multicopper oxidase                                     626   0.0      
ref|XP_008679334.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-23-like    632   0.0      
ref|XP_009122371.1|  PREDICTED: laccase-13 isoform X2                   624   0.0      
gb|EMS57222.1|  Laccase-23                                              627   0.0      
sp|Q2RBK2.1|LAC17_ORYSJ  RecName: Full=Putative laccase-17; AltNa...    627   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KHN48594.1|  Laccase-5                                               620   0.0      
gb|KHN38548.1|  Laccase-5                                               619   0.0      
gb|EMT01053.1|  Laccase-3                                               622   0.0      
gb|EMT30315.1|  Laccase-3                                               618   0.0      
gb|ABR17528.1|  unknown                                                 618   0.0      Picea sitchensis
gb|KHN31314.1|  Laccase-5                                               614   0.0      
gb|AES71245.2|  laccase/diphenol oxidase family protein                 612   0.0      
gb|KGN45808.1|  hypothetical protein Csa_6G012820                       610   0.0      
gb|ACN27868.1|  unknown                                                 606   0.0      Zea mays [maize]
ref|NP_001065548.2|  Os11g0108700                                       603   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFV52380.1|  laccase                                                 603   0.0      
gb|AFV52381.1|  laccase                                                 603   0.0      
gb|ACN40347.1|  unknown                                                 602   0.0      Picea sitchensis
gb|AFV52379.1|  laccase                                                 602   0.0      
gb|AFW64582.1|  putative laccase family protein                         601   0.0      
emb|CBL95260.1|  laccase                                                599   0.0      
gb|KDO67041.1|  hypothetical protein CISIN_1g013075mg                   587   0.0      
gb|KFK43018.1|  hypothetical protein AALP_AA1G068300                    590   0.0      
ref|XP_004240153.1|  PREDICTED: laccase-7-like                          570   0.0      
ref|XP_006480933.1|  PREDICTED: laccase-7-like                          568   0.0      
ref|XP_006429258.1|  hypothetical protein CICLE_v10011375mg             568   0.0      
gb|KDO58025.1|  hypothetical protein CISIN_1g008351mg                   564   0.0      
ref|XP_006342285.1|  PREDICTED: laccase-7-like                          564   0.0      
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          563   0.0      
ref|XP_010678347.1|  PREDICTED: laccase-7                               562   0.0      
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          561   0.0      
ref|XP_002276415.1|  PREDICTED: laccase-7                               560   0.0      Vitis vinifera
ref|XP_010262708.1|  PREDICTED: laccase-7-like                          560   0.0      
gb|KDP24517.1|  hypothetical protein JCGZ_25081                         558   0.0      
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          558   0.0      
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         557   0.0      
ref|XP_009629941.1|  PREDICTED: laccase-7-like                          557   0.0      
ref|XP_010037756.1|  PREDICTED: laccase-7                               556   0.0      
ref|XP_010037755.1|  PREDICTED: laccase-7-like                          556   0.0      
gb|AIS22739.1|  laccase 7                                               555   0.0      
ref|XP_009787131.1|  PREDICTED: laccase-7-like                          555   0.0      
ref|XP_002991629.1|  hypothetical protein SELMODRAFT_133734             554   0.0      
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          554   0.0      
gb|KDO58019.1|  hypothetical protein CISIN_1g008366mg                   553   0.0      
ref|XP_002971503.1|  hypothetical protein SELMODRAFT_95740              552   0.0      
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   552   0.0      
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          552   0.0      
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   552   0.0      
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         551   0.0      
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             551   0.0      
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              551   0.0      
ref|XP_002308196.1|  laccase family protein                             550   0.0      
ref|XP_010256735.1|  PREDICTED: laccase-7-like                          549   0.0      
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      550   0.0      
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         549   0.0      
ref|XP_011095211.1|  PREDICTED: laccase-7                               549   0.0      
ref|XP_004302678.1|  PREDICTED: laccase-7-like                          548   0.0      
ref|XP_006357975.1|  PREDICTED: laccase-7-like                          548   0.0      
emb|CDP06537.1|  unnamed protein product                                547   0.0      
gb|KDO58020.1|  hypothetical protein CISIN_1g008422mg                   547   0.0      
ref|XP_002299682.1|  laccase family protein                             547   0.0      
ref|XP_006429253.1|  hypothetical protein CICLE_v10011377mg             547   0.0      
ref|XP_006480930.1|  PREDICTED: laccase-7-like                          546   0.0      
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         547   0.0      
ref|XP_002265344.1|  PREDICTED: laccase-14                              545   0.0      
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 546   0.0      
ref|XP_007026975.1|  Laccase 17                                         546   0.0      
ref|XP_006429254.1|  hypothetical protein CICLE_v10011384mg             545   0.0      
ref|XP_008239920.1|  PREDICTED: laccase-7                               545   0.0      
ref|XP_004305159.1|  PREDICTED: laccase-7-like                          545   0.0      
gb|EEC71780.1|  hypothetical protein OsI_04394                          546   0.0      
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             546   0.0      
ref|XP_010683867.1|  PREDICTED: laccase-17-like                         545   0.0      
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         545   0.0      
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              545   0.0      
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              545   0.0      
ref|XP_011019185.1|  PREDICTED: laccase-7                               544   0.0      
gb|KHF97742.1|  Laccase-17 -like protein                                544   0.0      
ref|XP_010106521.1|  hypothetical protein L484_025281                   544   0.0      
ref|NP_001233816.1|  laccase precursor                                  543   0.0      
ref|NP_001044773.1|  Os01g0842500                                       543   0.0      
ref|XP_009407501.1|  PREDICTED: laccase-4-like                          543   0.0      
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         541   0.0      
gb|KHN36103.1|  Laccase-11                                              541   0.0      
ref|XP_010107320.1|  hypothetical protein L484_009454                   542   0.0      
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          541   0.0      
ref|XP_011012658.1|  PREDICTED: laccase-14                              541   0.0      
ref|XP_006373964.1|  hypothetical protein POPTR_0016s11540g             540   0.0      
ref|XP_008787257.1|  PREDICTED: laccase-21-like                         540   2e-180   
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         540   2e-180   
ref|XP_009358813.1|  PREDICTED: laccase-7-like                          539   2e-180   
ref|XP_002531562.1|  laccase, putative                                  540   3e-180   
ref|XP_002962354.1|  hypothetical protein SELMODRAFT_404075             539   4e-180   
ref|XP_007026973.1|  Laccase 17                                         538   8e-180   
emb|CDM84967.1|  unnamed protein product                                538   8e-180   
ref|XP_010937050.1|  PREDICTED: putative laccase-9                      538   1e-179   
gb|AAK37830.1|AF132126_1  laccase                                       537   2e-179   
ref|XP_002962923.1|  hypothetical protein SELMODRAFT_78404              538   2e-179   
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270          537   2e-179   
ref|XP_009764219.1|  PREDICTED: laccase-11-like                         536   3e-179   
ref|XP_007016364.1|  Laccase 2                                          537   3e-179   
gb|KCW71481.1|  hypothetical protein EUGRSUZ_E00040                     535   4e-179   
ref|XP_002520232.1|  laccase, putative                                  536   4e-179   
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             536   4e-179   
ref|XP_004984718.1|  PREDICTED: laccase-10-like                         536   5e-179   
gb|AES94995.2|  laccase/diphenol oxidase family protein                 536   5e-179   
ref|NP_001044772.1|  Os01g0842400                                       536   5e-179   
emb|CBI30455.3|  unnamed protein product                                535   6e-179   
ref|XP_010054994.1|  PREDICTED: laccase-6                               536   6e-179   
gb|EAZ14115.1|  hypothetical protein OsJ_04039                          536   6e-179   
ref|XP_007150345.1|  hypothetical protein PHAVU_005G145800g             536   6e-179   
dbj|BAJ99773.1|  predicted protein                                      535   1e-178   
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                535   1e-178   
ref|XP_007132049.1|  hypothetical protein PHAVU_011G062600g             536   1e-178   
emb|CDP09087.1|  unnamed protein product                                535   2e-178   
gb|EEC71777.1|  hypothetical protein OsI_04389                          535   2e-178   
ref|XP_007026974.1|  Laccase 17                                         535   2e-178   
ref|XP_011008003.1|  PREDICTED: laccase-7-like                          534   2e-178   
ref|XP_002519529.1|  laccase, putative                                  534   2e-178   
ref|XP_008784581.1|  PREDICTED: laccase-21-like                         534   3e-178   
ref|XP_011004932.1|  PREDICTED: laccase-7-like                          534   3e-178   
ref|XP_004512055.1|  PREDICTED: laccase-11-like                         533   3e-178   
ref|XP_009590676.1|  PREDICTED: laccase-11-like                         533   3e-178   
ref|XP_010414434.1|  PREDICTED: laccase-2 isoform X1                    534   4e-178   
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          534   5e-178   
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         534   5e-178   
ref|XP_009760909.1|  PREDICTED: laccase-7-like                          533   5e-178   
ref|XP_009416152.1|  PREDICTED: laccase-4-like                          533   5e-178   
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          533   6e-178   
ref|XP_007227301.1|  hypothetical protein PRUPE_ppa016865mg             533   6e-178   
ref|XP_010414436.1|  PREDICTED: laccase-2 isoform X3                    534   7e-178   
ref|XP_007205006.1|  hypothetical protein PRUPE_ppa003587mg             532   8e-178   
emb|CAN75876.1|  hypothetical protein VITISV_029713                     533   9e-178   
ref|XP_003568310.1|  PREDICTED: laccase-12/13-like                      533   1e-177   
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             533   1e-177   
gb|AAC04576.1|  putative high-pI laccase                                532   1e-177   
emb|CBI40575.3|  unnamed protein product                                532   1e-177   
ref|XP_008785569.1|  PREDICTED: laccase-17-like                         532   2e-177   
gb|ABW81073.1|  unknown                                                 531   2e-177   
ref|XP_002322939.2|  hypothetical protein POPTR_0016s11520g             532   2e-177   
ref|XP_003564593.1|  PREDICTED: laccase-12/13-like                      532   2e-177   
emb|CBI30529.3|  unnamed protein product                                532   2e-177   
ref|XP_004961859.1|  PREDICTED: laccase-12/13-like                      532   2e-177   
ref|XP_011013481.1|  PREDICTED: laccase-7-like                          531   2e-177   
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             531   2e-177   
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          532   2e-177   
ref|XP_004292037.1|  PREDICTED: laccase-11-like                         531   3e-177   
gb|KHN14004.1|  Laccase-17                                              531   3e-177   
ref|XP_011005032.1|  PREDICTED: laccase-7-like                          531   3e-177   
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg             531   3e-177   
ref|XP_002264410.2|  PREDICTED: laccase-6                               533   3e-177   
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             531   4e-177   
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         531   4e-177   
ref|XP_003532290.1|  PREDICTED: laccase-17-like isoform X1              531   4e-177   
gb|AGR33431.1|  laccase                                                 531   4e-177   
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg             531   4e-177   
ref|XP_011013044.1|  PREDICTED: laccase-7-like                          531   4e-177   
ref|XP_010937049.1|  PREDICTED: putative laccase-9                      531   4e-177   
ref|NP_180477.1|  laccase 2                                             531   5e-177   
gb|EMT20803.1|  Laccase-4                                               531   5e-177   
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         531   7e-177   
gb|ACN39933.1|  unknown                                                 530   7e-177   
ref|XP_006373961.1|  hypothetical protein POPTR_0016s11500g             530   8e-177   
ref|XP_010667935.1|  PREDICTED: laccase-15-like                         530   8e-177   
ref|XP_002307537.2|  hypothetical protein POPTR_0005s22240g             530   9e-177   
ref|XP_004241217.1|  PREDICTED: laccase-2-like                          530   9e-177   
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   530   9e-177   
ref|XP_008339252.1|  PREDICTED: laccase-14                              530   9e-177   
ref|XP_006341009.1|  PREDICTED: laccase-17-like                         530   9e-177   
ref|XP_006370270.1|  hypothetical protein POPTR_0001s41160g             530   1e-176   
ref|XP_002310245.1|  hypothetical protein POPTR_0007s13050g             530   1e-176   
dbj|BAJ84890.1|  predicted protein                                      530   1e-176   
ref|XP_004289138.1|  PREDICTED: laccase-11-like                         530   1e-176   
ref|XP_003612037.1|  Laccase-11                                         530   1e-176   
ref|XP_002512915.1|  laccase, putative                                  529   1e-176   
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         530   1e-176   
ref|NP_001055747.1|  Os05g0458600                                       530   1e-176   
ref|XP_009804481.1|  PREDICTED: laccase-5-like isoform X2               527   2e-176   
ref|XP_003529131.1|  PREDICTED: laccase-7-like                          530   2e-176   
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             530   2e-176   
ref|XP_002308209.2|  laccase family protein                             529   2e-176   
ref|XP_008218979.1|  PREDICTED: laccase-14                              529   2e-176   
emb|CDP01152.1|  unnamed protein product                                529   2e-176   
ref|XP_011094888.1|  PREDICTED: laccase-17-like                         530   2e-176   
ref|XP_002531565.1|  laccase, putative                                  529   2e-176   
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             529   2e-176   
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                529   2e-176   
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         529   2e-176   
gb|KHN07178.1|  Laccase-17                                              528   3e-176   
ref|XP_010557244.1|  PREDICTED: laccase-2-like                          529   3e-176   
ref|XP_004233973.1|  PREDICTED: laccase-11                              528   3e-176   
ref|XP_011087840.1|  PREDICTED: laccase-14                              529   3e-176   
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   528   3e-176   
emb|CDY02043.1|  BnaC04g14580D                                          526   3e-176   
ref|XP_002531824.1|  laccase, putative                                  529   3e-176   
ref|XP_010919279.1|  PREDICTED: laccase-6-like                          529   4e-176   
ref|XP_006293883.1|  hypothetical protein CARUB_v10022868mg             529   4e-176   
ref|XP_011089492.1|  PREDICTED: laccase-17                              529   4e-176   
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         529   5e-176   
gb|ABW81166.1|  unknown                                                 528   5e-176   
gb|KHN40291.1|  Laccase-17                                              528   5e-176   
ref|NP_001105874.1|  putative laccase precursor                         528   6e-176   
ref|XP_009378520.1|  PREDICTED: laccase-11-like                         528   7e-176   
ref|XP_009340732.1|  PREDICTED: laccase-11-like                         527   7e-176   
ref|XP_004246356.1|  PREDICTED: laccase-17-like                         528   8e-176   
ref|XP_010107530.1|  hypothetical protein L484_024383                   527   1e-175   
ref|XP_010092993.1|  hypothetical protein L484_007174                   528   1e-175   
gb|EYU24320.1|  hypothetical protein MIMGU_mgv1a021399mg                527   1e-175   
ref|XP_004294236.1|  PREDICTED: laccase-4-like                          527   1e-175   
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         528   1e-175   
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          526   1e-175   
ref|XP_008236999.1|  PREDICTED: laccase-11-like                         526   2e-175   
gb|KCW49490.1|  hypothetical protein EUGRSUZ_K03009                     526   2e-175   
ref|XP_002299296.1|  laccase family protein                             527   2e-175   
ref|XP_002881031.1|  hypothetical protein ARALYDRAFT_901874             527   2e-175   
dbj|BAJ96691.1|  predicted protein                                      527   2e-175   
ref|XP_002465485.1|  hypothetical protein SORBIDRAFT_01g039690          527   2e-175   
ref|XP_007208016.1|  hypothetical protein PRUPE_ppa003296mg             527   2e-175   
ref|XP_009354529.1|  PREDICTED: laccase-17-like                         527   2e-175   
gb|AES63403.2|  laccase/diphenol oxidase family protein                 527   2e-175   
ref|XP_006347000.1|  PREDICTED: laccase-11-like                         526   2e-175   
ref|XP_006592190.1|  PREDICTED: laccase-2-like isoform X2               527   2e-175   
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          526   2e-175   
ref|XP_004300985.1|  PREDICTED: laccase-11-like                         526   2e-175   
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         526   3e-175   
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   526   3e-175   
ref|XP_006363101.1|  PREDICTED: laccase-17-like                         526   3e-175   
dbj|BAN10308.1|  laccase                                                526   3e-175   
ref|XP_010654259.1|  PREDICTED: laccase-2-like                          526   3e-175   
ref|XP_006592189.1|  PREDICTED: laccase-2-like isoform X1               527   3e-175   
ref|XP_006429120.1|  hypothetical protein CICLE_v10011363mg             526   3e-175   
ref|XP_003562893.1|  PREDICTED: laccase-4-like                          526   3e-175   
ref|XP_002527888.1|  laccase, putative                                  525   3e-175   
ref|XP_009392410.1|  PREDICTED: laccase-11                              526   3e-175   
ref|XP_004961862.1|  PREDICTED: putative laccase-11-like                526   3e-175   
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g             526   3e-175   
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         525   4e-175   
gb|KDO51175.1|  hypothetical protein CISIN_1g008090mg                   526   4e-175   
gb|AFW64473.1|  putative laccase family protein                         526   4e-175   
gb|AES98533.2|  laccase/diphenol oxidase family protein                 525   4e-175   
ref|NP_001105915.1|  putative laccase precursor                         526   4e-175   
ref|XP_006480879.1|  PREDICTED: laccase-17-like                         526   4e-175   
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          525   4e-175   
ref|XP_010906603.1|  PREDICTED: laccase-17-like                         526   4e-175   
gb|KEH22909.1|  laccase/diphenol oxidase family protein                 526   5e-175   
ref|XP_011099634.1|  PREDICTED: laccase-11-like                         525   5e-175   
ref|XP_011044810.1|  PREDICTED: laccase-15-like isoform X2              525   6e-175   
ref|XP_009593898.1|  PREDICTED: laccase-11-like                         525   6e-175   
ref|XP_009370245.1|  PREDICTED: laccase-7-like                          525   6e-175   
ref|XP_010490794.1|  PREDICTED: laccase-11-like                         525   6e-175   
ref|XP_006848034.1|  hypothetical protein AMTR_s00029p00185120          525   6e-175   
ref|XP_002305436.1|  hypothetical protein POPTR_0004s16370g             524   6e-175   
gb|KDP35658.1|  hypothetical protein JCGZ_09096                         525   7e-175   
ref|XP_004160985.1|  PREDICTED: laccase-11-like                         525   7e-175   
ref|XP_009400979.1|  PREDICTED: laccase-6                               525   7e-175   
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         525   7e-175   
ref|XP_004146556.1|  PREDICTED: laccase-11-like                         525   7e-175   
emb|CDM80721.1|  unnamed protein product                                525   9e-175   



>ref|XP_009797628.1| PREDICTED: laccase-3-like [Nicotiana sylvestris]
Length=570

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/568 (85%), Positives = 517/568 (91%), Gaps = 0/568 (0%)
 Frame = -3

Query  2151  TSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGP  1972
             TS        LA   V+L++L S ANAD++  EF VQET+ITRLCKTK IITVNGQFPGP
Sbjct  3     TSKKALFKVLLATTVVILSLLFSFANADIHQHEFSVQETRITRLCKTKNIITVNGQFPGP  62

Query  1971  TIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKI  1792
             T+ VRNGD +VV+VVNRARYNVTIHWHG+RQMRTPWADGPEYVTQCPI PGG YTYRF I
Sbjct  63    TLTVRNGDKLVVRVVNRARYNVTIHWHGIRQMRTPWADGPEYVTQCPIKPGGVYTYRFTI  122

Query  1791  ENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQR  1612
             E+QEGTLWWHAHSRWLRATVYGA +I PK GSHFPFSQPKKDIPILLGEWWN+DII +QR
Sbjct  123   EDQEGTLWWHAHSRWLRATVYGALVILPKQGSHFPFSQPKKDIPILLGEWWNKDIIVIQR  182

Query  1611  QTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSV  1432
             QTQFTGAAPNIS+AYTINGQPGDLYRCSSQDT+KF V+PGET+LLRVINAALNQQLFFSV
Sbjct  183   QTQFTGAAPNISDAYTINGQPGDLYRCSSQDTLKFLVNPGETILLRVINAALNQQLFFSV  242

Query  1431  ANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFD  1252
             ANHKL VVGADAAYNKPFTTN+IMVGPGQTTNV+LTADQPPARYYMAARAYA+AQNAPFD
Sbjct  243   ANHKLIVVGADAAYNKPFTTNIIMVGPGQTTNVILTADQPPARYYMAARAYASAQNAPFD  302

Query  1251  NTTTTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESL  1072
             NTTTTAVLEYTNLR GANSRPL+PQ P FNDT   T+FT+Q+RS+P NN  V NQ +E+L
Sbjct  303   NTTTTAVLEYTNLRSGANSRPLLPQFPAFNDTNAVTSFTSQMRSIPKNNIKVPNQINENL  362

Query  1071  FFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPP  892
             FFTVGLGLV+CTPGPRCQGPNNTRFAASMNNVSFV PRRTSLLQAYY NIPGIYTLDFPP
Sbjct  363   FFTVGLGLVSCTPGPRCQGPNNTRFAASMNNVSFVFPRRTSLLQAYYQNIPGIYTLDFPP  422

Query  891   VPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWV  712
             VPPV+FDYTGNVSR L QP  GTKLYKIK+GS VQ+VLQDTAIF+ EDHPIHLHGYHFWV
Sbjct  423   VPPVKFDYTGNVSRVLRQPGFGTKLYKIKFGSNVQIVLQDTAIFSVEDHPIHLHGYHFWV  482

Query  711   VGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAW  532
             VGQGFGNFNPQTDTAKFNL DPPVRNTIDVPVGGWAVIRF ADNPGVWL HCHIDSHLAW
Sbjct  483   VGQGFGNFNPQTDTAKFNLNDPPVRNTIDVPVGGWAVIRFVADNPGVWLFHCHIDSHLAW  542

Query  531   GLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GLAM+FIVENG+GEKQT+EPPP DLP+C
Sbjct  543   GLAMSFIVENGKGEKQTMEPPPPDLPQC  570



>ref|XP_009599788.1| PREDICTED: laccase-3-like [Nicotiana tomentosiformis]
Length=570

 Score =   910 bits (2353),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/568 (83%), Positives = 513/568 (90%), Gaps = 0/568 (0%)
 Frame = -3

Query  2151  TSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGP  1972
             TS         A + V+L++L   ANAD++  EF VQET+ITRLCKTK IITVNGQFPGP
Sbjct  3     TSKKALFKVLFATIVVILSLLPPTANADIHQHEFAVQETRITRLCKTKNIITVNGQFPGP  62

Query  1971  TIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKI  1792
             T+ VRNGD +VV+V NRARYNVTIHWHG+RQMRTPWADGPEYVTQCPI PGG YTYRF I
Sbjct  63    TLTVRNGDKLVVRVANRARYNVTIHWHGIRQMRTPWADGPEYVTQCPIKPGGVYTYRFTI  122

Query  1791  ENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQR  1612
             E+QEGTLWWHAHSRWLRATVYGA +I PK GSHFPFSQPKKDIPI+LGEWWN+DIIALQR
Sbjct  123   EDQEGTLWWHAHSRWLRATVYGALVILPKQGSHFPFSQPKKDIPIILGEWWNKDIIALQR  182

Query  1611  QTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSV  1432
             QTQFTGAAPNIS+AYTINGQPGDLYRCSSQDT+K  V+PGET+LLRVINAALNQQLFFSV
Sbjct  183   QTQFTGAAPNISDAYTINGQPGDLYRCSSQDTLKLLVNPGETILLRVINAALNQQLFFSV  242

Query  1431  ANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFD  1252
             ANHKL VVGADAAYNKPFTTNVIMVGPGQTTNV+L  DQPPARYYMAARAYA+AQNAPFD
Sbjct  243   ANHKLIVVGADAAYNKPFTTNVIMVGPGQTTNVILATDQPPARYYMAARAYASAQNAPFD  302

Query  1251  NTTTTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESL  1072
             NTTTTA+LEYTNLR GANSRPL+PQLP FNDT   T+FT+Q+RS+P NN  V NQ DE+L
Sbjct  303   NTTTTAILEYTNLRSGANSRPLLPQLPAFNDTNIVTSFTSQMRSIPKNNIRVPNQIDENL  362

Query  1071  FFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPP  892
             FFTVGLG+V+CTPGPRCQGPNNTRFAASMNNVSFV PRRTSLLQAYY NIPGIYTLDFPP
Sbjct  363   FFTVGLGMVSCTPGPRCQGPNNTRFAASMNNVSFVFPRRTSLLQAYYQNIPGIYTLDFPP  422

Query  891   VPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWV  712
             VPPV+FDYTGNVSR L QP  GTKLYKIK+GS VQ+VLQDTAIF+ EDHPIHLHGYHFWV
Sbjct  423   VPPVKFDYTGNVSRGLRQPGFGTKLYKIKFGSNVQIVLQDTAIFSVEDHPIHLHGYHFWV  482

Query  711   VGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAW  532
             VGQGFGNFNPQTDT+KFNL DPPVRNTIDVPVGGWAVIRF ADNPGVWL HCHIDSHLAW
Sbjct  483   VGQGFGNFNPQTDTSKFNLDDPPVRNTIDVPVGGWAVIRFVADNPGVWLFHCHIDSHLAW  542

Query  531   GLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GL M+FIVENG+GEKQT+EPPP DLP+C
Sbjct  543   GLGMSFIVENGKGEKQTMEPPPPDLPQC  570



>ref|XP_009790079.1| PREDICTED: laccase-3-like [Nicotiana sylvestris]
Length=575

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/564 (84%), Positives = 509/564 (90%), Gaps = 0/564 (0%)
 Frame = -3

Query  2139  PFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAv  1960
             P  NG LA +  +L++L S ANA+ +  EF+VQET+ITRLC+TK IITVNGQFPGPT+ V
Sbjct  12    PLFNGLLATIIAILSLLPSFANAEFHYHEFIVQETRITRLCRTKNIITVNGQFPGPTLTV  71

Query  1959  rngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQE  1780
             RNGD + V VVNRARYNVTIHWHG+RQMRTPWADGPEYVTQCPI PGG YTYRF IENQE
Sbjct  72    RNGDTLFVTVVNRARYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGFYTYRFTIENQE  131

Query  1779  GTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQF  1600
             GTLWWHAHS+WLRATVYGA +I PK GS+FPF QP+KDIPILLGEWWNRDIIA+QRQ QF
Sbjct  132   GTLWWHAHSKWLRATVYGALVILPKQGSNFPFLQPQKDIPILLGEWWNRDIIAVQRQAQF  191

Query  1599  TGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHK  1420
             TGAAPN S+AYTINGQPGDLYRCSSQ TVK SV+PGETVLLRVINAALNQQLFFSVANH 
Sbjct  192   TGAAPNNSDAYTINGQPGDLYRCSSQGTVKVSVNPGETVLLRVINAALNQQLFFSVANHM  251

Query  1419  LQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTT  1240
             L VVG DA YNKPFTTNVIMVGPGQTTNV+LTA++PP RYYMAA AYATA+NA FDNTTT
Sbjct  252   LTVVGVDATYNKPFTTNVIMVGPGQTTNVILTANRPPGRYYMAASAYATARNAQFDNTTT  311

Query  1239  TAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             TA+LEYTNL   ANSRP +PQLP FNDTATATAFT+QLRS+PSNN  V NQ DE+LFFTV
Sbjct  312   TAILEYTNLVSVANSRPSLPQLPAFNDTATATAFTSQLRSIPSNNVRVPNQIDENLFFTV  371

Query  1059  GLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPV  880
             GLGLVNC PGPRCQGPNNTRFAASMNN+SFVLPRRTSLLQAYY NIPGIYTLDFPPVPPV
Sbjct  372   GLGLVNCAPGPRCQGPNNTRFAASMNNISFVLPRRTSLLQAYYQNIPGIYTLDFPPVPPV  431

Query  879   QFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQG  700
             QFDYTGNVSR LWQP  GTKL+KIK+GS VQ+VLQDTAIF+TEDHPIHLHGYHFWVVGQG
Sbjct  432   QFDYTGNVSRGLWQPRFGTKLHKIKFGSTVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQG  491

Query  699   FGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAM  520
             FGNFNPQTDTA FNLVDPPVRNTIDVPVGGWAVIRF ADNPGVWL HCHIDSHLAWGL M
Sbjct  492   FGNFNPQTDTATFNLVDPPVRNTIDVPVGGWAVIRFVADNPGVWLFHCHIDSHLAWGLGM  551

Query  519   AFIVENGQGEKQTVEPPPLDLPRC  448
             AFIVENG GEKQT+EPPP DLP+C
Sbjct  552   AFIVENGIGEKQTMEPPPPDLPQC  575



>ref|XP_009616771.1| PREDICTED: laccase-3-like [Nicotiana tomentosiformis]
Length=574

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/574 (82%), Positives = 511/574 (89%), Gaps = 0/574 (0%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M++  N    P  NG LA +  +L++L+S ANA+ +  EF+VQET +TRLC+TK IITVN
Sbjct  1     METCKNYLKIPLSNGLLATIIAILSLLSSFANAEFHYHEFIVQETSVTRLCRTKNIITVN  60

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQFPGPT+ VRNGD + V VVNRARYNVTIHWHG+RQMRTPWADGPEYVTQCPI PGG Y
Sbjct  61    GQFPGPTLTVRNGDTLFVTVVNRARYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGFY  120

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYRF IENQEGTLWWHAHS+WLRATVYGA +I PK GS+FPFS P+KDIPILLGEWWNRD
Sbjct  121   TYRFTIENQEGTLWWHAHSKWLRATVYGALVILPKQGSNFPFSLPQKDIPILLGEWWNRD  180

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
             IIA+QRQ QFTGAAPNISNAYTINGQPGDLYRCSSQ T+K SV+PGETVLLRVINAALNQ
Sbjct  181   IIAVQRQAQFTGAAPNISNAYTINGQPGDLYRCSSQGTMKVSVNPGETVLLRVINAALNQ  240

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             QLFFSVANH L VVG DA YNKPFTTNVIMVGPGQTTNV+LTA++PP RYYMAA AYATA
Sbjct  241   QLFFSVANHMLTVVGVDATYNKPFTTNVIMVGPGQTTNVILTANRPPGRYYMAASAYATA  300

Query  1269  qnaPFDNTTTTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFN  1090
             +NA FDNTTTTA+LEY NL PGANSRP +PQLP FNDTATATAFT+QLR +PSNN  V  
Sbjct  301   RNAQFDNTTTTAILEYANLNPGANSRPSLPQLPAFNDTATATAFTSQLRRIPSNNVRVPT  360

Query  1089  QPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIY  910
             Q DE+LFFTVGLGLVNC PGPRCQGPNNTRFAASMNN+SFVLPRRTSLLQAYY NIPGIY
Sbjct  361   QIDENLFFTVGLGLVNCAPGPRCQGPNNTRFAASMNNISFVLPRRTSLLQAYYQNIPGIY  420

Query  909   TLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLH  730
             TLDFPPVP VQFDYTGNVSR LWQP  GTKL+KIK+GS VQ+VLQDTAIF+TEDHPIHLH
Sbjct  421   TLDFPPVPTVQFDYTGNVSRGLWQPRFGTKLHKIKFGSAVQIVLQDTAIFSTEDHPIHLH  480

Query  729   GYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHI  550
             GYHFWVVGQGFGNFNPQTDT  FNLVDPPVRNTIDVPVGGWAVIRF ADNPG+WL HCHI
Sbjct  481   GYHFWVVGQGFGNFNPQTDTTTFNLVDPPVRNTIDVPVGGWAVIRFVADNPGLWLFHCHI  540

Query  549   DSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             DSHLAWGL MAFIVENG GEKQT+EPPP DLP+C
Sbjct  541   DSHLAWGLGMAFIVENGIGEKQTMEPPPPDLPQC  574



>ref|XP_004242502.1| PREDICTED: laccase-3-like [Solanum lycopersicum]
Length=562

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/555 (82%), Positives = 504/555 (91%), Gaps = 1/555 (0%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             + V+L++L++ ANA+ +  EF+VQET +TRLC+TK IITVNGQFPGPT+ VRNGD + V 
Sbjct  9     IVVILSLLSTFANAEFHYHEFIVQETSVTRLCRTKNIITVNGQFPGPTLTVRNGDTLFVT  68

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVNRARYNVTIHWHG+R MRTPWADGPEYVTQCPI PGG YTYRF IENQEGTLWWHAHS
Sbjct  69    VVNRARYNVTIHWHGVRLMRTPWADGPEYVTQCPIRPGGFYTYRFTIENQEGTLWWHAHS  128

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             +WLRATVYGA +I PK GS+FPFS P+KD P++LGEWWNRDIIA+QRQ QFTGAAPN S+
Sbjct  129   KWLRATVYGALVILPKQGSNFPFSLPQKDFPVILGEWWNRDIIAVQRQAQFTGAAPNNSD  188

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLYRCS+Q TVK+SV+PGE+VLLRVINAALNQQLFFSVANH L VVG DA 
Sbjct  189   AYTINGQPGDLYRCSTQGTVKYSVNPGESVLLRVINAALNQQLFFSVANHMLTVVGIDAT  248

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             YNKPFTTNVIMVGPGQTTNV+LTA+Q P RYYMAARAYAT +N  FDNTTTTA+LEYTN+
Sbjct  249   YNKPFTTNVIMVGPGQTTNVILTANQSPGRYYMAARAYATVRNGQFDNTTTTAILEYTNV  308

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP  1033
               GANSRPL+PQLP FNDTATATAF  QLRS+PSNN  V NQ D++LFFTVGLGLVNCTP
Sbjct  309   NSGANSRPLLPQLPAFNDTATATAFANQLRSIPSNN-RVPNQIDDNLFFTVGLGLVNCTP  367

Query  1032  GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVS  853
             GPRCQGPNNTRFAAS+NN+SFV+PRRTSLLQAYY NIPGIYTLDFPPVPPVQFDYTGNVS
Sbjct  368   GPRCQGPNNTRFAASVNNISFVIPRRTSLLQAYYQNIPGIYTLDFPPVPPVQFDYTGNVS  427

Query  852   RALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTD  673
             R LWQP  GTKLYK+K+GS VQ+VLQDTAIF+TEDHPIHLHGYHFWVVGQGFGNFNPQTD
Sbjct  428   RGLWQPRFGTKLYKLKFGSNVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQGFGNFNPQTD  487

Query  672   TAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQG  493
             TA FNL+DPPVRNTIDVPVGGWAVIRF ADNPGVWL+HCHIDSHLAWGL MAFIVENG G
Sbjct  488   TANFNLIDPPVRNTIDVPVGGWAVIRFVADNPGVWLLHCHIDSHLAWGLGMAFIVENGIG  547

Query  492   EKQTVEPPPLDLPRC  448
             E+QT+EPPP DLP+C
Sbjct  548   EEQTMEPPPPDLPQC  562



>ref|XP_006350924.1| PREDICTED: laccase-3-like [Solanum tuberosum]
Length=571

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/564 (81%), Positives = 501/564 (89%), Gaps = 10/564 (2%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             + V+L++L++ ANA+ +  EF+VQET +TRLC+TK IITVNGQFPGPT+ VRNGD + V 
Sbjct  9     IVVILSLLSTFANAEFHYHEFIVQETSVTRLCRTKNIITVNGQFPGPTLTVRNGDTLFVT  68

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVNRARYNVTIHWHG+RQMRTPWADGPEYVTQCPI PGG YTYRF IENQEGTLWWHAHS
Sbjct  69    VVNRARYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGFYTYRFTIENQEGTLWWHAHS  128

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             +WLRATVYGA +I PK GS+FPFS P+KD P+LLGEWWNRDII +QRQ QFTGAAPN S+
Sbjct  129   KWLRATVYGALVILPKQGSNFPFSLPQKDFPVLLGEWWNRDIIVVQRQAQFTGAAPNNSD  188

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLYRCS+Q TVK+ V+PGE+VLLRVINAALNQQLFFSVANH L VVG DA 
Sbjct  189   AYTINGQPGDLYRCSTQGTVKYLVNPGESVLLRVINAALNQQLFFSVANHMLTVVGIDAT  248

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---  1222
             YNKPFTTNVIMVGPGQTTNV+LTA+Q P +YYMAARAYAT +N  FDNTTTTA+LEY   
Sbjct  249   YNKPFTTNVIMVGPGQTTNVILTANQSPRQYYMAARAYATVRNGQFDNTTTTAILEYKNL  308

Query  1221  ------TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
                   TN+  GANSRPL+PQLP FNDTATATAF  QLRS+PSNN  V NQ DE+LFFTV
Sbjct  309   NSGAKYTNVNSGANSRPLLPQLPAFNDTATATAFANQLRSIPSNN-RVPNQIDENLFFTV  367

Query  1059  GLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPV  880
             GLGLVNCTPGPRCQGPNNTRFAASMNN+SFV PRRTSLLQAYY NIPGIYTLDFPPVPPV
Sbjct  368   GLGLVNCTPGPRCQGPNNTRFAASMNNISFVFPRRTSLLQAYYQNIPGIYTLDFPPVPPV  427

Query  879   QFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQG  700
             QFDYTGNVSR LWQP  GTKLYK+K+GS VQ+VLQDTAIF+TEDHPIHLHGYHFWVVGQG
Sbjct  428   QFDYTGNVSRGLWQPRFGTKLYKLKFGSNVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQG  487

Query  699   FGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAM  520
             FGNFNPQTD+A FNL+DPPVRNTIDVPVGGWAVIRF ADNPGVWL HCHIDSHLAWGL M
Sbjct  488   FGNFNPQTDSANFNLIDPPVRNTIDVPVGGWAVIRFVADNPGVWLFHCHIDSHLAWGLGM  547

Query  519   AFIVENGQGEKQTVEPPPLDLPRC  448
             AFIVENG GEKQT+EPPP DLP+C
Sbjct  548   AFIVENGIGEKQTMEPPPPDLPQC  571



>ref|XP_006350864.1| PREDICTED: laccase-3-like [Solanum tuberosum]
Length=568

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/555 (82%), Positives = 499/555 (90%), Gaps = 1/555 (0%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             + V+L++L+  ANA+ +  +F VQ+T++TRLC+TK IITVNGQFPGPT+ VRNGD VVV 
Sbjct  15    IVVILSLLSYFANAESHKHDFTVQQTRVTRLCRTKNIITVNGQFPGPTLTVRNGDTVVVT  74

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVNRARYNVTIHWHG+RQMRTPWADGPEYVTQCPI PGG+YTYRF IENQEGTLWWHAHS
Sbjct  75    VVNRARYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGSYTYRFTIENQEGTLWWHAHS  134

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             +WLRATVYGA +I PK GS+FPFS P+KD P++LGEWWNRDIIA+QRQ QFTGAAPNIS+
Sbjct  135   KWLRATVYGALVILPKQGSNFPFSLPQKDFPVILGEWWNRDIIAVQRQAQFTGAAPNISD  194

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLYRCS+Q TVK+SV+PGE+VLLRVINAALNQQLFFSVANH L VVG DA 
Sbjct  195   AYTINGQPGDLYRCSTQGTVKYSVNPGESVLLRVINAALNQQLFFSVANHMLTVVGIDAT  254

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             YNKPFTTNVIMVGPGQTTNV+LTA+Q P +YYMAARAYAT +N  FDNTTTTA+LEY NL
Sbjct  255   YNKPFTTNVIMVGPGQTTNVILTANQSPRQYYMAARAYATVRNGQFDNTTTTAILEYKNL  314

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP  1033
               GANSRPL+PQLP FNDTATATAF  +LR VP+NN  V NQ DE+LFFTVGLGLVNCT 
Sbjct  315   NSGANSRPLLPQLPAFNDTATATAFANRLRGVPNNN-RVPNQIDENLFFTVGLGLVNCTR  373

Query  1032  GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVS  853
             GPRCQGPNNTRFAASMNN+SFVLPRRTSLLQAYY  IPGIYTLDFP VPPVQFDYTGNVS
Sbjct  374   GPRCQGPNNTRFAASMNNISFVLPRRTSLLQAYYQKIPGIYTLDFPRVPPVQFDYTGNVS  433

Query  852   RALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTD  673
             R LWQP  GTKLYK+K+GS VQ+VLQDTAIF+TEDHPIHLHGYHFWVVGQGFGNFN QTD
Sbjct  434   RGLWQPRFGTKLYKLKFGSNVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQGFGNFNAQTD  493

Query  672   TAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQG  493
             TA FNL DPPVRNTIDVPVGGW VIRF ADNPGVWL HCHIDSHLAWGLAMAFIVENG G
Sbjct  494   TANFNLNDPPVRNTIDVPVGGWTVIRFVADNPGVWLFHCHIDSHLAWGLAMAFIVENGIG  553

Query  492   EKQTVEPPPLDLPRC  448
             EKQT+EPPP DLP+C
Sbjct  554   EKQTMEPPPPDLPQC  568



>ref|XP_004242503.1| PREDICTED: laccase-3-like [Solanum lycopersicum]
Length=568

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/555 (81%), Positives = 497/555 (90%), Gaps = 1/555 (0%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             + V+L++L+S ANA+ +  +F VQET +TRLC+TK IITVNGQFPGPT+ VRNGD VVV 
Sbjct  15    IVVILSLLSSFANAESHKHDFTVQETSVTRLCRTKKIITVNGQFPGPTLTVRNGDTVVVN  74

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVNRARYNVTIHWHG+RQMRTPWADGPEYVTQCPI PGG+YTYRF IENQEGTLWWHAHS
Sbjct  75    VVNRARYNVTIHWHGIRQMRTPWADGPEYVTQCPIRPGGSYTYRFTIENQEGTLWWHAHS  134

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             +WLRATVYGA +I PK GS+FPFS P+KD P++LGEWWNRDIIA+QRQ QFTGAAPN S+
Sbjct  135   KWLRATVYGALVILPKQGSNFPFSLPQKDFPVILGEWWNRDIIAVQRQAQFTGAAPNNSD  194

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLYRCS+Q TVK+SV+PGE+VLLRVINAALNQQLFFSVANH L VVG DA 
Sbjct  195   AYTINGQPGDLYRCSTQGTVKYSVNPGESVLLRVINAALNQQLFFSVANHMLTVVGIDAT  254

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             YNKPFTTNVIMVGPGQTTNV+LTA+Q P RYYMA+RAYAT +N  FDNTTTTA+LEY NL
Sbjct  255   YNKPFTTNVIMVGPGQTTNVILTANQSPGRYYMASRAYATVRNGQFDNTTTTAILEYKNL  314

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP  1033
             + GANSRPL+PQLP FNDTATATAF  +LR  P++N  V NQ D++LFFTVGLGLVNCT 
Sbjct  315   KSGANSRPLLPQLPAFNDTATATAFANRLRGTPNSN-RVPNQIDDNLFFTVGLGLVNCTR  373

Query  1032  GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVS  853
             GPRCQGPNNTRFAAS+NNVSF+ P +TSLLQAYY   PGIYTLDFP VPPVQFDYTGNVS
Sbjct  374   GPRCQGPNNTRFAASVNNVSFIFPSKTSLLQAYYQKTPGIYTLDFPRVPPVQFDYTGNVS  433

Query  852   RALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTD  673
             R LWQP  GTKLYK+K+GS VQ+VLQDTAIF+TEDHPIHLHGYHFWVVGQGFGNFN QTD
Sbjct  434   RGLWQPTFGTKLYKLKFGSNVQIVLQDTAIFSTEDHPIHLHGYHFWVVGQGFGNFNAQTD  493

Query  672   TAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQG  493
             TA FNL DPPVRNTIDVPVGGWAVIRF ADNPGVWL+HCHIDSHLAWGLAMAFIVENG G
Sbjct  494   TANFNLNDPPVRNTIDVPVGGWAVIRFVADNPGVWLLHCHIDSHLAWGLAMAFIVENGIG  553

Query  492   EKQTVEPPPLDLPRC  448
             EKQT+EPPP DLP+C
Sbjct  554   EKQTMEPPPPDLPQC  568



>ref|XP_011080750.1| PREDICTED: laccase-3-like [Sesamum indicum]
Length=568

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/574 (76%), Positives = 497/574 (87%), Gaps = 6/574 (1%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M++    S++P    FL  L  +L+ +ASLA+A+ +  +FVVQ+T +TRLC+T  IITVN
Sbjct  1     MEATKLCSMSPL---FLF-LLGILSFMASLADAETHYHDFVVQQTPVTRLCRTHNIITVN  56

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQFPGPTIA RNGD +V+KV NRARYNVT+HWHG+RQMRTPWADGPEYVTQCPI PGGTY
Sbjct  57    GQFPGPTIAARNGDTLVIKVTNRARYNVTLHWHGIRQMRTPWADGPEYVTQCPIKPGGTY  116

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYRF IENQEGTLWWHAHS+WLRATVYGA +I+PKSGS +PF  PK D+PI+LGEWW+R+
Sbjct  117   TYRFTIENQEGTLWWHAHSKWLRATVYGALVIFPKSGSSYPFPAPKIDVPIILGEWWDRN  176

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
             I+ + RQ  FTGAAPN+S+AYTINGQPGDLYRCSSQ TV+ SV+ G+TVLLRVINAALNQ
Sbjct  177   IVDVLRQALFTGAAPNVSDAYTINGQPGDLYRCSSQGTVRISVNSGDTVLLRVINAALNQ  236

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             QLFFSVANHKL VVGADAAYNKPFTT VIMVGPGQTTNVLLTADQPPARYYMAARAYA+ 
Sbjct  237   QLFFSVANHKLTVVGADAAYNKPFTTRVIMVGPGQTTNVLLTADQPPARYYMAARAYASG  296

Query  1269  qnaPFDNTTTTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFN  1090
             QN  FDNTTTTA+L+Y        S P++PQLP FNDTAT T FT+QL+ +PS      N
Sbjct  297   QNVTFDNTTTTAILDYKTAT-SRTSSPVLPQLPAFNDTATVTQFTSQLKGIPSLAKVAKN  355

Query  1089  QPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIY  910
               DE+LFFT+GLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPR+TSLLQAYY NIPG++
Sbjct  356   V-DENLFFTIGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRKTSLLQAYYQNIPGVF  414

Query  909   TLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLH  730
             T DFPP PPV+FDYTGNVSR LWQP  GTKLYK+K+GS VQ+VLQDTAI TTEDHPIHLH
Sbjct  415   TTDFPPSPPVKFDYTGNVSRGLWQPRFGTKLYKLKFGSNVQLVLQDTAIVTTEDHPIHLH  474

Query  729   GYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHI  550
             GYHF+VVGQGFGNFNP+TDTAKFNLVDPPVRNTIDVPVGGW VIRF ADNPGVWL HCHI
Sbjct  475   GYHFFVVGQGFGNFNPKTDTAKFNLVDPPVRNTIDVPVGGWVVIRFVADNPGVWLFHCHI  534

Query  549   DSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             DSHL WGL M+F+VENG+G+ Q++EPPP DLP+C
Sbjct  535   DSHLTWGLGMSFLVENGKGKSQSIEPPPADLPQC  568



>ref|XP_011080832.1| PREDICTED: laccase-3-like, partial [Sesamum indicum]
Length=554

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/550 (77%), Positives = 473/550 (86%), Gaps = 4/550 (1%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             S A A+ +  +F VQ+T + RLCKT  IITVNGQFPGPT+ VR+GD +V+KVVN ARYNV
Sbjct  5     SSATAETHYHQFFVQQTPVKRLCKTHNIITVNGQFPGPTLEVRDGDTLVIKVVNSARYNV  64

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             T+HWHG+RQMRTPWADGPEYVTQCPI PG +YTYRF IENQ+GTLWWHAHSRWLRATVYG
Sbjct  65    TLHWHGIRQMRTPWADGPEYVTQCPIQPGASYTYRFTIENQDGTLWWHAHSRWLRATVYG  124

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A IIYPK G  +PF +P K+IP+LLGEWW+RDII++ RQ  FTGAAPN S+AYTINGQPG
Sbjct  125   ALIIYPKLGVPYPFPKPTKEIPVLLGEWWDRDIISVLRQATFTGAAPNASDAYTINGQPG  184

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DLYRCSS++T KF V  GETVLLR+INAALNQ+LFF+VANH L VVG DA YNKPF T V
Sbjct  185   DLYRCSSKETTKFYVKSGETVLLRIINAALNQELFFTVANHMLTVVGNDATYNKPFATRV  244

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL----RPGAN  1198
             +M+GPGQTTNVLLTA+Q   RYYMA RAYATAQNA FDNTT+TA+LEY ++    + G  
Sbjct  245   VMLGPGQTTNVLLTANQIAGRYYMATRAYATAQNAAFDNTTSTAILEYDSVPCPSKTGVA  304

Query  1197  SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQ  1018
             SRPLMP LP FNDTAT TAFT+QLRS+PS N  V  Q DE+LFFTVGLGLVNC PGPRCQ
Sbjct  305   SRPLMPVLPRFNDTATVTAFTSQLRSLPSKNAKVPTQIDENLFFTVGLGLVNCMPGPRCQ  364

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             GPNNTRFAASMNN+SFVLPRRTSLLQAYY NIPG+YT+DFPPVP V FDYTGNVSR LWQ
Sbjct  365   GPNNTRFAASMNNISFVLPRRTSLLQAYYQNIPGVYTMDFPPVPLVTFDYTGNVSRGLWQ  424

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTKLYK+K+GS VQ+VLQDTAI TTEDHPIHLHGYHF+VVGQGFGNFNP  DTA FN
Sbjct  425   PRFGTKLYKLKFGSNVQIVLQDTAIVTTEDHPIHLHGYHFYVVGQGFGNFNPTVDTAGFN  484

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             L+DPPVRNTI+VPVGGWAVIRF ADNPGVWLMHCHIDSHL WGLAMAF+VENG GE Q++
Sbjct  485   LIDPPVRNTINVPVGGWAVIRFVADNPGVWLMHCHIDSHLTWGLAMAFLVENGPGELQSI  544

Query  477   EPPPLDLPRC  448
             E PP DLP C
Sbjct  545   EAPPPDLPPC  554



>emb|CDP09253.1| unnamed protein product [Coffea canephora]
Length=1557

 Score =   837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/568 (76%), Positives = 490/568 (86%), Gaps = 3/568 (1%)
 Frame = -3

Query  2145  LNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTI  1966
             + P+ +GFL     +L  +AS  N +++  EFVVQ   +TRLC T +IITVNGQFPGPT+
Sbjct  991   VKPWSSGFLLGFLAILAAVASHPNGEIHYHEFVVQAKSVTRLCSTHSIITVNGQFPGPTL  1050

Query  1965  AvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIEN  1786
             AVRNGD +V++V+NRA YNVT+HWHG+RQMRTPWADGPEYVTQCPI PGGTYTYRF IEN
Sbjct  1051  AVRNGDTLVIRVLNRAPYNVTLHWHGVRQMRTPWADGPEYVTQCPIQPGGTYTYRFTIEN  1110

Query  1785  QEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILL-GEWWNRDIIALQRQ  1609
             QEGTLWWHAHSRWLRATVYGA +I+PK G  +PF++PK D+PI+L GEWW RDII++ RQ
Sbjct  1111  QEGTLWWHAHSRWLRATVYGALVIFPKQGFAYPFAKPKLDVPIILAGEWWKRDIISVMRQ  1170

Query  1608  TQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVA  1429
               FTGAAPN+S+AYTINGQPGDLYRCS++ T K  V+ G+TVLLRVINAALNQQLFF++A
Sbjct  1171  ALFTGAAPNVSDAYTINGQPGDLYRCSNRGTFKVYVNSGDTVLLRVINAALNQQLFFTIA  1230

Query  1428  NHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDN  1249
             NH+L VVGADA+Y KPF+T VIM+GPGQTT+VLL A+Q   RYYMAARAYATAQ APFDN
Sbjct  1231  NHQLTVVGADASYLKPFSTRVIMLGPGQTTDVLLNANQRAGRYYMAARAYATAQGAPFDN  1290

Query  1248  TTTTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLF  1069
             TTTTA+LEY N R G+ SRP++PQLP FNDTAT TAFT+QLRS+PSN   V  Q D+SLF
Sbjct  1291  TTTTAILEYRNSRTGSFSRPILPQLPAFNDTATTTAFTSQLRSIPSNY-KVPTQIDDSLF  1349

Query  1068  FTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             FTVGLG VNC PGPRCQGPNNTRFAASMNNVSFVLP RTSLLQAYY NIPGIYTLDFPPV
Sbjct  1350  FTVGLGFVNCNPGPRCQGPNNTRFAASMNNVSFVLPNRTSLLQAYYQNIPGIYTLDFPPV  1409

Query  888   PPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PPVQF+YTG V R+ WQP  GTKLYK+K+G+ VQ+VLQDT IF+TEDHPIHLHGYHF+VV
Sbjct  1410  PPVQFNYTGTVPRSQWQPVFGTKLYKLKFGANVQIVLQDTGIFSTEDHPIHLHGYHFFVV  1469

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNP-GVWLMHCHIDSHLAW  532
             GQGFGNFNPQTDT  FNLVDPP RNTIDVPVGGWAVIRF ADNP GVWL HCHIDSHL W
Sbjct  1470  GQGFGNFNPQTDTGNFNLVDPPSRNTIDVPVGGWAVIRFVADNPAGVWLFHCHIDSHLTW  1529

Query  531   GLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GLAM+FIVENG+GE QTVEPPP DLPRC
Sbjct  1530  GLAMSFIVENGRGELQTVEPPPADLPRC  1557



>emb|CDP09079.1| unnamed protein product [Coffea canephora]
Length=569

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/549 (76%), Positives = 477/549 (87%), Gaps = 3/549 (1%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             S ANA+ +  +FVV+   + RLC+T  IITVN +FPGPT+ VRNGD +V+K +N+ARYNV
Sbjct  21    SFANAETHYHDFVVEAKPVKRLCRTHNIITVNKKFPGPTLTVRNGDTLVIKALNKARYNV  80

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             T+HWHG+RQMRTPWADGPEYVTQCPI PG TYTYRF IE+QEGTLWWHAHS+WLRATVYG
Sbjct  81    TLHWHGIRQMRTPWADGPEYVTQCPIQPGATYTYRFTIEDQEGTLWWHAHSKWLRATVYG  140

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A +I PK GS +PF +P+ ++PI+LGEWW+RDII++ RQ  FTGAAPN+S+AYTINGQPG
Sbjct  141   ALVILPKLGSPYPFPKPRHEVPIILGEWWDRDIISVLRQALFTGAAPNVSDAYTINGQPG  200

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DLYRCSS+ T K SV+ G+ VLLRVINAALNQQLFF++ANH+L VVGADA Y+KPF T V
Sbjct  201   DLYRCSSKGTFKVSVNSGDRVLLRVINAALNQQLFFTIANHQLTVVGADAIYHKPFATRV  260

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANS--R  1192
             IM+GPGQTT+VLLTA+Q PARYYMAARAYA+A+ APFDNTTTTAVLEY   R G++S  R
Sbjct  261   IMLGPGQTTDVLLTANQRPARYYMAARAYASARGAPFDNTTTTAVLEYNTARGGSSSTSR  320

Query  1191  PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGP  1012
             PL+P+LP FNDTATATAF   LRS+PS    V  + D SLFFTVGLG VNC PGPRCQGP
Sbjct  321   PLLPRLPAFNDTATATAFENGLRSIPSEAAKVPTKIDHSLFFTVGLGFVNCNPGPRCQGP  380

Query  1011  NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPP  832
             NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGI+T DFPPVPP+QF+YTGNV R+LWQP 
Sbjct  381   NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIFTTDFPPVPPLQFNYTGNVPRSLWQPR  440

Query  831   SGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLV  652
              GTKLYK+KYGS VQ+VLQDT IF+TEDHPIHLHGYHF+VVGQGFGNFNP+TD A+FNLV
Sbjct  441   FGTKLYKLKYGSTVQIVLQDTGIFSTEDHPIHLHGYHFFVVGQGFGNFNPRTDPARFNLV  500

Query  651   DPPVRNTIDVPVGGWAVIRFFADNPG-VWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVE  475
             DPP RNTIDVPVGGWAVIRF ADNPG VWL HCHID+HL WGLAM+F+VENG GE QTVE
Sbjct  501   DPPARNTIDVPVGGWAVIRFVADNPGSVWLFHCHIDAHLTWGLAMSFLVENGIGELQTVE  560

Query  474   PPPLDLPRC  448
             PPP DLPRC
Sbjct  561   PPPADLPRC  569



>ref|XP_002277722.1| PREDICTED: laccase-12 [Vitis vinifera]
Length=574

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/550 (73%), Positives = 465/550 (85%), Gaps = 5/550 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             ASLA+A+ +  +FVVQ+T + RLC+T  IITVNGQFPGPT+ VR+GD +V+KVVN ARYN
Sbjct  27    ASLADAETHYHDFVVQQTPVKRLCRTHNIITVNGQFPGPTLEVRDGDTLVIKVVNSARYN  86

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             VT+HWHG+RQMRTPWADGPEYVTQCPI PG TYTYRF IENQEGTLWWHAHS+WLRATVY
Sbjct  87    VTLHWHGIRQMRTPWADGPEYVTQCPIRPGATYTYRFTIENQEGTLWWHAHSKWLRATVY  146

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA +IYPK GS +PF QP  + PILLGEWW+RD IA+ RQ  FTGAAPNIS+AYTINGQP
Sbjct  147   GALVIYPKLGSSYPFPQPNHEAPILLGEWWDRDPIAVLRQATFTGAAPNISDAYTINGQP  206

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLYRCSS++T +  +  GE +LLR+IN+ALNQQLFFSVANHKL VVGADAAY KPFTT 
Sbjct  207   GDLYRCSSKETARLPLDSGERILLRIINSALNQQLFFSVANHKLTVVGADAAYTKPFTTT  266

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL---RPGAN  1198
             V+M+GPGQTT+VLLTADQPPARYYMAARAY +AQNAPFDNTTTTA+LEY      + G +
Sbjct  267   VMMLGPGQTTDVLLTADQPPARYYMAARAYDSAQNAPFDNTTTTAILEYKGACYTKKGQS  326

Query  1197  SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQ  1018
             S+P+ P+LP +NDT T TAFT++ +S+ ++   V  + DESLFFT+G GL NC PGPRCQ
Sbjct  327   SKPVFPRLPAYNDTPTVTAFTSRFKSLTTSK--VPTKIDESLFFTIGFGLFNCRPGPRCQ  384

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             GPN TRF ASMNNVSFVLP   S+LQA Y  IPG++T DFP  PP+QFDYTGNVSRALWQ
Sbjct  385   GPNGTRFGASMNNVSFVLPSSNSILQASYQGIPGVFTTDFPASPPLQFDYTGNVSRALWQ  444

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTK+YK+KYGS VQ+VLQDT+IF+ E+HP+HLHGYHF+VV  GFGNFNP TDTAKFN
Sbjct  445   PVRGTKVYKLKYGSTVQIVLQDTSIFSIENHPMHLHGYHFYVVALGFGNFNPVTDTAKFN  504

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             L+DPPVRNTI VP GGWAVIRF ADNPG WLMHCHID+HL WGLAM F+VENG GE Q++
Sbjct  505   LIDPPVRNTIGVPTGGWAVIRFVADNPGTWLMHCHIDAHLTWGLAMVFLVENGAGELQSI  564

Query  477   EPPPLDLPRC  448
             EPPP DLP C
Sbjct  565   EPPPADLPPC  574



>ref|XP_010099447.1| hypothetical protein L484_011146 [Morus notabilis]
 gb|EXB78522.1| hypothetical protein L484_011146 [Morus notabilis]
Length=575

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/573 (70%), Positives = 475/573 (83%), Gaps = 12/573 (2%)
 Frame = -3

Query  2145  LNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTI  1966
             + P C   L  +F +L  L S+A+A+ +  +FVVQ T +TRLC+T+  ITVNGQFPGPT+
Sbjct  8     VKPCCYSLLLAVFGLLASLTSIADAETHYHQFVVQPTPVTRLCRTRNRITVNGQFPGPTL  67

Query  1965  AvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIEN  1786
             AVRNGD +V++V+N A+YNVT+HWHG+RQ++ PWADGPEYVTQCPI PGGTYTYRF I +
Sbjct  68    AVRNGDTLVIRVINSAQYNVTMHWHGIRQLQNPWADGPEYVTQCPIQPGGTYTYRFTIID  127

Query  1785  QEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQT  1606
             QEGTLWWHAHSRWLRATVYGA IIYPK G+ +PF  PK+++PILLGEWWNR+ + + RQ+
Sbjct  128   QEGTLWWHAHSRWLRATVYGALIIYPKLGTPYPFHMPKREVPILLGEWWNRNPMDVLRQS  187

Query  1605  QFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVAN  1426
             QFTGAAPN+S+AYTINGQPGDLYRCS+++TV+  V  GET+LLR+IN+ALNQ+LFF++AN
Sbjct  188   QFTGAAPNVSDAYTINGQPGDLYRCSNKETVRIPVDSGETILLRLINSALNQELFFAIAN  247

Query  1425  HKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNT  1246
             HK+ VV ADA Y KPFTT VIM+GPGQTT++LLTADQ PARYYMAARAY TAQNA FDNT
Sbjct  248   HKMTVVAADALYTKPFTTQVIMIGPGQTTDILLTADQKPARYYMAARAYETAQNAAFDNT  307

Query  1245  TTTAVLEYTN-----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPD  1081
             TTTA+LEY +     L+P   SRP++ QLP FNDTATATAFT + RS PS    V  Q D
Sbjct  308   TTTAILEYKSACKKGLQP---SRPILSQLPAFNDTATATAFTAKFRS-PSKV-DVPTQID  362

Query  1080  ESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYT  907
              +LFFTVG GL NCT    PRCQGPN TRFAASMNNVSFV PRRTSL+QAYY  +PG++T
Sbjct  363   HNLFFTVGFGLNNCTRPNSPRCQGPNGTRFAASMNNVSFVFPRRTSLMQAYYQGVPGVFT  422

Query  906   LDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHG  727
              DFPPVPP+QFDYTGNV R LWQP +GTKLYK+KYGS VQ+VLQDT+I TTEDHP+HLHG
Sbjct  423   TDFPPVPPLQFDYTGNVPRGLWQPSTGTKLYKLKYGSSVQIVLQDTSIVTTEDHPMHLHG  482

Query  726   YHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHID  547
             YHF+VVG GFGNFNPQTD AKFNL+DPP RNTI  P GGW  IRF ADNPG+WLMHCH+D
Sbjct  483   YHFYVVGSGFGNFNPQTDPAKFNLIDPPQRNTIGTPPGGWVAIRFIADNPGIWLMHCHLD  542

Query  546   SHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +H+  GLAMAF+VENG G  Q+V PPP DLPRC
Sbjct  543   AHIVLGLAMAFLVENGVGASQSVIPPPADLPRC  575



>ref|XP_002516345.1| laccase, putative [Ricinus communis]
 gb|EEF46029.1| laccase, putative [Ricinus communis]
Length=577

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/570 (69%), Positives = 467/570 (82%), Gaps = 10/570 (2%)
 Frame = -3

Query  2139  PFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAv  1960
             P C   L  + V L  LAS + A  +  EFV+Q   + RLC+T +IITVNGQFPGPT+ V
Sbjct  12    PHC--ILVGILVSLCFLASSSQAKTHYHEFVIQAKPVKRLCRTHSIITVNGQFPGPTLEV  69

Query  1959  rngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQE  1780
             R+GD +V+K VN A+YNVT+HWHG+RQ+R PWADGP++VTQCPI+PGG+YTYRF I+NQE
Sbjct  70    RDGDSLVIKAVNNAKYNVTLHWHGIRQLRNPWADGPDHVTQCPILPGGSYTYRFTIQNQE  129

Query  1779  GTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQF  1600
             GTLWWHAHSRWLRATVYGA IIYPK GS +PF  PK++IPILLGEWW+R+ + + RQ  F
Sbjct  130   GTLWWHAHSRWLRATVYGALIIYPKLGSSYPFPMPKREIPILLGEWWDRNPMDVLRQAIF  189

Query  1599  TGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHK  1420
             TGAAPN+S+AY INGQPGDLYRCSS++TV F V  GET+LLR+IN+A+NQ+LFF+VANH+
Sbjct  190   TGAAPNVSDAYNINGQPGDLYRCSSKETVIFPVDSGETILLRIINSAMNQELFFAVANHR  249

Query  1419  LQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTT  1240
             L VV  DAAY KPFTT+VIM+ PGQTTNVLLTADQ P RYYMAARAY TAQNA FDNTTT
Sbjct  250   LTVVAVDAAYTKPFTTSVIMIAPGQTTNVLLTADQTPGRYYMAARAYNTAQNAAFDNTTT  309

Query  1239  TAVLEY----TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESL  1072
             TA+L+Y     N + G +S+ ++PQLP +NDT TATAFT QLRS PS N  V    D++L
Sbjct  310   TAILQYKSAPCNSKKGKSSQAILPQLPAYNDTNTATAFTAQLRS-PS-NVKVPTDIDDNL  367

Query  1071  FFTVGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDF  898
             FF VGLGL+NCT    PRCQGPN TRFAAS+NNVSFVLP R S++QAYY   PGI+T DF
Sbjct  368   FFAVGLGLINCTNPNSPRCQGPNGTRFAASINNVSFVLPTRNSIMQAYYQGQPGIFTTDF  427

Query  897   PPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHF  718
             PP PP++F+Y+GNV R LWQP  GTKLYK+KYGS+VQ+V QDT+I TTEDHP+HLHGY F
Sbjct  428   PPAPPIKFNYSGNVPRGLWQPVPGTKLYKLKYGSKVQIVFQDTSIVTTEDHPMHLHGYEF  487

Query  717   WVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHL  538
              VVG GFGNFNP TDTAKFNL+DPP+RNTI  P GGW  IRF ADNPG+WL+HCH+DSH+
Sbjct  488   AVVGMGFGNFNPGTDTAKFNLIDPPLRNTIGTPPGGWVAIRFVADNPGIWLLHCHLDSHI  547

Query  537   AWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
              WGLAMAF+VENG G+ Q+V+PPPLDLP+C
Sbjct  548   TWGLAMAFLVENGVGKLQSVQPPPLDLPQC  577



>emb|CBI15873.3| unnamed protein product [Vitis vinifera]
Length=1561

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/550 (73%), Positives = 465/550 (85%), Gaps = 5/550 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             ASLA+A+ +  +FVVQ+T + RLC+T  IITVNGQFPGPT+ VR+GD +V+KVVN ARYN
Sbjct  1014  ASLADAETHYHDFVVQQTPVKRLCRTHNIITVNGQFPGPTLEVRDGDTLVIKVVNSARYN  1073

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             VT+HWHG+RQMRTPWADGPEYVTQCPI PG TYTYRF IENQEGTLWWHAHS+WLRATVY
Sbjct  1074  VTLHWHGIRQMRTPWADGPEYVTQCPIRPGATYTYRFTIENQEGTLWWHAHSKWLRATVY  1133

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA +IYPK GS +PF QP  + PILLGEWW+RD IA+ RQ  FTGAAPNIS+AYTINGQP
Sbjct  1134  GALVIYPKLGSSYPFPQPNHEAPILLGEWWDRDPIAVLRQATFTGAAPNISDAYTINGQP  1193

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLYRCSS++T +  +  GE +LLR+IN+ALNQQLFFSVANHKL VVGADAAY KPFTT 
Sbjct  1194  GDLYRCSSKETARLPLDSGERILLRIINSALNQQLFFSVANHKLTVVGADAAYTKPFTTT  1253

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL---RPGAN  1198
             V+M+GPGQTT+VLLTADQPPARYYMAARAY +AQNAPFDNTTTTA+LEY      + G +
Sbjct  1254  VMMLGPGQTTDVLLTADQPPARYYMAARAYDSAQNAPFDNTTTTAILEYKGACYTKKGQS  1313

Query  1197  SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQ  1018
             S+P+ P+LP +NDT T TAFT++ +S+ ++   V  + DESLFFT+G GL NC PGPRCQ
Sbjct  1314  SKPVFPRLPAYNDTPTVTAFTSRFKSLTTSK--VPTKIDESLFFTIGFGLFNCRPGPRCQ  1371

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             GPN TRF ASMNNVSFVLP   S+LQA Y  IPG++T DFP  PP+QFDYTGNVSRALWQ
Sbjct  1372  GPNGTRFGASMNNVSFVLPSSNSILQASYQGIPGVFTTDFPASPPLQFDYTGNVSRALWQ  1431

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTK+YK+KYGS VQ+VLQDT+IF+ E+HP+HLHGYHF+VV  GFGNFNP TDTAKFN
Sbjct  1432  PVRGTKVYKLKYGSTVQIVLQDTSIFSIENHPMHLHGYHFYVVALGFGNFNPVTDTAKFN  1491

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             L+DPPVRNTI VP GGWAVIRF ADNPG WLMHCHID+HL WGLAM F+VENG GE Q++
Sbjct  1492  LIDPPVRNTIGVPTGGWAVIRFVADNPGTWLMHCHIDAHLTWGLAMVFLVENGAGELQSI  1551

Query  477   EPPPLDLPRC  448
             EPPP DLP C
Sbjct  1552  EPPPADLPPC  1561



>ref|XP_010032957.1| PREDICTED: laccase-13 [Eucalyptus grandis]
 gb|KCW52465.1| hypothetical protein EUGRSUZ_J01857 [Eucalyptus grandis]
Length=575

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/567 (71%), Positives = 461/567 (81%), Gaps = 8/567 (1%)
 Frame = -3

Query  2136  FCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvr  1957
             FC   L  L V+L  L S ++A+ +  EFV+QE  + RLC+T  IITVNGQFPGP + VR
Sbjct  13    FC--LLIALSVVLASLVSFSDAETHYHEFVIQEQPVKRLCRTHKIITVNGQFPGPILEVR  70

Query  1956  ngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEG  1777
             +GD +++K  N A+YNVT+HWHG+RQ+  PWADGPEY+TQCPI PGGTYTYRF I+NQ G
Sbjct  71    DGDSLIIKTTNIAQYNVTLHWHGVRQIANPWADGPEYITQCPIQPGGTYTYRFTIQNQVG  130

Query  1776  TLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFT  1597
             TLWWHAHS+WLRATVYGA IIYPK G  +PF+ P ++IP++LGEWW+RD +A+ RQ QFT
Sbjct  131   TLWWHAHSQWLRATVYGALIIYPKFGLPYPFATPNQEIPVILGEWWDRDPMAVLRQAQFT  190

Query  1596  GAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKL  1417
             GAAPN+S+AYTINGQPGD YRCSSQ+T  FSV  GETVLLR+INAALNQ+LFF+VANHKL
Sbjct  191   GAAPNVSDAYTINGQPGDFYRCSSQETTVFSVESGETVLLRIINAALNQELFFAVANHKL  250

Query  1416  QVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTT  1237
              VVG DAAY KPF T+VIM+GPGQTT+VL TADQ P+RYYMAA AY TAQNA FDNTTTT
Sbjct  251   TVVGVDAAYTKPFPTSVIMIGPGQTTDVLFTADQSPSRYYMAASAYDTAQNAAFDNTTTT  310

Query  1236  AVLEYTNLRPGA---NSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFF  1066
             AVLEY +    A   +S+ L+PQLP FNDTATATAFT  LRS PS    V N  DE+LFF
Sbjct  311   AVLEYGSETCSARRQSSQVLLPQLPAFNDTATATAFTAGLRS-PS-KVGVPNNIDENLFF  368

Query  1065  TVGLGLVNC-TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
              VGLGL+NC  P P CQGPNNTRFAASMNNVSFV P   S++QAYY  + GI+T DFPPV
Sbjct  369   AVGLGLINCLLPSPSCQGPNNTRFAASMNNVSFVFPTTLSVMQAYYQGVQGIFTADFPPV  428

Query  888   PPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PPV+FDYTGNV+RALWQP +GTK+YK+KYGS VQ+VLQDT+I TTEDHP+HLHGY F VV
Sbjct  429   PPVRFDYTGNVNRALWQPVNGTKVYKLKYGSTVQIVLQDTSIVTTEDHPMHLHGYQFSVV  488

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
             G GFGNFN   DT KFNLVDPPVRNTI  P GGW  IRF ADNPGVWLMHCHID+HL WG
Sbjct  489   GMGFGNFNAARDTPKFNLVDPPVRNTIGTPPGGWVAIRFVADNPGVWLMHCHIDAHLVWG  548

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAM F+VENGQG +QTV PPP DLP+C
Sbjct  549   LAMCFLVENGQGAQQTVIPPPQDLPQC  575



>emb|CDP09252.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/581 (68%), Positives = 461/581 (79%), Gaps = 23/581 (4%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
             +  L V     A LA+++ +  EFVVQ T I RLC +++I+TVNGQFPGPTI VR+GD +
Sbjct  9     ILSLSVTFIFAAWLADSETHYHEFVVQSTPIKRLCTSRSILTVNGQFPGPTIEVRDGDSL  68

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
             V+KV+NRA YNVTIHWHG+RQ  T WADGPEYVTQCPI PG  YTYRF I+NQ+GTLWWH
Sbjct  69    VIKVINRALYNVTIHWHGIRQRGTQWADGPEYVTQCPIQPGAAYTYRFSIQNQDGTLWWH  128

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPF-SQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             AHSRW+RAT+YGA +IYPK G  +PF + P KD P++LGEWW+ DI+ + RQ  F+GAAP
Sbjct  129   AHSRWIRATIYGALVIYPKLGVPYPFQNHPDKDFPVILGEWWDTDILGIMRQALFSGAAP  188

Query  1584  NISNAYTINGQPGDLYRCSSQD------------------TVKFSVSPGETVLLRVINAA  1459
             N+S+AYTINGQPGD YRCSS                    T  F V  G+TVLLR+INAA
Sbjct  189   NVSDAYTINGQPGDFYRCSSLGLLQTCSLYDCQVLLVSTYTATFYVDAGDTVLLRIINAA  248

Query  1458  LNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaaray  1279
             LNQQLFF+VANH L VVGADAAYNKPFTT VIMVGPGQTTNVLLTADQPPAR YMA RAY
Sbjct  249   LNQQLFFTVANHMLTVVGADAAYNKPFTTRVIMVGPGQTTNVLLTADQPPARSYMATRAY  308

Query  1278  ataqnaPFDNTTTTAVLEYTNL----RPGANSRPLMPQLPFFNDtatataftTQLRSVPS  1111
             ATAQ APFDNTT TA+LEY ++    R G++  P++P+LP +NDTAT  +FT+Q RS+ S
Sbjct  309   ATAQGAPFDNTTATAILEYNSIPCHSRKGSSYTPILPRLPPYNDTATVASFTSQFRSLSS  368

Query  1110  NNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYY  931
             ++  +    DE+LF TVGLG  NC P P CQGPN TRFA+SMNNVSFVLPRR SLLQAYY
Sbjct  369   SDAQIPTDIDENLFITVGLGFYNCIPSPTCQGPNATRFASSMNNVSFVLPRRASLLQAYY  428

Query  930   NNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTE  751
              +IPG+YT DFPPVPP+QFDYTGNV RALWQP  GTKLYK+KYGS+VQVV QDT IF+TE
Sbjct  429   QSIPGVYTTDFPPVPPIQFDYTGNVPRALWQPVRGTKLYKLKYGSKVQVVFQDTGIFSTE  488

Query  750   DHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGV  571
             DHPIHLHG+ F+VVGQGFGNFNP  D+  FNL+DPP RNTI VPVGGWA IRF ADNPGV
Sbjct  489   DHPIHLHGHQFYVVGQGFGNFNPSRDSTNFNLIDPPERNTIGVPVGGWAAIRFVADNPGV  548

Query  570   WLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             WLMHCHID+HL WGLAMAF+V+NG G  Q+V+ PPLDLP+C
Sbjct  549   WLMHCHIDAHLTWGLAMAFLVDNGPGLLQSVDRPPLDLPQC  589



>ref|XP_004294763.1| PREDICTED: laccase-3-like [Fragaria vesca subsp. vesca]
Length=578

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/554 (71%), Positives = 455/554 (82%), Gaps = 9/554 (2%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             AS A A+ +  EFVV+   + RLC+T   ITVNGQFPGPT+ VRNGD + VKV NRA+YN
Sbjct  27    ASFAAAETHYHEFVVEAKPVKRLCRTHNTITVNGQFPGPTLEVRNGDSLAVKVTNRAKYN  86

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             VTIHWHGL+Q+R PWADGPEYVTQCPI PG TYTYRF I+NQEGTLWWHAHS+WLRATVY
Sbjct  87    VTIHWHGLKQLRNPWADGPEYVTQCPIQPGATYTYRFTIQNQEGTLWWHAHSKWLRATVY  146

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA IIYP+ G+ +PFS PKK+ P+LLGEWW+R+ + +QR  QFTG APN+S+AYTINGQP
Sbjct  147   GALIIYPRLGTPYPFSMPKKEFPLLLGEWWDRNPLDVQRLAQFTGGAPNVSDAYTINGQP  206

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLYRCS Q TV+  V   ET+LLR+IN+ALNQ+LFF++ANH+L VV ADA+Y KPFTT 
Sbjct  207   GDLYRCSKQGTVRIPVESSETILLRIINSALNQELFFTIANHRLTVVSADASYTKPFTTR  266

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL-----RPG  1204
             VIM+GPGQTT+VLLTADQPPA YY AARAY TAQNA FDNTTTTA+LEY +      +  
Sbjct  267   VIMLGPGQTTDVLLTADQPPAHYYAAARAYQTAQNAAFDNTTTTAILEYKSAAACDSKKA  326

Query  1203  ANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP--G  1030
               S P++P LP +NDTATATAF+ Q++S PS    +  Q DE+L+F VGLGL+NCT    
Sbjct  327   KFSAPVLPSLPAYNDTATATAFSVQIKS-PSQV-QIPTQIDENLYFIVGLGLINCTVPNS  384

Query  1029  PRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSR  850
             PRCQGPNNTRFAASMNNVSFV P+ TSL+QAYYN IPG++T DFPPVPPVQFDYTGNVSR
Sbjct  385   PRCQGPNNTRFAASMNNVSFVFPKTTSLMQAYYNGIPGVFTTDFPPVPPVQFDYTGNVSR  444

Query  849   ALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDT  670
              LW P  GTKLYK+KYGS VQ+VLQDT+I TTEDHP+HLHGYHF+VVG GFGNFNP+TD 
Sbjct  445   GLWTPSRGTKLYKLKYGSSVQIVLQDTSIVTTEDHPMHLHGYHFYVVGSGFGNFNPRTDP  504

Query  669   AKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGE  490
             AKFNL+DPP+RNTI    GGW  IRF ADNPGVWLMHCH+D+HL  GLAMAF+VENG G 
Sbjct  505   AKFNLIDPPLRNTIGTNPGGWVAIRFVADNPGVWLMHCHLDAHLVLGLAMAFVVENGNGP  564

Query  489   KQTVEPPPLDLPRC  448
              Q+V PPP DLP+C
Sbjct  565   LQSVIPPPADLPQC  578



>ref|XP_010521986.1| PREDICTED: laccase-3 [Tarenaya hassleriana]
Length=565

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/561 (68%), Positives = 457/561 (81%), Gaps = 8/561 (1%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             FLA +    T+LAS A+A+++ +EFV++   + RLC+T   ITVNGQFPGPT+ VRNGD 
Sbjct  11    FLA-ILTCFTLLASFASAELHVREFVIEARPVKRLCRTHQTITVNGQFPGPTLEVRNGDS  69

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             + + V+N+ARYN++IHWHG+RQ+R PWADGPEY+TQCPI PG +YTYR  IE QEGT WW
Sbjct  70    LAITVINKARYNISIHWHGIRQLRNPWADGPEYITQCPIQPGQSYTYRIMIEGQEGTFWW  129

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHSRWLRATVYGA IIYP+ GS +PF  PK+DIPILLGEWW+R+ + + R  QFTGAAP
Sbjct  130   HAHSRWLRATVYGALIIYPRLGSPYPFPMPKRDIPILLGEWWDRNPMDVLRLAQFTGAAP  189

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLYRCS Q+TV+F V PGET+ LR+INAA+NQ+LFF++ANH L VV 
Sbjct  190   NVSDAYTINGQPGDLYRCSRQETVRFPVFPGETIQLRLINAAMNQELFFAIANHPLTVVE  249

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
              D+AY KPFTT+V+M+ PGQT NVLLTADQ P RYY+AARAY +A    FDNTTTTA+LE
Sbjct  250   VDSAYTKPFTTSVVMIAPGQTMNVLLTADQRPGRYYIAARAYNSANAP-FDNTTTTAILE  308

Query  1224  YTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLV  1045
             Y N      + P  P+LP FNDTATATAFT +LRS+      +  + DE+LFFTVGLGL+
Sbjct  309   YVNT--PRRTAPTFPRLPGFNDTATATAFTNRLRSMRREGLPL--EIDENLFFTVGLGLI  364

Query  1044  NCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFD  871
             NCT    PRCQGPN TRFAASMNNVSFVLPRR SL+QAYY   PG++T+DFPPVPPV+FD
Sbjct  365   NCTNPNSPRCQGPNGTRFAASMNNVSFVLPRRNSLMQAYYQGTPGVFTVDFPPVPPVKFD  424

Query  870   YTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             YTGNVSR LWQP  GTK+YK++Y +RVQ+VLQDT+I T E+HP+HLHGY F+VVG GFGN
Sbjct  425   YTGNVSRGLWQPRRGTKVYKLRYKARVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGN  484

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             F+P+ D A FNLVDPP RNTI  P GGW  IRF ADNPG+W MHCHIDSHL WGLAMAF+
Sbjct  485   FDPKRDPANFNLVDPPERNTIGTPPGGWVAIRFIADNPGIWFMHCHIDSHLGWGLAMAFL  544

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             V+NG+GE QTV+PPPLDLPRC
Sbjct  545   VKNGKGELQTVQPPPLDLPRC  565



>ref|XP_007016999.1| Laccase 3 [Theobroma cacao]
 gb|EOY34618.1| Laccase 3 [Theobroma cacao]
Length=576

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/571 (67%), Positives = 456/571 (80%), Gaps = 14/571 (2%)
 Frame = -3

Query  2133  CNGFLAKLFVMLTVLASLA---NADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIA  1963
             C+ +L   FV+L + ASLA   +A V+  +FV++   + RLC+T + ITVNGQFPGPT+ 
Sbjct  11    CSSYL--FFVILLIFASLASFADAAVHYHDFVIEAKPVKRLCRTHSTITVNGQFPGPTLE  68

Query  1962  vrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQ  1783
             VR+GD +V+K +NRARYN+T+HWHG+RQ+R PWADGPEYVTQCPI PG +YTY+F I+NQ
Sbjct  69    VRDGDTLVIKAINRARYNITLHWHGIRQLRNPWADGPEYVTQCPIQPGRSYTYQFTIQNQ  128

Query  1782  EGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQ  1603
             EGTLWWHAHSRWLRATVYGA IIYPK GS +PF  PKK+IPILLGEWW+RD + + R   
Sbjct  129   EGTLWWHAHSRWLRATVYGALIIYPKLGSPYPFPMPKKEIPILLGEWWDRDPMDVLRLAL  188

Query  1602  FTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANH  1423
             FTGAAPN+S+A+TINGQPGDLYRCSS++T  F V  GET+LLR+IN+A+NQ+LFF VANH
Sbjct  189   FTGAAPNVSDAFTINGQPGDLYRCSSKETAIFPVEAGETILLRIINSAMNQELFFGVANH  248

Query  1422  KLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTT  1243
             KL VV  DAAY KPFTTNVIM+ PGQTTNVLLTADQ P+  Y  A       NAPFDNTT
Sbjct  249   KLTVVAVDAAYTKPFTTNVIMIAPGQTTNVLLTADQ-PSARYYMAAHAYNTANAPFDNTT  307

Query  1242  TTAVLEY----TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDES  1075
             TTA+LEY     + + G   +P+ PQLP FNDTATATAFT Q++S   +   V  + DES
Sbjct  308   TTAILEYKSAPCSAKKGQPVKPIFPQLPGFNDTATATAFTAQIKS--PSQVKVPIEIDES  365

Query  1074  LFFTVGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLD  901
             LFFTVGLGL+NC+    PRCQGPN TRFAAS+NNVSFVLPRR SL+QAYY   PGI+T D
Sbjct  366   LFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNVSFVLPRRNSLMQAYYQGQPGIFTAD  425

Query  900   FPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYH  721
             FPPVPP+ FDYTGNVSR LWQP  GTKL+K+K+GS VQ+V QDT+I T EDHP+HLHGY 
Sbjct  426   FPPVPPIPFDYTGNVSRGLWQPVKGTKLFKLKFGSTVQIVFQDTSIVTVEDHPMHLHGYQ  485

Query  720   FWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSH  541
             F+VVG GFGNF+P+ D AKFNL+DPP RNTI  P GGW  IRF ADNPG+WL+HCHID+H
Sbjct  486   FYVVGSGFGNFDPRNDPAKFNLIDPPQRNTIGTPPGGWVAIRFVADNPGIWLLHCHIDTH  545

Query  540   LAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             L WGLA AF+VENG G+ QTV+PPPLDLP C
Sbjct  546   LPWGLATAFLVENGVGKLQTVQPPPLDLPPC  576



>ref|XP_002319955.1| laccase family protein [Populus trichocarpa]
 gb|EEE95878.1| laccase family protein [Populus trichocarpa]
Length=576

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/562 (68%), Positives = 451/562 (80%), Gaps = 9/562 (2%)
 Frame = -3

Query  2115  KLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvv  1936
              +FV+ +  A  + A+ + +EFV+Q   + RLC+T   ITVNG FPGPT+ VR+GD +V+
Sbjct  18    SIFVIFSFQAHFSEAETHYREFVIQAKPVKRLCRTHNTITVNGLFPGPTLEVRDGDTLVI  77

Query  1935  kvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAH  1756
             K VN ARYNVT+HWHG+RQ+R PWADGP+ VTQCPI PG +YTYRF IENQEGTLWWHAH
Sbjct  78    KAVNNARYNVTLHWHGIRQLRNPWADGPDRVTQCPIRPGRSYTYRFTIENQEGTLWWHAH  137

Query  1755  SRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             SRWLRATVYGA II+PK GS +PF  P+ +IPILLGEWW+R+ + + R   FTGAAPNIS
Sbjct  138   SRWLRATVYGALIIHPKLGSPYPFPMPRTEIPILLGEWWDRNPMDVLRIADFTGAAPNIS  197

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
             +AYTINGQPGDLYRCS Q+TV+F V  GET+LLRVIN+ALNQ+LFF VANH L VV  DA
Sbjct  198   DAYTINGQPGDLYRCSKQETVRFPVGSGETILLRVINSALNQELFFGVANHILTVVAVDA  257

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYT-  1219
             AY KPFTT+VIM+ PGQTT+VLLTADQ P  YYMAARAY +A    FDNTTTTA+LEY  
Sbjct  258   AYTKPFTTSVIMIAPGQTTDVLLTADQTPGHYYMAARAYNSANAP-FDNTTTTAILEYKT  316

Query  1218  ---NLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGL  1048
                N + G  S P+ P+LP FNDT +A AFT++LRS PS       Q DE+LFFTVGLGL
Sbjct  317   APRNAKKGKQSTPIFPRLPGFNDTNSAIAFTSRLRS-PSKVKVPL-QIDENLFFTVGLGL  374

Query  1047  VNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             +NCT    PRCQGPN TRFAAS+NN+SFVLP+R SL+QAYY   PGI+T DFPPVPPV+F
Sbjct  375   INCTNPNSPRCQGPNGTRFAASINNMSFVLPKRNSLMQAYYQGQPGIFTTDFPPVPPVKF  434

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             DYTGNVSR LWQP   TKLYK+K+G++VQ+VLQDT+I T EDHP+HLHGYHF V+G GFG
Sbjct  435   DYTGNVSRGLWQPVKSTKLYKLKFGAKVQIVLQDTSIVTVEDHPMHLHGYHFAVIGSGFG  494

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NFNPQTD A+FNL+DPP RNTI  P GGW  IRF ADNPG+W MHCH+DSHL WGL MAF
Sbjct  495   NFNPQTDPARFNLIDPPYRNTIGTPPGGWVAIRFEADNPGIWFMHCHLDSHLNWGLGMAF  554

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +VENG G+ Q+V+PPPLDLPRC
Sbjct  555   LVENGVGKLQSVQPPPLDLPRC  576



>ref|XP_010685887.1| PREDICTED: laccase-3-like [Beta vulgaris subsp. vulgaris]
Length=563

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/561 (67%), Positives = 450/561 (80%), Gaps = 7/561 (1%)
 Frame = -3

Query  2127  GFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngd  1948
             G +  L ++L   A LA A+ +   FV+Q T + RLC    I+TVNGQFPGPT+ VRNGD
Sbjct  9     GLIIGLSIIL-AYACLARAETHYHNFVIQPTPVKRLCNNHVIMTVNGQFPGPTLQVRNGD  67

Query  1947  dvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLW  1768
              VV+K  N  +YN+T+HWHG+RQMRTPWADGPEYVTQCPI PGGTYTYR+ IE QEGTLW
Sbjct  68    TVVIKATNAGKYNITLHWHGVRQMRTPWADGPEYVTQCPIRPGGTYTYRYTIEEQEGTLW  127

Query  1767  WHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAA  1588
             WHAHS+WLRATVYGA +IYPK GS +PF +P ++ P++LGEWWNRD + + +Q+  TGAA
Sbjct  128   WHAHSQWLRATVYGALVIYPKLGSSYPFPKPAREFPLILGEWWNRDPMQVLQQSMITGAA  187

Query  1587  PNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVV  1408
             PN+S+AYTINGQPGDLY CSS+DT  F V  GET+LLR+INAALNQQLFF++ANH++ +V
Sbjct  188   PNVSDAYTINGQPGDLYSCSSRDTTTFPVKAGETILLRIINAALNQQLFFAIANHQMTIV  247

Query  1407  GADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVL  1228
              ADAAY KPFTTN++M+GPGQTTNVL+TA+QPP RYY+AA AY++A    FDNTTTTA+L
Sbjct  248   EADAAYTKPFTTNIVMIGPGQTTNVLITANQPPGRYYIAATAYSSAPGVAFDNTTTTAIL  307

Query  1227  EYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGL  1048
             EYT+ R    SRP++PQLP +NDT TA +FT Q RS+      V  Q D++LFFT+ LG 
Sbjct  308   EYTSRR---FSRPVLPQLPAWNDTNTANSFTAQFRSISRGK--VPLQIDQNLFFTINLGS  362

Query  1047  VNCT-PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFD  871
             +NC+ P  RCQ PNNTRF ASMNNVSFVLPRR S+LQA Y N PG++T DFPPVPP+QFD
Sbjct  363   INCSRPSFRCQAPNNTRFTASMNNVSFVLPRRNSILQAMYQNTPGVFTTDFPPVPPLQFD  422

Query  870   YTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             YTGNVSR LW P  GTKLYK+K+GS VQ++LQ+T I T EDHP+HLHGYHF+VVG G GN
Sbjct  423   YTGNVSRGLWTPTRGTKLYKLKFGSHVQIILQNTNIVTVEDHPMHLHGYHFFVVGTGKGN  482

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             FNPQTD A+FNLVDPPVRNT+    GGW  IRF ADNPGVWLMHCH+D H+ WGLAM F+
Sbjct  483   FNPQTDPARFNLVDPPVRNTVGTTPGGWVAIRFIADNPGVWLMHCHLDVHIGWGLAMVFL  542

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             VENG GE QT+E PP DLP+C
Sbjct  543   VENGVGELQTLEAPPRDLPQC  563



>ref|XP_011021001.1| PREDICTED: laccase-13-like [Populus euphratica]
Length=576

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/580 (67%), Positives = 459/580 (79%), Gaps = 10/580 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M+++N T        FL+ +FV+ +  A  + A+ + +EFV+Q   + RLC+T   ITVN
Sbjct  1     METRNLTVKQVSYRLFLS-IFVIFSFQAHFSEAETHYREFVIQAKPVKRLCRTHNTITVN  59

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             G FPGPT+ VR+GD +V+K VN ARYNVT+HWHG+RQ+R PWADGP+ +TQCPI PG +Y
Sbjct  60    GLFPGPTLEVRDGDSLVIKAVNNARYNVTLHWHGIRQLRNPWADGPDRITQCPIQPGRSY  119

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYRF IENQEGTLWWHAHS+WLRATVYGA II+PK GS +PF  P+ +IPILLGEWW+R+
Sbjct  120   TYRFTIENQEGTLWWHAHSKWLRATVYGALIIHPKLGSPYPFPMPRTEIPILLGEWWDRN  179

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              + + R   FTGAAPNIS+AYTINGQPGDLYRCS Q+TV+F V  GET+LLRVINAALNQ
Sbjct  180   PMDVLRLADFTGAAPNISDAYTINGQPGDLYRCSKQETVRFPVGSGETILLRVINAALNQ  239

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             +LFF VANHKL VV  DAAY KPFTT+VIM+ PGQTT+VLLTADQ P +YYMAA AY +A
Sbjct  240   ELFFGVANHKLTVVAVDAAYTKPFTTSVIMISPGQTTDVLLTADQTPGQYYMAAHAYNSA  299

Query  1269  qnaPFDNTTTTAVLEY----TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNP  1102
                 FDNTTTTA+LEY     N + G  S P+ P+LP FNDT +A AFT+ LRS PS   
Sbjct  300   NAP-FDNTTTTAILEYKTAPCNAKKGKQSTPIFPRLPGFNDTNSAIAFTSGLRS-PSKVK  357

Query  1101  TVFNQPDESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYN  928
                 Q DE+LFFTVGLGL+NC     PRCQGPN TRFAAS+NNVSFVLP+R SL+QAYY 
Sbjct  358   VPL-QIDENLFFTVGLGLINCPNPNSPRCQGPNGTRFAASINNVSFVLPKRNSLMQAYYQ  416

Query  927   NIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTED  748
               PGI+T DFPPVPPV+FDYTGNVSR LWQP   TKLYK+K+G++VQ+V QDT+I T ED
Sbjct  417   GQPGIFTTDFPPVPPVKFDYTGNVSRGLWQPVKATKLYKLKFGAKVQIVFQDTSIVTVED  476

Query  747   HPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVW  568
             HP+HLHGYHF V+G GFGNFNPQTD A+FNL+DPP RNTI  P GGW  IRF ADNPG+W
Sbjct  477   HPMHLHGYHFAVIGSGFGNFNPQTDPARFNLIDPPYRNTIGAPPGGWVAIRFEADNPGIW  536

Query  567   LMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             L+HCH+DSHL WGL MAF+VENG G+ Q+V+PPPLDLPRC
Sbjct  537   LLHCHLDSHLNWGLGMAFLVENGVGKLQSVQPPPLDLPRC  576



>ref|XP_010542673.1| PREDICTED: laccase-3-like [Tarenaya hassleriana]
Length=564

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/570 (66%), Positives = 455/570 (80%), Gaps = 11/570 (2%)
 Frame = -3

Query  2148  SLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPT  1969
             SL P    F   + + ++ L+S A+A+++ +EFV++   + RLC+T   ITVNGQFPGPT
Sbjct  3     SLPPILLSF--SILICISFLSSFASAELHVREFVIEARPVKRLCRTHQTITVNGQFPGPT  60

Query  1968  IAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIE  1789
             + VRNGD + + VVN+ARYN++IHWHG+RQ+R PWADGPE++TQCPI PG +YTYRF IE
Sbjct  61    LEVRNGDSLAITVVNKARYNISIHWHGIRQLRNPWADGPEFITQCPIRPGQSYTYRFTIE  120

Query  1788  NQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQ  1609
              QEGTLWWHAHSRWLRATVYGA IIYP+ GS +PF  PK+DIPILLGEWW+R+ + + RQ
Sbjct  121   GQEGTLWWHAHSRWLRATVYGALIIYPRLGSPYPFPMPKRDIPILLGEWWDRNPMDVLRQ  180

Query  1608  TQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVA  1429
              QFTGAAPN+S+AYTINGQPGDLYRCS + T++F V PGETV LR+INAA+NQ+LFF+VA
Sbjct  181   AQFTGAAPNVSDAYTINGQPGDLYRCSRRGTLRFPVFPGETVQLRLINAAMNQELFFAVA  240

Query  1428  NHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDN  1249
             NH+L VV  D+AY KPFTTNV+M+ PGQTTNVLLTA+Q     Y  A     + NAPFDN
Sbjct  241   NHRLTVVEVDSAYTKPFTTNVVMIAPGQTTNVLLTANQ-RPGRYYIAARAYNSANAPFDN  299

Query  1248  TTTTAVLEYTNL-RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESL  1072
             TTTTA+LEY N  R  A+   + P+LP FNDTAT TAFT +LRSV      +  + DE+L
Sbjct  300   TTTTAILEYVNAPRRTAH---VFPRLPGFNDTATVTAFTNRLRSVRREGLPL--EIDENL  354

Query  1071  FFTVGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDF  898
             FFTVGLGL+NC+    PRCQGPN TRFAASMNNVSFVLP R SL+QAYY    G++T DF
Sbjct  355   FFTVGLGLINCSNPNSPRCQGPNGTRFAASMNNVSFVLPSRNSLMQAYYQGKRGVFTTDF  414

Query  897   PPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHF  718
             PPVPPV+FDYTGNVSR LWQP  GTK+YK+KY ++VQ+VLQDT+I T E+HP+HLHGY F
Sbjct  415   PPVPPVKFDYTGNVSRGLWQPSRGTKVYKLKYKAKVQIVLQDTSIVTAENHPMHLHGYQF  474

Query  717   WVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHL  538
             +VVG GFGNF+P+ D AKFNLVDPP RNTI  P GGW  +RF ADNPG+W MHCHIDSHL
Sbjct  475   YVVGSGFGNFDPKRDPAKFNLVDPPERNTIGTPPGGWVAMRFIADNPGIWFMHCHIDSHL  534

Query  537   AWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
              WGLAMA +VENG+GE QTV+PPPLDLPRC
Sbjct  535   GWGLAMALLVENGKGELQTVQPPPLDLPRC  564



>ref|XP_006425169.1| hypothetical protein CICLE_v10030322mg [Citrus clementina]
 gb|ESR38409.1| hypothetical protein CICLE_v10030322mg [Citrus clementina]
Length=578

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/581 (67%), Positives = 467/581 (80%), Gaps = 13/581 (2%)
 Frame = -3

Query  2163  SQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQ  1984
              +N+  + P+ +  L  L  +   LASL++A+++  EFV++   + RLC+T + +TVNGQ
Sbjct  2     KRNDQIVQPWSSCLLLGLLFIFAFLASLSHAEIHYHEFVIEARPVKRLCRTHSTVTVNGQ  61

Query  1983  FPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTY  1804
             FPGPT+ VRNGD +V++ +NRARYNVT+HWHG+RQ R PWADGPEYVTQCPI PG +YTY
Sbjct  62    FPGPTLQVRNGDTLVIRAINRARYNVTLHWHGVRQTRNPWADGPEYVTQCPIQPGRSYTY  121

Query  1803  RFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDII  1624
             RF IE+QEGTLWWHAHSRWLRATVYGA I+YP+ GS +PF  PKK+IPIL+GEWW+RD +
Sbjct  122   RFTIEDQEGTLWWHAHSRWLRATVYGALIVYPRMGSPYPFPMPKKEIPILIGEWWDRDPM  181

Query  1623  ALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQL  1444
              + RQ  FTG APNIS+A TINGQPGDLYRCSS++TV+F V  GET+LLR+IN+A+NQ+ 
Sbjct  182   DVLRQALFTGGAPNISDALTINGQPGDLYRCSSKETVRFPVEAGETILLRIINSAMNQEH  241

Query  1443  FFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqn  1264
             FF VANHKL VVG D +Y KPF+T+VIM+ PGQTTNVLLTAD+PPARYYMAA AY TA  
Sbjct  242   FFGVANHKLTVVGVDTSYTKPFSTSVIMIAPGQTTNVLLTADRPPARYYMAAHAYNTANA  301

Query  1263  aPFDNTTTTAVLEYT----NLRPGAN--SRPLMPQLPFFNDtatataftTQLRSVPSNN-  1105
             A FDNTTTTA+LEY     N + G +  S P+ P LP FNDTATATAFT +++S+     
Sbjct  302   A-FDNTTTTAILEYKSAPFNGKKGKSRSSAPIFPILPGFNDTATATAFTARIKSLHQVQV  360

Query  1104  PTVFNQPDESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYY  931
             PTV    DE+LFFTVGLGL+NC+    PRCQGPN TRFAAS+NN+SFV PRR SL+QAY 
Sbjct  361   PTVI---DENLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYI  417

Query  930   NNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTE  751
                PGI+T DFPPVPP+ FDYTGNVSR LWQP   TKLYK+K+GSRVQ+V QDT+I + E
Sbjct  418   QGQPGIFTTDFPPVPPIIFDYTGNVSRGLWQPRKRTKLYKLKFGSRVQIVFQDTSIVSVE  477

Query  750   DHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGV  571
             DHP+HLHG+ F+VVG GFGNFNP TDTAKFNL+DPP RNTI  P GGW  +RF A+NPG+
Sbjct  478   DHPMHLHGHEFYVVGSGFGNFNPSTDTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGI  537

Query  570   WLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             WL+HCHIDSHL WGLAMAF+VENG G+ QTV+PPPLDLPRC
Sbjct  538   WLLHCHIDSHLTWGLAMAFLVENGVGKLQTVQPPPLDLPRC  578



>gb|KDP45752.1| hypothetical protein JCGZ_17359 [Jatropha curcas]
Length=570

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/567 (68%), Positives = 459/567 (81%), Gaps = 9/567 (2%)
 Frame = -3

Query  2130  NGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrng  1951
             N FL  +FV+ + LA+ + A+++  EFV+Q   + RLC+T   ITVNGQFPGPT+ VRNG
Sbjct  7     NIFLV-IFVIFSFLAANSQAEIHYHEFVIQAKPVKRLCRTHNTITVNGQFPGPTLQVRNG  65

Query  1950  ddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTL  1771
             D +V+K +N A+YNVT+HWHG+RQ+R PWADGP+ VTQCPI PG +YTYRF I+NQEGTL
Sbjct  66    DSLVIKAINNAQYNVTLHWHGIRQLRNPWADGPDMVTQCPIRPGRSYTYRFTIQNQEGTL  125

Query  1770  WWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             WWHAHS+WLRATVYGA IIYPK GS +PF  PK++IPILLGEWW+R+ + + +   FTGA
Sbjct  126   WWHAHSKWLRATVYGALIIYPKLGSSYPFPMPKQEIPILLGEWWDRNPMDVLKLATFTGA  185

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APN+S+AYTINGQPGDLYRCS ++T  F V+ GET+LLR+IN+A+NQ+LFF++ANHK+ V
Sbjct  186   APNVSDAYTINGQPGDLYRCSQKETAVFPVASGETILLRIINSAMNQELFFAIANHKMTV  245

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             V  DAAY KPFTT+VI++ PGQTT VLLTADQ P RYYMAARAY  AQNAPFDNTTTTA+
Sbjct  246   VEVDAAYTKPFTTSVIVISPGQTTTVLLTADQTPGRYYMAARAYHPAQNAPFDNTTTTAI  305

Query  1230  LEYT----NLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFT  1063
             L+YT    N + G +  P++PQLP +NDT T TAFT QLRS       V  Q DE+LFFT
Sbjct  306   LQYTSAPCNTKKGKSLPPILPQLPAYNDTNTVTAFTGQLRS--PQKVEVPIQIDENLFFT  363

Query  1062  VGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             VGLGL+NCT    PRCQGPN TRF AS+NNVSFVLP R SL+QAYY   PGI+T DFPPV
Sbjct  364   VGLGLINCTNPNSPRCQGPNGTRFTASINNVSFVLPTRNSLMQAYYQGQPGIFTTDFPPV  423

Query  888   PPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PP+QFDYTGNVSR LW P   TKLYK+KYGS+VQ+V QDT+I T +DHP+HLHGYHF VV
Sbjct  424   PPLQFDYTGNVSRGLWTPVKRTKLYKLKYGSKVQIVFQDTSIVTPDDHPMHLHGYHFAVV  483

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
             G GFGNFNP TDT KFNL+DPP RNTI  P GGW  IRF ADNPG+WL+HCH+DSHL WG
Sbjct  484   GTGFGNFNPGTDTVKFNLIDPPFRNTIGAPPGGWVAIRFVADNPGIWLLHCHLDSHLTWG  543

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAM+F+VENG G+ Q+V+PPPLDLP+C
Sbjct  544   LAMSFLVENGAGQLQSVQPPPLDLPQC  570



>ref|XP_003615861.1| Laccase-like multicopper oxidase [Medicago truncatula]
 gb|AES98819.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=560

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/561 (68%), Positives = 453/561 (81%), Gaps = 8/561 (1%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANA-DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             L  L  +LT++ S A+A + +  +FV+Q   + RLCKT+ I+TVNGQFPGPTI  R+GD 
Sbjct  5     LCYLLGLLTIIVSFASAAENHYHQFVIQTATVKRLCKTRRILTVNGQFPGPTIEARDGDS  64

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +V+KV N   YN++IHWHG R +R PWADGP YVTQCPI PGG+YTYRF I+NQEGTLWW
Sbjct  65    MVIKVTNAGPYNISIHWHGFRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWW  124

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAH+ +LRATVYGAFIIYPK GS +PFS P ++ PILLGEW++RD +AL RQTQFTGA P
Sbjct  125   HAHTGFLRATVYGAFIIYPKMGSPYPFSMPTREFPILLGEWFDRDPMALLRQTQFTGAPP  184

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S AYT+NGQPGDLYRCSSQ TV+F V  GET+LLR+IN+ALNQ+LFFS+ANH++ VV 
Sbjct  185   NVSVAYTMNGQPGDLYRCSSQGTVRFQVYAGETILLRIINSALNQELFFSIANHRMTVVA  244

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
              DAAY KP  T V+M+GPGQT NVL+TADQPP RYYMAARAY TA NA FDNTTTTA+LE
Sbjct  245   MDAAYTKPSNTRVLMIGPGQTINVLVTADQPPGRYYMAARAYQTAMNAAFDNTTTTAILE  304

Query  1224  YTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLV  1045
             Y N  P   SRP++P LPFFNDTAT+TAFT+++R +  +   VF   D SL FTVGLGL+
Sbjct  305   YRNRPP---SRPILPVLPFFNDTATSTAFTSRIRGL--SKIKVFQNVDVSLLFTVGLGLI  359

Query  1044  NCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFD  871
             NCT    PRCQGPN TRFAAS+NN SFVLPR TSL+QAYYN +PGI+T DFPPVPP+QF+
Sbjct  360   NCTNPNSPRCQGPNGTRFAASINNNSFVLPRTTSLMQAYYNGVPGIFTTDFPPVPPIQFN  419

Query  870   YTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             YTGNV R LW P  GTKL+K+KYGS VQ+VLQDT+I T EDHP+H+HG+HF+VVG GFGN
Sbjct  420   YTGNVPRGLWTPRKGTKLFKLKYGSNVQIVLQDTSIVTVEDHPMHVHGFHFFVVGSGFGN  479

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             FNP+TD A FNLVDPPVRNTI  P GGW  IRF ADNPG+W +HCHIDSHL WGL  A +
Sbjct  480   FNPRTDPATFNLVDPPVRNTIGTPPGGWVAIRFKADNPGIWFLHCHIDSHLNWGLGTALL  539

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             VENG G  Q+V PPP DLP+C
Sbjct  540   VENGVGPLQSVIPPPPDLPQC  560



>ref|XP_009141050.1| PREDICTED: laccase-3 [Brassica rapa]
 emb|CDY29689.1| BnaA04g17380D [Brassica napus]
Length=570

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/565 (67%), Positives = 444/565 (79%), Gaps = 10/565 (2%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
                   +L   A LA+A+++ +EFV++   + RLC+T   ITVNGQFPGPT+ VRNGD +
Sbjct  9     FVSFIALLAYFAFLASAELHVREFVIEPKPVKRLCRTHQSITVNGQFPGPTLEVRNGDSL  68

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
              + V+NRARYN++IHWHG+RQ+R PWADGPEY+TQCPI PG +YTYRF IE+QEGTLWWH
Sbjct  69    AITVINRARYNISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFTIEDQEGTLWWH  128

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHSRWLRATVYGA IIYP+ GS +PFS PK+DIPILLGEWW+R+ + + RQ QFTGAA N
Sbjct  129   AHSRWLRATVYGALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAAN  188

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+AYTINGQPGDLYRCS  +TV+F + PGETV LRVINA LNQ+LFFSVANH+L VV  
Sbjct  189   VSDAYTINGQPGDLYRCSRAETVRFPIFPGETVQLRVINAGLNQELFFSVANHQLTVVET  248

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             D+AY KPFTT+VIM+GPGQTTNVLLTA+Q     Y  A     + NAPFDNTTTTA+LEY
Sbjct  249   DSAYTKPFTTSVIMIGPGQTTNVLLTANQ-RPGRYYMAARAYNSANAPFDNTTTTAILEY  307

Query  1221  TNL-----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
              N      R      P+ P LP FNDTATATAFT +LR        V  Q DE+LFFTVG
Sbjct  308   VNAPTRRGRGRGQIAPVFPVLPGFNDTATATAFTNRLRYW--KRAPVPLQVDENLFFTVG  365

Query  1056  LGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             LGL NC+    PRCQGPN TRFAAS+NN SFVLPRR S++QAYY  +PGI+T DFPPVPP
Sbjct  366   LGLTNCSNPNSPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPVPP  425

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             VQFDYTGNVSR LWQP  GTK YK+KY + VQ+VLQDT+I TTE+HP+HLHGY F+VVG 
Sbjct  426   VQFDYTGNVSRGLWQPVKGTKAYKLKYRANVQIVLQDTSIVTTENHPMHLHGYQFYVVGS  485

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNFNP+TD A+FNL DPP RNT+  P GGW  IRF ADNPG W MHCHIDSHL WGLA
Sbjct  486   GFGNFNPRTDPARFNLYDPPERNTVGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLA  545

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG+G+ Q+V+ PPLDLPRC
Sbjct  546   MVFLVENGRGQLQSVQAPPLDLPRC  570



>ref|XP_006296399.1| hypothetical protein CARUB_v10025575mg [Capsella rubella]
 gb|EOA29297.1| hypothetical protein CARUB_v10025575mg [Capsella rubella]
Length=570

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/565 (67%), Positives = 444/565 (79%), Gaps = 10/565 (2%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
                +  +L   A LA+A+++ +EFV++   + RLC+T   ITVNGQFPGPT+ VRNGD +
Sbjct  9     FVSIIALLAYFAFLASAELHVREFVIEPRPVKRLCRTHQSITVNGQFPGPTLEVRNGDSL  68

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
              + V+NRARYN++IHWHGLRQMR PWADGPEY+TQCPI PG +YTY+F IE+QEGTLWWH
Sbjct  69    AITVINRARYNISIHWHGLRQMRNPWADGPEYITQCPIRPGQSYTYKFTIEDQEGTLWWH  128

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHSRWLRATVYGA IIYP+ GS +PFS PK+DIPILLGEWW+R+ + + RQ QFTGAA N
Sbjct  129   AHSRWLRATVYGALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAAN  188

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+AYTINGQPGDLYRCS   T++F + PGETV LRVINA +NQ+LFFSVANH+L VV  
Sbjct  189   VSDAYTINGQPGDLYRCSRAGTMRFPIFPGETVQLRVINAGMNQELFFSVANHQLTVVET  248

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             D+AY KPFTTNVIM+GPGQTTNVL+TA+Q     Y  A     + NAPFDNTTTTA+LEY
Sbjct  249   DSAYTKPFTTNVIMLGPGQTTNVLITANQ-RPGRYYMAARAYNSANAPFDNTTTTAILEY  307

Query  1221  TNL-----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
              N      R      P+ P LP FNDTATATAFT +LR        V  Q DE+LFFTVG
Sbjct  308   VNAPTRRGRGRGQIAPVFPVLPGFNDTATATAFTNRLRY--WKRAPVPQQIDENLFFTVG  365

Query  1056  LGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             LGL+NC     PRCQGPN TRFAASMNN+SFVLPR  S++QAYY  IPGI+T DFPPVPP
Sbjct  366   LGLINCVNPNSPRCQGPNGTRFAASMNNMSFVLPRTNSVMQAYYQGIPGIFTTDFPPVPP  425

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             VQ+DYTGNVSRALWQP  GTK Y++KY + VQ+VLQDT+I T E+HP+HLHGY F+VVG 
Sbjct  426   VQYDYTGNVSRALWQPIKGTKAYQLKYKAHVQIVLQDTSIVTPENHPMHLHGYQFYVVGS  485

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNFNP+TD A+FNL DPP RNTI  P GGW  IRF ADNPG W MHCHIDSHL WGLA
Sbjct  486   GFGNFNPRTDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLA  545

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG+G+ Q+V+ PPLDLPRC
Sbjct  546   MVFLVENGRGQLQSVQAPPLDLPRC  570



>ref|XP_002881090.1| hypothetical protein ARALYDRAFT_481932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57349.1| hypothetical protein ARALYDRAFT_481932 [Arabidopsis lyrata subsp. 
lyrata]
Length=570

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/565 (67%), Positives = 444/565 (79%), Gaps = 10/565 (2%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
                   +L   A LA+A+ + Q+FV+  T + RLC+T   ITVNGQFPGPT+ VRNGD +
Sbjct  9     FVSFIALLAYFAFLASAEHHVQQFVIIPTPVKRLCRTHQSITVNGQFPGPTLIVRNGDSL  68

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
              + V+NRARYN++IHWHG+RQ+R PWADGPEY+TQCPI PG +YTYRFKIE+QEGTLWWH
Sbjct  69    AITVINRARYNISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFKIEDQEGTLWWH  128

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHSRWLRATVYGA IIYP+ GS +PFS PK+DIPILLGEWW+R+ + + RQ QFTGAA N
Sbjct  129   AHSRWLRATVYGALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAAN  188

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+AYTINGQPGDLYRCS   T++F + PGETV LRVINAA+NQ+LFFSVANH+  VV  
Sbjct  189   VSDAYTINGQPGDLYRCSRAGTIRFPIFPGETVQLRVINAAMNQELFFSVANHQFTVVET  248

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             D+AY KPFTT+VIM+GPGQTTN+LLTA+Q     Y  A     + NAPFDNTTTTA+L+Y
Sbjct  249   DSAYTKPFTTSVIMIGPGQTTNLLLTANQ-RPGRYYMAARAYNSANAPFDNTTTTAILQY  307

Query  1221  TNL-----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
              N      R      P+ P LP FNDTATATAFT +LR        V  Q DE+LFFTVG
Sbjct  308   VNAPTRRGRGRGQIAPVFPVLPGFNDTATATAFTNRLRYW--KRAPVPQQVDENLFFTVG  365

Query  1056  LGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             LGL+NC+    PRCQGPN TRFAASMNN+SFVLPRR S++QAYY  +PGI+T DFPPVPP
Sbjct  366   LGLINCSNPNSPRCQGPNGTRFAASMNNMSFVLPRRNSVMQAYYQGMPGIFTTDFPPVPP  425

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             VQFDYTGNVSR LWQP  GTK YK+KY + VQ+VLQDT+I T E+HP+HLHGY F+VVG 
Sbjct  426   VQFDYTGNVSRGLWQPIKGTKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGS  485

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNFNP+TD A+FNL DPP RNTI  P GGW  IRF ADNPG W MHCHIDSHL WGLA
Sbjct  486   GFGNFNPRTDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLA  545

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG+G+ Q+V+ PPLDLPRC
Sbjct  546   MVFLVENGRGQLQSVQAPPLDLPRC  570



>ref|XP_006488594.1| PREDICTED: laccase-3-like [Citrus sinensis]
Length=578

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/576 (67%), Positives = 463/576 (80%), Gaps = 13/576 (2%)
 Frame = -3

Query  2148  SLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPT  1969
             ++ P+ +  L  L  +   LASL++A+++  EFV++   + RLC+T + +TVNGQFPGPT
Sbjct  7     TVKPWSSCLLLGLLFIFAFLASLSHAEIHYHEFVIEARPVKRLCRTHSTVTVNGQFPGPT  66

Query  1968  IAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIE  1789
             + VRNGD +V++ +NRARYNVT+HWHG+ Q R PWADGPEYVTQCPI PG +YTYRF IE
Sbjct  67    LQVRNGDTLVIRAINRARYNVTLHWHGVHQTRNPWADGPEYVTQCPIQPGRSYTYRFTIE  126

Query  1788  NQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQ  1609
             +QEGTLWWHAHSRWLRATVYGA I+YP+ GS +PF  PK++IPIL+GEWW+RD + + RQ
Sbjct  127   DQEGTLWWHAHSRWLRATVYGALIVYPRMGSPYPFPMPKREIPILIGEWWDRDPMDVLRQ  186

Query  1608  TQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVA  1429
               FTG APNIS+A TINGQPGDLYRCSS++TV+F V  GET+LLR+IN+A+NQ+ FF VA
Sbjct  187   ALFTGGAPNISDALTINGQPGDLYRCSSKETVRFPVEAGETILLRIINSAMNQEHFFGVA  246

Query  1428  NHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDN  1249
             NH+L VVG D +Y KPF T+VIM+ PGQTTNVLLTADQPPARYYMAA AY TA  A FDN
Sbjct  247   NHRLTVVGVDTSYTKPFPTSVIMIAPGQTTNVLLTADQPPARYYMAAHAYNTANAA-FDN  305

Query  1248  TTTTAVLEYT----NLRPGAN--SRPLMPQLPFFNDtatataftTQLRSVPSNN-PTVFN  1090
             TTTTA+LEY     N + G +  S P+ P LP FNDTATATAFT +++S+     PTV  
Sbjct  306   TTTTAILEYKSAPFNGKKGKSRSSAPIFPILPGFNDTATATAFTARIKSLHQVQVPTVI-  364

Query  1089  QPDESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPG  916
               DE+LFFTVGLGL+NC+    PRCQGPN TRFAAS+NN+SFV PRR SL+QAY    PG
Sbjct  365   --DENLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNISFVFPRRNSLMQAYIQGQPG  422

Query  915   IYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIH  736
             I+T DFPPVPP+ FDYTGNVSR LWQP   TKLYK+K+GSRVQVV QDT+I + EDHP+H
Sbjct  423   IFTTDFPPVPPIIFDYTGNVSRGLWQPRKRTKLYKLKFGSRVQVVFQDTSIVSVEDHPMH  482

Query  735   LHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHC  556
             LHG+ F+VVG GFGNFNP TDTAKFNL+DPP RNTI  P GGW  +RF A+NPG+WL+HC
Sbjct  483   LHGHEFYVVGSGFGNFNPSTDTAKFNLIDPPRRNTIGTPPGGWVAVRFVAENPGIWLLHC  542

Query  555   HIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             HIDSHL WGLAMAF+VENG G+ QTV+PPPLDLPRC
Sbjct  543   HIDSHLTWGLAMAFLVENGVGKLQTVQPPPLDLPRC  578



>ref|XP_003518325.1| PREDICTED: laccase-3-like [Glycine max]
Length=575

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/569 (67%), Positives = 455/569 (80%), Gaps = 12/569 (2%)
 Frame = -3

Query  2133  CNGFLAKLFVMLTVLASLANA-DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvr  1957
             C+ FL  L   L+++ASLA+A + +  EFV+Q   + RLC+T+ I+TVNGQFPGPT+  R
Sbjct  12    CSWFLLGL---LSIIASLASAAENHYHEFVIQTVPVKRLCRTQNILTVNGQFPGPTVEAR  68

Query  1956  ngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEG  1777
             NGD + +KVVN   YN++IHWHGLR +R PWADGP YVTQCPI PGG+YTYRF I+NQEG
Sbjct  69    NGDSLAIKVVNAGPYNISIHWHGLRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEG  128

Query  1776  TLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFT  1597
             TLWWHAH+ +LRATVYGA IIYPK GS +PFS PK++ P+LL EW+NRD + L RQTQFT
Sbjct  129   TLWWHAHTGFLRATVYGALIIYPKLGSPYPFSMPKREYPLLLAEWFNRDPMVLLRQTQFT  188

Query  1596  GAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKL  1417
             GA PN+S AYTINGQPGDLYRCSSQ+TV+  V  GET+LLR+IN+ALNQ+LFF++ANH++
Sbjct  189   GAPPNVSVAYTINGQPGDLYRCSSQETVRVPVDAGETILLRIINSALNQELFFTIANHRM  248

Query  1416  QVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTT  1237
              VV  DAAY KPFTTNV+M+GPGQT NVL+TADQ P RYYMAARAY TA NA FDNTTTT
Sbjct  249   TVVATDAAYTKPFTTNVLMIGPGQTINVLVTADQTPGRYYMAARAYQTAMNAAFDNTTTT  308

Query  1236  AVLEYTNL----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLF  1069
             A+LEY +     + G   RP++P LP FNDTATATA+T  +R +   N  VF   D SL+
Sbjct  309   AILEYKSATCSKKNGQLPRPILPVLPAFNDTATATAYTAGIRGLSKIN--VFTNVDVSLY  366

Query  1068  FTVGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFP  895
             F VGLGL+NCT    PRCQGPN TRFAAS+NN SFVLP  TSL+QAYYN IPG++T DFP
Sbjct  367   FIVGLGLINCTNPNSPRCQGPNGTRFAASINNHSFVLPTTTSLMQAYYNGIPGVFTTDFP  426

Query  894   PVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFW  715
             PVPPVQF+YTGNV R LW P  GTKL+K+KYGS VQ+VLQDT+I TTEDHP+H+HG+HF+
Sbjct  427   PVPPVQFNYTGNVPRGLWTPARGTKLFKLKYGSNVQIVLQDTSIVTTEDHPMHVHGFHFF  486

Query  714   VVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLA  535
             VVG GFGNFNP TD A+FNLVDPPVRNTI  P GGW  IRF ADNPG+W +HCHIDSHL 
Sbjct  487   VVGSGFGNFNPATDPARFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLN  546

Query  534   WGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             WGL  A +VENG G  Q+V PPP DLP+C
Sbjct  547   WGLGTALLVENGVGPSQSVIPPPPDLPQC  575



>ref|XP_009144319.1| PREDICTED: laccase-3 [Brassica rapa]
Length=570

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/562 (67%), Positives = 442/562 (79%), Gaps = 10/562 (2%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
                +L   A LA+A+++ +EFV+Q   + RLC+T   ITVNGQFPGPT+ VRNGD + + 
Sbjct  12    FIALLAYFAFLASAELHVREFVIQPKPVKRLCRTHESITVNGQFPGPTLEVRNGDSLAIT  71

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+N+ARYN++IHWHG+RQ+R PWADGPEY+TQCPI PG +YTYRF IE+QEGTLWWHAHS
Sbjct  72    VINKARYNISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFTIEDQEGTLWWHAHS  131

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             RWLRATVYGA IIYP+ GS +PF  PK+DIPILLGEWW+R+ + + RQ QFTGAA N+S+
Sbjct  132   RWLRATVYGALIIYPRLGSPYPFHMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSD  191

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLYRCS  +TV+F + PGETV LRVINA LNQ+LFFSVANH+L VV  D+A
Sbjct  192   AYTINGQPGDLYRCSRSETVRFPIFPGETVQLRVINAGLNQELFFSVANHQLTVVETDSA  251

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+VIM+GPGQTTNVLLTA+Q     Y  A     + NAPFDNTTTTA+LEY N 
Sbjct  252   YTKPFTTSVIMIGPGQTTNVLLTANQ-RPGRYYMAARAYNSANAPFDNTTTTAILEYVNA  310

Query  1212  -----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGL  1048
                  R      P  P LP FNDTATATAFT +LR        V  Q DE+LFFTVGLGL
Sbjct  311   PTRRGRGRGQIAPGFPVLPGFNDTATATAFTNRLRYW--KRAPVPLQVDENLFFTVGLGL  368

Query  1047  VNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             +NC+    PRCQGPN TRFAAS+NN SFVLPRR S++QAYY  +PGI+T DFPPVPPVQF
Sbjct  369   INCSNPNSPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPVPPVQF  428

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             DYTGNVSR LWQP  GTK YK+KY + VQ+VLQDT+I T E+HP+HLHGY F+VVG GFG
Sbjct  429   DYTGNVSRGLWQPVKGTKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFG  488

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NFNP+TD A+FNL DPP RNTI  P GGW  IRF ADNPG W MHCHIDSHL WGLAM F
Sbjct  489   NFNPRTDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVF  548

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +VENG+G+ Q+V+ PPLDLPRC
Sbjct  549   LVENGRGQLQSVQAPPLDLPRC  570



>emb|CDX97838.1| BnaC04g41010D [Brassica napus]
Length=570

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/565 (67%), Positives = 444/565 (79%), Gaps = 10/565 (2%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
             L     +L   A LA+A+++ +EFV++   + RLC+T   ITVNGQFPGPT+ VRNGD +
Sbjct  9     LVSFIALLAYFAFLASAELHVREFVIEPKPVKRLCRTHQSITVNGQFPGPTLEVRNGDSL  68

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
              + V+NRARYN++IHWHG+RQ+R PWADGPEY+TQCPI PG +YTYRF IE+QEGTLWWH
Sbjct  69    AITVINRARYNISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFTIEDQEGTLWWH  128

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHSRWLRATVYGA IIYP+ GS +PFS PK+DIPILLGEWW+R+ + + R  QFTGAA N
Sbjct  129   AHSRWLRATVYGALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRLAQFTGAAAN  188

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+AYTINGQPGDLYRCS  +TV+F + PGETV LRVINA LNQ+LFFSVANH+L VV  
Sbjct  189   VSDAYTINGQPGDLYRCSRAETVRFPIFPGETVQLRVINAGLNQELFFSVANHQLTVVET  248

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             D+AY KPFTT+VIM+GPGQTTNVLLTA+Q     Y  A     + NAPFDNTTTTA+LEY
Sbjct  249   DSAYTKPFTTSVIMIGPGQTTNVLLTANQ-RPGRYYMAARAYNSANAPFDNTTTTAILEY  307

Query  1221  TNL-----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
              N      R      P+ P LP FNDTATATAFT +LR        V  Q +E+LFFTVG
Sbjct  308   VNAPTRRGRGRGQIVPVFPVLPGFNDTATATAFTNRLRYW--KRARVPLQVNENLFFTVG  365

Query  1056  LGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             LGL NC+    PRCQGPN TRFAAS+NN SFVLPRR S++QAYY  +PGI+T DFPPVPP
Sbjct  366   LGLTNCSNPNSPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPVPP  425

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             VQFDYTGNVSR LWQP  GTK YK+KY + VQ+VLQDT+I TTE+HP+HLHGY F+VVG 
Sbjct  426   VQFDYTGNVSRGLWQPVKGTKAYKLKYRANVQIVLQDTSIVTTENHPMHLHGYQFYVVGS  485

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNFNP+TD A+FNL DPP RNT+  P GGW  IRF ADNPG W MHCHIDSHL WGLA
Sbjct  486   GFGNFNPRTDPARFNLYDPPERNTVGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLA  545

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG+G+ Q+V+ PPLDLPRC
Sbjct  546   MVFLVENGRGQLQSVQAPPLDLPRC  570



>ref|NP_180580.1| laccase 3 [Arabidopsis thaliana]
 sp|Q56YT0.2|LAC3_ARATH RecName: Full=Laccase-3; AltName: Full=Benzenediol:oxygen oxidoreductase 
3; AltName: Full=Diphenol oxidase 3; AltName: Full=Urishiol 
oxidase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16927.1| putative laccase [Arabidopsis thaliana]
 gb|AAM14916.1| putative laccase [Arabidopsis thaliana]
 gb|AEC08358.1| laccase 3 [Arabidopsis thaliana]
Length=570

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/565 (67%), Positives = 440/565 (78%), Gaps = 10/565 (2%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
             L     +L   A LA+A+ +  +FV+  T + RLC+T   ITVNGQ+PGPT+ VRNGD +
Sbjct  9     LLSFIALLAYFAFLASAEHHVHQFVITPTPVKRLCRTHQSITVNGQYPGPTLVVRNGDSL  68

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
              + V+NRARYN++IHWHG+RQ+R PWADGPEY+TQCPI PG TYTYRFKIE+QEGTLWWH
Sbjct  69    AITVINRARYNISIHWHGIRQLRNPWADGPEYITQCPIRPGQTYTYRFKIEDQEGTLWWH  128

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHSRWLRATVYGA IIYP+ GS +PFS PK+DIPILLGEWW+R+ + + +Q QFTGAA N
Sbjct  129   AHSRWLRATVYGALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLKQAQFTGAAAN  188

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+AYTINGQPGDLYRCS   T++F + PGETV LRVINA +NQ+LFFSVANH+  VV  
Sbjct  189   VSDAYTINGQPGDLYRCSRAGTIRFPIFPGETVQLRVINAGMNQELFFSVANHQFTVVET  248

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             D+AY KPFTTNVIM+GPGQTTNVLLTA+Q     Y  A     + NAPFDNTTTTA+L+Y
Sbjct  249   DSAYTKPFTTNVIMIGPGQTTNVLLTANQ-RPGRYYMAARAYNSANAPFDNTTTTAILQY  307

Query  1221  TNL-----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
              N      R      P+ P LP FNDTATATAFT +LR        V  Q DE+LFFTVG
Sbjct  308   VNAPTRRGRGRGQIAPVFPVLPGFNDTATATAFTNRLRYW--KRAPVPQQVDENLFFTVG  365

Query  1056  LGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             LGL+NC     PRCQGPN TRFAASMNN+SFVLPR  S++QAYY   PGI+T DFPPVPP
Sbjct  366   LGLINCANPNSPRCQGPNGTRFAASMNNMSFVLPRSNSVMQAYYQGTPGIFTTDFPPVPP  425

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             VQFDYTGNVSR LWQP  GTK YK+KY S VQ+VLQDT+I T E+HP+HLHGY F+VVG 
Sbjct  426   VQFDYTGNVSRGLWQPIKGTKAYKLKYKSNVQIVLQDTSIVTPENHPMHLHGYQFYVVGS  485

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNFNP+TD A+FNL DPP RNTI  P GGW  IRF ADNPG W MHCHIDSHL WGLA
Sbjct  486   GFGNFNPRTDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLA  545

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG+G+ Q+V+ PPLDLPRC
Sbjct  546   MVFLVENGRGQLQSVQAPPLDLPRC  570



>ref|XP_010457861.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=571

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/579 (66%), Positives = 450/579 (78%), Gaps = 13/579 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVM--LTVLASLANADVYNQEFVVQETKITRLCKTKTIIT  1996
             M SQ  T+L     G ++ + V+   T LASL +A+V+ +EFV++   + RLC+T   IT
Sbjct  1     MKSQTPTNL-----GRVSIILVLACCTFLASLTSAEVHVREFVIEAKPVKRLCRTHQTIT  55

Query  1995  VNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGG  1816
             VNGQFPGPT+ VRNGD + + V+NRARYN+++HWHG+RQ+R PWADGPEY+TQCPI PG 
Sbjct  56    VNGQFPGPTLEVRNGDSLAITVINRARYNISLHWHGIRQLRNPWADGPEYITQCPIQPGQ  115

Query  1815  TYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWN  1636
             +YTYR KIE+QEGTLWWHAHS WLRATVYGA IIYP+ GS +PFS PK+DIPI+LGEWW+
Sbjct  116   SYTYRIKIEDQEGTLWWHAHSHWLRATVYGALIIYPRLGSPYPFSMPKRDIPIILGEWWD  175

Query  1635  RDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAAL  1456
             R+ + + R  QFTGAAPN+S+AYTINGQPGDLYRCS  +TV+F + PGETV LR+INAAL
Sbjct  176   RNPMDVLRLAQFTGAAPNVSDAYTINGQPGDLYRCSKPETVRFPIVPGETVQLRLINAAL  235

Query  1455  NQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaaraya  1276
             NQ+LFF+VANH+L VV  D+AY KPFTTNV+M+GPGQTTNVL+TA+Q     Y  A    
Sbjct  236   NQELFFTVANHQLTVVEVDSAYTKPFTTNVVMLGPGQTTNVLITANQ-RPGRYYMAARAY  294

Query  1275  taqnaPFDNTTTTAVLEYTNLRPGANS-RPLMPQLPFFNDtatataftTQLRSVPSNNPT  1099
              + NAPFDNTTTTA+LEY N   G     P+ P LP FNDTATATAF  +LR        
Sbjct  295   NSANAPFDNTTTTAILEYVNAPSGRGQITPVFPVLPGFNDTATATAFVNRLRYY--KRAP  352

Query  1098  VFNQPDESLFFTVGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNN  925
             V  + DE+LFF VGLGL+NCT    PRCQGPN TRFAASMNNVSFVLPR  S++QAYY  
Sbjct  353   VPLKIDENLFFAVGLGLINCTNQNSPRCQGPNGTRFAASMNNVSFVLPRTNSVMQAYYQG  412

Query  924   IPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDH  745
             IPGI T DFPPVPPVQFDYTGNVSR LWQP   TK YK+KY + VQ+VLQDT+I T E+H
Sbjct  413   IPGIITADFPPVPPVQFDYTGNVSRGLWQPVKATKAYKLKYKANVQIVLQDTSIVTPENH  472

Query  744   PIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWL  565
             P+HLHGY F+VVG GFGNF+P+ D A FNL DPP RNTI  P GGW  IRF ADNPG W 
Sbjct  473   PMHLHGYQFYVVGSGFGNFDPKRDPASFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWF  532

Query  564   MHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             MHCHIDSHL WGLAM F+VENG G+ Q+V+PPPLDLPRC
Sbjct  533   MHCHIDSHLGWGLAMVFLVENGVGQLQSVQPPPLDLPRC  571



>ref|XP_009598627.1| PREDICTED: laccase-12-like [Nicotiana tomentosiformis]
Length=578

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/580 (66%), Positives = 462/580 (80%), Gaps = 8/580 (1%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M   N +  NP  +  +  + ++     SLA A ++N +FV+Q T + RLC T++ ITVN
Sbjct  1     MQGFNMSIANPLRSLLIYGILLLFANAVSLAKAKIHNHDFVIQATPVKRLCNTRSTITVN  60

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQFPGPT+ V NGD +VVKVVNRA+YNVTIHWHG+RQMRT WADGPE++TQCPI PGG+Y
Sbjct  61    GQFPGPTLEVNNGDTLVVKVVNRAQYNVTIHWHGVRQMRTAWADGPEFITQCPIRPGGSY  120

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYRF I+ QEGTLWWHAHS WLRATVYGA +I+PK G+ +PF +PK++ PILLGEWW+ +
Sbjct  121   TYRFTIQGQEGTLWWHAHSSWLRATVYGALVIHPKEGTSYPFPKPKRETPILLGEWWDAN  180

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              I + RQ   TGAAPN+S+AYTINGQPGDLY+CSSQDT+   V  GET LLRVINA LNQ
Sbjct  181   PIDVIRQATRTGAAPNVSDAYTINGQPGDLYKCSSQDTMIVHVDSGETNLLRVINAGLNQ  240

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             QLFF+VANHK  VVGADA+Y KPFTT+VIM+GPGQTT+VL+TA+QPPARYYMAARAYA+A
Sbjct  241   QLFFTVANHKFTVVGADASYVKPFTTSVIMLGPGQTTDVLITANQPPARYYMAARAYASA  300

Query  1269  qnaPFDNTTTTAVLEYTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPT  1099
             Q APFDNTTTTA+LEY        G    P++P LP FNDTA+AT FT+  RS  +    
Sbjct  301   QGAPFDNTTTTAILEYKAAPCPAKGVKINPVLPSLPAFNDTASATTFTSSFRS--ARKVE  358

Query  1098  VFNQPDESLFFTVGLGLVNCTPGP---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYN  928
             V  + DE+LFFTVGLGL NC  G     CQGPN TRF ASMNNVSFVLP   SLLQA++ 
Sbjct  359   VPTEIDENLFFTVGLGLNNCPAGASSSSCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQ  418

Query  927   NIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTED  748
              IPG+++ DFP VPPV+FDYTGNVSR+LWQP S TKLYK++YG+RVQ+VLQ T+IFT E+
Sbjct  419   GIPGVFSTDFPAVPPVKFDYTGNVSRSLWQPISATKLYKLRYGARVQIVLQGTSIFTAEN  478

Query  747   HPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVW  568
             HPIHLHGY F+++ +GFGNFNPQTDTAKFNLVDPP+RNT  VPV GW+VIRF ADNPGVW
Sbjct  479   HPIHLHGYDFYILAEGFGNFNPQTDTAKFNLVDPPLRNTASVPVNGWSVIRFVADNPGVW  538

Query  567   LMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +MHCH+D H+ WGLAMAF+VENG  E + +E PP+DLP C
Sbjct  539   IMHCHLDVHITWGLAMAFLVENGVTELEALEEPPVDLPVC  578



>ref|XP_011041833.1| PREDICTED: laccase-13 [Populus euphratica]
Length=611

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/590 (65%), Positives = 456/590 (77%), Gaps = 16/590 (3%)
 Frame = -3

Query  2190  TLQKHPQMDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKT  2011
             T +    M++ N T    +C   L  +FV+ +  AS + A+ +  EFV+Q   + RLC+T
Sbjct  29    TTKAKKAMETHNLTVKQLYC-CLLLGIFVITSFQASFSEAETHYHEFVIQAKPVRRLCRT  87

Query  2010  KTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCP  1831
                ITVNG FPGPT+ VR+GD +V+K +N ARYNVT+HWHG+RQ+R PWADGP+ VTQCP
Sbjct  88    HNTITVNGLFPGPTLEVRDGDTLVIKAINNARYNVTLHWHGVRQLRNPWADGPDRVTQCP  147

Query  1830  IMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILL  1651
             I PG +YTYRF IENQEGTLWWHAHS WLRATVYGA II+PK GS + F  P+++IPILL
Sbjct  148   IQPGRSYTYRFTIENQEGTLWWHAHSSWLRATVYGALIIHPKLGSPYSFPMPRREIPILL  207

Query  1650  GEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRV  1471
             GEWW+R+ + + R   FTGAAPN+S+AYTINGQPGDLYRCS Q+TV+F V PGET+LLRV
Sbjct  208   GEWWDRNPMDVLRLADFTGAAPNVSDAYTINGQPGDLYRCSKQETVRFPVDPGETILLRV  267

Query  1470  INAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyyma  1291
             IN+ LNQ+LFF+VANH L VV  DA   KPF T+ IM+ PGQTT+VLLTADQ P  YYMA
Sbjct  268   INSGLNQELFFAVANHILTVVAVDADCTKPFATSFIMIAPGQTTDVLLTADQTPGHYYMA  327

Query  1290  arayataqnaPFDNTTTTAVLEY----TNLRPGANSRPLMPQLPFFNDtatataftTQLR  1123
             A AY +A    FDNTTTTA+LEY     N   G +S P+ PQLP FNDT++A AFT+ LR
Sbjct  328   AHAYNSANAP-FDNTTTTAILEYKSAPCNANKGKSSTPIFPQLPGFNDTSSAIAFTSSLR  386

Query  1122  SVPSNNPTVFNQP---DESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPR  958
             S     P+  N P   DE+LFFTVGLGL+NCT    PRCQGPN TRFAAS+NNVSFVLP 
Sbjct  387   S-----PSKVNVPLQIDENLFFTVGLGLINCTNPNSPRCQGPNGTRFAASINNVSFVLPT  441

Query  957   RTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVL  778
             R SL+QAYY   PG++T DFPPVPPV+FDYTGNVSR LWQP   TKLYK+K+G++VQ+V 
Sbjct  442   RNSLMQAYYQGQPGVFTTDFPPVPPVKFDYTGNVSRGLWQPVKATKLYKLKFGAKVQIVF  501

Query  777   QDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVI  598
             QDT+I T EDHP+HLHG+HF VVG GFGNFNPQTD AKFNL+DPP RNTI  P GGW  I
Sbjct  502   QDTSIVTVEDHPMHLHGHHFAVVGSGFGNFNPQTDPAKFNLIDPPYRNTIGNPPGGWVAI  561

Query  597   RFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             R  ADNPG+WL+HCH+DSHL WGLAMAF+VENG GE Q+V+PPPLDLP+C
Sbjct  562   RLVADNPGIWLLHCHLDSHLNWGLAMAFLVENGGGELQSVQPPPLDLPQC  611



>ref|XP_006596443.1| PREDICTED: laccase-3-like [Glycine max]
Length=575

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/562 (68%), Positives = 455/562 (81%), Gaps = 9/562 (2%)
 Frame = -3

Query  2112  LFVMLTVLASLANA-DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvv  1936
             L  +L+++ASLA+A + +  EFV+Q   + RLC+T+ I+TVNGQFPGPT+  RNGD + +
Sbjct  16    LLGLLSIIASLASAAENHYHEFVIQTVPVKRLCRTQNILTVNGQFPGPTVEARNGDSLAI  75

Query  1935  kvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAH  1756
             KVVN   YN++IHWHGLR +R PWADGP YVTQCPI PGG+YTYRF I+NQEGTLWWHAH
Sbjct  76    KVVNAGPYNISIHWHGLRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAH  135

Query  1755  SRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             + +LRATVYGA IIYPK GS +PFS PK++ P+LL EW++RD + L RQTQFTGA PN+S
Sbjct  136   TGFLRATVYGALIIYPKLGSPYPFSMPKREYPLLLAEWFDRDPMVLLRQTQFTGAPPNVS  195

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
              AYTINGQPGDLYRCSSQ+TV+  V  GET+LLR+IN+ALNQ+LFF++ANH++ VV  DA
Sbjct  196   VAYTINGQPGDLYRCSSQETVRVPVDAGETILLRIINSALNQELFFAIANHRMTVVATDA  255

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             AY KPFTTNV+M+GPGQT NVL+TADQ P RYYMAARAY TA NA FDNTTTTA+LEY +
Sbjct  256   AYTKPFTTNVLMIGPGQTINVLVTADQTPGRYYMAARAYQTAMNAAFDNTTTTAILEYKS  315

Query  1215  L----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGL  1048
                  + G   RP++P LP FNDTATATA+TT +R +   N  VF + D +L+F VGLGL
Sbjct  316   ASCSKKNGQLPRPILPVLPAFNDTATATAYTTGIRGLSKIN--VFTKVDVNLYFIVGLGL  373

Query  1047  VNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             +NCT    PRCQGPN TRFAAS+NN SFVLP  TSL+QAYYN IPG++T DFPPVPP+QF
Sbjct  374   INCTNPNSPRCQGPNGTRFAASINNHSFVLPTTTSLMQAYYNGIPGVFTTDFPPVPPLQF  433

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             +YTGNV R LW P  GTKL+K+KYGS VQ+VLQDT+I TTEDHP+H+HG+HF+VVG GFG
Sbjct  434   NYTGNVPRGLWTPARGTKLFKLKYGSNVQIVLQDTSIVTTEDHPMHIHGFHFFVVGSGFG  493

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NFNP TD A+FNLVDPPVRNTI  P GGW  IRF ADNPG+W +HCHIDSHL WGLA A 
Sbjct  494   NFNPATDPARFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLATAL  553

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +VENG G  Q+V PPP DLP+C
Sbjct  554   LVENGVGPSQSVIPPPPDLPQC  575



>ref|XP_011014542.1| PREDICTED: laccase-3-like [Populus euphratica]
Length=631

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/590 (64%), Positives = 456/590 (77%), Gaps = 16/590 (3%)
 Frame = -3

Query  2190  TLQKHPQMDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKT  2011
             T +    M++ N T    +C   L  +FV+++  AS + A+ +  EFV+Q   + RLC+T
Sbjct  49    TTKAKKAMETHNLTVKQLYC-CLLLGIFVIISFQASFSEAETHYHEFVIQAKPVRRLCRT  107

Query  2010  KTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCP  1831
                ITVNG FPGPT+ VR+GD +V+K +N ARYNVT+HWHG+RQ+R PWADGP+ VTQCP
Sbjct  108   HNTITVNGLFPGPTLEVRDGDSLVIKAINNARYNVTLHWHGVRQLRNPWADGPDRVTQCP  167

Query  1830  IMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILL  1651
             I PG +YTYRF IENQEGTLWWHAHS WLRATVYGA II+PK GS + F  P+++IPILL
Sbjct  168   IRPGRSYTYRFTIENQEGTLWWHAHSSWLRATVYGALIIHPKLGSPYSFPMPRREIPILL  227

Query  1650  GEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRV  1471
             GEWW+R+ + + R   FTGAAPN+S+AYTINGQPGDLYRCS Q+TV+F V PGET+LLRV
Sbjct  228   GEWWDRNPMDVLRLADFTGAAPNVSDAYTINGQPGDLYRCSKQETVRFPVDPGETILLRV  287

Query  1470  INAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyyma  1291
             IN+ LNQ+ FF+VANH L VV  DA + KPF T+ IM+ PGQTT+VLLTADQ P  YYMA
Sbjct  288   INSGLNQEFFFAVANHILTVVSVDADFTKPFATSFIMIAPGQTTDVLLTADQTPGHYYMA  347

Query  1290  arayataqnaPFDNTTTTAVLEY----TNLRPGANSRPLMPQLPFFNDtatataftTQLR  1123
             A AY +A    FDNTTTTA+LEY     N   G +S P+ PQLP FNDT +A AFT+ LR
Sbjct  348   AHAYNSANAP-FDNTTTTAILEYKSAPCNANKGRSSTPIFPQLPGFNDTNSAIAFTSSLR  406

Query  1122  SVPSNNPTVFNQP---DESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPR  958
             S     P+  N P   DE+LFFTVGLGL+NCT    PRCQGPN TRFAAS+NNVSFVLP 
Sbjct  407   S-----PSKVNVPLQIDENLFFTVGLGLINCTNPNSPRCQGPNGTRFAASINNVSFVLPT  461

Query  957   RTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVL  778
             R SL+QAYY   PG++T DFPPVPPV+FDYTGNVSR LWQP   TKLYK+K+G++VQ+V 
Sbjct  462   RNSLMQAYYQGQPGVFTTDFPPVPPVKFDYTGNVSRGLWQPVKATKLYKLKFGAKVQIVF  521

Query  777   QDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVI  598
             QDT+I T E+HP+HLHG+HF VVG GFGNFNPQTD AKFNL+DPP RNTI  P GGW  I
Sbjct  522   QDTSIVTVENHPMHLHGHHFAVVGSGFGNFNPQTDPAKFNLIDPPYRNTIGNPPGGWVAI  581

Query  597   RFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             R  ADNPG+WL+HCH+DSHL WGLAMAF+VENG GE Q+V+PPPLDLP+C
Sbjct  582   RLVADNPGIWLLHCHLDSHLNWGLAMAFLVENGVGELQSVQPPPLDLPQC  631



>ref|XP_006303628.1| hypothetical protein CARUB_v10011512mg [Capsella rubella]
 gb|EOA36526.1| hypothetical protein CARUB_v10011512mg [Capsella rubella]
Length=574

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/577 (65%), Positives = 445/577 (77%), Gaps = 6/577 (1%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M SQ  T+L       +  L V  T LASLA+A+++ +EFV++   + RLC+T   ITVN
Sbjct  1     MKSQYPTNLGRIYALSIIFLLVCCTFLASLASAELHVREFVIEAKPVKRLCRTHQTITVN  60

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQFPGPT+ VRNGD + + V+N+ARYN+++HWHGLRQ+R PWADGPEY+TQCPI PG +Y
Sbjct  61    GQFPGPTLEVRNGDSLAITVINKARYNISLHWHGLRQLRNPWADGPEYITQCPIQPGQSY  120

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYR KIE+QEGTLWWHAHS WLRATVYGA IIYP+ GS +PFS PK+DIPI+LGEWW+R+
Sbjct  121   TYRIKIEDQEGTLWWHAHSHWLRATVYGALIIYPRLGSPYPFSMPKRDIPIILGEWWDRN  180

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              + + R  QFTGAAPN+S+AYTINGQPGDLYRCS  +T++F + PGETV LR+INAALNQ
Sbjct  181   PMDVLRLAQFTGAAPNVSDAYTINGQPGDLYRCSKPETLRFPIVPGETVQLRLINAALNQ  240

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             +LFF+VANH L VV  D+AY KPFTTNV+M+GPGQTTNVL+TA+Q     Y  A     +
Sbjct  241   ELFFTVANHPLTVVEVDSAYTKPFTTNVVMLGPGQTTNVLITANQ-RPGRYYIAARAYNS  299

Query  1269  qnaPFDNTTTTAVLEYTNLRPGANS-RPLMPQLPFFNDtatataftTQLRSVPSNNPTVF  1093
              NA FDNTTTTA++EY N   G     P+ P LP FNDTATATAF  +LR        V 
Sbjct  300   ANAAFDNTTTTAIIEYVNAPSGQGQITPVFPVLPGFNDTATATAFVNRLRY--WTRAPVP  357

Query  1092  NQPDESLFFTVGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP  919
              + DE+LFF VGLGL+NC     PRCQGPN TRFAASMNNVSFVLPR  S++QAYY  IP
Sbjct  358   LEIDENLFFAVGLGLINCANPNSPRCQGPNGTRFAASMNNVSFVLPRTNSVMQAYYQGIP  417

Query  918   GIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPI  739
             GI T DFPPVPPVQFDYTGNVSR LWQP   TK YK+KY + VQ+VLQDT+I T E+HP+
Sbjct  418   GIITSDFPPVPPVQFDYTGNVSRGLWQPVKATKAYKLKYKANVQIVLQDTSIVTPENHPM  477

Query  738   HLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMH  559
             HLHGY F+VVG GFGNF+P+ D A FNL DPP RNTI  P GGW  IRF ADNPG W MH
Sbjct  478   HLHGYQFYVVGSGFGNFDPKRDPASFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMH  537

Query  558   CHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             CHIDSHL WGLAM F+VENG G+ Q+V+PPPLDLPRC
Sbjct  538   CHIDSHLGWGLAMVFLVENGIGQLQSVQPPPLDLPRC  574



>ref|XP_010264533.1| PREDICTED: laccase-12 [Nelumbo nucifera]
Length=578

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/553 (69%), Positives = 453/553 (82%), Gaps = 14/553 (3%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             A+ + +  EFVVQ T + RLCKT   ITVNGQFPGPT+ VRNGD +V++V+NRARYNVTI
Sbjct  31    ADPETHYHEFVVQATPVKRLCKTHNTITVNGQFPGPTLEVRNGDTLVIRVINRARYNVTI  90

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQ+RT WADGPEYVTQCPI PGG+YTYRF I++QEGTLWWHAHS WLRATVYGA 
Sbjct  91    HWHGVRQLRTAWADGPEYVTQCPIQPGGSYTYRFTIQDQEGTLWWHAHSSWLRATVYGAL  150

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             IIYP+ GS +PF++PK++ P+LLGEWW+ + I + R+   TGAAPN+S+AYTINGQPGDL
Sbjct  151   IIYPRLGSSYPFTKPKRETPVLLGEWWDDNPIDVIRRATRTGAAPNVSDAYTINGQPGDL  210

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y CSSQDTV   V  GET LLRVINAALNQ+LF ++ NH+L VV ADA+Y KPFTT+V+M
Sbjct  211   YNCSSQDTVIIPVDSGETNLLRVINAALNQELFLAIGNHQLTVVAADASYKKPFTTSVLM  270

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL---RPGANSRP  1189
             +GPGQTT+VL+TA+QPP RYY+AARAY +AQ A FDNTTTTA+LEY +    + G   +P
Sbjct  271   LGPGQTTDVLITANQPPGRYYIAARAYQSAQGAAFDNTTTTAILEYKSAPCPKKGLTLQP  330

Query  1188  LMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTPG---P  1027
             + P LP +NDT TATAF  + RS     P+  + P   DE+LFFTVGLGL NC PG    
Sbjct  331   VFPSLPAYNDTTTATAFAAKFRS-----PSKVDIPTDIDENLFFTVGLGLFNCPPGFSQS  385

Query  1026  RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRA  847
             RCQGPN TRF ASMNNVS VLP   S+LQAY   +PG+YT DFPPVPPVQFDYTGNVSRA
Sbjct  386   RCQGPNGTRFTASMNNVSLVLPSSFSILQAYQQGVPGVYTTDFPPVPPVQFDYTGNVSRA  445

Query  846   LWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTA  667
             LWQP SGTKLYK+KYGS+VQ+VLQDT+I T E+HPIH+HGY F+++ +GFGNFNPQTDTA
Sbjct  446   LWQPISGTKLYKLKYGSKVQLVLQDTSIVTAENHPIHIHGYDFYIIAEGFGNFNPQTDTA  505

Query  666   KFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEK  487
             KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG+GE 
Sbjct  506   KFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGEGEL  565

Query  486   QTVEPPPLDLPRC  448
             Q+++ PP DLP C
Sbjct  566   QSLQSPPADLPPC  578



>ref|XP_006410143.1| hypothetical protein EUTSA_v10016445mg [Eutrema salsugineum]
 gb|ESQ51596.1| hypothetical protein EUTSA_v10016445mg [Eutrema salsugineum]
Length=570

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/566 (66%), Positives = 441/566 (78%), Gaps = 10/566 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             F   L  +L   A  A+A+++ +EFV+Q   + RLC+T   ITVNGQFPGP + VRNGD 
Sbjct  8     FFVSLIALLAYFALFASAELHVREFVIQPKPVKRLCRTHQSITVNGQFPGPNLEVRNGDS  67

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             + + V+NRARYN++IHWHG+RQ+R PWADGPEY+TQCPI PG +YTYRF IE QEGTLWW
Sbjct  68    LAITVINRARYNISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFTIEGQEGTLWW  127

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS+WLRATVYGA IIYP+ GS +PFS PK+DIPILLGEWW+R+ + + R  QFTGAAP
Sbjct  128   HAHSKWLRATVYGALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRLAQFTGAAP  187

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLYRCS  +T +F + PGETV LRVINAALNQ+LFFSVANH+L VV 
Sbjct  188   NVSDAYTINGQPGDLYRCSRAETTRFPIFPGETVQLRVINAALNQELFFSVANHQLTVVE  247

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
              D+AY KPFTT+VIM+GPGQTTNVLLTA+Q     Y  A     + NAPFDNTTTTA+LE
Sbjct  248   TDSAYTKPFTTSVIMIGPGQTTNVLLTANQ-RPGRYYMAARAYNSANAPFDNTTTTAILE  306

Query  1224  YTNL-----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             Y N      R      P+ P LP FNDTATATAFT +LR        V  Q D++LF TV
Sbjct  307   YVNAPTRRGRGRGQIAPVFPVLPGFNDTATATAFTNRLRY--WKRAPVPLQVDDNLFLTV  364

Query  1059  GLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             GLGL+NCT    PRCQGPN TRFAAS+NN SFVLPRR S++QAYY  +PGI+T DFPP P
Sbjct  365   GLGLINCTNPNSPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPFP  424

Query  885   PVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVG  706
             PVQFDYTGNVSR LWQP  GTK+YK+KY + VQ+V QDT+I T E+HP+HLHGY F+VVG
Sbjct  425   PVQFDYTGNVSRGLWQPVKGTKVYKLKYKANVQIVFQDTSIVTPENHPMHLHGYQFYVVG  484

Query  705   QGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGL  526
              GFGNFNP+TD A+FNL DPP RNTI  P GGW  IRF ADNPG W MHCHIDSHL WGL
Sbjct  485   SGFGNFNPRTDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGL  544

Query  525   AMAFIVENGQGEKQTVEPPPLDLPRC  448
             AM F+VENG+G+ Q+V+ PPLDLPRC
Sbjct  545   AMVFLVENGRGQLQSVQAPPLDLPRC  570



>ref|XP_010475452.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=568

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/577 (66%), Positives = 446/577 (77%), Gaps = 12/577 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M SQN T+L          + ++L     LA+A+++ +EFV++   + RLC+T   ITVN
Sbjct  1     MKSQNPTNLG------RVSIILVLACCTLLASAELHVREFVIEAKPVKRLCRTHQTITVN  54

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQFPGPT+ VRNGD + + V+NRARYN+++HWHG+RQ+R PWADGPEY+TQCPI PG +Y
Sbjct  55    GQFPGPTLEVRNGDSLAITVINRARYNISLHWHGIRQLRNPWADGPEYITQCPIQPGQSY  114

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYR KIE+QEGTLWWHAHS WLRATVYGA IIYP+ GS +PFS PK+DIPI+LGEWW+R+
Sbjct  115   TYRIKIEDQEGTLWWHAHSHWLRATVYGALIIYPRLGSPYPFSMPKRDIPIILGEWWDRN  174

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              + + R  QFTGAAPN+S+AYTINGQPGDLYRCS  +TV+F + PGETV LR+INAALNQ
Sbjct  175   PMDVLRLAQFTGAAPNVSDAYTINGQPGDLYRCSKPETVRFPIVPGETVQLRLINAALNQ  234

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             +LFF+VANH+L VV  D+AY KPFTTNV+M+GPGQTTNVL+TA+Q     Y  A     +
Sbjct  235   ELFFTVANHQLTVVEVDSAYTKPFTTNVVMLGPGQTTNVLITANQ-RPGRYYMAARAYNS  293

Query  1269  qnaPFDNTTTTAVLEYTNL-RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVF  1093
              NAPFDNTTTTA+LEY N  R      P+ P LP FNDTATATAF  +LR        V 
Sbjct  294   ANAPFDNTTTTAILEYVNAPRGRGQVTPVFPVLPGFNDTATATAFVNRLRY--WKRAPVP  351

Query  1092  NQPDESLFFTVGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP  919
              Q DE+LFF VGLGL+NCT    PRCQGPN TRFAASMNNVSFVLPR  S++QAYY  IP
Sbjct  352   LQIDENLFFAVGLGLINCTNPNSPRCQGPNGTRFAASMNNVSFVLPRTNSVMQAYYQGIP  411

Query  918   GIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPI  739
             GI T DFPPVPPVQFDYTGNVSR LWQP   TK YK+KY + VQ+VLQDT+I T E+HP+
Sbjct  412   GIITADFPPVPPVQFDYTGNVSRGLWQPVKATKAYKLKYKANVQIVLQDTSIVTPENHPM  471

Query  738   HLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMH  559
             HLHGY F+VVG GFGNF+P+ D A FNL DPP RNTI  P GGW  IRF ADNPG W MH
Sbjct  472   HLHGYQFYVVGSGFGNFDPKRDPASFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMH  531

Query  558   CHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             CHIDSHL WGLAM F+VENG G+ Q+V+PPPLDLPRC
Sbjct  532   CHIDSHLGWGLAMVFLVENGVGQLQSVQPPPLDLPRC  568



>ref|XP_010414291.1| PREDICTED: laccase-3 [Camelina sativa]
 ref|XP_010469882.1| PREDICTED: laccase-3 [Camelina sativa]
Length=572

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/567 (67%), Positives = 442/567 (78%), Gaps = 12/567 (2%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
                   +L   A LA+A+ + ++FV+    +TRLC+T   ITVNGQFPGPT+ VRNGD V
Sbjct  9     FVSCIALLAYFAFLASAEHHVRQFVIAPRPVTRLCRTHQSITVNGQFPGPTLEVRNGDSV  68

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
              + V+NRARYN++IHWHGLRQMR PWADGPEY+TQCPI PG +YTY+F IE+QEGTLWWH
Sbjct  69    AITVINRARYNISIHWHGLRQMRNPWADGPEYITQCPIRPGQSYTYKFTIEDQEGTLWWH  128

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHSRWLRATVYGA IIYP+ GS +PFS PK+DIPILLGEWW+R+ + + RQ QFTGAA N
Sbjct  129   AHSRWLRATVYGALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAAN  188

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+AYTINGQPGDLYRCS   T++F + PGETV LRVINA +NQ+LFFSVANH+L VV  
Sbjct  189   VSDAYTINGQPGDLYRCSRAGTMRFPIFPGETVQLRVINAGMNQELFFSVANHQLTVVET  248

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             D+AY KPFTTNVIM+GPGQTTNVL+TA+Q     Y  A     + NAPFDNTTTTA+L+Y
Sbjct  249   DSAYTKPFTTNVIMLGPGQTTNVLITANQ-RPGRYYMAARAYNSANAPFDNTTTTAILQY  307

Query  1221  TN-------LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFT  1063
              N        R      P+ P LP FNDTATATAFT +LR        V  Q DE+LFFT
Sbjct  308   VNAPTRRGRGRGRGQMAPVFPVLPGFNDTATATAFTNRLRYW--KRAPVPQQIDENLFFT  365

Query  1062  VGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             VGLGL+NC     PRCQGPN TRFAAS+NN+SFVLPRR S++QAYY  +PGI+T DFPPV
Sbjct  366   VGLGLINCANPNSPRCQGPNGTRFAASINNMSFVLPRRNSVMQAYYQGMPGIFTTDFPPV  425

Query  888   PPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PPVQFDYTGNVSRALWQP  GTK YK+KY + VQ+VLQDT+I T E+HP+HLHGY F+VV
Sbjct  426   PPVQFDYTGNVSRALWQPIKGTKAYKLKYRANVQIVLQDTSIVTPENHPMHLHGYQFYVV  485

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
             G GFGNFNP+TD A+FNL DPP RNTI  P GGW  IRF ADNPG W MHCHIDSHL WG
Sbjct  486   GSGFGNFNPRTDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWG  545

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAM F+VENG+G  Q+V+ PPLDLPRC
Sbjct  546   LAMVFLVENGRGRLQSVQAPPLDLPRC  572



>ref|XP_010486989.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=571

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/559 (67%), Positives = 442/559 (79%), Gaps = 8/559 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             +    T+LASLA+A+++ +EFV++   + RLC+T   ITVNGQFPGPT+ VRNGD + + 
Sbjct  17    VLACCTLLASLASAELHVREFVIEAKPLKRLCRTHQTITVNGQFPGPTLEVRNGDSLAIT  76

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+NRARYN+++HWHG+RQ+R PWADGPEY+TQCPI PG +YTYR KIE+QEGTLWWHAHS
Sbjct  77    VINRARYNISLHWHGIRQLRNPWADGPEYITQCPIQPGQSYTYRIKIEDQEGTLWWHAHS  136

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRAT+YGA IIYP+ GS +PFS PK+DIPI+LGEWW+R+ + + R  QFTGAAPN+S+
Sbjct  137   HWLRATIYGALIIYPRLGSPYPFSMPKRDIPIILGEWWDRNPMDVLRLAQFTGAAPNVSD  196

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLYRCS  +T++F + PGETV LR+INAALNQ+LFF+VANH+L VV  D+A
Sbjct  197   AYTINGQPGDLYRCSKPETLRFPIVPGETVQLRLINAALNQELFFTVANHQLTVVEVDSA  256

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTTNV+M+GPGQTTNVL+TA+Q     Y  A     + NAPFDNTTTTA+LEY N 
Sbjct  257   YTKPFTTNVVMLGPGQTTNVLITANQ-RPGRYYMAARAYNSANAPFDNTTTTAILEYVN-  314

Query  1212  RPGANSR--PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNC  1039
             RP    +  P+ P L  FNDTATATAF  +LR        V  Q DE+LFF VGLGL+NC
Sbjct  315   RPSGRGQITPVFPVLAGFNDTATATAFFNRLRYY--KRAPVPLQIDENLFFAVGLGLINC  372

Query  1038  T--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT  865
             T    PRCQGPN TRFAASMNNVSFVLPR  S++QAYY  IPGI T DFPPVPPVQFDYT
Sbjct  373   TNPNSPRCQGPNGTRFAASMNNVSFVLPRTNSVMQAYYQGIPGIITADFPPVPPVQFDYT  432

Query  864   GNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFN  685
             GNVSR LWQP   TK YK+KY + VQ+VLQDT+I T E+HP+HLHGY F+VVG GFGNF+
Sbjct  433   GNVSRGLWQPVKATKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFGNFD  492

Query  684   PQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVE  505
             P+ D A FNL DPP RNTI  P GGW  IRF ADNPG W MHCHIDSHL WGLAM F+VE
Sbjct  493   PKRDPASFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVFLVE  552

Query  504   NGQGEKQTVEPPPLDLPRC  448
             NG G+ Q+V+PPPLDLPRC
Sbjct  553   NGVGQLQSVQPPPLDLPRC  571



>ref|XP_003537321.1| PREDICTED: laccase-3-like [Glycine max]
 gb|KHN22790.1| Laccase-3 [Glycine soja]
Length=573

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/566 (66%), Positives = 451/566 (80%), Gaps = 8/566 (1%)
 Frame = -3

Query  2133  CNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrn  1954
             C+ FL  L  ++  LAS    +++  EFV+Q   + RLCKT+ IITVNGQFPGPT+  RN
Sbjct  12    CSWFLLGLLALIGSLASAT--EIHFHEFVIQARPVRRLCKTQNIITVNGQFPGPTVEARN  69

Query  1953  gddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGT  1774
             GD +V+KVVN A+YN++IHWHGLR +R PWADGP YVTQCPI PGG+YTYRF+I +QEGT
Sbjct  70    GDFIVIKVVNAAQYNISIHWHGLRMLRNPWADGPSYVTQCPIQPGGSYTYRFRIRDQEGT  129

Query  1773  LWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTG  1594
             LWWHAH+ +LRATVYGAFIIYP+ GS +PFS PK+++P+LLGEW++ D++ LQRQ  F G
Sbjct  130   LWWHAHTGFLRATVYGAFIIYPRLGSPYPFSMPKQEVPLLLGEWFDTDLVLLQRQADFAG  189

Query  1593  AAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQ  1414
               PN S AYTINGQPGDLYRCSSQ+TV+  V  GET++LR+I++ALNQ+LFFS+ANH + 
Sbjct  190   LPPNTSVAYTINGQPGDLYRCSSQETVRVPVDAGETIMLRIISSALNQELFFSIANHTMT  249

Query  1413  VVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTA  1234
             VVG DAAY KPF T+V+M+GPGQT NV++TADQP   YYMAARAY +A NAPFDNTTTTA
Sbjct  250   VVGTDAAYTKPFKTSVLMIGPGQTFNVIVTADQPLGLYYMAARAYESAANAPFDNTTTTA  309

Query  1233  VLEY--TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             +LEY  T  R    SRP++P LP FNDT TATAFT ++R +      VF + D +L+  V
Sbjct  310   ILEYRSTRRRNQNRSRPILPALPAFNDTPTATAFTARIRGL--TRVRVFKKVDVNLYVIV  367

Query  1059  GLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             GLGL+NCT    PRCQGPN TRF ASMNNVSFVLP  TSL+QAYY  IPG++T DFPP+P
Sbjct  368   GLGLINCTNPNSPRCQGPNGTRFTASMNNVSFVLPSTTSLMQAYYEGIPGVFTTDFPPIP  427

Query  885   PVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVG  706
             P+QFDYTGNV R LW P  GTKLYK+KYGS+VQ+VLQDT+I TTE+HP+H+HG+HF+VVG
Sbjct  428   PLQFDYTGNVPRGLWTPSRGTKLYKVKYGSKVQIVLQDTSIVTTEEHPMHVHGFHFFVVG  487

Query  705   QGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGL  526
              GFGNFNP TD  KFNLVDPPVRNTI  P GGW  IRF ADNPG+W +HCHIDSHL WGL
Sbjct  488   SGFGNFNPTTDPQKFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFVHCHIDSHLNWGL  547

Query  525   AMAFIVENGQGEKQTVEPPPLDLPRC  448
              MA +VENG G  Q+V PPP DLP+C
Sbjct  548   GMALLVENGVGLSQSVLPPPPDLPQC  573



>ref|XP_007142103.1| hypothetical protein PHAVU_008G252800g [Phaseolus vulgaris]
 gb|ESW14097.1| hypothetical protein PHAVU_008G252800g [Phaseolus vulgaris]
Length=573

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/560 (67%), Positives = 450/560 (80%), Gaps = 7/560 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANA-DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvv  1936
             L  +L+++ SLA+A + +  EFV+Q   + RLC+T  ++TVNGQFPGPT+  RNGD + +
Sbjct  16    LLGLLSIIVSLASATENHYHEFVIQTVPVKRLCRTHNVLTVNGQFPGPTVEARNGDSLAI  75

Query  1935  kvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAH  1756
             +VVN   YN++IHWHGLR +R PWADGP YVTQCPI PGG+YTYRF I+NQEGTLWWHAH
Sbjct  76    RVVNAGPYNISIHWHGLRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAH  135

Query  1755  SRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             + +LRATVYGA IIYPK GS +PFS PKK+ P+LLGEW++RD +AL RQ QFTGA PN+S
Sbjct  136   TGFLRATVYGALIIYPKLGSPYPFSMPKKEFPLLLGEWFDRDPMALLRQAQFTGAPPNVS  195

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
              AYTINGQPGDLYRCSSQ+TV+  V  GET+LLR+IN+ALNQ+LFF++ANH++ VV  DA
Sbjct  196   VAYTINGQPGDLYRCSSQETVRVPVDAGETILLRIINSALNQELFFAIANHRMTVVATDA  255

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             AY KPFTTNV+M+GPGQT NVL+TADQ P RYYMAARAY TA NA FDNTTTTA+LEY +
Sbjct  256   AYTKPFTTNVLMIGPGQTINVLVTADQTPGRYYMAARAYQTAMNAAFDNTTTTAILEYKS  315

Query  1215  LRPGANS--RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVN  1042
                G     RP++P LP FNDTATATA+T  +R +  +   VF + D SL+F VGLGL+N
Sbjct  316   ASCGNGQVPRPILPVLPAFNDTATATAYTAGIRGL--SKIKVFTKVDVSLYFVVGLGLIN  373

Query  1041  CT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDY  868
             CT    PRCQGPN TRFAAS+NN SFVLP  TSL+QAYY  IPGI+T DFPPVPP+QF+Y
Sbjct  374   CTNPNSPRCQGPNGTRFAASINNNSFVLPTTTSLMQAYYQGIPGIFTTDFPPVPPLQFNY  433

Query  867   TGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNF  688
             TGNV R LW P  GTKL+K+KYGS +Q+VLQDT+I TTEDHP+H+HG+HF+VVG GFGNF
Sbjct  434   TGNVPRGLWTPVRGTKLFKVKYGSTLQIVLQDTSIVTTEDHPMHVHGFHFFVVGSGFGNF  493

Query  687   NPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIV  508
             NP TD A+FNLVDPPVRNTI  P GGW  IRF ADNPG+W +HCHIDSHL WGL  A +V
Sbjct  494   NPATDPARFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLGTALLV  553

Query  507   ENGQGEKQTVEPPPLDLPRC  448
             ENG G  Q+V PPP DLP+C
Sbjct  554   ENGVGPSQSVIPPPPDLPQC  573



>gb|KFK21959.1| hypothetical protein AALP_AAs48252U000800 [Arabis alpina]
Length=570

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/562 (67%), Positives = 440/562 (78%), Gaps = 10/562 (2%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
                +L     LA A+ + ++FV++   + RLC+T   ITVNGQFPGPT+ VRNGD + + 
Sbjct  12    FIALLAYFDFLACAEHHVRQFVIEPRPVKRLCRTHQSITVNGQFPGPTLEVRNGDSLAIT  71

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+NRARYN++IHWHG+RQ+R PWADGPEY+TQCPI PG +YTYRFKIE+QEGTLWWHAHS
Sbjct  72    VINRARYNISIHWHGIRQLRNPWADGPEYITQCPIRPGQSYTYRFKIEDQEGTLWWHAHS  131

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             RWLRATVYGA IIYP+ GS +PFS PK+DIPILLGEWW+R+ + + RQ QFTGAA N+S+
Sbjct  132   RWLRATVYGALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSD  191

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLYRCS  +T++F + PGETV LRVINAA+NQ+LFFSVANH+L VV  D+A
Sbjct  192   AYTINGQPGDLYRCSRAETIRFPIFPGETVQLRVINAAMNQELFFSVANHQLTVVETDSA  251

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+VIMVGPGQTTNVLLTA+Q     Y  A     + NAPFDNTTTTA+ EY N 
Sbjct  252   YTKPFTTSVIMVGPGQTTNVLLTANQ-RPGRYYMAARAYNSANAPFDNTTTTAIFEYINA  310

Query  1212  -----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGL  1048
                  R      P+ P LP FNDTATATA+  +LR        V  Q DE+LFFTVGLGL
Sbjct  311   PTRRGRGRGQIAPVFPVLPGFNDTATATAYVNRLRY--WKQAPVPLQIDENLFFTVGLGL  368

Query  1047  VNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
              NC+    PRCQGPN TRFAAS+NN SFVLPRR S++QAYY  +PGI+T DFPPVPPVQF
Sbjct  369   TNCSNPNSPRCQGPNGTRFAASINNQSFVLPRRNSVMQAYYQGMPGIFTTDFPPVPPVQF  428

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             DYTGNVSR LWQP  GTK YK+KY + VQ+VLQDT+I T E+HP+HLHGY F+VVG GFG
Sbjct  429   DYTGNVSRGLWQPVKGTKAYKLKYNANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFG  488

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NFNP+TD A+FNL DPP +NTI  P GGW  IRF ADNPG W MHCHIDSHL WGLAM F
Sbjct  489   NFNPRTDPARFNLFDPPEKNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVF  548

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +VENG+G+ Q+V+ PPLDLPRC
Sbjct  549   LVENGRGQLQSVQAPPLDLPRC  570



>ref|XP_004490661.1| PREDICTED: laccase-3-like [Cicer arietinum]
Length=573

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/566 (66%), Positives = 453/566 (80%), Gaps = 9/566 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANA-DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngd  1948
             +L  L  +LT++ S+A+A + +  EFV+Q   + RLCKT+ I+TVNGQFPGPTI  R+GD
Sbjct  10    YLYFLLGLLTIIVSIASAAENHYHEFVIQTKSVKRLCKTRNILTVNGQFPGPTIEARDGD  69

Query  1947  dvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLW  1768
              +V+KV N   YN++IHWHG R +R PWADGP YVTQCPI PGG+YTYRF I+NQEGTLW
Sbjct  70    SMVIKVTNAGPYNISIHWHGFRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLW  129

Query  1767  WHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAA  1588
             WHAH+ +LRATVYGAFI+YPK GS +PFS P+K+ PILLGEW++RD + + RQTQFTGA 
Sbjct  130   WHAHTGFLRATVYGAFIVYPKLGSPYPFSMPRKEFPILLGEWFDRDPMVILRQTQFTGAP  189

Query  1587  PNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVV  1408
             PN S AYT+NGQPGDLYRCSSQ T++F V  GET+LLR+IN+ LNQ+LFFS+ANH++ VV
Sbjct  190   PNASVAYTMNGQPGDLYRCSSQGTIRFQVDAGETILLRIINSGLNQELFFSIANHRMTVV  249

Query  1407  GADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVL  1228
               DAAY KP TT V+M+GPGQT NVL+TADQPP RYYMAARAY TA NA FDNTTTT++L
Sbjct  250   AMDAAYTKPSTTTVLMIGPGQTINVLVTADQPPGRYYMAARAYQTAMNATFDNTTTTSIL  309

Query  1227  EY----TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             EY     N R    SRP++P LP FNDT T+TAFT+++R +  +   VF   D SL FTV
Sbjct  310   EYKSAACNNRNRQCSRPILPILPAFNDTPTSTAFTSRIRGL--SKVKVFQNFDVSLLFTV  367

Query  1059  GLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             GLGL+NCT    PRCQGPN TRFAAS+NN SFVLPR TSL+QAYY  +PG++T DFPPVP
Sbjct  368   GLGLINCTNPNSPRCQGPNGTRFAASINNNSFVLPRTTSLMQAYYQGVPGVFTTDFPPVP  427

Query  885   PVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVG  706
             P+QF+YTGNV R LW P  GT+L+++KYGS VQ+VLQDT+I TTEDHP+H+HG+HF+VVG
Sbjct  428   PIQFNYTGNVPRGLWTPRKGTRLFRLKYGSYVQIVLQDTSIVTTEDHPMHVHGFHFFVVG  487

Query  705   QGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGL  526
              GFGNFNP+TD  +FNLVDPPVRNTI  P GGW  IRF ADNPG+W +HCHIDSHL WGL
Sbjct  488   SGFGNFNPRTDPFRFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGL  547

Query  525   AMAFIVENGQGEKQTVEPPPLDLPRC  448
             A A +VENG G  Q+V PPP DLP+C
Sbjct  548   ATALLVENGVGPLQSVIPPPPDLPQC  573



>ref|XP_008232145.1| PREDICTED: laccase-13 [Prunus mume]
Length=577

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/547 (71%), Positives = 450/547 (82%), Gaps = 8/547 (1%)
 Frame = -3

Query  2070  DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWH  1891
             + +  EFVVQ   + RLC+T   ITVNGQFPGP + VRNGD +V+KV N ARYNVTIHWH
Sbjct  33    ETHYHEFVVQAKPVRRLCRTHNTITVNGQFPGPNLEVRNGDSLVIKVTNAARYNVTIHWH  92

Query  1890  GLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIY  1711
             GLRQ+R PWADGPEY+TQCPI PG TYTYRF I++QEGTLWWHAHSRWLRATVYGA IIY
Sbjct  93    GLRQLRNPWADGPEYITQCPIQPGATYTYRFTIQDQEGTLWWHAHSRWLRATVYGALIIY  152

Query  1710  PKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRC  1531
             PK GS +PFS PK+++P+LLGEW++R+ + +Q+   FTG APN S+AYTINGQPGDLYRC
Sbjct  153   PKLGSPYPFSMPKREVPLLLGEWFDRNPLDVQKLAAFTGGAPNASDAYTINGQPGDLYRC  212

Query  1530  SSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGP  1351
             S Q+TV+  V  GE++LLR+IN+ALNQ+LFFS+ANH+L VV ADA+Y KPFTT V+M+GP
Sbjct  213   SKQETVRIPVDSGESILLRIINSALNQELFFSIANHRLTVVSADASYTKPFTTRVLMMGP  272

Query  1350  GQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL----RPGANSRPLM  1183
             GQTT+VLLTADQPPA YY+AAR Y TAQNAPFDNTTTTA+LEY +     + G +  P +
Sbjct  273   GQTTDVLLTADQPPAHYYVAARVYETAQNAPFDNTTTTAILEYKSAACSSKKGQSPPPAL  332

Query  1182  PQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT--PGPRCQGPN  1009
             P LP FNDTATATAFT Q++S PS    V  Q DE+LFF VGLGL NCT    PRCQGPN
Sbjct  333   PLLPAFNDTATATAFTAQIKS-PSQV-KVPTQIDENLFFIVGLGLNNCTVPNSPRCQGPN  390

Query  1008  NTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPS  829
             NTRFAASMNNVSFV PR  SL+QAYYN +PG++T DFPPVP VQFDYTGNV R LW P  
Sbjct  391   NTRFAASMNNVSFVFPRTNSLMQAYYNGVPGVFTTDFPPVPLVQFDYTGNVPRGLWTPRR  450

Query  828   GTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVD  649
             GTKLYK+KYGS VQ+VLQDT+I TTEDHP+HLHGYHF+V+G GFGNFNP+TD AKFNLVD
Sbjct  451   GTKLYKLKYGSNVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNFNPRTDPAKFNLVD  510

Query  648   PPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPP  469
             PP RNTI  P GGW  IRF ADNPGVWLMHCH+DSHLA GL+MAF+VENG+G  Q+V PP
Sbjct  511   PPQRNTIGTPPGGWVAIRFVADNPGVWLMHCHLDSHLALGLSMAFLVENGKGPSQSVIPP  570

Query  468   PLDLPRC  448
             P DLPRC
Sbjct  571   PADLPRC  577



>gb|KHN02112.1| Laccase-3 [Glycine soja]
Length=573

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/566 (66%), Positives = 451/566 (80%), Gaps = 8/566 (1%)
 Frame = -3

Query  2133  CNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrn  1954
             C+ FL  L  ++  LAS    +++  EFV+Q   + RLCKT+ IITVNGQFPGPT+  RN
Sbjct  12    CSWFLLGLLALIGSLASAT--EIHFHEFVIQAKPVRRLCKTQNIITVNGQFPGPTVEARN  69

Query  1953  gddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGT  1774
             GD VV+KVVN A+YN++IHWHGLR +R PWADGP YVTQCPI PGG+YTYRF+I +QEGT
Sbjct  70    GDFVVIKVVNAAQYNISIHWHGLRMLRNPWADGPSYVTQCPIQPGGSYTYRFRIRDQEGT  129

Query  1773  LWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTG  1594
             LWWHAH+ +LRATVYGAFIIYP+ GS +PFS PK+++P+LLGEW++ D++ LQRQ  F G
Sbjct  130   LWWHAHTGFLRATVYGAFIIYPRLGSPYPFSMPKQEVPLLLGEWFDTDLVLLQRQADFAG  189

Query  1593  AAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQ  1414
               PN S AYTINGQPGDLYRCSSQ+TV+  V  GET++LR+I++ LNQ+LFFS+ANH + 
Sbjct  190   LPPNTSVAYTINGQPGDLYRCSSQETVRVPVDAGETIMLRIISSTLNQELFFSIANHTMT  249

Query  1413  VVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTA  1234
             VVG DAAY KPF T+V+M+GPGQT NV++TADQPP  YY+AA AY +A NAPFDNTTTTA
Sbjct  250   VVGTDAAYTKPFKTSVLMIGPGQTFNVIVTADQPPGFYYVAAHAYESAVNAPFDNTTTTA  309

Query  1233  VLEY--TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             +LEY  T  R    SRP++P LP FNDT TATAFT ++R +      VF + D +L+F V
Sbjct  310   ILEYRSTRRRNQNRSRPVLPALPAFNDTPTATAFTARIRGL--TRVRVFKKVDVNLYFIV  367

Query  1059  GLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             GLGL+NCT    PRCQGPN TRF ASMNNVSFVLP  TSL+QAYY  IPG++T DFPPVP
Sbjct  368   GLGLINCTNPNSPRCQGPNGTRFTASMNNVSFVLPSTTSLMQAYYEGIPGVFTTDFPPVP  427

Query  885   PVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVG  706
             P+QFDYTGNV + LW P  GTKLYK+KYGS+VQ+VLQDT+I TTE+HP+H+HG+HF+VVG
Sbjct  428   PLQFDYTGNVPQGLWTPSRGTKLYKVKYGSKVQIVLQDTSIVTTEEHPMHVHGFHFFVVG  487

Query  705   QGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGL  526
              GFGNFNP TD  KFNLVDPPVRNTI  P GGW  IRF ADNPG+W +HCHIDSHL WGL
Sbjct  488   SGFGNFNPATDPLKFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFVHCHIDSHLNWGL  547

Query  525   AMAFIVENGQGEKQTVEPPPLDLPRC  448
              MA +VENG G  Q+V PPP DLP+C
Sbjct  548   GMALLVENGVGLSQSVLPPPPDLPQC  573



>ref|XP_010510393.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=572

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/567 (67%), Positives = 441/567 (78%), Gaps = 12/567 (2%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
                   +L   A LA+A+ + ++FV+    +TRLC+T   ITVNGQFPGPT+ VRNGD V
Sbjct  9     FVSCIALLAYFAFLASAEHHVRQFVIAPRPVTRLCRTHQSITVNGQFPGPTLEVRNGDSV  68

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
              + V+NRARYN++IHWHGLRQMR PWADGPEY+TQCPI PG +YTY+F IE+QEGTLWWH
Sbjct  69    AITVINRARYNISIHWHGLRQMRNPWADGPEYITQCPIRPGQSYTYKFTIEDQEGTLWWH  128

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHSRWLRATVYGA IIYP+ GS +PF  PK+DIPILLGEWW+R+ + + RQ QFTGAA N
Sbjct  129   AHSRWLRATVYGALIIYPRLGSPYPFVMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAAN  188

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+AYTINGQPGDLYRCS   T++F + PGETV LRVINA +NQ+LFFSVANH+L VV  
Sbjct  189   VSDAYTINGQPGDLYRCSRAGTMRFPIFPGETVQLRVINAGMNQELFFSVANHQLTVVET  248

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             D+AY KPFTTNVIM+GPGQTTNVL+TA+Q     Y  A     + NAPFDNTTTTA+L+Y
Sbjct  249   DSAYTKPFTTNVIMLGPGQTTNVLITANQ-RPGRYYMAARAYNSANAPFDNTTTTAILQY  307

Query  1221  TN-------LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFT  1063
              N        R      P+ P LP FNDTATATAFT +LR        V  Q DE+LFFT
Sbjct  308   VNAPTRRGRGRGRGQMAPVFPVLPGFNDTATATAFTNRLRY--WKRAPVPQQIDENLFFT  365

Query  1062  VGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             VGLGL+NC     PRCQGPN TRFAAS+NN+SFVLPRR S++QAYY  +PGI+T DFPPV
Sbjct  366   VGLGLINCANPNSPRCQGPNGTRFAASINNMSFVLPRRNSVMQAYYQGMPGIFTTDFPPV  425

Query  888   PPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PPVQFDYTGNVSRALWQP  GTK YK+KY + VQ+VLQDT+I T E+HP+HLHGY F+VV
Sbjct  426   PPVQFDYTGNVSRALWQPIKGTKAYKLKYRANVQIVLQDTSIVTPENHPMHLHGYQFYVV  485

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
             G GFGNFNP+TD A+FNL DPP RNTI  P GGW  IRF ADNPG W MHCHIDSHL WG
Sbjct  486   GSGFGNFNPRTDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWG  545

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAM F+VENG+G  Q+V+ PPLDLPRC
Sbjct  546   LAMVFLVENGRGRLQSVQAPPLDLPRC  572



>ref|XP_002326089.1| hypothetical protein POPTR_0019s14530g [Populus trichocarpa]
 gb|EEF00471.1| hypothetical protein POPTR_0019s14530g [Populus trichocarpa]
Length=576

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/583 (65%), Positives = 452/583 (78%), Gaps = 16/583 (3%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M++ N T    +C   L  +FV+++  AS +  + +  EFV+Q   + RLC+T   ITVN
Sbjct  1     METHNLTVKQLYC-CLLLSIFVIISFQASSSEPETHYHEFVIQAKPVRRLCRTHNTITVN  59

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             G FPGPT+ VR+GD +V+K +N ARYNVT+HWHG+RQ+R PWADGP+ VTQCPI PG +Y
Sbjct  60    GLFPGPTLEVRDGDTLVIKAINNARYNVTLHWHGVRQLRNPWADGPDRVTQCPIQPGRSY  119

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYRF IENQEGTLWWHAHSRWLRATVYGA II+PK GS + F  P ++IPILLGEWW R+
Sbjct  120   TYRFTIENQEGTLWWHAHSRWLRATVYGALIIHPKLGSPYSFPMPIREIPILLGEWWVRN  179

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              + + R   FTGAAPN+S+AYTINGQPGDLYRCS Q+TV+F V PGET+LLRVIN+A+NQ
Sbjct  180   PMDVLRLADFTGAAPNVSDAYTINGQPGDLYRCSKQETVRFPVDPGETILLRVINSAMNQ  239

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             +LFF+VANH L VV  DAA   PF T+ IM+ PGQTTNVLLTADQ P  YYMAA AY +A
Sbjct  240   ELFFAVANHILTVVAVDAACTMPFATSFIMIAPGQTTNVLLTADQTPGHYYMAAHAYNSA  299

Query  1269  qnaPFDNTTTTAVLEY----TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNP  1102
                 FDNTTTTA+LEY     N   G +S P+ PQLP FNDT +A AFT+ LRS     P
Sbjct  300   NAP-FDNTTTTAILEYKSAPCNANKGKSSTPIFPQLPGFNDTNSAIAFTSSLRS-----P  353

Query  1101  TVFNQP---DESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQA  937
             +  N P   DE+LFFTVG GL+NCT    PRCQGPN TRFAAS+NNVSFVLP R SL+QA
Sbjct  354   SKVNVPLQIDENLFFTVGFGLINCTNPNSPRCQGPNGTRFAASINNVSFVLPTRNSLMQA  413

Query  936   YYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFT  757
             YY   PG++T DFPPVPPV+FDYTGNVSR LWQP   TKLYK+K+G++VQ+V QDT+I T
Sbjct  414   YYQGQPGVFTTDFPPVPPVKFDYTGNVSRGLWQPVKATKLYKLKFGAKVQIVFQDTSIVT  473

Query  756   TEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNP  577
              EDHP+HLHG++F VVG GFGNFNPQTD AKFNL++PP RNTI  P GGW  IRF ADNP
Sbjct  474   VEDHPMHLHGHNFAVVGSGFGNFNPQTDPAKFNLINPPYRNTIGNPPGGWVAIRFVADNP  533

Query  576   GVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             G+WL+HCH+DSHL WGLAMAF+VENG G  Q+V+PPPLDLP+C
Sbjct  534   GIWLLHCHLDSHLNWGLAMAFLVENGVGNLQSVQPPPLDLPQC  576



>ref|XP_004145307.1| PREDICTED: laccase-3-like [Cucumis sativus]
 ref|XP_004153690.1| PREDICTED: laccase-3-like [Cucumis sativus]
 ref|XP_004168716.1| PREDICTED: laccase-3-like [Cucumis sativus]
Length=574

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/556 (69%), Positives = 448/556 (81%), Gaps = 5/556 (1%)
 Frame = -3

Query  2136  FCNGFL-AKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAv  1960
             FC+ FL   L   L  L++      +  +F+VQ   + RLCK   IITVNGQFPGPT+AV
Sbjct  11    FCSFFLLISLLAFLPFLSAFPLPKTHFHQFIVQPKPVKRLCKVHNIITVNGQFPGPTLAV  70

Query  1959  rngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQE  1780
             R+GD +V+KVVN ARYNV++HWHG+RQ+R PWADGPE++TQC I PGGTYTYRF IE QE
Sbjct  71    RDGDSLVIKVVNAARYNVSLHWHGIRQLRNPWADGPEFITQCSIKPGGTYTYRFTIEGQE  130

Query  1779  GTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQF  1600
             GTLWWHAHSRWLRATVYGA IIYPK GS  PF  PKK+ P+LLGEW++RD I++ RQ  F
Sbjct  131   GTLWWHAHSRWLRATVYGALIIYPKLGSPRPFIMPKKEFPLLLGEWFDRDPISVLRQALF  190

Query  1599  TGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHK  1420
             TGA PN+S+AYTINGQPGD Y CS ++T++ +V  GET+LLR+IN+ALNQ+LFFS+ANH+
Sbjct  191   TGAGPNVSDAYTINGQPGDFYICSKKETMRLAVDSGETILLRIINSALNQELFFSIANHQ  250

Query  1419  LQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTT  1240
             + VV  DAAY KPF TNVIMVGPGQTT+VL+TA+QPPA YYMAA AY TAQNAPFDNTTT
Sbjct  251   MTVVAVDAAYTKPFATNVIMVGPGQTTDVLVTANQPPAYYYMAATAYNTAQNAPFDNTTT  310

Query  1239  TAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             TA+L+Y NL P  N +P++ QLP FNDT TAT FT QLRS   N  +V    DE+LFFTV
Sbjct  311   TAILQYNNLPPQQNPQPILAQLPNFNDTPTATRFTDQLRS--PNRVSVPLHIDENLFFTV  368

Query  1059  GLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             GLGL NCT    PRCQGPN TRF AS+NNVSFV P+  S++QAYY  +PG++T DFPP P
Sbjct  369   GLGLNNCTNPNSPRCQGPNGTRFTASINNVSFVFPKSNSIMQAYYQGVPGVFTADFPPFP  428

Query  885   PVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVG  706
             P+QFDYTGNVSR LWQP  GTK YK+KYGS VQ+VLQDT+I T E+HP+HLHGYHF+VVG
Sbjct  429   PLQFDYTGNVSRGLWQPRRGTKAYKLKYGSSVQIVLQDTSIVTPENHPMHLHGYHFYVVG  488

Query  705   QGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGL  526
              GFGNFNP+TD A+FNL+DPPVRNTI  P GGW  IRF ADNPG WLMHCHIDSHLAWGL
Sbjct  489   SGFGNFNPRTDPARFNLIDPPVRNTIGTPTGGWVAIRFIADNPGAWLMHCHIDSHLAWGL  548

Query  525   AMAFIVENGQGEKQTV  478
             AM F+VENG+GE Q+V
Sbjct  549   AMVFLVENGEGEMQSV  564



>ref|XP_009771638.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=578

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/580 (66%), Positives = 460/580 (79%), Gaps = 8/580 (1%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M + N +  NP  +  +  + ++     SLA A ++N +FV+Q T + RLC T++ ITVN
Sbjct  1     MQAFNMSIANPLRSLLIYGILLLFANAVSLAKAKIHNHDFVIQATPVKRLCNTRSTITVN  60

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQFPGPT+ V NGD +VVKVVN+A+YNVTIHWHG+RQMRT WADGPE++TQCPI PGG+Y
Sbjct  61    GQFPGPTLEVNNGDTLVVKVVNKAQYNVTIHWHGVRQMRTAWADGPEFITQCPIRPGGSY  120

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYRF I+ QEGTLWWHAHS WLRATVYGA +I+PK G+ +PF +PK++ PILLGEWW+ +
Sbjct  121   TYRFTIQGQEGTLWWHAHSSWLRATVYGALVIHPKEGTSYPFPKPKRETPILLGEWWDAN  180

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              I + RQ   TGAAPN+S+AYTINGQPGDLY+CSSQDT    V  GET LLRVINA LNQ
Sbjct  181   PIDVIRQATRTGAAPNVSDAYTINGQPGDLYKCSSQDTTIVHVDSGETNLLRVINAGLNQ  240

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             QLFF VANHK  VVGADA+Y KPFTT+VIM+GPGQTT+VL+TA+QPPARYYMA RAYA+A
Sbjct  241   QLFFKVANHKFTVVGADASYVKPFTTSVIMLGPGQTTDVLITANQPPARYYMAVRAYASA  300

Query  1269  qnaPFDNTTTTAVLEYTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPT  1099
             Q APFDNTTTTA+LEY        G    P++P LP FNDTATAT FT+  RS  +    
Sbjct  301   QGAPFDNTTTTAILEYKAAPCPAKGVKINPILPSLPAFNDTATATTFTSSFRS--ARKVD  358

Query  1098  VFNQPDESLFFTVGLGLVNCTPGP---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYN  928
             V  + DE+LFFTVGLGL NC  G     CQGPN TRF ASMNNVSFVLP   SLLQA++ 
Sbjct  359   VPTEIDENLFFTVGLGLNNCPAGASSSSCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQ  418

Query  927   NIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTED  748
              IPG+++ DFP VPPV+FDYTGNVSR+LWQP S TKLYK+KYG+RVQ+VLQ T+IFT E+
Sbjct  419   GIPGVFSTDFPAVPPVKFDYTGNVSRSLWQPISATKLYKLKYGARVQIVLQGTSIFTAEN  478

Query  747   HPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVW  568
             HPIHLHGY F+++ +GFGNFNPQTDTAKFNLVDPP+RNT  VPV GW+VIRF ADNPGVW
Sbjct  479   HPIHLHGYDFYILAEGFGNFNPQTDTAKFNLVDPPLRNTASVPVNGWSVIRFVADNPGVW  538

Query  567   LMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +MHCH+D H+ WGLAMAF+V+NG  + + +E PP+DLP C
Sbjct  539   IMHCHLDVHITWGLAMAFLVQNGVTQLEALEEPPVDLPVC  578



>ref|XP_010045386.1| PREDICTED: laccase-3-like [Eucalyptus grandis]
 gb|KCW87557.1| hypothetical protein EUGRSUZ_B04003 [Eucalyptus grandis]
Length=575

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/562 (68%), Positives = 455/562 (81%), Gaps = 9/562 (2%)
 Frame = -3

Query  2112  LFVMLTVLA-SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvv  1936
             LF  L V + S + A+V+  EFV+Q   + RLC+T + ITVNGQFPGPT+AVR+GD +V+
Sbjct  16    LFATLLVSSVSFSVAEVHFHEFVIQARPVKRLCRTHSTITVNGQFPGPTLAVRDGDSLVI  75

Query  1935  kvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAH  1756
               +NRARYNVT+HWHG+RQ+R PWADGPEYVTQCPI PGGTYTYRF I+NQEGTLWWHAH
Sbjct  76    TAINRARYNVTLHWHGVRQLRNPWADGPEYVTQCPIQPGGTYTYRFTIQNQEGTLWWHAH  135

Query  1755  SRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             S+WLRATVYGA II+PK GSH+PF  PK++ P+LLGEW++R+ + + +Q  FTGAAPN+S
Sbjct  136   SKWLRATVYGALIIFPKLGSHYPFPMPKREFPVLLGEWFDRNPMDVLKQALFTGAAPNVS  195

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
             +AYTINGQPGDLYRCSS+ T  F   PGET+LLR+INAALNQ+LFFSVANH++ VVG DA
Sbjct  196   DAYTINGQPGDLYRCSSKGTAVFPAIPGETILLRIINAALNQELFFSVANHQMTVVGVDA  255

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             AY +PF TNVIM+GPGQTTNVL+TA+Q P RYY+AARAY TAQNA FDNTTTTA+L+Y +
Sbjct  256   AYTRPFATNVIMIGPGQTTNVLITANQAPGRYYVAARAYDTAQNAAFDNTTTTAILQYIS  315

Query  1215  ----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGL  1048
                    G +SRP++P LP +NDT TATAFT  LRS    N  V  Q DE+L FTVGLGL
Sbjct  316   TSGSGGQGQSSRPILPILPAYNDTTTATAFTASLRSPGKIN--VPTQIDENLLFTVGLGL  373

Query  1047  VNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             +NC+    PRCQGPN TRFAAS+NN+SFV P   SL+QAYY  +PG++T DFPPVPP+ F
Sbjct  374   LNCSNPNSPRCQGPNGTRFAASVNNISFVFPTTNSLMQAYYQGVPGVFTTDFPPVPPIPF  433

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             +YTGNVSR LWQP   TKLYK+KYGSRVQ+V QDT+I TTEDHP+HLHGY F VVG GFG
Sbjct  434   NYTGNVSRGLWQPVKATKLYKLKYGSRVQLVFQDTSIVTTEDHPMHLHGYSFAVVGTGFG  493

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NF+P  D  KFNL+DPP+RNTI    GGWA IRF ADNPGVWLMHCH+DSHL  GLAM+F
Sbjct  494   NFDPINDPPKFNLIDPPLRNTIGSTPGGWAAIRFVADNPGVWLMHCHLDSHLVIGLAMSF  553

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +VENG GE Q+V PPP DLPRC
Sbjct  554   LVENGVGELQSVIPPPPDLPRC  575



>ref|XP_002315131.1| hypothetical protein POPTR_0010s19090g [Populus trichocarpa]
 gb|EEF01302.1| hypothetical protein POPTR_0010s19090g [Populus trichocarpa]
Length=575

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/567 (68%), Positives = 459/567 (81%), Gaps = 9/567 (2%)
 Frame = -3

Query  2133  CNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrn  1954
             C+ FL  L +  T+  SLA A++++ +FVVQ TK+ RLCKT   ITVNG FPGPT+ V+N
Sbjct  13    CSFFLVVLLLASTM--SLAIAEIHHHDFVVQATKVKRLCKTHNSITVNGMFPGPTLEVKN  70

Query  1953  gddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGT  1774
             GD +VVKVVN+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF IE QEGT
Sbjct  71    GDTLVVKVVNKARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFNIEGQEGT  130

Query  1773  LWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTG  1594
             LWWHAHS WLRATVYGA II+P+ GS +PF++PK++ PILLGEWW+ + + + R+   TG
Sbjct  131   LWWHAHSSWLRATVYGALIIHPREGSSYPFAKPKRETPILLGEWWDANPVDVVREATRTG  190

Query  1593  AAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQ  1414
             AAPNIS+AYTINGQPGDLY CSS+DT    ++ GET LLRVINAALNQ LFF++ANHK  
Sbjct  191   AAPNISDAYTINGQPGDLYNCSSEDTTIVPIASGETNLLRVINAALNQPLFFTIANHKFT  250

Query  1413  VVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTA  1234
             V+GADA+Y KPFTT+VIM+GPGQTT+VL++ DQ P RYYMAARAY +AQNAPFDNTTTTA
Sbjct  251   VIGADASYLKPFTTSVIMLGPGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTA  310

Query  1233  VLEYTN-LRPG-ANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             +LEY + L P    ++P+MP+LP +NDTAT TAF+  LRS       V    DE+LFFT+
Sbjct  311   ILEYKSALCPAKCTTKPVMPRLPAYNDTATVTAFSGSLRS--PRKVEVPTDIDENLFFTI  368

Query  1059  GLGLVNC---TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             GLGL NC   +   RCQGPN TRF ASMNNVSFV P   +LLQAY   +PGIYT DFP  
Sbjct  369   GLGLNNCPKNSRARRCQGPNGTRFTASMNNVSFVFPSNIALLQAYQQKVPGIYTTDFPAK  428

Query  888   PPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PPV+FDYTGNVSR+L+QP  GTKLYK+KYGSRVQ+VLQDT+I T E+HPIHLHGY F+++
Sbjct  429   PPVKFDYTGNVSRSLFQPVRGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYII  488

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
              +GFGNFNP+T  +KFNLVDPP+RNT+ VP  GWAVIRF ADNPGVWLMHCH+D H+ WG
Sbjct  489   AEGFGNFNPKTHKSKFNLVDPPMRNTVAVPSNGWAVIRFVADNPGVWLMHCHLDVHITWG  548

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAMAF+VE+G GE Q+VEPPP DLP C
Sbjct  549   LAMAFLVEDGIGELQSVEPPPADLPIC  575



>ref|XP_007206448.1| hypothetical protein PRUPE_ppa003408mg [Prunus persica]
 gb|EMJ07647.1| hypothetical protein PRUPE_ppa003408mg [Prunus persica]
Length=577

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/547 (71%), Positives = 449/547 (82%), Gaps = 8/547 (1%)
 Frame = -3

Query  2070  DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWH  1891
             + +  EFVVQ   + RLC+T   ITVNGQFPGP + VRNGD + +KV N ARYNVTIHWH
Sbjct  33    ETHYHEFVVQAKPVKRLCRTHNTITVNGQFPGPNLEVRNGDSLAIKVTNAARYNVTIHWH  92

Query  1890  GLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIY  1711
             G+RQ+R PWADGPEY+TQCPI PG TYTYRF I++QEGTLWWHAHSRWLRATVYGA IIY
Sbjct  93    GVRQLRNPWADGPEYITQCPIQPGATYTYRFTIQDQEGTLWWHAHSRWLRATVYGALIIY  152

Query  1710  PKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRC  1531
             PK GS +PF  PK+++P+LLGEW++R+ + +QR   FTG APN S+AYTINGQPGDLYRC
Sbjct  153   PKLGSPYPFLMPKREVPLLLGEWFDRNPLDVQRLAAFTGGAPNASDAYTINGQPGDLYRC  212

Query  1530  SSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGP  1351
             S Q+TV+  V  GE++LLR+IN+ALNQ+LFFS+ANH+L VV ADA+Y KPFTT V+M+GP
Sbjct  213   SKQETVRIPVDSGESILLRIINSALNQELFFSIANHRLTVVSADASYTKPFTTRVLMMGP  272

Query  1350  GQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL----RPGANSRPLM  1183
             GQTT+VLLTADQPPA YY+AAR Y TAQNAPFDNTTTTA+LEY +     + G +  P +
Sbjct  273   GQTTDVLLTADQPPAHYYVAARVYQTAQNAPFDNTTTTAILEYKSAACSSKKGQSPPPAL  332

Query  1182  PQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP--GPRCQGPN  1009
             P LPFFNDTATATA+T Q++S PS    V  Q DE+LFF VGLGL NCT    PRCQGPN
Sbjct  333   PLLPFFNDTATATAYTAQIKS-PSQV-KVPTQIDENLFFIVGLGLNNCTVPNSPRCQGPN  390

Query  1008  NTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPS  829
             NTRF ASMNNVSFV PR  SL+QAYYN +PG++T DFPPVP VQFDYTGNV R LW P  
Sbjct  391   NTRFTASMNNVSFVFPRTNSLMQAYYNGVPGVFTTDFPPVPLVQFDYTGNVPRGLWTPRR  450

Query  828   GTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVD  649
             GTKLYK+KYGS VQ+VLQDT+I TTEDHP+HLHGYHF+V+G GFGNFNP+TD AKFNLVD
Sbjct  451   GTKLYKLKYGSNVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNFNPRTDPAKFNLVD  510

Query  648   PPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPP  469
             PP+RNTI  P GGW  IRF ADNPGVWLMHCH+D+HLA GLAMAF+VENG+G  Q+V PP
Sbjct  511   PPLRNTIGTPPGGWVAIRFVADNPGVWLMHCHLDAHLALGLAMAFLVENGKGPLQSVIPP  570

Query  468   PLDLPRC  448
             P DLPRC
Sbjct  571   PADLPRC  577



>ref|XP_003552931.1| PREDICTED: laccase-3-like [Glycine max]
Length=573

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/566 (66%), Positives = 449/566 (79%), Gaps = 8/566 (1%)
 Frame = -3

Query  2133  CNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrn  1954
             C+ FL  L  ++  LAS    +++  EFV+Q   + RLCKT+ IITVNGQFPGPT+  RN
Sbjct  12    CSWFLLGLLALIGSLASAT--EIHFHEFVIQAKPVRRLCKTQNIITVNGQFPGPTVEARN  69

Query  1953  gddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGT  1774
             GD VV+KVVN A+YN++IHWHGLR +R PWADGP YVTQCPI PGG+YTYRF+I +QEGT
Sbjct  70    GDFVVIKVVNAAQYNISIHWHGLRMLRNPWADGPSYVTQCPIQPGGSYTYRFRIRDQEGT  129

Query  1773  LWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTG  1594
             LWWHAH+ +LRATVYGAFIIYP+ GS +PFS PK+++P+LLGEW++ D++ LQRQ  F G
Sbjct  130   LWWHAHTGFLRATVYGAFIIYPRLGSPYPFSMPKQEVPLLLGEWFDTDLVLLQRQADFAG  189

Query  1593  AAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQ  1414
               PN S AYTINGQPGDLYRCSSQ+TV+  V  GET++LR+I++ LNQ+LFFS+ANH + 
Sbjct  190   LPPNTSVAYTINGQPGDLYRCSSQETVRVPVDAGETIMLRIISSTLNQELFFSIANHTMT  249

Query  1413  VVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTA  1234
             VVG DAAY KPF T V+M+GPGQT NV++TADQPP  YYMAA AY +A NAPFDNTTTTA
Sbjct  250   VVGTDAAYTKPFKTTVLMIGPGQTFNVIVTADQPPGFYYMAAHAYESAVNAPFDNTTTTA  309

Query  1233  VLEY--TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             +LEY  T  R    SRP++P LP FNDT TATAFT ++R +      VF + D +L+F V
Sbjct  310   ILEYRSTRRRNQNRSRPVLPALPAFNDTPTATAFTARIRGL--TRVRVFKKVDVNLYFIV  367

Query  1059  GLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             GLGL+NCT    PRCQGPN TRF ASMNNVSFVLP  TSL+QAYY  IPG++T DFPPVP
Sbjct  368   GLGLINCTNPNSPRCQGPNGTRFTASMNNVSFVLPSTTSLMQAYYEGIPGVFTTDFPPVP  427

Query  885   PVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVG  706
             P+QFDYTGNV   LW P  GTKLYK+KYGS+VQ+VLQDT+I TTE+HP+H+HG+HF+VVG
Sbjct  428   PLQFDYTGNVPPGLWTPSRGTKLYKVKYGSKVQIVLQDTSIVTTEEHPMHVHGFHFFVVG  487

Query  705   QGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGL  526
              GFGNFNP TD  KFNLVDPPVRNTI  P GGW  IRF ADNPG+W +HCHIDSHL WGL
Sbjct  488   SGFGNFNPATDPLKFNLVDPPVRNTIGTPPGGWVAIRFVADNPGIWFVHCHIDSHLNWGL  547

Query  525   AMAFIVENGQGEKQTVEPPPLDLPRC  448
              MA +VENG G  Q+V PPP DLP+C
Sbjct  548   GMALLVENGVGLSQSVLPPPPDLPQC  573



>ref|XP_010257021.1| PREDICTED: laccase-12-like [Nelumbo nucifera]
Length=575

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/555 (69%), Positives = 452/555 (81%), Gaps = 14/555 (3%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             SLAN + +  +FVVQ T + RLCKT  IITVNGQ+PGPT+ VRNGD +V+ VVNRARYNV
Sbjct  26    SLANPETHYHDFVVQATPVKRLCKTHNIITVNGQYPGPTLEVRNGDTLVINVVNRARYNV  85

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             T+HWHG+RQMRT WADGPE+VTQCPI PGG YTYRF IE QEGTLWWHAHS WLRATVYG
Sbjct  86    TLHWHGIRQMRTGWADGPEFVTQCPIQPGGRYTYRFTIEGQEGTLWWHAHSSWLRATVYG  145

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A IIYP+ GS +PF++P+++ PILLGEWW+ + I + RQ   TGAAPN+S+AYTINGQPG
Sbjct  146   ALIIYPRLGSSYPFTKPRREAPILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPG  205

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DLY CS+QDTV   V  GET LLRVINAALNQ+LFF+VANH++ VV ADA+Y KPFTT+V
Sbjct  206   DLYNCSAQDTVIIPVDSGETNLLRVINAALNQELFFTVANHQMTVVAADASYTKPFTTSV  265

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL---RPGANS  1195
             +M+GPGQTT+VL+  +QPP RYY+AARAY +AQNA FDNTT TA+LEY +    + G + 
Sbjct  266   LMLGPGQTTDVLINTNQPPGRYYIAARAYQSAQNAAFDNTTPTAILEYKSAPCPKKGLSV  325

Query  1194  RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTPG--  1030
             +P+ P LP +NDT TATAF   L+S     P+  + P   DE+LFFTVGLGL NC P   
Sbjct  326   QPVFPLLPAYNDTPTATAFAAGLKS-----PSKVDVPTDIDENLFFTVGLGLFNCPPRFS  380

Query  1029  -PRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVS  853
               RCQGPN TRF ASMNNVSFVLP   S+LQAY   IPG+YT DFP VPPVQFDYTGNVS
Sbjct  381   RSRCQGPNGTRFTASMNNVSFVLPSNFSILQAYQQGIPGVYTTDFPAVPPVQFDYTGNVS  440

Query  852   RALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTD  673
             RALWQP  GTK+YK+K+GSRVQ+VLQ T+IF+ E+HPIH+HGY F++V +GFGNFNPQTD
Sbjct  441   RALWQPVPGTKVYKLKFGSRVQLVLQGTSIFSAENHPIHIHGYDFYIVAEGFGNFNPQTD  500

Query  672   TAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQG  493
             TAKFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG G
Sbjct  501   TAKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDIHITWGLAMAFLVENGVG  560

Query  492   EKQTVEPPPLDLPRC  448
             E Q++EPPP DLP C
Sbjct  561   ELQSLEPPPADLPPC  575



>ref|XP_010685889.1| PREDICTED: laccase-3-like [Beta vulgaris subsp. vulgaris]
Length=569

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/565 (65%), Positives = 444/565 (79%), Gaps = 6/565 (1%)
 Frame = -3

Query  2133  CNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrn  1954
             C  FL   F+ L    S  N   +  EF +Q T + RLCKT+ I+TVNGQFPGPT+ V N
Sbjct  8     CRLFLGLTFI-LAFATSFTNGKTHYHEFDIQPTAVNRLCKTQQIMTVNGQFPGPTLRVHN  66

Query  1953  gddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGT  1774
             GD +V+KV N  +Y++++HWHG+RQMR PWADGPEYVTQCPI PGGTYTYRF IENQEGT
Sbjct  67    GDTLVIKVKNAGKYDISLHWHGVRQMRNPWADGPEYVTQCPIKPGGTYTYRFTIENQEGT  126

Query  1773  LWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTG  1594
             LWWHAHS+WLRATVYGA IIYPK GS +PF +P ++ P++LGEWWNRD + + RQ   TG
Sbjct  127   LWWHAHSKWLRATVYGALIIYPKPGSSYPFPKPAREFPLILGEWWNRDPMQVLRQATITG  186

Query  1593  AAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQ  1414
             AAPN+S+AYTIN QPGDLY CS +DT  F V+ GET+LLR+INAALNQQLFF++ANH++ 
Sbjct  187   AAPNVSDAYTINSQPGDLYGCSKKDTTIFPVAAGETILLRIINAALNQQLFFAIANHQMT  246

Query  1413  VVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTA  1234
             VV ADAAYNKPFTTNVIM+ PGQTTNVL+TA+QPP RYYMAA AYA+A    FDNTTTTA
Sbjct  247   VVEADAAYNKPFTTNVIMIAPGQTTNVLVTANQPPGRYYMAATAYASAPGVAFDNTTTTA  306

Query  1233  VLEYTNL--RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             +LEY +   + G+  +P++PQLP +NDT TA +FT Q R + +    V  + DE+LFFT+
Sbjct  307   ILEYNSCKSKKGSPMKPILPQLPAWNDTNTANSFTAQFRGISTGK--VPLEIDENLFFTI  364

Query  1059  GLGLVNCT-PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
              LG++NC  P  RCQGPNNTRF ASMNNVSFV P++ S+LQA Y N PG++T DFPPVPP
Sbjct  365   NLGVINCARPSFRCQGPNNTRFTASMNNVSFVFPKKNSILQALYQNTPGVFTTDFPPVPP  424

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             VQFDYTGNVS+ LW P  GTKLYK+K+GS VQ++LQ+T I   EDHP+HLHGYHF+VVG 
Sbjct  425   VQFDYTGNVSQQLWTPVRGTKLYKLKFGSHVQIILQNTNISAIEDHPMHLHGYHFFVVGG  484

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             G GNF+P+ D A FNLVDPPVRNT+    GGW  IRF ADNPGVWLMHCH+D H+ WGLA
Sbjct  485   GKGNFDPKRDPANFNLVDPPVRNTVGTTPGGWVAIRFVADNPGVWLMHCHLDVHIGWGLA  544

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             MAF+VENG G+  ++E PP  LP+C
Sbjct  545   MAFLVENGVGKLNSIEAPPPMLPQC  569



>ref|XP_008457330.1| PREDICTED: laccase-3 [Cucumis melo]
Length=574

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/555 (68%), Positives = 449/555 (81%), Gaps = 5/555 (1%)
 Frame = -3

Query  2133  CNGFL-AKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvr  1957
             C+ FL   L   L +L++      +  +F+VQ   + RLCK   IITVNGQFPGPT+AVR
Sbjct  12    CSFFLLISLLGFLPLLSAFPLPKTHYHQFIVQPKPVKRLCKVHNIITVNGQFPGPTLAVR  71

Query  1956  ngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEG  1777
             +GD +V+KVVN ARYNV++HWHG+RQ+R PWADGPE++TQC I PGG+YTYRF IE QEG
Sbjct  72    DGDSLVIKVVNAARYNVSLHWHGIRQLRNPWADGPEFITQCSIKPGGSYTYRFTIEGQEG  131

Query  1776  TLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFT  1597
             TLWWHAHSRWLRATVYGA IIYPK  S  PF  PKK+ P+LLGEW++RD I++ RQ  FT
Sbjct  132   TLWWHAHSRWLRATVYGALIIYPKLASPHPFVMPKKEFPLLLGEWFDRDPISVLRQALFT  191

Query  1596  GAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKL  1417
             GAAPN+S+AYTINGQPGD Y CS ++T++ +V+ GET+LLR+IN+ALNQ+LFFS+ANH++
Sbjct  192   GAAPNVSDAYTINGQPGDFYICSKKETMRLAVNSGETILLRIINSALNQELFFSIANHQM  251

Query  1416  QVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTT  1237
              VV  DAAY KPF TNVIM+GPGQTT+VL+TA+QPPA YYMAA AY TAQNAPFDNTTTT
Sbjct  252   TVVAVDAAYTKPFATNVIMIGPGQTTDVLVTANQPPAYYYMAATAYNTAQNAPFDNTTTT  311

Query  1236  AVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
             A+L+Y NL P  N RP++ QLP FNDT TAT FT QLRS   +  +V    DE+LFFTVG
Sbjct  312   AILQYNNLPPQQNPRPILAQLPNFNDTPTATRFTDQLRS--PHRVSVPLHIDENLFFTVG  369

Query  1056  LGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             LGL NCT    PRCQGPN TRF AS+NNVSFV P+  S++QAYY  +PG++T DFPP PP
Sbjct  370   LGLNNCTNPNSPRCQGPNGTRFTASINNVSFVFPKSNSIMQAYYQGVPGVFTADFPPFPP  429

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             +QFDYTGNVSR LWQP  GTK YK+KYGS VQ+VLQDT+I T E+HP+HLHGYHF+VVG 
Sbjct  430   LQFDYTGNVSRGLWQPRRGTKAYKLKYGSSVQIVLQDTSIVTPENHPMHLHGYHFYVVGS  489

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNFNP+TD A+FNL+DPPVRNTI  P GGW  IRF ADNPG WLMHCHIDSHLAWGLA
Sbjct  490   GFGNFNPRTDPARFNLIDPPVRNTIGTPTGGWVAIRFIADNPGAWLMHCHIDSHLAWGLA  549

Query  522   MAFIVENGQGEKQTV  478
             M F+VENG+GE Q+V
Sbjct  550   MVFLVENGEGEMQSV  564



>ref|XP_009611705.1| PREDICTED: laccase-12-like [Nicotiana tomentosiformis]
Length=574

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/571 (68%), Positives = 454/571 (80%), Gaps = 11/571 (2%)
 Frame = -3

Query  2142  NPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIA  1963
             NP  + F      +L + A+ A    +  +FV+Q T + RLCKT   ITVNGQFPGPT+ 
Sbjct  9     NPLSSFFF---ICILLLFANAAFGKTHYHDFVIQATPVKRLCKTHNTITVNGQFPGPTLE  65

Query  1962  vrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQ  1783
             V NGD +VV VVN+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ Q
Sbjct  66    VNNGDTLVVNVVNKARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQ  125

Query  1782  EGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQ  1603
             EGTLWWHAHS WLRATVYGA II+PK G  +PF++PK++ PI+LGEWW+ + I + RQ  
Sbjct  126   EGTLWWHAHSSWLRATVYGALIIHPKEGESYPFAKPKRETPIMLGEWWDANPIDVIRQAT  185

Query  1602  FTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANH  1423
              TGAAPN+S+AYTINGQPGDLY+CSSQDT    V  GET LLRVINAALNQQLFF+VANH
Sbjct  186   RTGAAPNVSDAYTINGQPGDLYKCSSQDTTIVPVDAGETNLLRVINAALNQQLFFTVANH  245

Query  1422  KLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTT  1243
             KL VVGADA+Y KPFTT+V+M+GPGQTT+VL+TADQ PARYYMAARAYA+AQ A FDNTT
Sbjct  246   KLTVVGADASYVKPFTTSVLMLGPGQTTDVLITADQQPARYYMAARAYASAQGAAFDNTT  305

Query  1242  TTAVLEYTNLRPGAN---SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESL  1072
             TTA+LEY      +N   + P+ P LP +NDTATATAFTT+ RS       V  + DE+L
Sbjct  306   TTAILEYKTASCSSNCVKTNPVSPSLPAYNDTATATAFTTKFRS--PRKVEVPTEIDENL  363

Query  1071  FFTVGLGLVNCTPGPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLD  901
             FFTVGLGL NC  G R   CQGPN TRF ASMNNVSFVLP   SLLQA++  IPG+++ D
Sbjct  364   FFTVGLGLNNCPRGARSRNCQGPNGTRFTASMNNVSFVLPSNYSLLQAHHQGIPGVFSTD  423

Query  900   FPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYH  721
             FP  PPV+FDYTGNVSR+LWQP  GTKLYK+KYG+RVQVVLQ T+IFT E+HPIHLHGY 
Sbjct  424   FPAKPPVKFDYTGNVSRSLWQPIRGTKLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYD  483

Query  720   FWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSH  541
             F+++ +GFGNFNP+ DTAKFNLVDPP+RNT  VPV GWAVIRF ADNPGVWLMHCH+D H
Sbjct  484   FYIIAEGFGNFNPKRDTAKFNLVDPPLRNTASVPVNGWAVIRFVADNPGVWLMHCHLDVH  543

Query  540   LAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             + WGLAMAFIVENG  E +++E PP+DLP C
Sbjct  544   IGWGLAMAFIVENGVTELESLEAPPVDLPVC  574



>ref|XP_006435828.1| hypothetical protein CICLE_v10031070mg [Citrus clementina]
 ref|XP_006486242.1| PREDICTED: laccase-5-like [Citrus sinensis]
 gb|ESR49068.1| hypothetical protein CICLE_v10031070mg [Citrus clementina]
Length=579

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/583 (67%), Positives = 460/583 (79%), Gaps = 13/583 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLT--VLASLANADVYNQEFVVQETKITRLCKTKTIIT  1996
             M+  N+   N F  GF   L +++    L S ANA  ++ +FV+Q T + RLCKT   IT
Sbjct  1     MEFFNSRFANSF--GFFLGLVLLIASNALLSFANAKAHHHDFVIQATPVKRLCKTHNTIT  58

Query  1995  VNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGG  1816
             VNG +PGPT+ V NGD +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG 
Sbjct  59    VNGMYPGPTLEVNNGDTLVVKVTNKARYNVTIHWHGVRQMRTAWADGPEFVTQCPIRPGM  118

Query  1815  TYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWN  1636
             +YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK GS +PF +PK++ PILLGEWW+
Sbjct  119   SYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPKEGSSYPFPKPKRETPILLGEWWD  178

Query  1635  RDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAAL  1456
              + I + RQ   TGAAPNIS+AYTINGQPGDLY CSSQDTV   +  GET LLRVINA L
Sbjct  179   ANPIDVVRQATRTGAAPNISDAYTINGQPGDLYNCSSQDTVVVPIDSGETNLLRVINAGL  238

Query  1455  NQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaaraya  1276
             NQ LFF++ANH+  VVGADA+Y KPFTT+VIM+GPGQTT+VL+  DQPP+RYY+AARAYA
Sbjct  239   NQPLFFTIANHQFTVVGADASYLKPFTTSVIMLGPGQTTDVLIKGDQPPSRYYLAARAYA  298

Query  1275  taqnaPFDNTTTTAVLEYTNL----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSN  1108
             +A +APFDNTTTTA+LEY +     + G + RP+MPQLP FNDTAT TAFT + RS    
Sbjct  299   SAPSAPFDNTTTTAILEYKSAPCPAKKGLSIRPVMPQLPAFNDTATVTAFTKKFRS--PQ  356

Query  1107  NPTVFNQPDESLFFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQA  937
                V    DESLFFTVGLGL NC       RCQGPN TRF ASMNNVSFVLP   SLLQA
Sbjct  357   KVEVPTDIDESLFFTVGLGLNNCPRNFGSSRCQGPNGTRFTASMNNVSFVLPSNFSLLQA  416

Query  936   YYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFT  757
             +++ IPG++T DFP  PP +FDYTGNVSR+LWQP  GTKLYK++YGSRVQ+VLQDT+IFT
Sbjct  417   HHHGIPGVFTTDFPANPPFKFDYTGNVSRSLWQPVPGTKLYKLEYGSRVQIVLQDTSIFT  476

Query  756   TEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNP  577
              E+HPIH+HGY F+++ +GFGNFNP+TDT+KFNLVDPP+RNT+ VPVGGWAVIRF ADNP
Sbjct  477   PENHPIHIHGYDFYIIAEGFGNFNPKTDTSKFNLVDPPLRNTVGVPVGGWAVIRFVADNP  536

Query  576   GVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GVWLMHCH+D H+ WGLAMAF+VENG  E + +E PPLD P C
Sbjct  537   GVWLMHCHLDVHITWGLAMAFLVENGVTELEKLEAPPLDYPVC  579



>ref|XP_009354572.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=569

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/552 (70%), Positives = 454/552 (82%), Gaps = 7/552 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             AS + A+ +  EF+V+   + RLC+T T ITVNGQFPGPT+ VRNGD V V+V NRA+YN
Sbjct  20    ASFSAAEDHFHEFIVEAKPVRRLCRTHTTITVNGQFPGPTLEVRNGDSVAVQVTNRAKYN  79

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             +TIHWHGL+Q R PWADGPEYVTQCPI PG TYTYRF I +QEGTLWWHAHSRWLRATVY
Sbjct  80    ITIHWHGLKQQRNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRATVY  139

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA IIYP+ GS +PFS PK+++P+LLGEW++R+ + +QR   FTG APN+S+AYTINGQP
Sbjct  140   GALIIYPRLGSPYPFSMPKQEVPLLLGEWFDRNPLDVQRLAAFTGGAPNVSDAYTINGQP  199

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLYRCS Q+T++  V  GE++LLRV+N+ALNQ+LFF+VANH+L VV ADAAY KPFTT 
Sbjct  200   GDLYRCSKQETIRIPVESGESLLLRVVNSALNQELFFTVANHQLTVVSADAAYTKPFTTR  259

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRP  1189
             VIM+GPGQTT+VL+TADQPPARYY+AARAY TAQNAPFDNTTTTA+LEY N     N +P
Sbjct  260   VIMLGPGQTTDVLVTADQPPARYYVAARAYQTAQNAPFDNTTTTAILEYKNAACSKNGKP  319

Query  1188  LMPQLPF---FNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT--PGPR  1024
             L P LP    +NDTAT+TAFT QL+S PS    V  Q DE+L+F VGLGL NCT    PR
Sbjct  320   LAPLLPRLPAYNDTATSTAFTAQLKS-PSQV-KVPMQIDENLYFIVGLGLNNCTVPNSPR  377

Query  1023  CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRAL  844
             CQGPNNTRFAASMNNVSFV PR TSL+QA Y+ +PG++T DFPPVPPVQF+YTGNV R L
Sbjct  378   CQGPNNTRFAASMNNVSFVFPRSTSLMQAAYSGVPGVFTTDFPPVPPVQFNYTGNVPRGL  437

Query  843   WQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAK  664
             W P  GTKLYK+KY + VQ+VLQDT+I TTEDHP+HLHGYHF+V+G GFGN+NP+TD AK
Sbjct  438   WSPRRGTKLYKLKYDANVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNYNPRTDPAK  497

Query  663   FNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQ  484
             FNLVDPP RNTI  P GGW  IRF ADNPGVWLMHCH+D+HL  GLAMAF+VENG G  Q
Sbjct  498   FNLVDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDAHLFLGLAMAFLVENGNGPLQ  557

Query  483   TVEPPPLDLPRC  448
             +V PPP DLPRC
Sbjct  558   SVIPPPADLPRC  569



>ref|XP_008384707.1| PREDICTED: laccase-3-like [Malus domestica]
Length=567

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/549 (70%), Positives = 447/549 (81%), Gaps = 5/549 (1%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             S + A+V+  EF+V+   + RLC T + ITVNGQFPGPT+ VRNGD V VKV NRARYN+
Sbjct  21    SFSAAEVHFYEFIVEARPVXRLCXTLSTITVNGQFPGPTLEVRNGDSVAVKVTNRARYNI  80

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             TIHWHGL+Q   PWADGPEYVTQCPI PG TYTYRF I++QEGTLWWHAHSRWLRATVYG
Sbjct  81    TIHWHGLKQQNNPWADGPEYVTQCPIQPGATYTYRFTIKDQEGTLWWHAHSRWLRATVYG  140

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A IIYP+ GS +PF  PK+++PILLGEW++RD   + R   FTG APN+S+AYTINGQPG
Sbjct  141   ALIIYPRLGSPYPFPMPKREVPILLGEWFDRDPQDVMRLAAFTGGAPNVSDAYTINGQPG  200

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DLYRCS Q+T++  V  GE++LLRVIN+ALNQ+LFF+VANH+L VVGADA+Y +PFTT V
Sbjct  201   DLYRCSRQETIRIPVVSGESLLLRVINSALNQELFFTVANHQLTVVGADASYTRPFTTRV  260

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANS-RP  1189
             IM+GPGQTT+VLLTADQ PARYYMAARAYATAQNAPFDNTTTTA+LEY N         P
Sbjct  261   IMIGPGQTTDVLLTADQRPARYYMAARAYATAQNAPFDNTTTTAILEYKNAASSNQGLAP  320

Query  1188  LMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP--GPRCQG  1015
             + P LP +NDTATATA+T Q++S PS    V  Q DE LFFTVGLGL NCT    PRCQG
Sbjct  321   VFPTLPAYNDTATATAYTAQIKS-PSQV-RVPTQIDEYLFFTVGLGLYNCTVPNSPRCQG  378

Query  1014  PNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQP  835
             PNNTRFAASMNNVSFVLPR  SL+QA Y  +PG++T DFPP+PPVQF+YTGNV R LW P
Sbjct  379   PNNTRFAASMNNVSFVLPRTNSLMQAAYYGVPGVFTTDFPPIPPVQFNYTGNVPRGLWSP  438

Query  834   PSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNL  655
               GTKLY++KY + VQ+VLQDT+I TTEDHP+HLHGYHF+V+G GFGN+NP TD A+FNL
Sbjct  439   RRGTKLYRLKYCANVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNYNPSTDPARFNL  498

Query  654   VDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVE  475
             +DPP RNTI  P GGW  IRF ADNPGVWLMHCH+DSHL  GLAMAF+VENG G  Q+V 
Sbjct  499   IDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDSHLFLGLAMAFLVENGIGPLQSVI  558

Query  474   PPPLDLPRC  448
             PPP DLPRC
Sbjct  559   PPPPDLPRC  567



>ref|XP_010685886.1| PREDICTED: laccase-3-like [Beta vulgaris subsp. vulgaris]
Length=573

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/566 (65%), Positives = 445/566 (79%), Gaps = 8/566 (1%)
 Frame = -3

Query  2127  GFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngd  1948
             G L    ++ + +A LANA+++  +FVVQ   + RLCKT  I+TVNG+FPGPT+ +R+GD
Sbjct  10    GLLFVYCMLFSFVACLANAEIHYHDFVVQPAPVKRLCKTHHILTVNGEFPGPTLEIRDGD  69

Query  1947  dvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLW  1768
              VV+KV N  +YN+T+HWHG+RQMRTPWADGP YVTQCPI PG TYTY+F IE QEGTLW
Sbjct  70    TVVIKVTNAGKYNITLHWHGIRQMRTPWADGPAYVTQCPIRPGETYTYKFTIEEQEGTLW  129

Query  1767  WHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAA  1588
             WHAH  WLRATVYGA +IYPK GS +PFS P ++ PILLGEWWNRD +++ +Q   TG A
Sbjct  130   WHAHIYWLRATVYGAIVIYPKLGSSYPFSHPAREFPILLGEWWNRDSMSILQQALNTGIA  189

Query  1587  PNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVV  1408
             PN+S+AYTINGQPGDLY+CSS DT+ F V  GET+LLR+INAALNQQLFF++ANH++ VV
Sbjct  190   PNVSDAYTINGQPGDLYQCSSTDTITFFVEAGETILLRIINAALNQQLFFAIANHQMTVV  249

Query  1407  GADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVL  1228
              ADAAY KPFTTNVIM+GPGQTT+VL+TA+QPP  YYMAA AY++     FDNTTTTA++
Sbjct  250   SADAAYTKPFTTNVIMIGPGQTTDVLVTANQPPGHYYMAATAYSSGPGIAFDNTTTTAII  309

Query  1227  EYTNLRPGANS----RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             +Y      +N     +P+  QLP +NDT TA AFT Q +S+      +  + DE LFFTV
Sbjct  310   QYKTAPCKSNKGSLLQPIFTQLPAWNDTNTANAFTAQFKSMYEGKVPL--EIDEKLFFTV  367

Query  1059  GLGLVNCT-PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQA-YYNNIPGIYTLDFPPVP  886
             GLGL+NC+ P  RCQ PNN+RFAAS+NN+SFVLPR+ S+LQ+ YY N  G++T DFPPVP
Sbjct  368   GLGLINCSNPSYRCQAPNNSRFAASINNISFVLPRKNSILQSLYYQNNAGVFTTDFPPVP  427

Query  885   PVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVG  706
             PVQFDYTGNVSR LW P SGTK+YK+K+G+ VQ+VLQDT I T EDHP+HLHGY F+VVG
Sbjct  428   PVQFDYTGNVSRGLWTPVSGTKVYKLKFGTTVQIVLQDTNISTIEDHPMHLHGYQFFVVG  487

Query  705   QGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGL  526
              G GNF+P  D A+FNLVDP +RNTI    GGW  IRF ADNPGVW MHCHID HL WGL
Sbjct  488   SGKGNFDPNRDPARFNLVDPTIRNTIGTSPGGWVAIRFIADNPGVWFMHCHIDLHLTWGL  547

Query  525   AMAFIVENGQGEKQTVEPPPLDLPRC  448
             AM F+VENG GE Q++EPPPLDLP+C
Sbjct  548   AMVFLVENGDGELQSIEPPPLDLPQC  573



>ref|XP_009763768.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=574

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/575 (67%), Positives = 455/575 (79%), Gaps = 11/575 (2%)
 Frame = -3

Query  2154  NTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPG  1975
             N+  NP  + F      +L +LA+ A+   ++ +FV+Q T + RLCKT   ITVNGQFPG
Sbjct  5     NSIANPLSSFFF---ICILLLLANAASGKTHHHDFVIQATPVKRLCKTHNTITVNGQFPG  61

Query  1974  PTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFK  1795
             PT+ V NGD +VVKVVNRARYNVTIHWHG+RQMRT WADGPE++TQCPI PG +YTYRF 
Sbjct  62    PTLEVNNGDTLVVKVVNRARYNVTIHWHGVRQMRTGWADGPEFITQCPIRPGKSYTYRFT  121

Query  1794  IENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQ  1615
             I+ QEGTLWWHAHS WLRATVYGA II+PK G  +PF++PK++ PILLGEWW+ + I + 
Sbjct  122   IQGQEGTLWWHAHSSWLRATVYGALIIHPKDGGSYPFAKPKRETPILLGEWWDANPIDVI  181

Query  1614  RQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFS  1435
             RQ   TGAAPN+S+AYTINGQPGDLY+CSSQDT    V  GET LLRVINAALNQQLFFS
Sbjct  182   RQATRTGAAPNVSDAYTINGQPGDLYKCSSQDTTIVHVDSGETNLLRVINAALNQQLFFS  241

Query  1434  VANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPF  1255
             VANHKL VVGADA+Y KPFTT+V+M+GPGQTT+VL+ ADQ PA+YYMAARAYA+AQ APF
Sbjct  242   VANHKLTVVGADASYVKPFTTSVLMLGPGQTTDVLIKADQQPAKYYMAARAYASAQGAPF  301

Query  1254  DNTTTTAVLEYTNLRPGAN---SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP  1084
             DNTTTTA+LEY      +N   +  + P LP +NDT TATAFTT+ RS       V  + 
Sbjct  302   DNTTTTAILEYKTASCSSNCAKTNAVFPSLPAYNDTVTATAFTTKFRS--PRKVEVPKEI  359

Query  1083  DESLFFTVGLGLVNCTPGPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGI  913
             DE+LFFTVGLGL NC  G     CQGPN TRF ASMNNVSFVLP   SLLQA++  IPG+
Sbjct  360   DENLFFTVGLGLDNCPRGASSSNCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQGIPGV  419

Query  912   YTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHL  733
             ++ DFP  PPV+FDYTGNVSR+LWQP  GTKLYK+KYG+RVQVVLQ T+IFT E+HPIHL
Sbjct  420   FSTDFPAKPPVKFDYTGNVSRSLWQPIRGTKLYKLKYGARVQVVLQGTSIFTAENHPIHL  479

Query  732   HGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCH  553
             HGY F+++ +GFGNFNP+ D  KFN+VDPP+RNT  VPV GWAVIRF ADNPGVWLMHCH
Sbjct  480   HGYDFYIIAEGFGNFNPKRDATKFNIVDPPLRNTASVPVNGWAVIRFVADNPGVWLMHCH  539

Query  552   IDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +D H+ WGLAMAF+VENG  E +++E PP+DLP C
Sbjct  540   LDVHIGWGLAMAFLVENGISEVESLEAPPVDLPVC  574



>ref|XP_008354603.1| PREDICTED: laccase-3-like [Malus domestica]
Length=568

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/559 (69%), Positives = 454/559 (81%), Gaps = 7/559 (1%)
 Frame = -3

Query  2109  FVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkv  1930
                LT LAS + A+ +  EFVV+   + RLC+T T ITVNGQFPGPT+ VRNGD + VKV
Sbjct  12    LAFLTFLASFSAAEDHFHEFVVEAKPVRRLCRTHTTITVNGQFPGPTLEVRNGDSIAVKV  71

Query  1929  vnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSR  1750
              NRA+YN+TIHWHGL+Q R PWADGPEYVTQCPI PG TYTYRF I +QEGTLWWHAHSR
Sbjct  72    TNRAKYNITIHWHGLKQQRNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSR  131

Query  1749  WLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNA  1570
             WLRATVYGA IIYP+ GS +PF  PK+++P+LLGEW++R+ + +QR   FTG APN+S+A
Sbjct  132   WLRATVYGALIIYPRLGSPYPFPMPKREVPLLLGEWFDRNPLDVQRLAAFTGGAPNVSDA  191

Query  1569  YTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAY  1390
             YTING PGDLYRCS Q+T++  V  GE++LLRV+N+ALNQ+LFF+VANH+L VV ADAAY
Sbjct  192   YTINGXPGDLYRCSKQETIRIPVESGESLLLRVVNSALNQELFFTVANHQLTVVSADAAY  251

Query  1389  NKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLR  1210
              KPFTT VIM+GPGQTT+VL+TA+QPPARYY+AARAY TAQNAPFDNTTTTA+LEY N  
Sbjct  252   TKPFTTRVIMLGPGQTTDVLVTANQPPARYYVAARAYQTAQNAPFDNTTTTAILEYKNAA  311

Query  1209  PGANSRPLMPQLPF---FNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNC  1039
                N +PL P LP    +NDTAT+TAFT QL+S PS    V  Q DE+L+F VGLGL NC
Sbjct  312   CSKNGKPLAPLLPRLPAYNDTATSTAFTAQLKS-PSQV-KVPTQIDENLYFIVGLGLNNC  369

Query  1038  TP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT  865
             T    PRCQGPNNTRFAASMNNVSFV PR TSL+QA Y+ +PG++T DFPPVPPVQF+YT
Sbjct  370   TVPNSPRCQGPNNTRFAASMNNVSFVFPRSTSLMQAAYSGVPGVFTTDFPPVPPVQFNYT  429

Query  864   GNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFN  685
             GNV R LW P  GTKLYK+KYG+ VQ+VLQDT+I TTEDHP+HLHGYHF+V+G GFGN+N
Sbjct  430   GNVPRGLWSPRRGTKLYKLKYGANVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNYN  489

Query  684   PQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVE  505
             P+TD AKFNL DPP RNTI  P GGW  IRF ADNPGVWLMHCH+D+HL  GLAMAF+V 
Sbjct  490   PRTDPAKFNLXDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDAHLFLGLAMAFLVX  549

Query  504   NGQGEKQTVEPPPLDLPRC  448
             NG G  Q+V PPP DLPRC
Sbjct  550   NGNGPLQSVIPPPADLPRC  568



>gb|KHN46117.1| Laccase-3, partial [Glycine soja]
Length=537

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/539 (69%), Positives = 435/539 (81%), Gaps = 8/539 (1%)
 Frame = -3

Query  2046  VQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTP  1867
             +Q   + RLC+T+ I+TVNGQFPGPT+  RNGD + +KVVN   YN++IHWHGLR +R P
Sbjct  1     IQTVPVKRLCRTQNILTVNGQFPGPTVEARNGDSLAIKVVNAGPYNISIHWHGLRMLRNP  60

Query  1866  WADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFP  1687
             WADGP YVTQCPI PGG+YTYRF I+NQEGTLWWHAH+ +LRATVYGA IIYPK GS +P
Sbjct  61    WADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAHTGFLRATVYGALIIYPKLGSPYP  120

Query  1686  FSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKF  1507
             FS PK++ P+LL EW+NRD + L RQTQFTGA PN+S AYTINGQPGDLYRCSSQ+TV+ 
Sbjct  121   FSMPKREYPLLLAEWFNRDPMVLLRQTQFTGAPPNVSVAYTINGQPGDLYRCSSQETVRV  180

Query  1506  SVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLL  1327
              V  GET+LLR+IN+ALNQ+LFF++ANH++ VV  DAAY KPFTTNV+M+GPGQT NVL+
Sbjct  181   PVDAGETILLRIINSALNQELFFTIANHRMTVVATDAAYTKPFTTNVLMIGPGQTINVLV  240

Query  1326  TADQpparyymaarayataqnaPFDNTTTTAVLEYTNL----RPGANSRPLMPQLPFFND  1159
             TADQ P RYYMAARAY TA NA FDNTTTTA+LEY +     + G   RP++P LP FND
Sbjct  241   TADQTPGRYYMAARAYQTAMNAAFDNTTTTAILEYKSATCSKKNGQLPRPILPVLPAFND  300

Query  1158  tatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT--PGPRCQGPNNTRFAASM  985
             TATATA+T  +R +   N  VF   D SL+F VGLGL+NCT    PRCQGPN TRFAAS+
Sbjct  301   TATATAYTAGIRGLSKIN--VFTNVDVSLYFIVGLGLINCTNPNSPRCQGPNGTRFAASI  358

Query  984   NNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIK  805
             NN SFVLP  TSL+QAYYN IPG++T DFPPVPPVQF+YTGNV R LW P  GTKL+K+K
Sbjct  359   NNHSFVLPTTTSLMQAYYNGIPGVFTTDFPPVPPVQFNYTGNVPRGLWTPARGTKLFKLK  418

Query  804   YGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTID  625
             YGS VQ+VLQDT+I TTEDHP+H+HG+HF+VVG GFGNFNP TD A+FNLVDPPVRNTI 
Sbjct  419   YGSNVQIVLQDTSIVTTEDHPMHVHGFHFFVVGSGFGNFNPATDPARFNLVDPPVRNTIG  478

Query  624   VPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
              P GGW  IRF ADNPG+W +HCHIDSHL WGL  A +VENG G  Q+V PPP DLP+C
Sbjct  479   TPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLGTALLVENGVGPSQSVIPPPPDLPQC  537



>gb|KDP44695.1| hypothetical protein JCGZ_01195 [Jatropha curcas]
Length=576

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/550 (70%), Positives = 445/550 (81%), Gaps = 8/550 (1%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             AN  V++ EFVVQ TK+ RLCKT   ITVNG FPGPT+ + NGD +VVKVVN+ARYN+TI
Sbjct  29    ANPTVHHHEFVVQATKVKRLCKTHNTITVNGMFPGPTLELHNGDSLVVKVVNKARYNLTI  88

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF IE QEGTLWWHAHS WLRATVYGA 
Sbjct  89    HWHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGAL  148

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             IIYPK G+ +PF +PK++ PILLGEWW+ + I + R+   TGAAPNIS+AYTINGQPGDL
Sbjct  149   IIYPKEGTSYPFPKPKRETPILLGEWWDANPIDVVREATRTGAAPNISDAYTINGQPGDL  208

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y CSS+DTV   +  GET LLRVINAALNQ LFF++ANHK  VVGADA+Y KPFTT+VIM
Sbjct  209   YNCSSKDTVIVPIGSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYLKPFTTSVIM  268

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN---SRP  1189
             +GPGQTT+VL++ DQPPARYY+AARAY +AQNAPFDNTTTTA+LEY +    A    S+P
Sbjct  269   LGPGQTTDVLISGDQPPARYYLAARAYQSAQNAPFDNTTTTAILEYNSAPCPAKCLTSKP  328

Query  1188  LMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRCQ  1018
             +MPQLP +NDTATATAF+   +S+      V  + D SLFFTVGLGL NC       RCQ
Sbjct  329   IMPQLPAYNDTATATAFSQSQKSL--RKVEVPTKIDHSLFFTVGLGLNNCPKNFRARRCQ  386

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             GPN TRF ASMNNVSFV P   SLLQAY  NIPG++T DFP  PPV FD+TGNVSR+LWQ
Sbjct  387   GPNGTRFTASMNNVSFVFPSSFSLLQAYKQNIPGVFTTDFPARPPVNFDFTGNVSRSLWQ  446

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTKLYK+KYG  VQ+VLQDT+I T E+HPIHLHGY F++V +GFGNFNP+TD AKFN
Sbjct  447   PVPGTKLYKLKYGESVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFNPKTDRAKFN  506

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             LVDPP+RNT  VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAFIVE+G GE Q +
Sbjct  507   LVDPPMRNTAAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFIVEDGVGELQKL  566

Query  477   EPPPLDLPRC  448
             E PPLDLP C
Sbjct  567   ESPPLDLPIC  576



>ref|XP_009788692.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=574

 Score =   711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/575 (67%), Positives = 456/575 (79%), Gaps = 11/575 (2%)
 Frame = -3

Query  2154  NTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPG  1975
             N+  NP  + F      +L +LA+ A   V+  +FV+Q T + RLCKT   ITVNGQFPG
Sbjct  5     NSIANPLSSFFF---ICILLLLANAAFGKVHYHDFVIQATPVKRLCKTHNTITVNGQFPG  61

Query  1974  PTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFK  1795
             PT+ V NGD +VV  VN+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF 
Sbjct  62    PTLEVNNGDTLVVNAVNKARYNVTIHWHGVRQMRTAWADGPEFVTQCPIRPGKSYTYRFT  121

Query  1794  IENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQ  1615
             I+ QEGTLWWHAHS WLRATVYGA II+PK G  +PF++PK++ PI+LGEWW+ + I + 
Sbjct  122   IQGQEGTLWWHAHSSWLRATVYGALIIHPKEGESYPFAKPKRETPIMLGEWWDTNPIDVV  181

Query  1614  RQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFS  1435
             R+   TGAAPN+S+AYTINGQPGDLY+CSS+DT    V  GET LLRVINAALNQQLFF+
Sbjct  182   RRATRTGAAPNVSDAYTINGQPGDLYKCSSKDTTIVHVDAGETNLLRVINAALNQQLFFT  241

Query  1434  VANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPF  1255
             VANHKL VVGADA+Y KPFTT+V+M+GPGQTT+VL+ ADQPPA+YYMAARAYA+AQ APF
Sbjct  242   VANHKLTVVGADASYVKPFTTSVLMLGPGQTTDVLIIADQPPAKYYMAARAYASAQGAPF  301

Query  1254  DNTTTTAVLEYTNLRPGAN---SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP  1084
             DNTTTTA+LEY      +N   + P+ P LP +NDTATATAFTT+ RS       V  + 
Sbjct  302   DNTTTTAILEYKAASCSSNCAKTNPVSPSLPAYNDTATATAFTTKFRS--PRKVEVPTEI  359

Query  1083  DESLFFTVGLGLVNCTPGPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGI  913
             DE+LFFTVGLGL NC  G R   CQGPN TRF ASMNNVSFVLP   SLLQA++  IPG+
Sbjct  360   DENLFFTVGLGLNNCPRGARSRNCQGPNGTRFTASMNNVSFVLPSNYSLLQAHHQGIPGV  419

Query  912   YTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHL  733
             ++ DFP  PPV+FDYTGNVSR+LWQP  GTKLYK+KYG+RVQVVLQ T+IFT E+HPIHL
Sbjct  420   FSTDFPAKPPVKFDYTGNVSRSLWQPIRGTKLYKLKYGARVQVVLQGTSIFTAENHPIHL  479

Query  732   HGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCH  553
             HGY F+++ +GFGNFNP+ DTAKFNLVDPP+RNT  VPV GW VIRF ADNPGVWLMHCH
Sbjct  480   HGYDFYIIAEGFGNFNPKRDTAKFNLVDPPLRNTASVPVKGWTVIRFVADNPGVWLMHCH  539

Query  552   IDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +D H+ WGL MAFIVENG  E +++E PP+DLP C
Sbjct  540   LDVHIGWGLGMAFIVENGVSELESLEAPPVDLPVC  574



>ref|XP_008355071.1| PREDICTED: laccase-3-like [Malus domestica]
Length=568

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/559 (69%), Positives = 454/559 (81%), Gaps = 7/559 (1%)
 Frame = -3

Query  2109  FVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkv  1930
                LT LAS + A+ +  EFVV+   + RLC+T T ITVNGQFPGPT+ VRNGD + VKV
Sbjct  12    LAFLTFLASFSAAEDHFHEFVVEAKPVRRLCRTHTTITVNGQFPGPTLEVRNGDSIAVKV  71

Query  1929  vnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSR  1750
              NRA+YN+TIHWHGL+Q R PWADGPEYVTQCPI PG TYTYRF I +QEGTLWWHAHSR
Sbjct  72    TNRAKYNITIHWHGLKQQRNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSR  131

Query  1749  WLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNA  1570
             WLRATVYGA IIYP+ GS +PF  PK+++P+LLGEW++R+ + +QR   FTG APN+S+A
Sbjct  132   WLRATVYGALIIYPRLGSPYPFPMPKREVPLLLGEWFDRNPLDVQRLAAFTGGAPNVSDA  191

Query  1569  YTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAY  1390
             YTING PGDLYRCS Q+T++  V  GE++LLRV+N+ALNQ+LFF+VANH+L VV ADAAY
Sbjct  192   YTINGLPGDLYRCSKQETIRIPVESGESLLLRVVNSALNQELFFTVANHQLTVVSADAAY  251

Query  1389  NKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLR  1210
              KPFTT VIM+GPGQTT+VL+TA+QPPARYY+AARAY TAQNAPFDNTTTTA+LEY N  
Sbjct  252   TKPFTTRVIMLGPGQTTDVLVTANQPPARYYVAARAYQTAQNAPFDNTTTTAILEYKNAA  311

Query  1209  PGANSRPLMPQLPF---FNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNC  1039
                N +PL P LP    +NDTAT+TAFT QL+S PS    V  Q DE+L+F VGLGL NC
Sbjct  312   CSKNGKPLAPLLPRLPAYNDTATSTAFTAQLKS-PSQV-KVPTQIDENLYFIVGLGLNNC  369

Query  1038  TP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT  865
             T    PRCQGPNNTRFAASMNNVSFV PR TSL+QA Y+ +PG++T DFPPVPPVQF+YT
Sbjct  370   TVPNSPRCQGPNNTRFAASMNNVSFVFPRSTSLMQAAYSGVPGVFTTDFPPVPPVQFNYT  429

Query  864   GNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFN  685
             GNV R LW P  GTKLYK+KYG+ VQ+VLQDT+I TTEDHP+HLHGYHF+V+G GFGN+N
Sbjct  430   GNVPRGLWSPRRGTKLYKLKYGANVQIVLQDTSIVTTEDHPMHLHGYHFYVIGSGFGNYN  489

Query  684   PQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVE  505
             P+TD AKFNL DPP RNTI  P GGW  IRF ADNPGVWLMHCH+D+HL  GLAMAF+V 
Sbjct  490   PRTDPAKFNLXDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDAHLFLGLAMAFLVX  549

Query  504   NGQGEKQTVEPPPLDLPRC  448
             NG G  Q+V PPP DLPRC
Sbjct  550   NGNGPLQSVIPPPADLPRC  568



>ref|XP_010535350.1| PREDICTED: laccase-13 [Tarenaya hassleriana]
Length=573

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/571 (65%), Positives = 445/571 (78%), Gaps = 22/571 (4%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             LF+     A+     V+  EFV+Q T + RLC    +ITVNGQFPGPT+ V++GD + + 
Sbjct  9     LFIFFPFKATSVITQVHYHEFVIQATPVKRLCIVHNVITVNGQFPGPTLEVQDGDTLAIT  68

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
              +N+A+YN++ HWHG+RQ+R PWADGPEY+TQCPI PGG+YTYRF I+ QEGTLWWHAHS
Sbjct  69    AINKAQYNISFHWHGIRQVRNPWADGPEYITQCPIQPGGSYTYRFTIQEQEGTLWWHAHS  128

Query  1752  RWLRATVYGAFIIYPKSGSHFPF-SQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             RWLRATVYGA II PK GS +PF   PK++I +LLGEWW+R+ + + + TQFTGAAPN+S
Sbjct  129   RWLRATVYGALIIRPKLGSPYPFPVLPKREITLLLGEWWDRNPMDVLQLTQFTGAAPNVS  188

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
             +++TINGQPGDLYRCS Q+TVK+ V+ GETVLLR+IN+ALNQ+LFF VANHKL VV ADA
Sbjct  189   DSFTINGQPGDLYRCSKQETVKYLVNSGETVLLRIINSALNQELFFGVANHKLTVVAADA  248

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             +Y KPF+TNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A  A FDNTTTTA+LEY +
Sbjct  249   SYTKPFSTNVIMIGPGQTTDVLLTADQPPANYYMAAHAYNSANAA-FDNTTTTAILEYKS  307

Query  1215  LRPGAN----------SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DES  1075
                 A           S  + PQLP FNDTATAT FT Q++S     P+    P   DE 
Sbjct  308   APCVAQKGKSQASTFTSSTIFPQLPGFNDTATATTFTNQIKS-----PSKVEVPLDIDEY  362

Query  1074  LFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLD  901
             LFFTVGLGL NC     PRCQGPN TRF ASMNNVSF+ PRR S++QAYY   PG++T+D
Sbjct  363   LFFTVGLGLFNCLNPNSPRCQGPNGTRFTASMNNVSFIFPRRNSIMQAYYQGTPGVFTMD  422

Query  900   FPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYH  721
             FP VPP++FDYTGNVSR LWQP  GTK YK+KY S+VQ+VLQDT+I TTE+HP+HLHGY 
Sbjct  423   FPAVPPLKFDYTGNVSRGLWQPVRGTKAYKLKYKSKVQIVLQDTSIVTTENHPMHLHGYE  482

Query  720   FWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSH  541
             F+VVG GFGNFNP+TD+  FNLVDPP RNTI  P GGW  IRF ADNPG WLMHCHIDSH
Sbjct  483   FYVVGSGFGNFNPRTDSTSFNLVDPPRRNTIGTPPGGWVAIRFVADNPGAWLMHCHIDSH  542

Query  540   LAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAWGLAM F+VENG GE Q V+ PPLDLP+C
Sbjct  543   LAWGLAMVFLVENGAGELQAVQSPPLDLPQC  573



>ref|XP_004307691.1| PREDICTED: laccase-5-like [Fragaria vesca subsp. vesca]
Length=574

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/567 (67%), Positives = 449/567 (79%), Gaps = 10/567 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
              L    ++ +   S A    +N EFV+Q T + RLCKT   ITVNGQFPGPT+ V NGD 
Sbjct  10    LLGVCLLLASSTMSSAEPKTHNHEFVIQATPVKRLCKTHKSITVNGQFPGPTLEVNNGDT  69

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF I+ QEGTLWW
Sbjct  70    LVVKVTNKARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWW  129

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II+PK G  +PF++PK++  +LLGEWW+ + I + RQ   TGAAP
Sbjct  130   HAHSSWLRATVYGALIIHPKQGDSYPFTKPKREQTLLLGEWWDANPIDVLRQATRTGAAP  189

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLY+CSS+DTV   ++ GET LLRV+NAALNQQLFF+VANHKL VV 
Sbjct  190   NVSDAYTINGQPGDLYKCSSKDTVIVPINSGETNLLRVVNAALNQQLFFAVANHKLTVVS  249

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTT  +M+GPGQTT+VL+T DQPP+RYYMAARAY +AQNA FDNTTTTA+LE
Sbjct  250   ADASYTKPFTTTTLMLGPGQTTDVLITGDQPPSRYYMAARAYFSAQNAQFDNTTTTAILE  309

Query  1224  Y-----TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             Y     +N + G +++P+MPQLP +NDT TA+AFTT  RS       V    DE+LFFT+
Sbjct  310   YESAPCSNCKNGPSTKPVMPQLPAYNDTNTASAFTTSFRS--PRKVEVPTDIDENLFFTI  367

Query  1059  GLGLVNCT---PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             GLGL NC    P  RCQGPN TRF ASMNNVSFVLP   S+LQA+  NIPG+ T DFP  
Sbjct  368   GLGLNNCPKNFPSSRCQGPNGTRFTASMNNVSFVLPNNISILQAFQQNIPGVVTSDFPAN  427

Query  888   PPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PP QFDYTGNVSR+LWQP SGTK Y++ YGSRVQVVLQDT+I T E+HPIHLHGY F+V+
Sbjct  428   PPQQFDYTGNVSRSLWQPKSGTKGYRLNYGSRVQVVLQDTSIVTPENHPIHLHGYDFYVL  487

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
              +GFGNFN +TDT KFNLVDPP+RNT+ VPV GWAVIRF ADNPG W+MHCH+D H+ WG
Sbjct  488   AEGFGNFNAKTDTQKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHINWG  547

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAM F+V+NG G+ Q+VEPPP DLP C
Sbjct  548   LAMVFLVDNGVGKLQSVEPPPADLPLC  574



>ref|XP_011015318.1| PREDICTED: laccase-12-like [Populus euphratica]
 ref|XP_011035866.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=583

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/583 (65%), Positives = 462/583 (79%), Gaps = 15/583 (3%)
 Frame = -3

Query  2172  QMDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITV  1993
             QM+   +   +  C+ FL  + +  T+  SLA A++++ +FVVQ TK+ RLCKT   ITV
Sbjct  8     QMEVIKSIFADRHCSFFLVVMLLASTL--SLAIAEIHHHDFVVQATKVKRLCKTHNSITV  65

Query  1992  NGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGT  1813
             NG FPGPT+ V+NGD +VVKVVN+ARYNVTIHWHG+RQ+RT WADGPE+VTQCPI PGG+
Sbjct  66    NGMFPGPTLEVKNGDTLVVKVVNKARYNVTIHWHGVRQIRTGWADGPEFVTQCPIRPGGS  125

Query  1812  YTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNR  1633
             YTYRF IE QEGTLWWHAHS WLRATVYGA II P+ GS +PF++PK++ PILLGEWW+ 
Sbjct  126   YTYRFTIEGQEGTLWWHAHSSWLRATVYGAIIILPREGSSYPFTKPKRETPILLGEWWDA  185

Query  1632  DIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALN  1453
             + + + R+   TGAAPNIS+AYTINGQPGDLY CSS+DT    ++ GET LLRVINAALN
Sbjct  186   NPVDVVREATRTGAAPNISDAYTINGQPGDLYNCSSEDTTIVPIASGETNLLRVINAALN  245

Query  1452  QQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayat  1273
             Q LFF++ANHK  V+GADA+Y KPFTT+VIM+GPGQTT+VL++ DQ P RYY+AARAY +
Sbjct  246   QPLFFTIANHKFTVIGADASYLKPFTTSVIMLGPGQTTDVLISGDQLPGRYYIAARAYQS  305

Query  1272  aqnaPFDNTTTTAVLEYTN-LRPG-ANSRPLMPQLPFFNDtatataftTQLRSVPSNNPT  1099
              QNAPFDNTT TA+LEY + L P    ++P+MP+LP +NDTAT TAFT  LRS     P 
Sbjct  306   TQNAPFDNTTATAILEYKSALCPAKCTTKPVMPRLPAYNDTATVTAFTRSLRS-----PR  360

Query  1098  VFNQP---DESLFFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQA  937
               + P   DE+LFFT+GLGL NC       RCQGPN TRF AS+NNVSFV P   +LLQA
Sbjct  361   KVDVPTDIDENLFFTIGLGLNNCPKNFRARRCQGPNGTRFTASINNVSFVFPSNIALLQA  420

Query  936   YYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFT  757
             Y   +PGIYT DFP  PPV+FDYTGNVSR+L+QP  GTKLYK+KYGSRVQ+VLQDT+I T
Sbjct  421   YRQKVPGIYTTDFPAKPPVKFDYTGNVSRSLFQPVRGTKLYKLKYGSRVQIVLQDTSIVT  480

Query  756   TEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNP  577
              E+HP+HLHGY F+V+ +GFGNFNP+T  +KFNLVDPP+RNT+ VP  GWAVIRF ADNP
Sbjct  481   PENHPMHLHGYDFYVIAEGFGNFNPKTHKSKFNLVDPPMRNTVAVPTNGWAVIRFVADNP  540

Query  576   GVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GVW+MHCH+D H+ WGLAMAF+VE+G GE Q+VEPPP DLP C
Sbjct  541   GVWIMHCHLDVHITWGLAMAFLVEDGIGELQSVEPPPADLPIC  583



>ref|XP_002273875.2| PREDICTED: laccase-12 [Vitis vinifera]
 emb|CBI25418.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/555 (68%), Positives = 442/555 (80%), Gaps = 15/555 (3%)
 Frame = -3

Query  2082  LANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVT  1903
                A+ ++ +FVVQ T + RLCKT   ITVNGQ+PGPT+ + NGD + VKV N+ARYNVT
Sbjct  28    FTEAETHHHDFVVQATPVKRLCKTHNTITVNGQYPGPTLEINNGDTLEVKVTNKARYNVT  87

Query  1902  IHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGA  1723
             IHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF ++ QEGTLWWHAHS WLRATVYGA
Sbjct  88    IHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLRATVYGA  147

Query  1722  FIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGD  1543
              II+PK GS +PF++PK++ PILLGEWW+ + I + RQ   TGAAPN+S+AYTINGQPGD
Sbjct  148   LIIHPKPGSSYPFTKPKRETPILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGD  207

Query  1542  LYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVI  1363
             LY CSS+DTV   +  GET LLRVIN+ LNQ+LFF+VANHK  VV ADA+Y KPFTT+VI
Sbjct  208   LYNCSSKDTVIVPIDSGETNLLRVINSGLNQELFFTVANHKFTVVSADASYTKPFTTSVI  267

Query  1362  MVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL----RPGANS  1195
             M+GPGQTT+VL+T DQPPARYYMAARAY +AQ APFDNTTTTA+LEY +     + G ++
Sbjct  268   MLGPGQTTDVLITGDQPPARYYMAARAYQSAQGAPFDNTTTTAILEYKSAPCPAKKGVST  327

Query  1194  RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTP---  1033
              P+ P LP FNDTAT TAF+   RS     P     P   DESLFFTVGLGL  C P   
Sbjct  328   TPVFPSLPAFNDTATVTAFSKSFRS-----PAKVEVPTDIDESLFFTVGLGLNRCPPKFK  382

Query  1032  GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVS  853
               +CQGPN TRF ASMNNVSFVLP   SLLQA+   IPG++T D+P  PPV+FDYTGNVS
Sbjct  383   SSQCQGPNGTRFTASMNNVSFVLPSNFSLLQAHQQGIPGVFTTDYPAAPPVKFDYTGNVS  442

Query  852   RALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTD  673
             R+LWQP  GTKLYK+KYGSRVQVVLQ T+IFT E+HPIHLHGY F+++ +GFGNFNP TD
Sbjct  443   RSLWQPVPGTKLYKLKYGSRVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPSTD  502

Query  672   TAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQG  493
             T+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG G
Sbjct  503   TSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVG  562

Query  492   EKQTVEPPPLDLPRC  448
               Q++E PP DLP C
Sbjct  563   ALQSIETPPADLPLC  577



>gb|KDO44836.1| hypothetical protein CISIN_1g008066mg [Citrus sinensis]
Length=579

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/583 (66%), Positives = 459/583 (79%), Gaps = 13/583 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLT--VLASLANADVYNQEFVVQETKITRLCKTKTIIT  1996
             M+  N+   N F  GF   L +++    L S ANA  ++ +FV+Q T + RLCKT   IT
Sbjct  1     MEFFNSRFANSF--GFFLGLVLLIASNALLSFANAKAHHHDFVIQATPVKRLCKTHNTIT  58

Query  1995  VNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGG  1816
             VNG +PGPT+ V NGD +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG 
Sbjct  59    VNGMYPGPTLEVNNGDTLVVKVTNKARYNVTIHWHGVRQMRTAWADGPEFVTQCPIRPGM  118

Query  1815  TYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWN  1636
             +YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK GS +PF +PK++ PILLGEWW+
Sbjct  119   SYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPKEGSSYPFPKPKRETPILLGEWWD  178

Query  1635  RDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAAL  1456
              + I + RQ   TGAAPNIS+AYTINGQPGDLY CSSQDTV   +  GET LLRVIN+ L
Sbjct  179   ANPIDVVRQATRTGAAPNISDAYTINGQPGDLYNCSSQDTVVVPIDSGETNLLRVINSGL  238

Query  1455  NQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaaraya  1276
             NQ LFF++ANH+  VVGADA+Y KPFTT+VIM+GPGQTT+VL+  DQPP+RYY+AARAYA
Sbjct  239   NQPLFFTIANHQFTVVGADASYLKPFTTSVIMLGPGQTTDVLIKGDQPPSRYYLAARAYA  298

Query  1275  taqnaPFDNTTTTAVLEYTNL----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSN  1108
             +A NAPFDNTTTTA+LEY +     + G + RP+MP LP FNDTAT TAFT +LRS    
Sbjct  299   SAPNAPFDNTTTTAILEYKSAPCPAKKGLSIRPVMPPLPAFNDTATVTAFTKKLRS--PQ  356

Query  1107  NPTVFNQPDESLFFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQA  937
                V    DESLFFTVGLGL NC       RCQGPN TRF ASMNNVSFVLP   SLLQA
Sbjct  357   KVEVPTDIDESLFFTVGLGLNNCPRNFRSSRCQGPNGTRFTASMNNVSFVLPSNFSLLQA  416

Query  936   YYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFT  757
             +++ IPG++T DFP  PP +FDYTGNVSR+LWQP  GTKLYK++YGSRVQ+VLQDT+IFT
Sbjct  417   HHHGIPGVFTTDFPANPPFKFDYTGNVSRSLWQPVPGTKLYKLEYGSRVQIVLQDTSIFT  476

Query  756   TEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNP  577
              E+HPIH+HGY F+++ +GFGNFNP+TDT+KFNLVDPP+RNT+ VPVGGWAVIRF ADNP
Sbjct  477   PENHPIHIHGYDFYIIAEGFGNFNPKTDTSKFNLVDPPLRNTVGVPVGGWAVIRFVADNP  536

Query  576   GVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GVWLMHCH+D H+ WGLAMAF+VENG  E + +E PP D P C
Sbjct  537   GVWLMHCHLDVHITWGLAMAFLVENGVTELEKLEAPPPDYPVC  579



>ref|XP_002520797.1| laccase, putative [Ricinus communis]
 gb|EEF41506.1| laccase, putative [Ricinus communis]
Length=581

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/563 (67%), Positives = 454/563 (81%), Gaps = 13/563 (2%)
 Frame = -3

Query  2106  VMLTVLASLANAD--VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             V+ + L+S ANA    +N EFV+Q T + RLCKT+ +ITVNG FPGPT+ V NGD +VV 
Sbjct  22    VIASALSS-ANATPMTHNHEFVIQATSVKRLCKTQNVITVNGMFPGPTLEVNNGDTLVVT  80

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V NRA+YNVTIHWHG+RQMRT WADGPE+VTQCPI PGGTYTYRF I+ QEGTLWWHAHS
Sbjct  81    VTNRAQYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGTYTYRFTIQAQEGTLWWHAHS  140

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II+PK GS +PF +PK++ PI+LGEWWN + I + R+   TG APN+S+
Sbjct  141   SWLRATVYGALIIHPKEGSSYPFPKPKRETPIILGEWWNANPIDVLRKATRTGGAPNVSD  200

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY CSSQDTV   +  GET LLRVINAA+NQ LFF+VANH+L VVGADA+
Sbjct  201   AYTINGQPGDLYNCSSQDTVIVPIDSGETNLLRVINAAMNQPLFFTVANHRLTVVGADAS  260

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN-  1216
             Y KPFTT+V+M+GPGQTT+VL++ DQ PARYYMAARAY +AQNA FDNTTTTA+LEY + 
Sbjct  261   YTKPFTTSVLMLGPGQTTDVLISGDQKPARYYMAARAYQSAQNAQFDNTTTTAILEYKSA  320

Query  1215  ---LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLV  1045
                 +  ++++P+MP LP +NDTAT TAF+T  RS   N   V  + DE+LFFTVGLGL 
Sbjct  321   PCAAKNCSSNKPIMPPLPAYNDTATVTAFSTSFRS--RNKVLVPTEVDENLFFTVGLGLN  378

Query  1044  NCTP----GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQ  877
              C P      +CQGPN TRFAASMNNVSF LP   S+LQA+   IP ++T DFP  PP++
Sbjct  379   TCPPNFNKSSQCQGPNGTRFAASMNNVSFQLPSNFSILQAHQLGIPRVFTTDFPASPPLK  438

Query  876   FDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGF  697
             FDYTGNVSR+LWQ  +GTK+YK+KYGSRVQ+VLQDT+I T+E+HPIHLHGY F+++ +GF
Sbjct  439   FDYTGNVSRSLWQAVAGTKVYKLKYGSRVQIVLQDTSIVTSENHPIHLHGYDFYIIAEGF  498

Query  696   GNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMA  517
             GNFNPQTDT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMA
Sbjct  499   GNFNPQTDTSKFNLVDPPLRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMA  558

Query  516   FIVENGQGEKQTVEPPPLDLPRC  448
             F+VENG G  Q++E PP DLP C
Sbjct  559   FLVENGVGVLQSIEAPPEDLPPC  581



>ref|XP_009763769.1| PREDICTED: laccase-12-like [Nicotiana sylvestris]
Length=574

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/546 (70%), Positives = 444/546 (81%), Gaps = 8/546 (1%)
 Frame = -3

Query  2067  VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHG  1888
             ++   FV+Q T + RLCKT   ITVNGQFPGPT+ V NGD +VV VVN+ARYNVTIHWHG
Sbjct  31    IHYHNFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVNVVNKARYNVTIHWHG  90

Query  1887  LRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYP  1708
             +RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVYGA II+P
Sbjct  91    VRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHP  150

Query  1707  KSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCS  1528
             K G  +PF++PK++ PI+LGEWW+ + + + R+   TGAAPN+S+AYTINGQPGDLY+CS
Sbjct  151   KEGESYPFAKPKRETPIMLGEWWDANPMDVIRRATRTGAAPNVSDAYTINGQPGDLYKCS  210

Query  1527  SQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPG  1348
             SQDT    V  GET LLRVINAALNQQLFFSVANHKL VVGADA+Y KPFTT+V+M+GPG
Sbjct  211   SQDTTIVPVDSGETNLLRVINAALNQQLFFSVANHKLTVVGADASYVKPFTTSVLMLGPG  270

Query  1347  QTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN---SRPLMPQ  1177
             QTT+VL+TADQ PARYYMAARAYA+AQ  PFDNTTTTA+LEY      +N   + P+ P 
Sbjct  271   QTTDVLITADQQPARYYMAARAYASAQGNPFDNTTTTAILEYKTASCSSNCVKTNPVSPS  330

Query  1176  LPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR---CQGPNN  1006
             LP FNDTATATAFTT+ RS       V  + DE+LFFTVGLGL NC  G R   CQGPN 
Sbjct  331   LPAFNDTATATAFTTKFRS--PRKVEVPTEIDENLFFTVGLGLNNCPRGARSRNCQGPNG  388

Query  1005  TRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSG  826
             TRF ASMNNVSFVLP   SLLQA+   IPG+++ DFP  PPV+FDYTGNVSR+LWQP  G
Sbjct  389   TRFTASMNNVSFVLPSNYSLLQAHQQGIPGVFSTDFPANPPVKFDYTGNVSRSLWQPTRG  448

Query  825   TKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDP  646
             TKLYK+KYG+RVQVVLQ T+IFT E+HPIHLHGY F+++ +GFGNFNP+TDTAKFNLVDP
Sbjct  449   TKLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPKTDTAKFNLVDP  508

Query  645   PVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPP  466
             P+RNT  VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAFIVENG  + +++E PP
Sbjct  509   PLRNTASVPVKGWAVIRFVADNPGVWLMHCHLDVHIGWGLAMAFIVENGVTQLESLEAPP  568

Query  465   LDLPRC  448
             +DLP C
Sbjct  569   VDLPVC  574



>ref|XP_008374344.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/555 (68%), Positives = 434/555 (78%), Gaps = 11/555 (2%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             SLA   +   EFVVQ T + RLCKT+  ITVNGQ PGPT+ V NGD +VVKV NRA+YNV
Sbjct  31    SLAEPQIXKHEFVVQATPVKRLCKTQNSITVNGQLPGPTLEVNNGDTLVVKVTNRAQYNV  90

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             TIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF I+ QEGTLWWHAHS WLRATVYG
Sbjct  91    TIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYG  150

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A II+PK G  +PF++PK +  +LLGEWWN + I + RQ   TGAAPN+S+AYTINGQPG
Sbjct  151   ALIIHPKQGDSYPFTKPKSETTLLLGEWWNANPIDVLRQATMTGAAPNVSDAYTINGQPG  210

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DLY CSSQDTV   +  GET LLRVINAALNQ LFFSVANHKL VV ADA+Y KPFTT V
Sbjct  211   DLYNCSSQDTVIVPIDSGETNLLRVINAALNQPLFFSVANHKLTVVSADASYTKPFTTTV  270

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYT------NLRPG  1204
             +M GPGQTT+VL+T DQ PARYY+AA AY +AQNA FDNTTTTA+LEY       N +  
Sbjct  271   LMJGPGQTTDVLITGDQSPARYYLAASAYFSAQNAAFDNTTTTAILEYKSAPCSPNCKNS  330

Query  1203  ANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---  1033
             + ++P+M QLP FNDT TA+AFT   RS       V  + DE+LFFT+GLGL NC     
Sbjct  331   SAAKPIMAQLPAFNDTNTASAFTKSFRS--PRKVEVPTEIDENLFFTIGLGLNNCPKNFG  388

Query  1032  GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVS  853
               RCQGPN TRF ASMNNVSFVLP   S+LQAY  NIPG++T DFP  PP +FDYTGNVS
Sbjct  389   SQRCQGPNGTRFTASMNNVSFVLPNNISILQAYLQNIPGVFTADFPANPPTKFDYTGNVS  448

Query  852   RALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTD  673
             R+LWQP SGT+ YK+KYGSRVQVVLQDT+I T E+HPIHLHGY F+++ +GFGNFN QTD
Sbjct  449   RSLWQPMSGTRGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAQTD  508

Query  672   TAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQG  493
             T KFNL DPP+RNT+ VP  GWAVIRF ADNPG W+MHCH+D H+ WGLAM F+V+NG G
Sbjct  509   TKKFNLXDPPLRNTVAVPANGWAVIRFVADNPGAWIMHCHLDVHINWGLAMVFLVDNGVG  568

Query  492   EKQTVEPPPLDLPRC  448
               Q+VE PP+DLP C
Sbjct  569   ALQSVEQPPVDLPLC  583



>ref|XP_011076646.1| PREDICTED: laccase-12 [Sesamum indicum]
Length=578

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/581 (67%), Positives = 457/581 (79%), Gaps = 10/581 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLA-KLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITV  1993
             M++  N S N FC+ F+   L V+      + +A V+  +FVVQ T + RLC+T++ ITV
Sbjct  1     MEAYRNNS-NTFCSFFVFFGLLVLFVSTMPITDAKVHYHDFVVQATPVKRLCRTRSTITV  59

Query  1992  NGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGT  1813
             NG +PGPT+ V NGD +VV VVNRARYNVTIHWHG+RQ+RT W+DGPE+VTQCPI PGG+
Sbjct  60    NGMYPGPTLEVNNGDTLVVNVVNRARYNVTIHWHGVRQIRTGWSDGPEFVTQCPIRPGGS  119

Query  1812  YTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNR  1633
             YTYRF I+ QEGTLWWHAHS WLRATVYGA II PK G  +PF +PK++  +LLGEWWN 
Sbjct  120   YTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIRPKEGDSYPFPKPKRETALLLGEWWNA  179

Query  1632  DIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALN  1453
             D I + RQ   TGAAPN+S+AYTINGQPGDLY CSS+DT+   V  GET LLRV+N+ALN
Sbjct  180   DPIDVVRQATRTGAAPNVSDAYTINGQPGDLYNCSSRDTIIVPVDSGETNLLRVVNSALN  239

Query  1452  QQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayat  1273
             QQLFF VANHKL VVGADA+Y KPFTT+V+M+GPGQTT++L+TADQPPARYY+AARAYA+
Sbjct  240   QQLFFKVANHKLTVVGADASYVKPFTTSVLMLGPGQTTDILITADQPPARYYIAARAYAS  299

Query  1272  aqnaPFDNTTTTAVLEYTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNP  1102
             AQ APFDNTTTTA+LEY +      GA  +P+MP +P FNDTATAT+FTT  RS P   P
Sbjct  300   AQGAPFDNTTTTAILEYKSAPCPAKGATIKPVMPTMPAFNDTATATSFTTSFRS-PRQVP  358

Query  1101  TVFNQPDESLFFTVGLGLVNCTPGPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAYY  931
                N  D +LFFTVGLGL NC PG     CQGPN TRF ASMNNVSFVLP   SLLQA+ 
Sbjct  359   VPTNI-DHNLFFTVGLGLNNCPPGASRSSCQGPNGTRFTASMNNVSFVLPSNFSLLQAHQ  417

Query  930   NNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTE  751
               IPG++T DFP  PPV+FDYTGNVSR LWQP  GTKLY +KYG  VQVVLQ T+IFT E
Sbjct  418   QGIPGVFTRDFPANPPVKFDYTGNVSRTLWQPVPGTKLYPLKYGETVQVVLQGTSIFTAE  477

Query  750   DHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGV  571
             +HPIHLHGY F+++ +GFGNFNP TDTAKFNLVDPP+RNT  VPVGGW VIRF ADNPGV
Sbjct  478   NHPIHLHGYDFYIIAEGFGNFNPSTDTAKFNLVDPPLRNTASVPVGGWTVIRFVADNPGV  537

Query  570   WLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             WLMHCH+D H+ WGLA AF+VENG GE QT+E PP DLP C
Sbjct  538   WLMHCHLDVHIGWGLATAFLVENGVGELQTLEAPPADLPLC  578



>ref|XP_004307184.1| PREDICTED: laccase-12-like [Fragaria vesca subsp. vesca]
Length=575

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/562 (67%), Positives = 437/562 (78%), Gaps = 10/562 (2%)
 Frame = -3

Query  2109  FVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkv  1930
             F    + ++LA    ++ EFVVQ T + RLCKT   ITVNGQFPGPT+ V NGD +VVKV
Sbjct  16    FASSAMTSTLAEPKAHHHEFVVQATPVKRLCKTHNSITVNGQFPGPTLEVNNGDTLVVKV  75

Query  1929  vnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSR  1750
              N+ RYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF ++ QEGTLWWHAHS 
Sbjct  76    TNKGRYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSS  135

Query  1749  WLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNA  1570
             WLRATVYGA II+PK G  +PF +P +   +LLGEWW+ + I + RQ   TGAAPN+SNA
Sbjct  136   WLRATVYGAIIIHPKQGDSYPFPKPNRQETLLLGEWWDANPIDVVRQATRTGAAPNVSNA  195

Query  1569  YTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAY  1390
             YTINGQPGDLY CSS+ TV   +  GET LLRV+NAALNQ LFFSVANHKL VVGADA+Y
Sbjct  196   YTINGQPGDLYNCSSKGTVIVPIDSGETNLLRVVNAALNQPLFFSVANHKLTVVGADASY  255

Query  1389  NKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLR  1210
              KPFTT V+M+GPGQTT+VL++ DQ P+RYYMAA AY +AQNAPFDNTTTTA+LEY ++R
Sbjct  256   TKPFTTKVLMLGPGQTTDVLISGDQQPSRYYMAAHAYFSAQNAPFDNTTTTAILEYKSVR  315

Query  1209  -----PGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLV  1045
                      S+P+MPQLP FNDT TA  FT   RS       V  + DE+LFFT+GLGL 
Sbjct  316   CNNTTSCKKSKPIMPQLPAFNDTNTAEVFTRSFRS--PRKVEVPTEIDENLFFTIGLGLN  373

Query  1044  NCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
              C       RCQGPN TRFAASMNNVSFVLP   S+LQAY  NIPG+YT DFP  PP +F
Sbjct  374   KCPKHFRSRRCQGPNGTRFAASMNNVSFVLPNNMSILQAYQQNIPGVYTSDFPANPPKKF  433

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             DYTGNVSR+LWQP  GTK YK+KYGSRVQVVLQDT+I T E+HPIHLHGY F+++ QGFG
Sbjct  434   DYTGNVSRSLWQPSFGTKGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAQGFG  493

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NFN +TDT KFNLVDPP+RNT+ VP  GWAVIRF ADNPG WL+HCH+D H+ WGL M F
Sbjct  494   NFNAKTDTKKFNLVDPPLRNTVSVPANGWAVIRFVADNPGAWLLHCHLDVHINWGLGMFF  553

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +V+NG GE QT+EPPP DLPRC
Sbjct  554   LVDNGVGELQTIEPPPADLPRC  575



>gb|ABK92474.1| unknown [Populus trichocarpa]
Length=550

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/551 (69%), Positives = 442/551 (80%), Gaps = 7/551 (1%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             SLA A  ++ +F VQ TK+ RLCKT   ITVNG FPGPT+ V+NGD +VVKVVNRARYNV
Sbjct  2     SLAIAKTHHHDFTVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTLVVKVVNRARYNV  61

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             TIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF IE QEGTLWWHAHS WLRATVYG
Sbjct  62    TIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYG  121

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A II+P+ GS +PFS+PK++ PILLGEWW+ + I + R+   TGAAPNIS+AYTINGQPG
Sbjct  122   ALIIHPREGSSYPFSKPKRETPILLGEWWDANPIDVVREATRTGAAPNISDAYTINGQPG  181

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DL+ CSS+DT    +  GET LLRVINAALNQ LFF++ANHK  VVGADA+Y KPFTT+V
Sbjct  182   DLFNCSSKDTTIVPIDSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYLKPFTTSV  241

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN--SR  1192
             IM+GPGQTT+VL++ DQ P RYYMAARAY +AQNAPFDNTTTTA+LEY ++   A    +
Sbjct  242   IMLGPGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTAILEYKSVLCPAKCTKK  301

Query  1191  PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRC  1021
             P MP LP +NDTAT TAF+   RS       V    DE+LFFT+GLGL NC       RC
Sbjct  302   PFMPPLPAYNDTATVTAFSRSFRS--PRKVEVPTDIDENLFFTIGLGLNNCPKNFRARRC  359

Query  1020  QGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALW  841
             QGPN TRF ASMNNVSFV P + SLLQAY   IPG++T DFP  P V+FDYTGNVSR+L+
Sbjct  360   QGPNGTRFTASMNNVSFVFPSKASLLQAYKQKIPGVFTTDFPAKPQVKFDYTGNVSRSLF  419

Query  840   QPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKF  661
             QP  GTKLYK+KYGSRVQ+VLQDT+I T E+HPIHLHGY F+++ +GFGNFNP+TD +KF
Sbjct  420   QPARGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFNPKTDKSKF  479

Query  660   NLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQT  481
             NLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE G G  Q+
Sbjct  480   NLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEEGIGILQS  539

Query  480   VEPPPLDLPRC  448
             VEPPP DLP C
Sbjct  540   VEPPPADLPIC  550



>ref|XP_002520796.1| laccase, putative [Ricinus communis]
 gb|EEF41505.1| laccase, putative [Ricinus communis]
Length=577

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/549 (69%), Positives = 444/549 (81%), Gaps = 8/549 (1%)
 Frame = -3

Query  2076  NADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIH  1897
             NA V++ +FVVQ TK+ RLCKT   ITVNG FPGPTI V +GD +VVKV N+ARYNVT+H
Sbjct  31    NAKVHHHDFVVQATKVKRLCKTHNTITVNGMFPGPTIEVNSGDTLVVKVTNKARYNVTVH  90

Query  1896  WHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFI  1717
             WHG+RQMRT WADGPE++TQCPI PGG+YTYRF IE QEGTLWWHAHS WLRATVYGA I
Sbjct  91    WHGIRQMRTGWADGPEFITQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALI  150

Query  1716  IYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLY  1537
             IYPK G+ +P+++PK++ PILLGEWW+ + I + R+   TGAAPNIS+AYTINGQPGDLY
Sbjct  151   IYPKDGTSYPYAKPKRETPILLGEWWDANPIDVVREATRTGAAPNISDAYTINGQPGDLY  210

Query  1536  RCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMV  1357
              CSS++TV   +  GET LLRVINAALNQ LFF++ANHK  VVGADA Y KPF+T+VIM+
Sbjct  211   NCSSKETVIVPIGSGETHLLRVINAALNQPLFFTIANHKFTVVGADALYLKPFSTSVIML  270

Query  1356  GPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN---SRPL  1186
             GPGQTT+VL++ DQPPARYY+AARAY +AQNAPFDNTTTTA+LEY +    A    S+P+
Sbjct  271   GPGQTTDVLISGDQPPARYYIAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKCLTSKPI  330

Query  1185  MPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRCQG  1015
             MP LP FNDT T TAF+  LRS       V  + DE+LFFT+GLGL  C       RCQG
Sbjct  331   MPPLPAFNDTPTVTAFSKSLRS--PRKVDVPTEIDENLFFTIGLGLNKCPKNFRARRCQG  388

Query  1014  PNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQP  835
             PN TRF +SMNNVSFVLP   SLLQA   NIPG++T DFP  PPV+FDYTGNVS++LWQP
Sbjct  389   PNGTRFTSSMNNVSFVLPSNFSLLQAARQNIPGVFTTDFPAKPPVKFDYTGNVSQSLWQP  448

Query  834   PSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNL  655
               GTKLYK+KYGSRVQ+VLQDT+I T E+HPIHLHGY F+V+ +GFGNFNP+ DTAKFNL
Sbjct  449   VPGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYVIAEGFGNFNPKKDTAKFNL  508

Query  654   VDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVE  475
             VDPP+RNT+ VP  GWAVIRF ADNPGVW+MHCH+D H+ WGLAMAF+VE+G GE Q +E
Sbjct  509   VDPPMRNTVAVPSNGWAVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVEDGIGELQKLE  568

Query  474   PPPLDLPRC  448
             PPP DLP C
Sbjct  569   PPPNDLPLC  577



>ref|XP_007008849.1| Laccase 12 [Theobroma cacao]
 gb|EOY17659.1| Laccase 12 [Theobroma cacao]
Length=573

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/562 (67%), Positives = 447/562 (80%), Gaps = 9/562 (2%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             LF+++     LANA+V   +FV+Q T + RLCKT + ITVNG FPGPT+ V++GD + VK
Sbjct  14    LFLLICSALCLANAEVQQHQFVIQATPVKRLCKTHSSITVNGMFPGPTLEVKDGDTLEVK  73

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF I+ Q GTLWWHAHS
Sbjct  74    VINKARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQVGTLWWHAHS  133

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II PK G  +PF +PK++ PILLGEWW+ + I + R+   TGA+PNIS+
Sbjct  134   SWLRATVYGALIIRPKEGESYPFPKPKRETPILLGEWWDANPIDVVREATRTGASPNISD  193

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY CSS+DT    +  GET LLRVINAALNQ LFF+VANHKL VVGADA+
Sbjct  194   AYTINGQPGDLYICSSKDTTIVPIDSGETNLLRVINAALNQPLFFTVANHKLTVVGADAS  253

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+VIM+GPGQTT+VL+  DQ PA+YYMAARAY +AQNAPFDNTTTTA+LEY + 
Sbjct  254   YLKPFTTSVIMLGPGQTTDVLIRGDQAPAQYYMAARAYQSAQNAPFDNTTTTAILEYKSA  313

Query  1212  ----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLV  1045
                 + G   +P+MP LP +NDT T TAF+   RS       V    DESLFFTVGLGL 
Sbjct  314   PCPAKKGLAPKPIMPSLPAYNDTNTVTAFSRSFRS--PQKVEVPTDIDESLFFTVGLGLN  371

Query  1044  NCTPG---PRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             NC P     RCQGPN TRF ASMNNVSFVLP   SLLQA+   IPG++T DFP  PPV F
Sbjct  372   NCPPNFHKSRCQGPNGTRFTASMNNVSFVLPGNFSLLQAHQQGIPGVFTTDFPGTPPVIF  431

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             DYTGNVS++L+QP +GTKLYK+KYGSRVQ+V+QDT+I T E+HPIHLHGY F+++ +GFG
Sbjct  432   DYTGNVSQSLFQPVTGTKLYKLKYGSRVQIVIQDTSIVTPENHPIHLHGYDFYIIAEGFG  491

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NFNPQ DT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF
Sbjct  492   NFNPQKDTSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAF  551

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +VENG GE QT++ PP DLP C
Sbjct  552   LVENGFGELQTLQAPPPDLPIC  573



>ref|XP_010452665.1| PREDICTED: laccase-13-like isoform X1 [Camelina sativa]
Length=569

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/572 (66%), Positives = 452/572 (79%), Gaps = 20/572 (3%)
 Frame = -3

Query  2121  LAKLFVMLTV-LASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             L   FV+L V +ASL NA+V+  EFV+QET + RLC+    ITVNGQFPGPT+ VRNGD 
Sbjct  4     LLSYFVLLVVFVASLVNAEVHLHEFVIQETPVKRLCRIHNSITVNGQFPGPTLEVRNGDS  63

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +V+  +N+ARYN+++HWHG+RQMR PWADGPEY+TQCPI PGG+YTYRF IE+QEGTLWW
Sbjct  64    LVITAINKARYNISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTIEDQEGTLWW  123

Query  1764  HAHSRWLRATVYGAFIIYPK-SGSHFPFSQ-PKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             HAHSRWLRATVYGA II P  S  H+PF   PK++I +LLGEWW+R+ + +    QFTGA
Sbjct  124   HAHSRWLRATVYGALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGA  183

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APNIS+A+TINGQPGDLYRCSSQ+T++F V  GE VLLRVIN+ALNQ+LFF VANHKL V
Sbjct  184   APNISDAFTINGQPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTV  243

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             V ADA+Y KPF+TNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A  A FDNTTTTA+
Sbjct  244   VAADASYTKPFSTNVIMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAI  302

Query  1230  LEYTN-----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DES  1075
             L+Y +     L   + +R ++ QLP FNDTATA AFT Q++S     P+    P   DE+
Sbjct  303   LKYKDASCVTLLGKSQARAILAQLPGFNDTATAAAFTAQMKS-----PSKVEVPLEIDEN  357

Query  1074  LFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTL  904
             LFFTVGLGL NCT     RCQGPN TRF AS+NNVSFV P+R S++QAYY   P G++T 
Sbjct  358   LFFTVGLGLFNCTTPNTQRCQGPNGTRFTASINNVSFVFPKRNSIMQAYYQGTPAGVFTT  417

Query  903   DFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGY  724
             DFPP PPV FDYTGNVSR LWQP  GTK YK+K+ S+VQ++LQDT+I TTE+HP+HLHGY
Sbjct  418   DFPPTPPVTFDYTGNVSRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGY  477

Query  723   HFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDS  544
              F+VVG G GNFN  TDTA FNL+DPP RNTI  P GGW  IRF A+NPG WLMHCHIDS
Sbjct  478   EFYVVGTGVGNFNANTDTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDS  537

Query  543   HLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             H+ WGLAM F+VENG+G  Q+V+ PPLDLP+C
Sbjct  538   HIFWGLAMVFLVENGEGHLQSVQSPPLDLPQC  569



>ref|XP_009343306.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=567

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/553 (69%), Positives = 442/553 (80%), Gaps = 5/553 (1%)
 Frame = -3

Query  2097  TVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnra  1918
             T LAS + A+ +  EF+V+   + RLC+T + ITVNGQFPGPT+ VRNGD V V V NRA
Sbjct  17    TSLASFSAAEFHFHEFIVEARPVRRLCRTHSTITVNGQFPGPTLEVRNGDSVAVTVTNRA  76

Query  1917  rynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRA  1738
             RYNVTIHWHGLRQ+  PWADGPEYVTQCPI PG TYTYRF I +QEGTLWWHAHSRWLRA
Sbjct  77    RYNVTIHWHGLRQLNNPWADGPEYVTQCPIQPGATYTYRFTIIDQEGTLWWHAHSRWLRA  136

Query  1737  TVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTIN  1558
             TVYGA IIYP+ G  +PF  PK+++PILLGEW++RD   + R   FTG APN+S+AYTIN
Sbjct  137   TVYGALIIYPRLGVPYPFPMPKREVPILLGEWFDRDPQDVMRLAAFTGGAPNVSDAYTIN  196

Query  1557  GQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPF  1378
             GQPGDLYRCS ++T++  V  GE++LLR+IN+ALNQ+LFF+VANH+L VVGADA+Y KPF
Sbjct  197   GQPGDLYRCSRKETIRIPVVSGESLLLRIINSALNQELFFTVANHQLTVVGADASYTKPF  256

Query  1377  TTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN  1198
              T VIM+GPGQTT+ LLTADQ PARYYMAARAY TAQNAPFDNTTTTA+LEY N      
Sbjct  257   ATRVIMLGPGQTTDALLTADQRPARYYMAARAYQTAQNAPFDNTTTTAILEYKNAASSNQ  316

Query  1197  S-RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP--GP  1027
                P+ P LP +NDTATATA+T Q++S PS    V  Q DE LFFTVGLGL NCT    P
Sbjct  317   GLAPVFPTLPAYNDTATATAYTAQVKS-PSQV-RVPTQIDEYLFFTVGLGLYNCTVPNSP  374

Query  1026  RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRA  847
             RCQGPNNTRFAASMNNVSFVLPR  SL+QA Y  +PG++T DFPP+PPVQF+YTGNV R 
Sbjct  375   RCQGPNNTRFAASMNNVSFVLPRTNSLMQAAYYGVPGVFTTDFPPIPPVQFNYTGNVPRG  434

Query  846   LWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTA  667
             LW P  GTKLY++KYG+ VQ+VLQDT I T E+HP+HLHGYHF+V+G GFGN+NP TD A
Sbjct  435   LWSPRRGTKLYRLKYGANVQIVLQDTNIVTIEEHPMHLHGYHFYVIGSGFGNYNPSTDPA  494

Query  666   KFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEK  487
             +FNL DPP RNTI  P GGW  IRF ADNPGVWLMHCH+DSHL  GLAMAF+VENG    
Sbjct  495   RFNLFDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDSHLFLGLAMAFLVENGIEPL  554

Query  486   QTVEPPPLDLPRC  448
             Q+V PPP DLPRC
Sbjct  555   QSVIPPPPDLPRC  567



>ref|XP_009594351.1| PREDICTED: laccase-12-like [Nicotiana tomentosiformis]
Length=574

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/571 (67%), Positives = 451/571 (79%), Gaps = 11/571 (2%)
 Frame = -3

Query  2142  NPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIA  1963
             NP  + F      +L + A+ A+A  +  +FV+Q T + RLCKT   ITVNGQFPGPT+ 
Sbjct  9     NPLSSFFF---ICILLLSANAASAKTHYHDFVIQATPVKRLCKTHNTITVNGQFPGPTLE  65

Query  1962  vrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQ  1783
             V NGD +VV VVN+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTY+F I+ Q
Sbjct  66    VNNGDTLVVNVVNKARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYQFTIQGQ  125

Query  1782  EGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQ  1603
             EGTLWWHAHS WLRATVYGA II+PK G  +PF +PK++ PI+LGEWW+ + I + R+  
Sbjct  126   EGTLWWHAHSSWLRATVYGALIIHPKEGESYPFVKPKRETPIMLGEWWDTNPIDVVRRAT  185

Query  1602  FTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANH  1423
              TGAAPN+S+AYTINGQPGDLY+CSS+DT    V  GET LLRVINAALNQQLFF+VANH
Sbjct  186   RTGAAPNVSDAYTINGQPGDLYKCSSKDTTTVHVDTGETNLLRVINAALNQQLFFTVANH  245

Query  1422  KLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTT  1243
             KL VVGADA+Y KPFTT+V+M+GPGQTT+VL+ ADQ PA+YYMAARAYA+AQ APFDNTT
Sbjct  246   KLTVVGADASYVKPFTTSVLMLGPGQTTDVLIKADQQPAKYYMAARAYASAQGAPFDNTT  305

Query  1242  TTAVLEYTNLRPGAN---SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESL  1072
             TTA+LEY       N   + P+ P LP +NDTATATAFTT+ RS       V    DE+L
Sbjct  306   TTAILEYKTSSCSLNCVKTNPVSPSLPAYNDTATATAFTTKFRS--PRKVEVPTDIDENL  363

Query  1071  FFTVGLGLVNCTPGPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLD  901
             FFTVGLGL NC  G R   CQGPN TRF ASMNNVSFVLP   SLLQA++  IPG+++ D
Sbjct  364   FFTVGLGLNNCPRGARSRNCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQGIPGVFSTD  423

Query  900   FPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYH  721
             FP  PPV+FDYTGNVSR+LWQP  GTKLYK+KYG+RVQVVLQ T+IFT E+HPIHLHGY 
Sbjct  424   FPAKPPVKFDYTGNVSRSLWQPIRGTKLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYD  483

Query  720   FWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSH  541
             F+++ +GFGNFNP+ D AKFNLVDPP+RNT  VPV GWAVIRF ADNPGVWLMHCH+D H
Sbjct  484   FYIIAEGFGNFNPKRDAAKFNLVDPPLRNTASVPVKGWAVIRFVADNPGVWLMHCHLDVH  543

Query  540   LAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             + WGL MAFIVENG  E +++E PP+DLP C
Sbjct  544   IGWGLGMAFIVENGVSELESLEAPPVDLPVC  574



>ref|XP_010067566.1| PREDICTED: laccase-5 [Eucalyptus grandis]
 gb|KCW65725.1| hypothetical protein EUGRSUZ_G03098 [Eucalyptus grandis]
Length=571

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/565 (66%), Positives = 443/565 (78%), Gaps = 8/565 (1%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             FL    ++ +V  +LA+A VY  +FVVQ TK+ RLC T   ITVNGQFPGPT+ V +GD 
Sbjct  9     FLLGALLLFSVAVTLADAKVYYHDFVVQATKVKRLCTTHNTITVNGQFPGPTLEVNDGDT  68

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VV VVN+ARYNVTIHWHG+RQ+R+ WADGPE+VTQCPI PGG+YTYRF I+ Q GTLWW
Sbjct  69    LVVNVVNKARYNVTIHWHGVRQVRSGWADGPEFVTQCPIRPGGSYTYRFTIQGQVGTLWW  128

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA +I PK G+ +PF +PK++ PILLGEWW+ + I + R+   TG AP
Sbjct  129   HAHSSWLRATVYGALVIRPKEGTSYPFPKPKRETPILLGEWWDANPIDVVREATRTGGAP  188

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLY CSS+DTV   +  GET LLRVINAALNQ+LFF+VANH+  VVG
Sbjct  189   NVSDAYTINGQPGDLYNCSSKDTVIVPIDSGETHLLRVINAALNQELFFTVANHRFTVVG  248

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTT+VIM+GPGQTT+VL++ DQPPARYYMAA  Y +AQ APFDNTTTTA+LE
Sbjct  249   ADASYLKPFTTSVIMLGPGQTTDVLISGDQPPARYYMAAEPYQSAQGAPFDNTTTTAILE  308

Query  1224  YTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGL  1054
             Y +      G +S+P+MP LP FNDTAT TAF    RS   N   V    DE+LF TVGL
Sbjct  309   YKSAPCPAKGISSKPVMPTLPAFNDTATVTAFIQSFRS--PNKVDVPTDIDENLFITVGL  366

Query  1053  GLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             GL NC       RCQGPN TRF ASMNNVSFVLP   S+LQAY   +PG++T DFP  PP
Sbjct  367   GLFNCPKNFGSSRCQGPNGTRFTASMNNVSFVLPSNVSILQAYKQGVPGVFTTDFPANPP  426

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             VQFDYTGNVSR+LWQP  GTK+YK+KYGSRVQ+VLQ T I T E+HPIH+HGY F+++  
Sbjct  427   VQFDYTGNVSRSLWQPVPGTKVYKLKYGSRVQIVLQGTNIQTAENHPIHIHGYDFYILAT  486

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNFNPQ DTAKFNLVDPP+RNT+ V V GWAVIRF ADNPG WLMHCH+D H+ WGLA
Sbjct  487   GFGNFNPQKDTAKFNLVDPPMRNTVGVSVNGWAVIRFVADNPGAWLMHCHLDVHITWGLA  546

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             + F+VENG GE Q+++PPP DLP C
Sbjct  547   VVFLVENGVGELQSLQPPPADLPPC  571



>ref|XP_008369303.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/587 (65%), Positives = 451/587 (77%), Gaps = 17/587 (3%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLAS----LANADVYNQEFVVQETKITRLCKTKTI  2002
             MD+ N T  N  C  F   LF +  ++AS    LA    +  EFV+Q T + RLCK++  
Sbjct  1     MDALNATFGNKIC--FSLCLFGLCLLVASSTTSLAEPKTHKHEFVIQATPVKRLCKSRNS  58

Query  2001  ITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMP  1822
             ITVNGQFPGPT+ V NGD +VVKV NRA+YNVTIHWHG+RQMRT WADGPE+VTQCPI  
Sbjct  59    ITVNGQFPGPTLEVNNGDTLVVKVTNRAQYNVTIHWHGIRQMRTGWADGPEFVTQCPIRS  118

Query  1821  GGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEW  1642
             GG+YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK G  +PF++PK++  +LLGEW
Sbjct  119   GGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPKQGDSYPFTKPKRETTLLLGEW  178

Query  1641  WNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINA  1462
             WN + I + RQ+  TG APN+S+AYTINGQPGDLY CSS+DTV   +   ET LLRVINA
Sbjct  179   WNANPINVLRQSTRTGGAPNVSDAYTINGQPGDLYNCSSKDTVIVPIDSSETNLLRVINA  238

Query  1461  ALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaara  1282
             ALNQ LFFSVANHKL VV ADA+Y KPFTT V+M+GPGQTT+VL+T DQPPARYY+AARA
Sbjct  239   ALNQPLFFSVANHKLTVVSADASYTKPFTTTVLMLGPGQTTDVLITGDQPPARYYLAARA  298

Query  1281  yataqnaPFDNTTTTAVLEYT------NLRPGANSRPLMPQLPFFNDtatataftTQLRS  1120
             Y +A NA FDNTTTTA+LEY       N + G  ++P+MPQLP FNDT TA+AFT   RS
Sbjct  299   YFSAHNAAFDNTTTTAILEYKSAPCSPNCKKGPTAKPIMPQLPAFNDTNTASAFTKSFRS  358

Query  1119  VPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTS  949
                    V  + DE+LFFT+GLGL NC       RCQGPN TRF ASMNNVSFVLP   S
Sbjct  359   --PRKVEVPTEIDENLFFTIGLGLNNCPKNFGSQRCQGPNGTRFTASMNNVSFVLPNNIS  416

Query  948   LLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDT  769
             +LQAY  NIPG++T DFP  PP +FDYTGNVSR+LWQP  GT+ YK+KYGSRVQVVLQDT
Sbjct  417   ILQAYQQNIPGVFTTDFPANPPRKFDYTGNVSRSLWQPMPGTRGYKLKYGSRVQVVLQDT  476

Query  768   AIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFF  589
             +I T E+HPIHLHGY F+++ +GFGNFN QTDT KFNLVDPP+RNT+ VP  GWAVIRF 
Sbjct  477   SIVTPENHPIHLHGYDFYILAEGFGNFNAQTDTKKFNLVDPPLRNTVAVPANGWAVIRFV  536

Query  588   ADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             ADNPG W+MHCH+D H+ WGLAM F+V+NG G  Q+VE PP+DLP C
Sbjct  537   ADNPGAWIMHCHLDVHINWGLAMVFLVDNGVGALQSVEQPPVDLPLC  583



>ref|XP_006353418.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=567

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/561 (67%), Positives = 445/561 (79%), Gaps = 8/561 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             + ++    ASLA A ++  +FV+Q T + RLC T + ITVNGQFPGPT+ V NGD +VVK
Sbjct  9     ILLLFANAASLAKAKIHYHDFVIQATPVKRLCNTHSTITVNGQFPGPTLEVNNGDSLVVK  68

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVNRA+YNVTIHWHG+RQMRT WADGPE++TQCPI PGG+YTYRF I+ QEGTLWWHAHS
Sbjct  69    VVNRAQYNVTIHWHGVRQMRTAWADGPEFITQCPIRPGGSYTYRFTIQGQEGTLWWHAHS  128

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA +I+PK G+ +PF +PK+  PILLGEWW+ + I + RQ   TGAAPN S+
Sbjct  129   SWLRATVYGALVIHPKEGTAYPFPKPKRQTPILLGEWWDANPIDVIRQATRTGAAPNASD  188

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CS+QDT    V  GET LLRVIN+ LNQQLFFSVANHK  VVGADA+
Sbjct  189   AYTINGQPGDLYKCSNQDTTIVHVDSGETNLLRVINSGLNQQLFFSVANHKFTVVGADAS  248

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+V+M+GPGQTT+VL+TA+QPPARYYMAARAYA+AQ APFDNTTTTA+LEY   
Sbjct  249   YVKPFTTSVLMLGPGQTTDVLITANQPPARYYMAARAYASAQGAPFDNTTTTAILEYKAA  308

Query  1212  ---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVN  1042
                  G    P  P LP FNDTATATAFT+  RS  +    V  + DE LFFTVGLGL N
Sbjct  309   PCPAKGVKINPAFPSLPAFNDTATATAFTSSFRS--ARKVQVPTEIDEDLFFTVGLGLNN  366

Query  1041  CTPGP---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFD  871
             C  G     CQGPN TRF ASMNNVSFVLP   SLLQA++  IPG+++ DFP  PPV+FD
Sbjct  367   CPAGASSSSCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPSSPPVKFD  426

Query  870   YTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             YTGNVSR LWQP S TK+YK+ YG+RVQ+VLQ T+I T E+HPIHLHGY F+++ +GFGN
Sbjct  427   YTGNVSRTLWQPLSATKVYKLSYGARVQIVLQGTSIVTAENHPIHLHGYDFYILAEGFGN  486

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             FNPQTDT+KFNLVDPP+RNT  VPV GW+VIRF ADNPG+WLMHCH+D H+ WGLAMAF+
Sbjct  487   FNPQTDTSKFNLVDPPLRNTASVPVNGWSVIRFVADNPGIWLMHCHLDVHITWGLAMAFL  546

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             VENG  E + VE PP+DLP C
Sbjct  547   VENGVTELEAVEEPPVDLPVC  567



>ref|XP_010491316.1| PREDICTED: laccase-13 isoform X1 [Camelina sativa]
Length=569

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/572 (66%), Positives = 453/572 (79%), Gaps = 20/572 (3%)
 Frame = -3

Query  2121  LAKLFVMLTV-LASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             L   FV+L V +ASL NA+V+  EFV+QET + RLC+    ITVNGQFPGPT+ VRNGD 
Sbjct  4     LLSYFVLLVVFVASLVNAEVHFHEFVIQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDS  63

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +V+  +N+ARYN+++HWHG+RQMR PWADGPEY+TQCPI PGG+YTYRF IE+QEGTLWW
Sbjct  64    LVITAINKARYNISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTIEDQEGTLWW  123

Query  1764  HAHSRWLRATVYGAFIIYPK-SGSHFPFSQ-PKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             HAHSRWLRATVYGA II P  S  H+PF   PK++I +LLGEWW+R+ + +    QFTGA
Sbjct  124   HAHSRWLRATVYGALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGA  183

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APNIS+AYTINGQPGDLYRCSSQ+T++F V  GE VLLRVIN+ALNQ+LFF VANHKL V
Sbjct  184   APNISDAYTINGQPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTV  243

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             V ADA+Y KPF+TNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A  A FDNTTTTA+
Sbjct  244   VAADASYTKPFSTNVIMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAI  302

Query  1230  LEYTN-----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DES  1075
             L+Y +     L+  + +R +  QLP FNDTATA AFT Q++S     P+    P   DE+
Sbjct  303   LKYKDASCVTLQGKSLARAIPAQLPGFNDTATAAAFTAQMKS-----PSKVQVPLEIDEN  357

Query  1074  LFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTL  904
             LFFTVGLGL NCT     RCQGPN TRF AS+NNVSFV P++ S++QAYY   P G++T 
Sbjct  358   LFFTVGLGLFNCTTPNTQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFTT  417

Query  903   DFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGY  724
             DFPP PPV FDYTGNVSR LWQP  GTK YK+K+ S+VQ++LQDT+I TTE+HP+HLHGY
Sbjct  418   DFPPTPPVTFDYTGNVSRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGY  477

Query  723   HFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDS  544
              F+VVG G GNFNP TDTA FNL+DPP RNTI  P GGW  IRF A+NPG WLMHCHIDS
Sbjct  478   EFYVVGTGVGNFNPNTDTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDS  537

Query  543   HLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             H+ WGLAM F+VENG+G  Q+V+ PPLDLP+C
Sbjct  538   HIFWGLAMVFLVENGEGHLQSVQSPPLDLPQC  569



>ref|XP_004240885.1| PREDICTED: laccase-5-like [Solanum lycopersicum]
Length=567

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/561 (67%), Positives = 449/561 (80%), Gaps = 8/561 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             + ++   +ASLA A V+  +FV+Q T + RLC T + ITVNGQFPGPT+ V NGD +VVK
Sbjct  9     ILLLFANVASLAKAKVHYHDFVIQATPVKRLCNTHSTITVNGQFPGPTLEVNNGDTLVVK  68

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVNRA+YNVTIHWHG+RQMRT WADGPE++TQCPI PGG+YTYRF I+ QEGTLWWHAHS
Sbjct  69    VVNRAQYNVTIHWHGVRQMRTAWADGPEFITQCPIRPGGSYTYRFTIQGQEGTLWWHAHS  128

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRAT YGA +I+PK G+ +PF +PK+  PILLGEWW+ + I + RQ   TGAAPN S+
Sbjct  129   SWLRATAYGALVIHPKEGTTYPFPKPKRQTPILLGEWWDANPIDVIRQATRTGAAPNSSD  188

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CS+QDT    V  GET LLRVIN+ LNQQLFF+VANHKL VVGADA+
Sbjct  189   AYTINGQPGDLYKCSNQDTTIVHVDSGETNLLRVINSGLNQQLFFTVANHKLTVVGADAS  248

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+V+M+GPG+TT+VL+TA+QPPARYYMAARAYA+AQ APFDNTTTTA+LEY   
Sbjct  249   YVKPFTTSVLMLGPGETTDVLITANQPPARYYMAARAYASAQGAPFDNTTTTAILEYKAA  308

Query  1212  ---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVN  1042
                  G    P  P LP FNDTATATAFT+  RS  ++   V  + DE+LFFTVGLGL N
Sbjct  309   PCPAKGVKINPAFPSLPAFNDTATATAFTSSFRS--ASKVEVPTEIDENLFFTVGLGLNN  366

Query  1041  CTPGP---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFD  871
             C  G     CQGPN  RF ASMNNVSFVLP   SLLQA++  IPG+++ DFP  PPV+FD
Sbjct  367   CPAGASSSSCQGPNGMRFTASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPSSPPVKFD  426

Query  870   YTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             YTGNVSR+LWQP S TK+YK+KYG+RVQ+VLQ T+I T E+HPIHLHGY F+++ +GFGN
Sbjct  427   YTGNVSRSLWQPISATKVYKLKYGARVQIVLQGTSIVTAENHPIHLHGYDFYILAEGFGN  486

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             FNPQTDT+KFNLVDPP+RNT  VPV GW+VIRF ADNPG+WLMHCH+D H+ WGLAMAF+
Sbjct  487   FNPQTDTSKFNLVDPPLRNTASVPVNGWSVIRFVADNPGIWLMHCHLDVHITWGLAMAFL  546

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             VENG  E + +E PP+DLP C
Sbjct  547   VENGVTELEAIEEPPVDLPVC  567



>ref|XP_008363777.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/587 (65%), Positives = 451/587 (77%), Gaps = 17/587 (3%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLAS----LANADVYNQEFVVQETKITRLCKTKTI  2002
             MD+ N T  N  C  F   LF +  ++AS    LA    +  EFV+Q T + RLCK++  
Sbjct  1     MDALNATFGNKIC--FSLCLFGLCLLVASSTTSLAEPKTHKHEFVIQATPVKRLCKSRNS  58

Query  2001  ITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMP  1822
             ITVNGQFPGPT+ V NGD +VVKV NRA+YNVTIHWHG+RQMRT WADGPE+VTQCPI  
Sbjct  59    ITVNGQFPGPTLEVNNGDTLVVKVTNRAQYNVTIHWHGIRQMRTGWADGPEFVTQCPIRS  118

Query  1821  GGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEW  1642
             GG+YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK G  +PF++PK++  +LLGEW
Sbjct  119   GGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPKQGDSYPFTKPKRETTLLLGEW  178

Query  1641  WNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINA  1462
             WN + I + RQ+  TG APN+S+AYTINGQPGDLY CSS+DTV   +   ET LLRVINA
Sbjct  179   WNANPINVLRQSTRTGGAPNVSDAYTINGQPGDLYNCSSKDTVIVPIDSSETNLLRVINA  238

Query  1461  ALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaara  1282
             ALNQ LFFSVANHKL VV ADA+Y KPFTT V+M+GPGQTT+VL+T DQPPARYY+AARA
Sbjct  239   ALNQPLFFSVANHKLTVVSADASYTKPFTTTVLMLGPGQTTDVLITGDQPPARYYLAARA  298

Query  1281  yataqnaPFDNTTTTAVLEYT------NLRPGANSRPLMPQLPFFNDtatataftTQLRS  1120
             Y +A NA FDNTTTTA+LEY       N + G  ++P+MPQLP FNDT TA+AFT   RS
Sbjct  299   YFSAHNAAFDNTTTTAILEYKSAPCSPNCKKGPTAKPIMPQLPAFNDTNTASAFTKSFRS  358

Query  1119  VPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTS  949
                    V  + DE+LFFT+GLGL NC       RCQGPN TRF ASMNNVSFVLP   S
Sbjct  359   --PRKVEVPTEIDENLFFTIGLGLNNCPKNFGSQRCQGPNGTRFTASMNNVSFVLPNNIS  416

Query  948   LLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDT  769
             +LQAY  NIPG++T DFP  PP +FDYTGNVSR+LWQP  GT+ YK+KYGSRVQVVLQDT
Sbjct  417   ILQAYQQNIPGVFTTDFPANPPRKFDYTGNVSRSLWQPMPGTRGYKLKYGSRVQVVLQDT  476

Query  768   AIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFF  589
             +I T E+HPIHLHGY F+++ +GFGNFN +TDT KFNLVDPP+RNT+ VP  GWAVIRF 
Sbjct  477   SIVTPENHPIHLHGYDFYILAEGFGNFNAKTDTKKFNLVDPPMRNTVAVPANGWAVIRFV  536

Query  588   ADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             ADNPG W+MHCH+D H+ WGLAM F+V+NG G  Q+++PPP DLP C
Sbjct  537   ADNPGAWIMHCHLDVHINWGLAMVFLVDNGVGALQSIKPPPADLPLC  583



>ref|XP_009343324.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=567

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/550 (68%), Positives = 437/550 (79%), Gaps = 5/550 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             AS + A+ +  EFVV+   + RLC+T + ITVNGQFPGPT+ VRNGD V VKV N A+YN
Sbjct  20    ASFSAAEDHFHEFVVEARPVRRLCRTHSRITVNGQFPGPTLEVRNGDSVAVKVTNIAKYN  79

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             +TIHWHGL+Q   PWADGPEYVTQCPI PG TYTYRF I +QEGTLWWHAHSRWLRATVY
Sbjct  80    ITIHWHGLKQQNNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRATVY  139

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             G  IIYP+ GS +PF  PK+++P+LLGEW++R+ + + R   FTG APN+SNAYTINGQP
Sbjct  140   GVLIIYPRLGSPYPFPMPKREVPLLLGEWFDRNPLDVMRLAAFTGGAPNVSNAYTINGQP  199

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLYRCS ++T++  V  GE++LLRVIN+ALNQ+LFF+VANH+L VVGADA+Y KPF T 
Sbjct  200   GDLYRCSKKETIRIPVVSGESLLLRVINSALNQELFFTVANHQLTVVGADASYTKPFATR  259

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANS-R  1192
             VIM+GPGQTT+VLLTADQ PARYYMAA AY T  N  FDNTTTTA+LEY N         
Sbjct  260   VIMLGPGQTTDVLLTADQGPARYYMAAGAYQTGLNVAFDNTTTTAILEYKNAASSNQGLA  319

Query  1191  PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP--GPRCQ  1018
             P+ P LP +NDTATATA+T Q++S+  +   V  Q DE+LFFTVGLGL NCT    PRCQ
Sbjct  320   PVFPTLPAYNDTATATAYTAQIKSL--SQVKVPTQIDENLFFTVGLGLYNCTVPNSPRCQ  377

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             GPNNTRFAASMNNVSFVLPR  SL+QA Y  +PG++T DFPPVP VQF+YTGNV R LW 
Sbjct  378   GPNNTRFAASMNNVSFVLPRTNSLMQAAYYGVPGVFTTDFPPVPLVQFNYTGNVPRGLWS  437

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTKLYK+KYG+ VQ+V QDT+I TT+DHP+HLHGY F+V+G GFGN+NP TD A+FN
Sbjct  438   PRRGTKLYKLKYGANVQIVFQDTSIVTTDDHPMHLHGYQFYVIGSGFGNYNPSTDPARFN  497

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             L+DPP RNTI    GGW  IRF ADNPGVWLMHCH+DSHL+ GLAMAF VENG G  Q+V
Sbjct  498   LIDPPQRNTIGTGPGGWVAIRFKADNPGVWLMHCHLDSHLSLGLAMAFQVENGNGPLQSV  557

Query  477   EPPPLDLPRC  448
              PPP DLPRC
Sbjct  558   IPPPPDLPRC  567



>ref|XP_007218932.1| hypothetical protein PRUPE_ppa003349mg [Prunus persica]
 gb|EMJ20131.1| hypothetical protein PRUPE_ppa003349mg [Prunus persica]
Length=583

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/585 (65%), Positives = 452/585 (77%), Gaps = 13/585 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPF-CNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITV  1993
             MD+ N+   N   C+  +    +  +   SLA    ++ +FV+Q T + RLC T+  ITV
Sbjct  1     MDALNSIFGNKIRCSLLIGVCLLFASSAMSLAEPKTHHHDFVIQATPVKRLCTTQNSITV  60

Query  1992  NGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGT  1813
             NGQFPGPT+ V NGD +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+
Sbjct  61    NGQFPGPTLEVNNGDTLVVKVTNKARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGS  120

Query  1812  YTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNR  1633
             YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK G  +PF++PK++  +LLGEWWN 
Sbjct  121   YTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPKQGDSYPFTKPKRETTLLLGEWWNA  180

Query  1632  DIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALN  1453
             + I + RQ+  TG APN+S+AYTINGQPGDLY CSSQDTV   +  GET LLR+INAALN
Sbjct  181   NPINVLRQSTRTGGAPNVSDAYTINGQPGDLYNCSSQDTVIVPIDSGETNLLRIINAALN  240

Query  1452  QQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayat  1273
             Q LFF+VANHKL VV ADA+Y KPFTT V+M+GPGQTT+VL+T DQPPARYY+AARAY +
Sbjct  241   QPLFFTVANHKLTVVSADASYAKPFTTKVLMLGPGQTTDVLITGDQPPARYYLAARAYFS  300

Query  1272  aqnaPFDNTTTTAVLEYT------NLRPGANSRPLMPQLPFFNDtatataftTQLRSVPS  1111
             AQNA FDNTTTTA+LEY       N   G   +P+MP LP FNDTATA+AFTT  RS   
Sbjct  301   AQNAAFDNTTTTAILEYKSAPCSPNCTNGPAVKPIMPPLPAFNDTATASAFTTSFRS--P  358

Query  1110  NNPTVFNQPDESLFFTVGLGLVNC----TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLL  943
                 V  + DE+LFFT+GLGL NC     P  RCQGPN TRF ASMNNVSFVLP   S+L
Sbjct  359   RKVEVPTEIDENLFFTIGLGLNNCPKHFNPTRRCQGPNGTRFTASMNNVSFVLPNNISIL  418

Query  942   QAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAI  763
             QAY  NIPG++T DFP  PP++FDYTGNVSR+LWQP SGT+ YK+KYGSRVQVVLQDT+I
Sbjct  419   QAYQQNIPGVFTADFPANPPLKFDYTGNVSRSLWQPLSGTRGYKLKYGSRVQVVLQDTSI  478

Query  762   FTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFAD  583
              T E+HPIHLHGY F+++ +GFGNFN QTDT KFNLVDPP+RNT+ VP  GWAVIRF AD
Sbjct  479   VTPENHPIHLHGYDFYILAEGFGNFNAQTDTKKFNLVDPPMRNTVAVPANGWAVIRFVAD  538

Query  582   NPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             NPG W+MHCH+D H+ WGLAM F+V+NG G  Q++E PP DLP C
Sbjct  539   NPGAWIMHCHLDVHINWGLAMVFLVDNGVGTLQSIEAPPADLPLC  583



>ref|XP_004239961.1| PREDICTED: laccase-12-like [Solanum lycopersicum]
Length=574

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/582 (65%), Positives = 455/582 (78%), Gaps = 16/582 (3%)
 Frame = -3

Query  2169  MDSQNN--TSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIIT  1996
             M++  N   SL+  C         +L + A++A+A  ++ +FV+Q T + RLCKT   IT
Sbjct  1     MEAMKNIVKSLSSLC------FVCILLLFANVASAKTHHHDFVIQATPVKRLCKTHNSIT  54

Query  1995  VNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGG  1816
             VNGQFPGPT+ V NGD +VV VVNRARYNVTIHWHG+RQMRT WADGPE++TQCPI PG 
Sbjct  55    VNGQFPGPTLEVNNGDTLVVNVVNRARYNVTIHWHGVRQMRTGWADGPEFITQCPIRPGK  114

Query  1815  TYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWN  1636
             +YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK G ++PF +PK++ PI+LGEWW+
Sbjct  115   SYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPKEGGNYPFPKPKRETPIVLGEWWD  174

Query  1635  RDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAAL  1456
              + I + R+   TGAAPN+S+AYTINGQPGDLY+CS QDT    +  GET LLRVINA L
Sbjct  175   TNPIDVVRRATRTGAAPNVSDAYTINGQPGDLYKCSKQDTTIVHIDSGETNLLRVINAGL  234

Query  1455  NQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaaraya  1276
             NQQLFF+VANHKL VVGADA Y KPFTT+V+M+GPGQTT+VL+ ADQ P RYYMAARAYA
Sbjct  235   NQQLFFTVANHKLTVVGADANYVKPFTTSVLMLGPGQTTDVLIKADQTPNRYYMAARAYA  294

Query  1275  taqnaPFDNTTTTAVLEYTNLRPGAN---SRPLMPQLPFFNDtatataftTQLRSVPSNN  1105
             +AQ APFDNTTTTA+LEY      +N   + P+ P LP +NDTATATAFT + RS     
Sbjct  295   SAQGAPFDNTTTTAILEYKTSSCSSNCAKTNPISPSLPAYNDTATATAFTRKFRS--PRK  352

Query  1104  PTVFNQPDESLFFTVGLGLVNCTPGPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAY  934
               V  + DE+LF TVGLGL NC  G R   CQGPN TRFAASMNNVSFVLP   SLLQA+
Sbjct  353   VEVPTEIDENLFITVGLGLENCPTGARSRNCQGPNGTRFAASMNNVSFVLPSNFSLLQAH  412

Query  933   YNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTT  754
             +  IPG+++ DFP VPPV+F+YTGNVSR+LWQP  GTKLYK+KYG++VQVVLQ T IFT 
Sbjct  413   HQRIPGVFSTDFPAVPPVKFNYTGNVSRSLWQPIRGTKLYKLKYGAKVQVVLQGTGIFTA  472

Query  753   EDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPG  574
             E+HPIHLHGY F+++ +GFGNFNP+ DT+KFNLV+PP+RNT  VPV GW VIRF ADNPG
Sbjct  473   ENHPIHLHGYDFYIIAEGFGNFNPKADTSKFNLVNPPLRNTASVPVNGWTVIRFVADNPG  532

Query  573   VWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             VW+MHCH+D H+ WGLAMAF+VENG  E +++E PP+D P C
Sbjct  533   VWIMHCHLDVHITWGLAMAFLVENGVSELESLEAPPVDFPVC  574



>ref|XP_002871251.1| laccase-13 precursor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47510.1| laccase-13 precursor [Arabidopsis lyrata subsp. lyrata]
Length=569

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/573 (66%), Positives = 453/573 (79%), Gaps = 22/573 (4%)
 Frame = -3

Query  2121  LAKLFVMLTVL-ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             +   FV L VL ASL NA+V+  EFVVQET + RLC+    ITVNGQFPGPT+ VRNGD 
Sbjct  4     IRSFFVFLAVLLASLVNAEVHFHEFVVQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDS  63

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +V+  +N+ARYN+T+HWHG+RQMR PWADGPEY+TQCPI PGG+YTYRF IE+QEGTLWW
Sbjct  64    LVITAINKARYNITLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTIEDQEGTLWW  123

Query  1764  HAHSRWLRATVYGAFIIYPK-SGSHFPFSQ-PKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             HAHSRWLRATVYGA II P  S  H+PF   PK++I +LLGEWW+R+ + +    QFTGA
Sbjct  124   HAHSRWLRATVYGALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGA  183

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APNIS+A+TINGQPGDLYRCSSQ+T++F V  GE VLLRVIN+ALNQ+LFF VANHKL V
Sbjct  184   APNISDAFTINGQPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTV  243

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             V ADA+Y KPF+TNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A  A FDNTTTTA+
Sbjct  244   VAADASYTKPFSTNVIMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAI  302

Query  1230  LEYTN-----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DES  1075
             L+Y +     L+  + ++ +  QLP FNDTATA AFT Q++S     P+    P   DE+
Sbjct  303   LKYKDASCVTLQGKSQAQAIPAQLPGFNDTATAAAFTAQMKS-----PSKVKVPLEIDEN  357

Query  1074  LFFTVGLGLVNCTPGP---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYT  907
             LFFTVGLGL NC P P   RCQGPN TRF AS+NNVSFV P++ S++QAYY   P G++T
Sbjct  358   LFFTVGLGLFNC-PTPNTQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFT  416

Query  906   LDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHG  727
              DFPP PPV FDYTGNVSR LWQP  GTK YK+K+ S+VQ++LQDT+I TTE+HP+HLHG
Sbjct  417   TDFPPTPPVTFDYTGNVSRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHG  476

Query  726   YHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHID  547
             Y F+VVG G GNFNP TDTA FNL+DPP RNTI  P GGW  IRF A+NPG WLMHCH+D
Sbjct  477   YEFYVVGTGVGNFNPNTDTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHLD  536

Query  546   SHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             SH+ WGLAM F+VENG+G  Q+V+ PPLDLP+C
Sbjct  537   SHIFWGLAMVFLVENGEGHLQSVQSPPLDLPQC  569



>ref|XP_008233819.1| PREDICTED: laccase-12-like [Prunus mume]
Length=583

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/585 (65%), Positives = 451/585 (77%), Gaps = 13/585 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPF-CNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITV  1993
             MD+ N+   N   C+  L    +  +   SLA    +  +FV+Q T + RLC T+  ITV
Sbjct  1     MDALNSIFGNKIRCSLLLGVCLLFASSAMSLAEPKTHQHDFVIQATPVKRLCTTQNSITV  60

Query  1992  NGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGT  1813
             NGQFPGPT+ V NGD +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+
Sbjct  61    NGQFPGPTLEVNNGDTLVVKVTNKARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGS  120

Query  1812  YTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNR  1633
             YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK G  +PF++PK++  +LLGEWWN 
Sbjct  121   YTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPKQGDSYPFTKPKRETTLLLGEWWNA  180

Query  1632  DIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALN  1453
             + I + RQ+  TG APN+S+AYTINGQPGDLY CSSQDT+   +  GET LLR+INAALN
Sbjct  181   NPINVLRQSTRTGGAPNVSDAYTINGQPGDLYNCSSQDTIIVPIDSGETNLLRIINAALN  240

Query  1452  QQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayat  1273
             Q LFF+VANHKL +V ADA+Y KPFT+ V+M+GPGQTT+VL+T DQPPARYY+AARAY +
Sbjct  241   QPLFFTVANHKLTIVSADASYTKPFTSRVLMLGPGQTTDVLITGDQPPARYYLAARAYFS  300

Query  1272  aqnaPFDNTTTTAVLEYT------NLRPGANSRPLMPQLPFFNDtatataftTQLRSVPS  1111
             AQNA FDNTTTTA+LEY       N   G   +P+MPQLP FNDTATA+AFTT  RS   
Sbjct  301   AQNAAFDNTTTTAILEYKSAPCSPNCTNGPAVKPIMPQLPAFNDTATASAFTTSFRS--P  358

Query  1110  NNPTVFNQPDESLFFTVGLGLVNC----TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLL  943
                 V  + DE+LFFT+GLGL NC        RCQGPN TRF ASMNNVSFVLP   S+L
Sbjct  359   RKVEVPTEIDENLFFTIGLGLNNCPKHFNQTRRCQGPNGTRFTASMNNVSFVLPNNISIL  418

Query  942   QAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAI  763
             QAY  NIPG++T DFP  PP++FDYTGNVSR+LWQP SGT+ YK+KYGSRVQVVLQDT+I
Sbjct  419   QAYQQNIPGVFTADFPANPPLKFDYTGNVSRSLWQPLSGTRGYKLKYGSRVQVVLQDTSI  478

Query  762   FTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFAD  583
              T E+HPIHLHGY F+++ +GFGNFN QTDT KFNLVDPP+RNT+ VP  GWAVIRF AD
Sbjct  479   VTPENHPIHLHGYDFYILAEGFGNFNAQTDTKKFNLVDPPMRNTVAVPANGWAVIRFVAD  538

Query  582   NPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             NPG W+MHCH+D H+ WGLAM F+V+NG G  Q++E PP DLP C
Sbjct  539   NPGAWIMHCHLDVHINWGLAMVFLVDNGVGTLQSIEAPPADLPLC  583



>ref|XP_008363776.1| PREDICTED: laccase-12-like [Malus domestica]
Length=582

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/555 (68%), Positives = 437/555 (79%), Gaps = 12/555 (2%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             SLA   ++  EFV+Q TK+ RLCKT   ITVNGQ+PGPT+ V NGD +VVKV N+ARYN 
Sbjct  31    SLAEPKIHKHEFVIQATKVKRLCKTHNSITVNGQYPGPTLEVNNGDTLVVKVTNKARYNA  90

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             TIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF I+ QEGTLWWHAHS WLRATVYG
Sbjct  91    TIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYG  150

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A II+PK G  +PF++PK++  ILLGEWW+ + I + RQ   TGAAPN+S+AYTINGQPG
Sbjct  151   ALIIHPKQGDSYPFTKPKRETAILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPG  210

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DLY CSS+DTV   +  GET LLRVINAALNQ LFFSVANHKL VV ADA+Y KPFTT V
Sbjct  211   DLYNCSSKDTVIVPIDVGETNLLRVINAALNQPLFFSVANHKLTVVSADASYTKPFTTTV  270

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYT------NLRPG  1204
             +M+GPGQTT+VL+T DQPPARYY+AA AY +AQNA FDNTTTTA+LEY       N + G
Sbjct  271   LMLGPGQTTDVLITGDQPPARYYLAASAYFSAQNAAFDNTTTTAILEYRSAPCSPNCKNG  330

Query  1203  ANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT---P  1033
                +P+MPQLP FNDT TA+AFT   RS       V  + DE+LFFTVGLGL NC     
Sbjct  331   PTVKPIMPQLPAFNDTNTASAFTRSFRS--PRKVEVPTEIDENLFFTVGLGLNNCPNNFR  388

Query  1032  GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVS  853
               RCQGPN TRF ASMNNVSFV P   S+LQAY  NIPG++T DFP  PP+ FDYTGNVS
Sbjct  389   ARRCQGPNGTRFTASMNNVSFVFP-TISILQAYQQNIPGVFTADFPANPPLTFDYTGNVS  447

Query  852   RALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTD  673
             R+LWQP  GT+ YK+KYGSRVQ+VLQDT+I T E+HPIHLHGY F+++ +GFGNFN Q D
Sbjct  448   RSLWQPTPGTRGYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAQND  507

Query  672   TAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQG  493
               KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAM F+V+NG G
Sbjct  508   PKKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMVFLVDNGVG  567

Query  492   EKQTVEPPPLDLPRC  448
               Q++EPPP DLP C
Sbjct  568   ALQSIEPPPADLPLC  582



>ref|XP_010692917.1| PREDICTED: laccase-12 [Beta vulgaris subsp. vulgaris]
Length=575

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/558 (66%), Positives = 441/558 (79%), Gaps = 9/558 (2%)
 Frame = -3

Query  2100  LTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnr  1921
             L +  ++A+A V   +FVVQET + RLCK+   ITVNGQ PGPT+ V  GD +VV VVNR
Sbjct  20    LVLFFAMASAKVQYHDFVVQETPVKRLCKSLNAITVNGQLPGPTLEVYEGDTLVVNVVNR  79

Query  1920  arynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLR  1741
             A+YNVT+HWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF I  QEGTLWWHAHS WLR
Sbjct  80    AKYNVTVHWHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIRGQEGTLWWHAHSSWLR  139

Query  1740  ATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTI  1561
             ATVYGA +I P+ G+ +PF +P ++ PILLGEWWNRD I++ RQ   TGAAPN+S+AYTI
Sbjct  140   ATVYGALVIRPRQGTPYPFPKPNRETPILLGEWWNRDPISVIRQATRTGAAPNVSDAYTI  199

Query  1560  NGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKP  1381
             NGQPGDLY CS QDTV   +  GE  LLRVINAALNQ+LFFSVANH+L VVGADA Y KP
Sbjct  200   NGQPGDLYNCSKQDTVIVPIDIGERHLLRVINAALNQELFFSVANHQLTVVGADAGYLKP  259

Query  1380  FTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL----  1213
             FTTNV+M+GPGQTT+VL++ DQ   RYY+AA+ Y +AQ   FDNTTTTA+LEY ++    
Sbjct  260   FTTNVLMLGPGQTTDVLISGDQAAGRYYIAAKPYQSAQGVAFDNTTTTAILEYKSVACLP  319

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP  1033
             +  A   P+ P LP FNDTAT TAFT +LRS      +V  + DE+LFFTVGLGL  C P
Sbjct  320   KGAAKPTPVFPSLPAFNDTATVTAFTNKLRS--PRRVSVPLEIDENLFFTVGLGLNQCPP  377

Query  1032  ---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
                  +CQGPN TRF ASMNNVSFVLP   SLLQA+   +PG++T DFP  PPV FDYTG
Sbjct  378   NFNSNQCQGPNGTRFTASMNNVSFVLPSNWSLLQAHKFGVPGVFTTDFPAQPPVTFDYTG  437

Query  861   NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNP  682
             NVSR+LWQP +GTKLYK+KYGSRVQ+V+Q T+I T E+HP+H+HGY F+++ QGFGNFNP
Sbjct  438   NVSRSLWQPQTGTKLYKMKYGSRVQIVIQGTSIVTAENHPMHIHGYDFYILAQGFGNFNP  497

Query  681   QTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVEN  502
             +TDT KFNL+DPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H++WGLAMAF+VE+
Sbjct  498   RTDTKKFNLIDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHISWGLAMAFVVED  557

Query  501   GQGEKQTVEPPPLDLPRC  448
             G GE +++E PP DLP C
Sbjct  558   GVGELESLEAPPHDLPIC  575



>ref|XP_006355638.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=574

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/561 (66%), Positives = 446/561 (80%), Gaps = 8/561 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             +  +L + A+ A+   +  +FV+Q T + RLCKT   ITVNGQ+PGPT+ V NGD +VV 
Sbjct  16    VICILLLFANAASEKTHYHDFVIQATPVKRLCKTSNAITVNGQYPGPTLEVNNGDTLVVN  75

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVN+ARYNVTIHWHG+RQMRT WADGPE++TQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  76    VVNKARYNVTIHWHGVRQMRTAWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHS  135

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II+PK G ++PF +PK++ PILLGEWWN + I + RQ   TGAAPN+S+
Sbjct  136   SWLRATVYGALIIHPKEGGNYPFPKPKRETPILLGEWWNTNPIDVVRQATRTGAAPNVSD  195

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CS QDT    +  GET LLRVINA LNQQLFF+VANHKL VVGADA 
Sbjct  196   AYTINGQPGDLYKCSRQDTTIVHMDSGETNLLRVINAGLNQQLFFTVANHKLTVVGADAN  255

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+V+M+GPGQTT+VL+ ADQ P+RYYMAARAYA+AQ APFDNTTTTA+LEY   
Sbjct  256   YVKPFTTSVLMLGPGQTTDVLIKADQTPSRYYMAARAYASAQGAPFDNTTTTAILEYNTA  315

Query  1212  RPGAN---SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVN  1042
                +N   + P++P LP +NDT TATAFTT+ RS       V  + DE+LF TVGLGL N
Sbjct  316   SCSSNCTTTNPILPSLPAYNDTTTATAFTTKFRS--PRKVEVPTEIDENLFITVGLGLEN  373

Query  1041  C---TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFD  871
             C    P   CQGPN +RFAASMNNVSFVLP   SLLQA++  IPG+++ DFP VPPV+F+
Sbjct  374   CPTGVPSSNCQGPNGSRFAASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPAVPPVKFN  433

Query  870   YTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             YTGNVSR+LWQP  GTKLYK+ YG+RVQVVLQ T IFT E+HPIHLHGY F+++ +GFGN
Sbjct  434   YTGNVSRSLWQPIRGTKLYKLNYGARVQVVLQGTGIFTAENHPIHLHGYDFYIIAEGFGN  493

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             FNP+TDT+KFNLVDPP+RNT  +PV GW VIRF ADNPGVW+MHCH+D H+ WGLAMAF+
Sbjct  494   FNPKTDTSKFNLVDPPLRNTASLPVKGWTVIRFVADNPGVWIMHCHLDVHITWGLAMAFL  553

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             VENG  E +++E PP+D P C
Sbjct  554   VENGVSELESLEAPPVDFPVC  574



>gb|EYU43442.1| hypothetical protein MIMGU_mgv1a003472mg [Erythranthe guttata]
Length=583

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/568 (66%), Positives = 456/568 (80%), Gaps = 12/568 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             F A L V ++ +  + NA V++ +FVVQ T + RLCKT   ITVNG +PGPT+ V NGD 
Sbjct  18    FSALLLVFMSSM-PITNAKVHHHDFVVQATPVKRLCKTHNTITVNGMYPGPTLEVNNGDT  76

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKVVNRARYNVTIHWHG+RQMRT WADGP +VTQCPI PGG+YTYRF I+ QEGTLWW
Sbjct  77    LVVKVVNRARYNVTIHWHGVRQMRTAWADGPAFVTQCPIRPGGSYTYRFTIDRQEGTLWW  136

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II P+ G  +PF +P ++ P+LLGEWW+ + I + RQ   TGAAP
Sbjct  137   HAHSSWLRATVYGALIIRPRQGDEYPFPKPHRETPLLLGEWWDANPIDVVRQATRTGAAP  196

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             NIS+AYTINGQPGDLY CS++DT+   ++ GET LLRV+N+ALNQ+LFF VANHKL +VG
Sbjct  197   NISDAYTINGQPGDLYNCSAKDTIVVPIAAGETNLLRVVNSALNQELFFKVANHKLTIVG  256

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTT+V+M+GPGQTT+VL+TA+QPPARYY+AARAYA+AQ APFDNTTTTA+L+
Sbjct  257   ADASYVKPFTTSVLMLGPGQTTDVLITANQPPARYYIAARAYASAQGAPFDNTTTTAILQ  316

Query  1224  Y------TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFT  1063
             Y      T      +S+P++P++P FNDTAT TAFTT  RS P   P V  + D +LFFT
Sbjct  317   YKSAACSTTTSKCVSSKPVIPKMPAFNDTATVTAFTTSFRS-PRKAP-VPTKIDHNLFFT  374

Query  1062  VGLGLVNCTPGPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPP  892
             VGLGL NC  G R   CQ PN TRFAASMNNVSFVLP   SLLQA+   +PG++T DFP 
Sbjct  375   VGLGLNNCPRGARSRNCQAPNGTRFAASMNNVSFVLPSNFSLLQAHQQGVPGVFTTDFPA  434

Query  891   VPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWV  712
              PP++FDYTGNVSR+LWQP  GTK+Y++KYG  VQ+VLQ T+IFT E+HPIHLHGY F++
Sbjct  435   NPPLRFDYTGNVSRSLWQPAQGTKVYRLKYGETVQLVLQGTSIFTAENHPIHLHGYDFYI  494

Query  711   VGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAW  532
             + +GFGNFN + DTAKFNLVDPP+RNT  VPVGGW+VIRF ADNPGVWLMHCH+D H+ W
Sbjct  495   IAEGFGNFNAKRDTAKFNLVDPPLRNTASVPVGGWSVIRFVADNPGVWLMHCHLDVHITW  554

Query  531   GLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GLAMAF+VENG G+ QT+EPPP DLP+C
Sbjct  555   GLAMAFLVENGVGKLQTLEPPPADLPKC  582



>ref|XP_002312186.2| laccase family protein [Populus trichocarpa]
 gb|EEE89553.2| laccase family protein [Populus trichocarpa]
Length=574

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/547 (69%), Positives = 439/547 (80%), Gaps = 7/547 (1%)
 Frame = -3

Query  2073  ADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHW  1894
             A  ++ +F VQ TK+ RLCKT   ITVNG FPGPT+ V+NGD +VVKVVNRARYNVTIHW
Sbjct  30    AKTHHHDFTVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTLVVKVVNRARYNVTIHW  89

Query  1893  HGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFII  1714
             HG+RQMRT WADGPE+VTQCPI PGG+YTYRF IE QEGTLWWHAHS WLRATVYGA II
Sbjct  90    HGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALII  149

Query  1713  YPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYR  1534
             +P+ GS +PFS+PK++ PILLGEWW+ + I + R+   TGAAPNIS+AYTINGQPGDL+ 
Sbjct  150   HPREGSSYPFSKPKRETPILLGEWWDANPIDVVREATRTGAAPNISDAYTINGQPGDLFN  209

Query  1533  CSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVG  1354
             CSS+DT    +  GET LLRVINAALNQ LFF++ANHK  VVGADA+Y KPFTT+VIM+G
Sbjct  210   CSSKDTTIVPIDSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYLKPFTTSVIMLG  269

Query  1353  PGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN--SRPLMP  1180
             PGQTT+VL++ DQ P RYYMAARAY +AQNAPFDNTTTTA+LEY ++   A    +P MP
Sbjct  270   PGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTAILEYKSVLCPAKCTKKPFMP  329

Query  1179  QLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRCQGPN  1009
              LP +NDTAT TAF+   RS       V    DE+LFFT+GLGL NC       RCQGPN
Sbjct  330   PLPAYNDTATVTAFSRSFRS--PRKVEVPTDIDENLFFTIGLGLNNCPKNFRARRCQGPN  387

Query  1008  NTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPS  829
              TRF ASMNNVSFV P + SLLQAY   IPG++T DFP  P V+FDYTGNVSR+L+QP  
Sbjct  388   GTRFTASMNNVSFVFPSKASLLQAYKQKIPGVFTTDFPAKPQVKFDYTGNVSRSLFQPAR  447

Query  828   GTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVD  649
             GTKLYK+KYGSRVQ+VLQDT+I T E+HPIHLHGY F+++ +GFGNFNP+TD +KFNLVD
Sbjct  448   GTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFNPKTDKSKFNLVD  507

Query  648   PPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPP  469
             PP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE G G  Q+VEPP
Sbjct  508   PPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEEGIGILQSVEPP  567

Query  468   PLDLPRC  448
             P DLP C
Sbjct  568   PADLPIC  574



>ref|XP_004500522.1| PREDICTED: laccase-12-like [Cicer arietinum]
Length=569

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/565 (64%), Positives = 440/565 (78%), Gaps = 8/565 (1%)
 Frame = -3

Query  2133  CNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrn  1954
             C+      FV+L+   SLANA  +N EFVV+ T + RLCKT   ITVNGQ+PGPT+ + N
Sbjct  10    CSFIFIATFVLLSSALSLANAKTHNHEFVVEATPVKRLCKTHNTITVNGQYPGPTLEINN  69

Query  1953  gddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGT  1774
             GD +V+KV N+ARYNVTIHWHG+RQ+RT WADGPE++TQCPI PGG+YTYRF +E QEGT
Sbjct  70    GDSLVIKVTNKARYNVTIHWHGVRQVRTGWADGPEFITQCPIRPGGSYTYRFTVEGQEGT  129

Query  1773  LWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTG  1594
             LWWHAHS WLRATVYGA II P+ G  +PF +P ++ PILLGEWW+R+ I + RQ Q TG
Sbjct  130   LWWHAHSSWLRATVYGALIIRPREGETYPFPKPNRETPILLGEWWDRNPIDVVRQAQRTG  189

Query  1593  AAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQ  1414
             AAPN+S+AYTINGQPGDLY CS++ T    +  GET L+RVINAALNQ LFF +ANHKL 
Sbjct  190   AAPNVSDAYTINGQPGDLYNCSTKGTTIVPIRYGETNLIRVINAALNQPLFFKIANHKLT  249

Query  1413  VVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTA  1234
             VVGADA+Y KPFTTNV+M+GPGQTT+VL+TA+QP +RYY+AA AY +AQNA FDNTTTTA
Sbjct  250   VVGADASYLKPFTTNVLMLGPGQTTDVLITANQPISRYYIAASAYQSAQNAAFDNTTTTA  309

Query  1233  VLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGL  1054
             +L+Y N      ++P+MP LP FNDT T T F+ + +S+      V N  DE+L FT+GL
Sbjct  310   ILQYYN---STKTKPIMPSLPSFNDTNTVTKFSKRFKSL--KKVEVSNVIDENLLFTIGL  364

Query  1053  GLVNCTPG---PRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             GL  C       RCQGPN +R  ASMNNVSF LP   S+LQA+Y  IPG++T DFP  PP
Sbjct  365   GLQGCPKNFRERRCQGPNGSRLTASMNNVSFTLPNNLSILQAHYFGIPGVFTTDFPAKPP  424

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             V F+YTGNVSR LWQP  GTK+YK+K+GSRVQ+VLQDT+I T E+HP HLHGY F++V Q
Sbjct  425   VNFNYTGNVSRPLWQPVPGTKVYKLKFGSRVQIVLQDTSIVTGENHPTHLHGYDFYIVAQ  484

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNF+P+ D+AKFNLVDPP RNT+ VPV GW+VIRF ADNPG W+MHCH+D H+ WGLA
Sbjct  485   GFGNFDPKKDSAKFNLVDPPKRNTVAVPVNGWSVIRFVADNPGAWIMHCHLDVHINWGLA  544

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
                +VENG G+ Q++EPPP DLPRC
Sbjct  545   TVLLVENGVGKLQSIEPPPADLPRC  569



>ref|XP_009628839.1| PREDICTED: laccase-12-like isoform X2 [Nicotiana tomentosiformis]
Length=574

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/545 (69%), Positives = 444/545 (81%), Gaps = 8/545 (1%)
 Frame = -3

Query  2064  YNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGL  1885
             ++ +FV+Q T + RLC T   ITVNGQFPGPT+ V NGD +VVKVVN+A+YNVTIHWHG+
Sbjct  32    HHHDFVIQATPVKRLCMTHNTITVNGQFPGPTLEVNNGDTLVVKVVNKAQYNVTIHWHGV  91

Query  1884  RQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPK  1705
             RQ+RT WADGPE++TQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK
Sbjct  92    RQIRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPK  151

Query  1704  SGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSS  1525
              G  +PF +PK++ PILLGEWW+ + I + R+   TGAAPN+S+AYTINGQPGDLY+CSS
Sbjct  152   EGDSYPFPKPKRETPILLGEWWDANPIDVIRRATRTGAAPNVSDAYTINGQPGDLYKCSS  211

Query  1524  QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQ  1345
             QDT    V  GET LLRVINAALNQQLFFSVANHKL VVGADA+Y KPFTT+V+M+GPGQ
Sbjct  212   QDTTIVPVDSGETNLLRVINAALNQQLFFSVANHKLTVVGADASYVKPFTTSVLMLGPGQ  271

Query  1344  TTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN---SRPLMPQL  1174
             TT+VL+T DQP A+YYMAARAYA+AQ APFDNTTTTA+LEY      +N   + P+ P L
Sbjct  272   TTDVLITTDQPRAKYYMAARAYASAQGAPFDNTTTTAILEYKTASCSSNCVKTNPVFPSL  331

Query  1173  PFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR---CQGPNNT  1003
             P +NDTATATAFTT+ RS       V  + DE+LFFTVGLGL NC  G     CQGPN T
Sbjct  332   PAYNDTATATAFTTKFRS--PRKVEVPTEIDENLFFTVGLGLNNCPRGASSSNCQGPNGT  389

Query  1002  RFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGT  823
             RFAASMNNVSFVLP   SLLQA++  IPG+++ DFP  PPV+FDYTGNVSR+LWQP  GT
Sbjct  390   RFAASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPANPPVKFDYTGNVSRSLWQPVPGT  449

Query  822   KLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPP  643
             KLYK+KYG+RVQVVLQ T+IFT E+HPIHLHGY F+++ +GFGNFNP+ DTAKFNL+DPP
Sbjct  450   KLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPKRDTAKFNLIDPP  509

Query  642   VRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPL  463
             +RNT  VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG  E +++E PP+
Sbjct  510   LRNTASVPVNGWAVIRFVADNPGVWLMHCHLDVHIGWGLAMAFLVENGVSELESLEAPPV  569

Query  462   DLPRC  448
             DLP C
Sbjct  570   DLPVC  574



>ref|XP_007146836.1| hypothetical protein PHAVU_006G074000g [Phaseolus vulgaris]
 gb|ESW18830.1| hypothetical protein PHAVU_006G074000g [Phaseolus vulgaris]
Length=573

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/545 (67%), Positives = 437/545 (80%), Gaps = 6/545 (1%)
 Frame = -3

Query  2070  DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWH  1891
             +++  EFVVQ   + RLCKT+ IITVNGQFPGPT+  RNGD +++KVVN A+YN++IHWH
Sbjct  31    EIHFHEFVVQARSVRRLCKTQNIITVNGQFPGPTVEARNGDFMIIKVVNAAQYNISIHWH  90

Query  1890  GLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIY  1711
             GLR +R PWADGP YVTQCPI PGG+YTYRF+I +QEGTLWWHAH+ +LRATVYGAFIIY
Sbjct  91    GLRMLRNPWADGPSYVTQCPIQPGGSYTYRFRIRDQEGTLWWHAHTSFLRATVYGAFIIY  150

Query  1710  PKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRC  1531
             P+ GS +PFS PK++ P+LLGEW++ DI+ LQRQ  F G  P+ S AYTINGQPGDLYRC
Sbjct  151   PRLGSPYPFSMPKQEFPLLLGEWFDSDIVLLQRQADFAGLPPHPSVAYTINGQPGDLYRC  210

Query  1530  SSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGP  1351
             SSQ TV+  V  GE+++LR+I++ LNQ+LFFS+ANH + VVG DA Y KPF T V+M+GP
Sbjct  211   SSQGTVRVPVEAGESIMLRIISSTLNQELFFSIANHSMTVVGTDATYTKPFRTTVLMIGP  270

Query  1350  GQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY--TNLRPGANSRPLMPQ  1177
             GQT NVL+TADQP   YYMAARAY +A NAPFDNTTTTA+LEY  T  R     RP++P 
Sbjct  271   GQTFNVLVTADQPQGHYYMAARAYESAVNAPFDNTTTTAILEYRSTRRRNQNRPRPVLPT  330

Query  1176  LPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP--GPRCQGPNNT  1003
             LP FNDTAT+TAFT ++R +      VF + D +L+F VGLGL+NCT    PRCQGPN T
Sbjct  331   LPAFNDTATSTAFTARIRGLAGVK--VFTKVDVNLYFIVGLGLINCTDPNSPRCQGPNGT  388

Query  1002  RFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGT  823
             RF ASMNN+SFVLP+ TSL+QAYY  IPG++T DFPP+PP+QFDYTGNV R LW P  GT
Sbjct  389   RFTASMNNISFVLPKTTSLMQAYYEGIPGVFTTDFPPIPPLQFDYTGNVPRGLWTPSRGT  448

Query  822   KLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPP  643
             KLYK+KYGSRVQ+VLQDT+I TTE+HP+H+HG+HF+VVG GFGNFNP TD  KFNLVDPP
Sbjct  449   KLYKVKYGSRVQIVLQDTSIVTTEEHPMHVHGFHFFVVGSGFGNFNPATDPLKFNLVDPP  508

Query  642   VRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPL  463
             VRNTI  P GGW  IRF ADNPG+W +HCHIDSH  WGL MA +VENG G  Q+V PPP 
Sbjct  509   VRNTIGTPPGGWVAIRFVADNPGIWFIHCHIDSHQNWGLGMALLVENGVGLSQSVIPPPP  568

Query  462   DLPRC  448
             DLP+C
Sbjct  569   DLPQC  573



>gb|KDP44694.1| hypothetical protein JCGZ_01194 [Jatropha curcas]
Length=582

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/568 (67%), Positives = 452/568 (80%), Gaps = 11/568 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngd  1948
             F   +F++   + S ANAD  +  +FV+Q T + RLCKT+  ITVNG FPGPT+ V NGD
Sbjct  17    FFLGIFILTASILSFANADKTHYHDFVIQATPVKRLCKTQNTITVNGMFPGPTLEVNNGD  76

Query  1947  dvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLW  1768
              +VV VVNRA+YNVTIHWHG+RQMRT WADGPE+VTQCPI PGG YTYRF I+ QEGTLW
Sbjct  77    TLVVNVVNRAQYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGKYTYRFTIQGQEGTLW  136

Query  1767  WHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAA  1588
             WHAHS WLRATVYGA II+PK GS +PF +PK++ PI+LGEWWN + I + R+   TGAA
Sbjct  137   WHAHSSWLRATVYGALIIHPKEGSSYPFPKPKRETPIILGEWWNANPIDVVREATRTGAA  196

Query  1587  PNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVV  1408
             PN+S+AYTINGQPGDLY CSSQDT    +  GET LLRVINA LNQ LFF+VANHKL VV
Sbjct  197   PNVSDAYTINGQPGDLYNCSSQDTAIIPIDSGETNLLRVINAGLNQPLFFTVANHKLTVV  256

Query  1407  GADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVL  1228
             GADA+Y KPFTT V+M+GPGQTT+VL++ +QP ARYYMAARAY +AQNAPFDNTTTTA+L
Sbjct  257   GADASYTKPFTTTVLMLGPGQTTDVLISGNQPSARYYMAARAYQSAQNAPFDNTTTTAIL  316

Query  1227  EYTN----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             EY +     +  A ++P+MP LP +NDTAT TAF+   RS+  N   V  + DE+LFFTV
Sbjct  317   EYKSAPCAAKNCAAAKPIMPPLPAYNDTATVTAFSKSFRSL--NKAFVPTEIDENLFFTV  374

Query  1059  GLGLVNCTP----GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPP  892
             GLGL NC P      +CQGPN TRF ASMNNVSF LP   SLLQA+   +PG++T DFP 
Sbjct  375   GLGLNNCPPNFNKASQCQGPNGTRFTASMNNVSFQLPSTVSLLQAHQLRVPGVFTTDFPA  434

Query  891   VPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWV  712
              PP++FDYTGNVSR+LWQP   TK+YK+KYGSRVQ+VLQDT+I T+E+HPIHLHGY F++
Sbjct  435   NPPLKFDYTGNVSRSLWQPVPATKVYKLKYGSRVQLVLQDTSIVTSENHPIHLHGYDFYI  494

Query  711   VGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAW  532
             V +GFGNFNPQTDT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ W
Sbjct  495   VAEGFGNFNPQTDTSKFNLVDPPLRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITW  554

Query  531   GLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GLAM+F+VENG G  +++E PP DLP C
Sbjct  555   GLAMSFLVENGVGLLESIEAPPEDLPPC  582



>ref|XP_006289181.1| hypothetical protein CARUB_v10002622mg [Capsella rubella]
 gb|EOA22079.1| hypothetical protein CARUB_v10002622mg [Capsella rubella]
Length=568

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/572 (66%), Positives = 450/572 (79%), Gaps = 20/572 (3%)
 Frame = -3

Query  2121  LAKLFVMLTV-LASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             L   FV+L V +ASL NA+V+  EF++QET + RLC+    ITVNGQFPGPT+ VRNGD 
Sbjct  3     LLSYFVLLVVFVASLVNAEVHFHEFIIQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDS  62

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +V+  +N+ARYN+++HWHG+RQMR PWADGPEY+TQCPI PGG+YTY+F IE+QEGTLWW
Sbjct  63    LVITAINKARYNISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYKFTIEDQEGTLWW  122

Query  1764  HAHSRWLRATVYGAFIIYPK-SGSHFPF-SQPKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             HAHSRWLRATVYGA II P  S  H+PF   PK++I +LLGEWW+R+ + +    QFTGA
Sbjct  123   HAHSRWLRATVYGALIIRPPLSSPHYPFPVLPKREITLLLGEWWDRNPMDVLNLAQFTGA  182

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APNIS+A+TINGQPGDLYRCSSQ+T++F V  GE VLLRVIN+ALNQ+LFF VANHKL V
Sbjct  183   APNISDAFTINGQPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTV  242

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             V ADA+Y KPF+TNVIM+GPGQTT+VL TADQPP  YYMAA AY +A  A FDNTTTTA+
Sbjct  243   VAADASYTKPFSTNVIMLGPGQTTDVLFTADQPPEHYYMAAHAYNSANAA-FDNTTTTAI  301

Query  1230  LEYTN-----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DES  1075
             L+Y +     L+  + +R +  QLP FNDTATA AFT Q++S     P+    P   DE+
Sbjct  302   LKYKDASCVTLQGKSLARAIPAQLPGFNDTATAAAFTAQMKS-----PSKVKVPLEIDEN  356

Query  1074  LFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTL  904
             LFFTVGLGL NCT     RCQGPN TRF ASMNNVSFV P+  S++QAYY   P G++T 
Sbjct  357   LFFTVGLGLFNCTTPNTQRCQGPNGTRFTASMNNVSFVFPKGNSIMQAYYQGTPAGVFTT  416

Query  903   DFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGY  724
             DFPP PPV FDYTGNVSR LWQP  GTK YK+K+ S+VQ++LQDT+I TTE+HP+HLHGY
Sbjct  417   DFPPTPPVTFDYTGNVSRGLWQPTRGTKAYKLKFKSKVQIILQDTSIVTTENHPMHLHGY  476

Query  723   HFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDS  544
              F+VVG G GNFNP TDTA FNL+DPP RNTI  P GGW  IRF A+NPG WLMHCHID+
Sbjct  477   EFYVVGTGVGNFNPNTDTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDA  536

Query  543   HLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             H+ WGLAM F+VENG+G  Q+V+ PPLDLP+C
Sbjct  537   HIFWGLAMVFLVENGEGHLQSVQSPPLDLPQC  568



>ref|NP_196158.1| laccase 12 [Arabidopsis thaliana]
 sp|Q9FLB5.1|LAC12_ARATH RecName: Full=Laccase-12; AltName: Full=Benzenediol:oxygen oxidoreductase 
12; AltName: Full=Diphenol oxidase 12; AltName: 
Full=Urishiol oxidase 12; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09982.1| laccase (diphenol oxidase) [Arabidopsis thaliana]
 gb|AED90868.1| laccase 12 [Arabidopsis thaliana]
Length=565

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/563 (67%), Positives = 447/563 (79%), Gaps = 8/563 (1%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             F   LF      ASL  A V + +FV+QET + RLCKT+  ITVNG FPGPT+ V NGD 
Sbjct  7     FSILLFFCSLFSASLIIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDT  66

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             + VKV NRARYN+TIHWHG+RQ+RT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWW
Sbjct  67    LEVKVHNRARYNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWW  126

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II+P  GS FPF +P +   ++LGEWWN + + +  Q   TGAAP
Sbjct  127   HAHSSWLRATVYGALIIHPTPGSSFPFPKPDRQTALMLGEWWNANPVDVINQATRTGAAP  186

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             NIS+AYTINGQPGDLY CS+++TV   ++ GET LLRVINAALNQ LFF+VANHKL VVG
Sbjct  187   NISDAYTINGQPGDLYNCSTKETVVVPINSGETSLLRVINAALNQPLFFTVANHKLTVVG  246

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTT V+M+GPGQTT+VLLTADQPP RYY+AARAY +AQNAPFDNTTTTA+L+
Sbjct  247   ADASYLKPFTTKVLMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILQ  306

Query  1224  YTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLV  1045
             Y   +    S+P+MP LP FNDT T T+F+ + +S+   N  V    D++LFFT+GLGL 
Sbjct  307   YK--KTTTTSKPIMPVLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDDNLFFTIGLGLD  362

Query  1044  NCT---PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             NC    P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPV+F
Sbjct  363   NCPKKFPKSRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPSKPPVKF  422

Query  873   DYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGF  697
             DYTG N+SRAL+QP  GTKLYK+KYGSRVQVVLQDT I T+E+HPIHLHGY F++VG+GF
Sbjct  423   DYTGNNISRALFQPVKGTKLYKLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGF  482

Query  696   GNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMA  517
             GNFNP+ DT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMA
Sbjct  483   GNFNPKKDTSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMA  542

Query  516   FIVENGQGEKQTVEPPPLDLPRC  448
             F+V+NG GE +T+E PP DLP C
Sbjct  543   FLVDNGVGELETLEAPPHDLPIC  565



>ref|XP_006355635.1| PREDICTED: laccase-5-like [Solanum tuberosum]
Length=574

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/558 (66%), Positives = 447/558 (80%), Gaps = 8/558 (1%)
 Frame = -3

Query  2103  MLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvn  1924
             +L + A+ A+A  +  +FV+Q T + RLCKT   ITVNGQFPGPT+ V NGD +VV VVN
Sbjct  19    ILLLFANAASAKTHYHDFVIQATPVKRLCKTHNSITVNGQFPGPTLEVNNGDTLVVNVVN  78

Query  1923  rarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWL  1744
             RARYNVTIHWHG+RQMRT W+DGPE++TQCPI PG +YTYRF I+ QEGTLWWHAHS WL
Sbjct  79    RARYNVTIHWHGVRQMRTAWSDGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWL  138

Query  1743  RATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYT  1564
             RATVYGA II+PK G ++PF +PK++ P+LLGEWW+ + I + R+   TGAAPN+S+AYT
Sbjct  139   RATVYGALIIHPKQGENYPFPKPKRETPVLLGEWWDTNPIDVVRRATRTGAAPNVSDAYT  198

Query  1563  INGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNK  1384
             INGQPGDLY+CS QDT    +  GET LLRVINA LNQQLFF+VANHKL VVGADA Y K
Sbjct  199   INGQPGDLYKCSKQDTTIVHMDSGETNLLRVINAGLNQQLFFTVANHKLTVVGADANYVK  258

Query  1383  PFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPG  1204
             PFTT+V+M+GPGQTT+VL+ ADQ P+RYYMAARAYA+AQ APFDNTTTTA+LEY      
Sbjct  259   PFTTSVLMLGPGQTTDVLIKADQTPSRYYMAARAYASAQGAPFDNTTTTAILEYKTASCS  318

Query  1203  AN---SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP  1033
             +N   ++P+ P LP +NDTATATAFT + RS       V  + DE+LF TVGLGL NC  
Sbjct  319   SNCAKTKPVSPSLPAYNDTATATAFTRKFRS--PRKVEVPTEIDENLFITVGLGLENCPR  376

Query  1032  GPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
             G R   CQGPN TRFAASMNNVSFVLP   SLLQA++  IPG+++ DFP VPPV+F+YTG
Sbjct  377   GARSRNCQGPNGTRFAASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPAVPPVKFNYTG  436

Query  861   NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNP  682
             NVSR+LWQP  GTKLYK+KYG+ VQVVLQ T IFT E+HPIHLHGY F+++ +GFGNFNP
Sbjct  437   NVSRSLWQPIRGTKLYKLKYGATVQVVLQGTGIFTAENHPIHLHGYDFYIIAEGFGNFNP  496

Query  681   QTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVEN  502
             +TDT+KFNLV+PP+RNT  +PV GW VIRF ADNPGVW+MHCH+D H+ WGLAMAF+VEN
Sbjct  497   KTDTSKFNLVNPPLRNTASLPVNGWTVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVEN  556

Query  501   GQGEKQTVEPPPLDLPRC  448
             G  E +++E PP+D P C
Sbjct  557   GVSELESLESPPVDFPVC  574



>ref|XP_004307187.1| PREDICTED: laccase-12-like [Fragaria vesca subsp. vesca]
Length=574

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/558 (66%), Positives = 435/558 (78%), Gaps = 10/558 (2%)
 Frame = -3

Query  2097  TVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnra  1918
             + +++LA    ++ EFV+Q T   RLCKT   ITVNGQFPGPT+ V NGD +VVKV N+A
Sbjct  19    SAMSTLAEPKAHHHEFVIQATPAKRLCKTHNSITVNGQFPGPTLEVNNGDTLVVKVTNKA  78

Query  1917  rynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRA  1738
             RYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF ++ QEGTLWWHAHS WLRA
Sbjct  79    RYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLRA  138

Query  1737  TVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTIN  1558
             TVYGA II+PK G  +PF +P +   +LLGEWW+ + I + RQ   TGAAPNIS+AYTIN
Sbjct  139   TVYGALIIHPKQGDSYPFPKPNRQETLLLGEWWDANPIDVVRQATRTGAAPNISDAYTIN  198

Query  1557  GQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPF  1378
             GQPGDLY CS + TV   +  GET LLRV+NAALNQ LFFSVANHKL VVGADA+Y KPF
Sbjct  199   GQPGDLYNCSKKGTVVVPIDSGETNLLRVVNAALNQPLFFSVANHKLTVVGADASYTKPF  258

Query  1377  TTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLR----  1210
             TT V+M+GPGQTT+VL++ DQ P+ YYMAA AY +AQNAPFDNTTTTA+LEY ++R    
Sbjct  259   TTKVLMLGPGQTTDVLISGDQQPSLYYMAAHAYFSAQNAPFDNTTTTAILEYKSVRCNNT  318

Query  1209  -PGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP  1033
                  S+P+MPQLP FNDT TA  FT   RS       V  + DE+LFFT+GLGL  C  
Sbjct  319   TSCKKSKPIMPQLPAFNDTNTADVFTRSFRS--PRKVEVPTEIDENLFFTIGLGLNKCPK  376

Query  1032  ---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
                  RCQGPN TRF+ASMNNVSFVLP   S+LQAY  NIPG+YT DFP  PP +FDYTG
Sbjct  377   HFRSRRCQGPNGTRFSASMNNVSFVLPNNMSILQAYQQNIPGVYTSDFPANPPKKFDYTG  436

Query  861   NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNP  682
             N+SR+LWQP  GTK YK++YGS+VQVVLQDT+I T E+HP+HLHGY F+++ QGFGNFN 
Sbjct  437   NISRSLWQPSFGTKGYKLRYGSKVQVVLQDTSIVTPENHPVHLHGYDFYILAQGFGNFNA  496

Query  681   QTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVEN  502
             +TDT KFNLVDPP+RNT+ VP  GWAVIRF ADNPG WLMHCH+D H+ WGL M F+V+N
Sbjct  497   KTDTKKFNLVDPPLRNTVSVPANGWAVIRFVADNPGAWLMHCHLDVHINWGLGMVFLVDN  556

Query  501   GQGEKQTVEPPPLDLPRC  448
             G G+ QT+EPPP DLPRC
Sbjct  557   GVGQLQTIEPPPADLPRC  574



>ref|XP_006487674.1| PREDICTED: laccase-3-like [Citrus sinensis]
Length=579

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/582 (63%), Positives = 451/582 (77%), Gaps = 11/582 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             MD     ++ P+ +  L  +  +   +ASL++A++   EFV++   + RLC+T   +TVN
Sbjct  1     MDIPALITVKPWSSCLLLGVLFIFAFVASLSHAEIQFHEFVIEAKPVKRLCRTHNTVTVN  60

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQFPGPT+ VR+GD +++  +NRA+YN+T+HWHG+     PWADGPEYVTQCPI PG +Y
Sbjct  61    GQFPGPTLQVRDGDTLIITTINRAQYNITLHWHGVNLKGNPWADGPEYVTQCPIQPGRSY  120

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TY+F IE QEGTLWWHAHSRW+RATVYGA IIYP+ GS +PF  P ++IPILLGEWWN++
Sbjct  121   TYQFTIEGQEGTLWWHAHSRWIRATVYGAIIIYPRFGSSYPFPVPNREIPILLGEWWNKN  180

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              + +  Q  FTGAAPN+S+A+TINGQPGDLYRCS ++TV+F V  GETVLLR+INAA+NQ
Sbjct  181   PMDVLMQAIFTGAAPNVSDAFTINGQPGDLYRCSRRETVRFQVEAGETVLLRIINAAMNQ  240

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             +LFF VANHKL VVG D +Y K F+T+VIM+ PGQTTNVLLTADQPPARYYMAARAY +A
Sbjct  241   ELFFGVANHKLTVVGVDTSYTKAFSTSVIMIAPGQTTNVLLTADQPPARYYMAARAYNSA  300

Query  1269  qnaPFDNTTTTAVLEYTNL-----RPGANSR-PLMPQLPFFNDtatataftTQLRSVPSN  1108
               A FDNTTTTA+L Y +      + G+NS  P+ P LP FNDTATATA+  Q+R++   
Sbjct  301   NGA-FDNTTTTAILAYKSAPCNAKKWGSNSSAPVFPTLPGFNDTATATAYIAQIRNLQEV  359

Query  1107  NPTVFNQPDESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAY  934
                  N  DE LFFTVGLGL+NC+    PRCQGPN TRFAAS+NNVSF  P   SL+QAY
Sbjct  360   KVPTVN--DEDLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNVSFEFPTGNSLMQAY  417

Query  933   YNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTT  754
             + + PG++T DFPPVPP++FDYTGNVSR LWQP  GTKLYK+K+GS VQ+V QDT+I T 
Sbjct  418   FQDQPGVFTTDFPPVPPIKFDYTGNVSRGLWQPLKGTKLYKLKFGSSVQLVWQDTSIVTV  477

Query  753   EDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPG  574
             EDHP+HLHG+ F+VVG GFGNFNP TDTAKFNL+DPP RNTI  P GGW  IRF A+NPG
Sbjct  478   EDHPMHLHGHEFYVVGSGFGNFNPSTDTAKFNLIDPPRRNTIGTPPGGWVAIRFVANNPG  537

Query  573   VWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +W MHCH+DSHL WGLAMAF+VENG  E Q V+ PPLDLP C
Sbjct  538   IWFMHCHLDSHLTWGLAMAFLVENGDEELQAVQSPPLDLPPC  579



>ref|NP_196330.3| laccase 13 [Arabidopsis thaliana]
 sp|Q9LYQ2.1|LAC13_ARATH RecName: Full=Laccase-13; AltName: Full=Benzenediol:oxygen oxidoreductase 
13; AltName: Full=Diphenol oxidase 13; AltName: 
Full=Urishiol oxidase 13; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB87269.1| laccase-like protein [Arabidopsis thaliana]
 gb|AED91113.1| laccase 13 [Arabidopsis thaliana]
Length=569

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/573 (66%), Positives = 454/573 (79%), Gaps = 22/573 (4%)
 Frame = -3

Query  2121  LAKLFVMLTV-LASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             L   F++L + +ASL NA+V+  EFV+QET + RLC+    ITVNGQFPGPT+ VRNGD 
Sbjct  4     LRPFFLLLAIFVASLVNAEVHFHEFVIQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDS  63

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +V+  +N+ARYN+++HWHG+RQMR PWADGPEY+TQCPI PGG+YTYRF +E+QEGTLWW
Sbjct  64    LVITAINKARYNISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTMEDQEGTLWW  123

Query  1764  HAHSRWLRATVYGAFIIYPK-SGSHFPFSQ-PKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             HAHSRWLRATVYGA II P  S  H+PF   PK++I +LLGEWW+R+ + +    QFTGA
Sbjct  124   HAHSRWLRATVYGALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGA  183

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APNIS+A+TINGQPGDLYRCSSQ+T++F V  GE VLLRVIN+ALNQ+LFF VANHKL V
Sbjct  184   APNISDAFTINGQPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTV  243

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             V ADA+Y KPF+TNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A  A FDNTTTTA+
Sbjct  244   VAADASYTKPFSTNVIMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAI  302

Query  1230  LEYTN-----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DES  1075
             L+Y +     L+  + +R +  QLP FNDTATA AFT Q++S     P+    P   DE+
Sbjct  303   LKYKDASCVTLQAKSQARAIPAQLPGFNDTATAAAFTAQMKS-----PSKVKVPLEIDEN  357

Query  1074  LFFTVGLGLVNCTPGP---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYT  907
             LFFTVGLGL NC P P   RCQGPN TRF AS+NNVSFV P++ S++QAYY   P G++T
Sbjct  358   LFFTVGLGLFNC-PTPNTQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPTGVFT  416

Query  906   LDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHG  727
              DFPP PPV FDYTGNVSR LWQP  GTK YK+K+ S+VQ++LQDT+I TTE+HP+HLHG
Sbjct  417   TDFPPTPPVTFDYTGNVSRGLWQPTRGTKAYKLKFNSQVQIILQDTSIVTTENHPMHLHG  476

Query  726   YHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHID  547
             Y F+VVG G GNFNP TDT+ FNL+DPP RNTI  P GGW  IRF A+NPG WLMHCHID
Sbjct  477   YEFYVVGTGVGNFNPNTDTSSFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHID  536

Query  546   SHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             SH+ WGLAM F+VENG+G  Q+V+ PPLDLP+C
Sbjct  537   SHIFWGLAMVFLVENGEGHLQSVQSPPLDLPQC  569



>ref|XP_010423249.1| PREDICTED: laccase-13-like isoform X1 [Camelina sativa]
Length=569

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/572 (66%), Positives = 451/572 (79%), Gaps = 20/572 (3%)
 Frame = -3

Query  2121  LAKLFVMLTV-LASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             L   FV+L V +ASL NA+V+  EFV+QET + RLC+    ITVNGQFPGPT+ VRNGD 
Sbjct  4     LLSYFVLLVVFVASLVNAEVHLHEFVIQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDS  63

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             + +  +N+ARYN+++HWHG+RQMR PWADGPEY+TQCPI PGG+YTY F IE+QEGTLWW
Sbjct  64    LFITAINKARYNISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYSFTIEDQEGTLWW  123

Query  1764  HAHSRWLRATVYGAFIIYPK-SGSHFPFSQ-PKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             HAHSRWLRATVYGA II P  S  H+PF   PK++I +LLGEWW+R+ + +    QFTGA
Sbjct  124   HAHSRWLRATVYGALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNVAQFTGA  183

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APNIS+A+TINGQPGDLYRCSSQ+T++F V  GE VLLRVIN+ALNQ+LFF+VANHKL V
Sbjct  184   APNISDAFTINGQPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFAVANHKLTV  243

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             V ADA+Y KPF+TNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A  A FDNTTTTA+
Sbjct  244   VAADASYTKPFSTNVIMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAI  302

Query  1230  LEYTN-----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DES  1075
             L+Y +     L+  + +R +  QLP FNDTATA AFT Q++S     P+    P   DE+
Sbjct  303   LKYKDASCVTLQGKSLARAIPAQLPGFNDTATAAAFTAQMKS-----PSKVEVPLEIDEN  357

Query  1074  LFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTL  904
             LFFTVGLGL NCT     RCQGPN TRF AS+NNVSFV P++ S++QAYY   P G++T 
Sbjct  358   LFFTVGLGLFNCTTPNTQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFTT  417

Query  903   DFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGY  724
             DFPP PPV FDYTGNVSR LWQP  GTK YK+K+ S+VQ++LQDT+I TTE+HP+HLHGY
Sbjct  418   DFPPTPPVTFDYTGNVSRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGY  477

Query  723   HFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDS  544
              F+VVG G GNFN  TDTA FNL+DPP RNTI  P GGW  IRF A+NPG WLMHCHIDS
Sbjct  478   EFYVVGTGVGNFNANTDTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDS  537

Query  543   HLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             H+ WGLAM F+VENG+G  Q+V+ PPLDLP+C
Sbjct  538   HIFWGLAMVFLVENGEGHLQSVQSPPLDLPQC  569



>ref|XP_003616702.1| Laccase [Medicago truncatula]
 gb|AES99660.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=567

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/566 (65%), Positives = 446/566 (79%), Gaps = 9/566 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             F      +  + ASLANA V+  EFVVQ T + RLC T+  ITVNGQFPGPT+ + NGD 
Sbjct  4     FNTIFLAIFLLFASLANAKVHEHEFVVQATPVKRLCNTQMSITVNGQFPGPTLEINNGDT  63

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV+N+ARYNVTIHWHG+RQ+RT WADGPE+VTQCPI PG +YTYRF I  QEGTLWW
Sbjct  64    LVVKVINKARYNVTIHWHGVRQIRTGWADGPEFVTQCPIRPGESYTYRFTINGQEGTLWW  123

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II+PK G  +PF++PK++ PILLGEWW+ + I + RQ   TGAAP
Sbjct  124   HAHSSWLRATVYGALIIHPKEGDAYPFTKPKRETPILLGEWWDANPIDVVRQATQTGAAP  183

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             NIS+AYTINGQPGDLY+CSS+ T    +  GET L+RVINAALNQ LFF++ANHKL VVG
Sbjct  184   NISDAYTINGQPGDLYKCSSKGTTIVPIDSGETNLIRVINAALNQPLFFTIANHKLTVVG  243

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTTNV+M+GPGQTT+VL+  DQPP+RYY+A RAY +AQNA FDNTTTTA+LE
Sbjct  244   ADASYVKPFTTNVLMLGPGQTTDVLIQGDQPPSRYYIAGRAYQSAQNAAFDNTTTTAILE  303

Query  1224  YTN----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
             Y +     + GAN RP+MP LP +NDT T T+F+   RS+   N  V N+ DE LFFT+G
Sbjct  304   YKSSPCPAKGGANIRPIMPSLPAYNDTNTVTSFSKSFRSL--RNVEVPNEIDEDLFFTIG  361

Query  1056  LGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             LGL NC       +CQGPN TRF +SMNNVSFVLP   S+LQA+   + G++T DFP  P
Sbjct  362   LGLNNCPSNFNSNQCQGPNGTRFTSSMNNVSFVLPSNFSILQAHKLGVQGVFTTDFPTKP  421

Query  885   PVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVG  706
             PVQFDYTGNVSR+LWQP  GTK+ K+++GSRVQVVLQDT+I T E+HPIHLHGY F++V 
Sbjct  422   PVQFDYTGNVSRSLWQPIQGTKVTKLRFGSRVQVVLQDTSIVTPENHPIHLHGYDFYIVA  481

Query  705   QGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGL  526
             +GFGNF+P+ D +KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D H+ WGL
Sbjct  482   EGFGNFDPKKDASKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGVWIMHCHLDVHIGWGL  541

Query  525   AMAFIVENGQGEKQTVEPPPLDLPRC  448
             A  F+VE+G+G  +++E PP DLP C
Sbjct  542   ATVFLVEDGEGLLESIEAPPEDLPLC  567



>ref|XP_004500523.1| PREDICTED: laccase-12-like [Cicer arietinum]
Length=572

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/577 (63%), Positives = 447/577 (77%), Gaps = 8/577 (1%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M+          C+     + V+L+   SLANA  +N EFVV+ T + RLCKT   ITVN
Sbjct  1     MEGMKKIMTKAKCSFIFIAISVLLSSALSLANAKTHNHEFVVEATPVKRLCKTHNTITVN  60

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQ+PGPT+ + NGD +V+KV N+ARYNVTIHWHG+RQMRT WADGPE++TQCPI PGG+Y
Sbjct  61    GQYPGPTLEINNGDSLVIKVTNKARYNVTIHWHGIRQMRTGWADGPEFITQCPIRPGGSY  120

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYRF +E QEGTLWWHAHS WLRATVYGA II P+ G  +PF +P ++ PILLGEWW+R+
Sbjct  121   TYRFTVEGQEGTLWWHAHSSWLRATVYGALIIRPREGETYPFPKPNRETPILLGEWWDRN  180

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              I + RQ Q TGAAPN+S+AYTINGQPGDLY+CS++ T    +  GET L+RVINAALNQ
Sbjct  181   PIDVVRQAQRTGAAPNVSDAYTINGQPGDLYKCSTKGTTIVPIRYGETNLIRVINAALNQ  240

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
              LFF +ANHKL VVGADA+Y KPFTTNV+M+GPGQTT+VL+TA+QP +RYY+AA AY +A
Sbjct  241   PLFFKIANHKLTVVGADASYLKPFTTNVLMLGPGQTTDVLITANQPISRYYIAASAYQSA  300

Query  1269  qnaPFDNTTTTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFN  1090
             QNA FDNTTTTA+L+Y N      ++P+MP LP FNDT T T F+   +S+      V N
Sbjct  301   QNAAFDNTTTTAILQYHN---SIKTKPIMPSLPSFNDTNTVTKFSKSFKSL--KKVEVPN  355

Query  1089  QPDESLFFTVGLGLVNCTPG---PRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP  919
             + DE+LFFT+GLGL  C       RCQG N +RF ASMNNVSF LP   S+LQA+Y  IP
Sbjct  356   EIDENLFFTIGLGLNKCPKNFRKRRCQGLNGSRFTASMNNVSFTLPNNLSILQAHYFGIP  415

Query  918   GIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPI  739
             G++T DFP  PPV+FDYTGNVSR+LWQP  GTK YK+K+GSRVQ+VLQDT+I T E+HPI
Sbjct  416   GVFTTDFPAKPPVKFDYTGNVSRSLWQPVPGTKAYKLKFGSRVQIVLQDTSIVTAENHPI  475

Query  738   HLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMH  559
             HLHGY F++V QGFGNF+ + DTAKFNLVDPP+RNT+ VPV GW+VIRF ADNPG W+MH
Sbjct  476   HLHGYDFYIVAQGFGNFDSKKDTAKFNLVDPPMRNTVAVPVNGWSVIRFVADNPGAWIMH  535

Query  558   CHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             CH+D H+ WGLA   +VE+G G+ Q++EPPPLDLPRC
Sbjct  536   CHLDVHINWGLATVLLVEDGVGKYQSIEPPPLDLPRC  572



>gb|EYU20068.1| hypothetical protein MIMGU_mgv1a020620mg [Erythranthe guttata]
Length=551

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/549 (69%), Positives = 438/549 (80%), Gaps = 8/549 (1%)
 Frame = -3

Query  2076  NADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIH  1897
             NA V+  +FVVQ T + RLCKT   ITVNG +PGPT+ V NGD +VV VVNRARYNVTIH
Sbjct  5     NAKVHYHDFVVQATPVKRLCKTHNTITVNGMYPGPTLEVNNGDTLVVNVVNRARYNVTIH  64

Query  1896  WHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFI  1717
             WHG+RQMRT WADGPE+VTQCPI PG +YTYRF IE QEGTLWWHAHS WLRATVYGA I
Sbjct  65    WHGIRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALI  124

Query  1716  IYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLY  1537
             I+PK G  +PF+ P ++  +LLGEWW+ + I + RQ   TGAAPN+S+AYTINGQPGDLY
Sbjct  125   IHPKEGDSYPFTTPNRETALLLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGDLY  184

Query  1536  RCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMV  1357
              CS++DTV   V  GET LLRV+N+ALNQQLFF VANHKL VVGADA+Y KPFTT+V+M+
Sbjct  185   NCSTKDTVIVPVDSGETNLLRVVNSALNQQLFFKVANHKLTVVGADASYVKPFTTSVLML  244

Query  1356  GPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL---RPGANSRPL  1186
             GPGQTT+VL+TADQPPARYY+A +AYA+ Q APFDNTTTTA+LEY +      GA  +P+
Sbjct  245   GPGQTTDVLITADQPPARYYIAGQAYASGQGAPFDNTTTTAILEYKSAPCPAKGATIKPV  304

Query  1185  MPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR---CQG  1015
             MP +P FNDTATATAFTT  RS P   P +  + D +L FTVGLGL+NC PG     CQG
Sbjct  305   MPAMPAFNDTATATAFTTSFRS-PRQVP-LPTEIDHNLLFTVGLGLINCPPGASSSTCQG  362

Query  1014  PNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQP  835
             PN TRFAASMNN SFVLP   SLLQA+   IPG++T DFP  PP+ FDYTGNVSR+LWQP
Sbjct  363   PNGTRFAASMNNESFVLPSNFSLLQAHQQGIPGVFTTDFPANPPLTFDYTGNVSRSLWQP  422

Query  834   PSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNL  655
               GTKLYK+KYG  VQ+VLQ T+IFT E+HPIHLHGY F+++ +GFGNF+P  DT KFNL
Sbjct  423   IKGTKLYKLKYGETVQLVLQGTSIFTAENHPIHLHGYDFYILAEGFGNFDPSRDTTKFNL  482

Query  654   VDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVE  475
             VDPP RNT  VPVGGW VIRF ADNPGVWLMHCH+D+H+ WGLAMAF+VENG GE Q +E
Sbjct  483   VDPPQRNTASVPVGGWTVIRFVADNPGVWLMHCHLDAHITWGLAMAFLVENGLGELQKIE  542

Query  474   PPPLDLPRC  448
             PPP DLP C
Sbjct  543   PPPADLPLC  551



>ref|XP_006355742.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=574

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/558 (67%), Positives = 448/558 (80%), Gaps = 8/558 (1%)
 Frame = -3

Query  2103  MLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvn  1924
             +L + A+ A+A  +  +FV+Q T + RLCK   IITVNG+FPGPT+ V NGD +VV VVN
Sbjct  19    ILLLFANAASAKTHYHDFVIQATLVKRLCKIHNIITVNGKFPGPTLEVNNGDTLVVNVVN  78

Query  1923  rarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWL  1744
             RARYNVTIHWHG++QMRT WADGPE++TQCPI PG +YTYRF I+ QEGTLWWHAHS WL
Sbjct  79    RARYNVTIHWHGVKQMRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWL  138

Query  1743  RATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYT  1564
             RATVYGA II PK G  +PF +PK++ PILLGEWWN + I + RQ   TGAAPN+S+AYT
Sbjct  139   RATVYGALIINPKEGEIYPFPKPKRETPILLGEWWNTNPIDVVRQATRTGAAPNLSDAYT  198

Query  1563  INGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNK  1384
             +N QPGDLY+CSSQDT    +  GET LLRVIN ALNQQLFF+VANHKL VVGADA+Y K
Sbjct  199   VNSQPGDLYKCSSQDTTVVHIDSGETNLLRVINTALNQQLFFAVANHKLTVVGADASYVK  258

Query  1383  PFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPG  1204
             PFTT+V+M+GPGQTT+VL+ ADQ PARYYMAARAYA+AQ APFD+TTTTA+LEY      
Sbjct  259   PFTTSVLMLGPGQTTDVLIKADQQPARYYMAARAYASAQGAPFDDTTTTAILEYNTASCS  318

Query  1203  AN---SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNC--  1039
             +N   ++P+ P LP +NDTATATAFTT+ RS       V  + DE+LFFTVGLGL NC  
Sbjct  319   SNCIKTKPVFPSLPEYNDTATATAFTTKFRS--PRKVEVPKEIDENLFFTVGLGLENCPR  376

Query  1038  -TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
               P   CQGP+ TR  ASMNNVSFVLP   SLLQA+Y  IPG+++ DFP +PPV+FDYTG
Sbjct  377   GAPSSYCQGPSGTRLTASMNNVSFVLPSNNSLLQAHYQGIPGVFSTDFPAMPPVKFDYTG  436

Query  861   NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNP  682
             NVS++LWQP  GTKLYK+KYG+RVQVVLQ T+IF+ E+HPIHLHGY F+++ +GFGNFNP
Sbjct  437   NVSQSLWQPIRGTKLYKLKYGARVQVVLQGTSIFSAENHPIHLHGYDFYIIAEGFGNFNP  496

Query  681   QTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVEN  502
             +TDT+KFNLVDPP+RNT  VPV GW VIRF A+NPGVWLMHCH+D H+ WGLAMAF+VEN
Sbjct  497   KTDTSKFNLVDPPLRNTASVPVNGWTVIRFVANNPGVWLMHCHLDVHITWGLAMAFLVEN  556

Query  501   GQGEKQTVEPPPLDLPRC  448
             G  E +++E PP+DLP C
Sbjct  557   GVCELESLEAPPVDLPVC  574



>ref|XP_009391695.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/552 (67%), Positives = 437/552 (79%), Gaps = 14/552 (3%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             A+A+V++ EFVV+ T + RLC+T  IITVNGQ+PGPT+AVR+GD +VV V+NRA+YNVT+
Sbjct  21    ASAEVHHHEFVVEATPVKRLCRTHNIITVNGQYPGPTLAVRDGDTLVVNVINRAKYNVTL  80

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQ+RT WADGPE+VTQCPI PGG+YTYRF IE QEGTLWWHAHS WLRATV+GA 
Sbjct  81    HWHGVRQLRTAWADGPEFVTQCPIRPGGSYTYRFTIEEQEGTLWWHAHSSWLRATVHGAL  140

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             IIYPK GS +PF  PKK+IP +LGEWWN D I + R+   TGAAPN+S+A+TINGQPGDL
Sbjct  141   IIYPKHGS-YPFPTPKKEIPFILGEWWNEDPIRVVRRAARTGAAPNVSDAFTINGQPGDL  199

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y+CS+++T  F+V+PGET LLR INAALN + F S+A HK+ VV ADAAY KPFTT+V+M
Sbjct  200   YKCSNKETTVFTVAPGETNLLRFINAALNNEHFISIAGHKMTVVAADAAYTKPFTTSVLM  259

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL------RPGAN  1198
             + PGQTT+VLLTADQP  RYYMAA AYA+A+   FDNTTTTA+LEYTN       RPG  
Sbjct  260   LAPGQTTDVLLTADQPAGRYYMAAHAYASARGVAFDNTTTTAILEYTNSGCPTKNRPGV-  318

Query  1197  SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP-DESLFFTVGLGLVNCTPGPRC  1021
               P  P LP FNDT TATAF   +RS     P     P D  LFFTVGLGL NC PG RC
Sbjct  319   -LPAFPVLPAFNDTPTATAFAAGIRS---PRPVKIPSPIDHHLFFTVGLGLFNCPPGRRC  374

Query  1020  QGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRAL  844
              GPN TRF ASMNNVSF LP R S+LQAY+  + G++T DFP  PPVQFDYT  N+SRAL
Sbjct  375   GGPNGTRFGASMNNVSFQLPTRISILQAYHLGVRGVFTTDFPAAPPVQFDYTAANISRAL  434

Query  843   WQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAK  664
             WQP  GTKLY +KYGS VQ+VLQ T IF  E+HP+H+HGYHF+V+  GFGNF+P  D A 
Sbjct  435   WQPVPGTKLYPLKYGSVVQLVLQGTNIFAGEEHPMHIHGYHFYVLATGFGNFDPARDAAS  494

Query  663   FNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQ  484
             FNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG G+ Q
Sbjct  495   FNLVDPPLRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVGKLQ  554

Query  483   TVEPPPLDLPRC  448
             ++EPPP DLPRC
Sbjct  555   SLEPPPADLPRC  566



>ref|XP_010491317.1| PREDICTED: laccase-13 isoform X2 [Camelina sativa]
Length=568

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/572 (66%), Positives = 452/572 (79%), Gaps = 21/572 (4%)
 Frame = -3

Query  2121  LAKLFVMLTV-LASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             L   FV+L V +ASL NA+V+  EF+ QET + RLC+    ITVNGQFPGPT+ VRNGD 
Sbjct  4     LLSYFVLLVVFVASLVNAEVHFHEFI-QETPVKRLCRVHNSITVNGQFPGPTLEVRNGDS  62

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +V+  +N+ARYN+++HWHG+RQMR PWADGPEY+TQCPI PGG+YTYRF IE+QEGTLWW
Sbjct  63    LVITAINKARYNISLHWHGIRQMRNPWADGPEYITQCPIQPGGSYTYRFTIEDQEGTLWW  122

Query  1764  HAHSRWLRATVYGAFIIYPK-SGSHFPFSQ-PKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             HAHSRWLRATVYGA II P  S  H+PF   PK++I +LLGEWW+R+ + +    QFTGA
Sbjct  123   HAHSRWLRATVYGALIIRPPLSSPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGA  182

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APNIS+AYTINGQPGDLYRCSSQ+T++F V  GE VLLRVIN+ALNQ+LFF VANHKL V
Sbjct  183   APNISDAYTINGQPGDLYRCSSQETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTV  242

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             V ADA+Y KPF+TNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A  A FDNTTTTA+
Sbjct  243   VAADASYTKPFSTNVIMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAI  301

Query  1230  LEYTN-----LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DES  1075
             L+Y +     L+  + +R +  QLP FNDTATA AFT Q++S     P+    P   DE+
Sbjct  302   LKYKDASCVTLQGKSLARAIPAQLPGFNDTATAAAFTAQMKS-----PSKVQVPLEIDEN  356

Query  1074  LFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTL  904
             LFFTVGLGL NCT     RCQGPN TRF AS+NNVSFV P++ S++QAYY   P G++T 
Sbjct  357   LFFTVGLGLFNCTTPNTQRCQGPNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFTT  416

Query  903   DFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGY  724
             DFPP PPV FDYTGNVSR LWQP  GTK YK+K+ S+VQ++LQDT+I TTE+HP+HLHGY
Sbjct  417   DFPPTPPVTFDYTGNVSRGLWQPTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGY  476

Query  723   HFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDS  544
              F+VVG G GNFNP TDTA FNL+DPP RNTI  P GGW  IRF A+NPG WLMHCHIDS
Sbjct  477   EFYVVGTGVGNFNPNTDTASFNLIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDS  536

Query  543   HLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             H+ WGLAM F+VENG+G  Q+V+ PPLDLP+C
Sbjct  537   HIFWGLAMVFLVENGEGHLQSVQSPPLDLPQC  568



>ref|XP_010031156.1| PREDICTED: laccase-12-like [Eucalyptus grandis]
 gb|KCW50425.1| hypothetical protein EUGRSUZ_J00166 [Eucalyptus grandis]
Length=570

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/567 (65%), Positives = 451/567 (80%), Gaps = 8/567 (1%)
 Frame = -3

Query  2130  NGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrng  1951
              G +  + +  +++ S A A +   +FVVQ T + RLCKT++ ITVNGQ+PGPT+ V +G
Sbjct  6     KGLMYLVILFASIMVSTAVAKIQYHDFVVQATPVKRLCKTRSTITVNGQYPGPTLEVNDG  65

Query  1950  ddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTL  1771
             D +V+ VVNRARYNVTIHWHG+RQ+RT WADGPE++TQCPI PGG YTYRF IE QEGTL
Sbjct  66    DTLVISVVNRARYNVTIHWHGIRQVRTGWADGPEFITQCPIQPGGIYTYRFTIEGQEGTL  125

Query  1770  WWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             WWHAHS WLRATVYGA IIYP+ GS +PF++PK++ PILLGEWWN + I +  +   TG 
Sbjct  126   WWHAHSSWLRATVYGALIIYPRQGSTYPFAEPKRETPILLGEWWNANPIDVVNEATRTGG  185

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APNIS+AYTINGQPGDLYRCSS +T+   +  GET LLRVINAALNQ+LFF+VA+H+L V
Sbjct  186   APNISDAYTINGQPGDLYRCSSSETIIVPIDTGETNLLRVINAALNQELFFAVASHELIV  245

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             VGADA+Y KPFTT+VIM+GPGQTT+VL+T DQPP RYYM A+ Y +AQ APFDNTTTTA+
Sbjct  246   VGADASYLKPFTTSVIMLGPGQTTDVLITGDQPPGRYYMVAQPYQSAQGAPFDNTTTTAI  305

Query  1230  LEYTNLR---PGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
             L+Y +      G  S P+MP LP FNDTAT TAFT  LRS   +N +V    DE+LFFTV
Sbjct  306   LDYISAPCPFRGTPSTPVMPTLPAFNDTATVTAFTQNLRS--PDNVSVPTDIDENLFFTV  363

Query  1059  GLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             GLGL NC P     +CQGPN TRFA+SMNN+SFVLP   S+LQAY+  IPG++T DFP V
Sbjct  364   GLGLFNCPPNLSSDQCQGPNGTRFASSMNNMSFVLPSTYSILQAYHQGIPGVFTTDFPAV  423

Query  888   PPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PPV FDYTGNVS++LWQP  GTK+Y+++YGS VQ+VLQDT+I + E+HPIHLHGY+F+V+
Sbjct  424   PPVAFDYTGNVSQSLWQPVPGTKVYELEYGSNVQIVLQDTSIVSGENHPIHLHGYNFYVI  483

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
               GFGNF+P T T +FNLVDPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D H+ WG
Sbjct  484   AVGFGNFDPATHTKEFNLVDPPMRNTVGVPVNGWAVIRFLADNPGVWIMHCHLDVHITWG  543

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAMAF+V++G G  Q++E PP DLP C
Sbjct  544   LAMAFLVKDGVGGLQSLESPPEDLPPC  570



>ref|XP_006431538.1| hypothetical protein CICLE_v10003240mg [Citrus clementina]
 gb|ESR44778.1| hypothetical protein CICLE_v10003240mg [Citrus clementina]
Length=579

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/582 (63%), Positives = 454/582 (78%), Gaps = 11/582 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             MD     ++ P+ +  L  +  +   +ASL++A++   EFV++   + RLC+T   +TVN
Sbjct  1     MDIPALITVKPWSSCLLLGVLFIFAFVASLSHAEIQFHEFVIEAKPVKRLCRTHNTVTVN  60

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             G+FPGPT+ VR+GD +++  +NRA+YN+T+HWHG+     PWADGPEYVTQCPI PG +Y
Sbjct  61    GEFPGPTLLVRDGDTLIITTINRAQYNITLHWHGVSLKGNPWADGPEYVTQCPIQPGRSY  120

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TY+F IE+QEGTLWWHAHSRW+RATVYGA IIYP+ GS +PF  P ++IPILLGEWW+++
Sbjct  121   TYQFTIEDQEGTLWWHAHSRWIRATVYGAIIIYPRFGSSYPFPVPNREIPILLGEWWDKN  180

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              + +  Q  FTGAAPN+S+A+TINGQPGDLYRCS ++TV+F V  GETVLLR+INAA+NQ
Sbjct  181   PMDVLMQAIFTGAAPNVSDAFTINGQPGDLYRCSRRETVRFQVEAGETVLLRIINAAMNQ  240

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             +LFF VANHKL VVG D +Y K F+T+VIM+ PGQTTNVLLTADQPPARYYMAARAY +A
Sbjct  241   ELFFGVANHKLTVVGVDTSYTKAFSTSVIMIAPGQTTNVLLTADQPPARYYMAARAYNSA  300

Query  1269  qnaPFDNTTTTAVLEY----TNLRPGAN--SRPLMPQLPFFNDtatataftTQLRSVPSN  1108
               A FDNTTTTA+L Y     N + G +  S P+ P LP FNDTATATA+T Q+RS+  +
Sbjct  301   NVA-FDNTTTTAILAYKSAPCNAKNGGSNSSAPVFPTLPGFNDTATATAYTAQIRSL--H  357

Query  1107  NPTVFNQPDESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAY  934
                V    DE LFFTVGLGL+NC+    PRCQGPN TRFAAS+NNVSF  P   SL+QAY
Sbjct  358   EVKVPTAIDEDLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNVSFEFPTGNSLMQAY  417

Query  933   YNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTT  754
             + + PG++T DFPPVPP++FDYTGNVSR LWQP  GTKLYK+K+GS VQ+V QDT+I T 
Sbjct  418   FQDQPGVFTTDFPPVPPIKFDYTGNVSRVLWQPLKGTKLYKLKFGSSVQLVWQDTSIVTV  477

Query  753   EDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPG  574
             EDHP+HLHG+ F+VVG GFGNFNP TDT KFNL+DPP RNTI +P GGW  IRF A+NPG
Sbjct  478   EDHPMHLHGHEFYVVGSGFGNFNPSTDTPKFNLIDPPRRNTIGMPPGGWVAIRFVANNPG  537

Query  573   VWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +W MHCH+DSHL WGLAMAF+VENG  E QTV+ PPLDLP C
Sbjct  538   IWFMHCHLDSHLTWGLAMAFLVENGDKELQTVQSPPLDLPPC  579



>ref|XP_004239957.1| PREDICTED: laccase-12-like [Solanum lycopersicum]
Length=574

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/561 (66%), Positives = 444/561 (79%), Gaps = 8/561 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             +  +L + A+ A+   +  +FV+Q T + RLCKT   ITVNGQ+PGPT+ V NGD +VV 
Sbjct  16    VICILLLFANAASEKTHYHDFVIQATPVKRLCKTSNAITVNGQYPGPTLEVNNGDTLVVN  75

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVN+ARYNVTIHWHG+RQMRT WADGPE++TQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  76    VVNKARYNVTIHWHGVRQMRTAWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHS  135

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II+PK G ++PF  PK++ P+LLGEWWN + I + RQ   TGAAPN+S+
Sbjct  136   SWLRATVYGALIIHPKEGGNYPFPNPKRETPVLLGEWWNTNPIDVVRQATRTGAAPNVSD  195

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CS QDT    +  GET LLRVINA LNQQLFF+VANHKL VVGADA 
Sbjct  196   AYTINGQPGDLYKCSRQDTTIVHMDSGETNLLRVINAGLNQQLFFTVANHKLTVVGADAN  255

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+V+M+GPGQTT+VL+ ADQ P+RYYMAARAYA+AQ APFDNTT TA+LEY   
Sbjct  256   YVKPFTTSVLMLGPGQTTDVLIKADQTPSRYYMAARAYASAQGAPFDNTTATAILEYKKS  315

Query  1212  RPGAN---SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVN  1042
                +N   + P+ P LP +NDT TATAFTT+ RS       V  + DE+LF TVGLGL N
Sbjct  316   SCSSNCTTTNPIFPLLPAYNDTTTATAFTTKFRS--PRKVEVPTEIDENLFITVGLGLEN  373

Query  1041  C---TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFD  871
             C    P   CQGPN TRFAASMNN+SFVLP   SLLQA++  IPG+++ DFP VPPV+F+
Sbjct  374   CPTGAPSSNCQGPNGTRFAASMNNISFVLPSNFSLLQAHHQRIPGVFSTDFPSVPPVKFN  433

Query  870   YTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             YTGNVSR+LWQP  GTKLYK+KYG++VQVVLQ T IFT E+HPIHLHGY F+++ +GFGN
Sbjct  434   YTGNVSRSLWQPIRGTKLYKLKYGAKVQVVLQGTGIFTAENHPIHLHGYDFYIIAEGFGN  493

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             FNP+TDT+KFNL++PP+RNT  VPV GW VIRF ADNPGVW+MHCH+D H+ WGLAMAF+
Sbjct  494   FNPKTDTSKFNLINPPLRNTASVPVNGWTVIRFIADNPGVWIMHCHLDVHITWGLAMAFL  553

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             VENG  E +++E PP+D P C
Sbjct  554   VENGVSELESLEAPPVDFPVC  574



>ref|XP_011004316.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=575

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/550 (69%), Positives = 439/550 (80%), Gaps = 13/550 (2%)
 Frame = -3

Query  2073  ADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHW  1894
             A  ++ +F+VQ TK+ RLCKT   ITVNG FPGPT+ V+NGD VVVKVVN+ARYNVTIHW
Sbjct  31    AKTHHHDFIVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTVVVKVVNKARYNVTIHW  90

Query  1893  HGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFII  1714
             HG+RQMRT WADGPEYVTQCPI PG +YTYRF IE QEGTLWWHAHS WLRATVYGA II
Sbjct  91    HGIRQMRTGWADGPEYVTQCPIRPGRSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALII  150

Query  1713  YPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYR  1534
             +P+ GS +PFS+P ++ PILLGEWW+ + I + R+   TGAAPNIS+AYTINGQPGDLY 
Sbjct  151   HPREGSSYPFSKPNRETPILLGEWWDTNPIDVVREATRTGAAPNISDAYTINGQPGDLYN  210

Query  1533  CSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVG  1354
             CSS+DT    +  GET LLRVINAALNQ LFF++ANHK  VVGADA+Y KPFTT+VIM+G
Sbjct  211   CSSKDTTIVPIDSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYVKPFTTSVIMLG  270

Query  1353  PGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN--SRPLMP  1180
             PGQTT+VL++ DQ P RYYMAARAY +AQNAPFDNTTTTA+LEY ++   A    +P MP
Sbjct  271   PGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTAILEYKSVLCPAKCTKKPFMP  330

Query  1179  QLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTP---GPRCQ  1018
              LP +NDTAT TAF+   RS     P   + P   DE+LFFT+GLGL NC       RCQ
Sbjct  331   PLPAYNDTATVTAFSRSFRS-----PRKVDVPTDIDENLFFTIGLGLNNCPKNFRARRCQ  385

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             GPN TRF ASMNNVSFV P + SLLQAY   IPG++T DFP  P V+FDYTGNVSR+L+Q
Sbjct  386   GPNGTRFTASMNNVSFVFPSKASLLQAYKQKIPGVFTTDFPANPQVKFDYTGNVSRSLFQ  445

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTKLYK+KYGSRVQVVLQDT+I T E+HPIHLHGY F+V+ +GFGNFN +TD +KFN
Sbjct  446   PLPGTKLYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYVIAEGFGNFNHKTDKSKFN  505

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             LVDPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D H+ WGLAMAF+VE G G  Q+V
Sbjct  506   LVDPPMRNTVAVPVNGWAVIRFVADNPGVWIMHCHLDVHITWGLAMAFLVEEGIGILQSV  565

Query  477   EPPPLDLPRC  448
             EPPP DLP C
Sbjct  566   EPPPADLPIC  575



>ref|XP_006355637.1| PREDICTED: laccase-12-like [Solanum tuberosum]
Length=573

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/553 (68%), Positives = 446/553 (81%), Gaps = 9/553 (2%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             A  A+A  +  +FV+Q T + RLCKT   ITVNGQFPGPT+ V NGD +VVKVVNRARYN
Sbjct  24    ADAASAKTHYHDFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVKVVNRARYN  83

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             VTIHWHG+RQMRT WADGPE++TQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVY
Sbjct  84    VTIHWHGVRQMRTAWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA II+PK GS +PF +PK++ PILLGEWWN + I + R+   TGAAPN+S+AYTINGQP
Sbjct  144   GALIIHPKGGS-YPFPKPKRETPILLGEWWNANPIDVVREATRTGAAPNVSDAYTINGQP  202

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLY+CSSQDT       GET LLRVINA +NQ+LFF+VANHK  VVGADA+Y KPFTT+
Sbjct  203   GDLYKCSSQDTNIVHTDSGETNLLRVINAGMNQELFFTVANHKFTVVGADASYVKPFTTS  262

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN---  1198
             V+M+GPGQTT+VL+ ADQPP+RYYMAARAYA+AQ APFDNTTTTA+LEY      +N   
Sbjct  263   VLMLGPGQTTDVLIKADQPPSRYYMAARAYASAQGAPFDNTTTTAILEYKTSSCSSNCVK  322

Query  1197  SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR--  1024
             + P+ P LP +NDTATATAFTT+ RS       V  + DE+LFFTVGLGL NC  G R  
Sbjct  323   TNPVFPSLPAYNDTATATAFTTKFRS--PRKVEVPKEIDENLFFTVGLGLNNCPRGARSK  380

Query  1023  -CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRA  847
              CQGPN TRF ASMNN+SFVLP   SLLQA++N IPG+++ DFP VPPV+FDYTGNVSR+
Sbjct  381   NCQGPNGTRFTASMNNISFVLPSNFSLLQAHHNGIPGVFSTDFPAVPPVKFDYTGNVSRS  440

Query  846   LWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTA  667
             LWQP  GTKLYK+KYG+RVQVVLQ T I T E+HPIHLHGY F+++ +GFGNFNP+ D +
Sbjct  441   LWQPIRGTKLYKLKYGARVQVVLQGTNISTAENHPIHLHGYDFYIIAEGFGNFNPKRDAS  500

Query  666   KFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEK  487
             KFNLVDPP+RNT  VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG  + 
Sbjct  501   KFNLVDPPLRNTASVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVSQL  560

Query  486   QTVEPPPLDLPRC  448
             +++E PP+DLP C
Sbjct  561   ESLETPPVDLPVC  573



>ref|XP_004239959.1| PREDICTED: laccase-12 [Solanum lycopersicum]
Length=574

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/553 (68%), Positives = 447/553 (81%), Gaps = 8/553 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             A  A+A  +  +FV+Q T + RLCKT   ITVNGQFPGPT+ V NGD +VVKVVNRARYN
Sbjct  24    ADAASAKTHYHDFVIQATPVKRLCKTHNTITVNGQFPGPTLEVNNGDTLVVKVVNRARYN  83

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             VTIHWHG+RQMR+ WADGPE++TQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVY
Sbjct  84    VTIHWHGVRQMRSAWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  143

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA II+PK G ++PF +P+++ PILLGEWW+ + I + R+   TGAAPN+S+AYTINGQP
Sbjct  144   GALIIHPKEGGNYPFPKPRRETPILLGEWWDANPIDVVREATRTGAAPNVSDAYTINGQP  203

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLY+CSSQDT    +  GET LLRVINA +NQ+LFF+VANHK  VVGADA+Y KPFTT+
Sbjct  204   GDLYKCSSQDTTIVHMDSGETNLLRVINAGMNQELFFTVANHKFTVVGADASYVKPFTTS  263

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN---  1198
             V+M+GPGQTT+VL+ ADQPP+RYYMAARAYA+AQ APFDNTTTTA+LEY      +N   
Sbjct  264   VLMLGPGQTTDVLIKADQPPSRYYMAARAYASAQGAPFDNTTTTAILEYKTSSCSSNCVK  323

Query  1197  SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR--  1024
             + P+ P LP +NDTATATAFTT+ RS       V  + DE+LFFTVGLGL NC  G R  
Sbjct  324   TNPVFPSLPAYNDTATATAFTTKFRS--PRRVEVPKEIDENLFFTVGLGLNNCPRGARSR  381

Query  1023  -CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRA  847
              CQGPN TRF ASMNNVSFVLP   SLLQA++N IPG+++ DFP VPPV+FDYTGNVSR+
Sbjct  382   NCQGPNGTRFTASMNNVSFVLPSNFSLLQAHHNGIPGVFSTDFPAVPPVKFDYTGNVSRS  441

Query  846   LWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTA  667
             LWQ   GTKLYK+KYG+RVQVVLQ T I T E+HPIHLHGY F+++ +GFGNFNP+ DT+
Sbjct  442   LWQLIRGTKLYKLKYGARVQVVLQGTNISTAENHPIHLHGYDFYIIAEGFGNFNPKRDTS  501

Query  666   KFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEK  487
             KFNLVDPP+RNT  VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG  + 
Sbjct  502   KFNLVDPPLRNTASVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVSQL  561

Query  486   QTVEPPPLDLPRC  448
             +++E PP+DLP C
Sbjct  562   ESLEAPPVDLPVC  574



>ref|XP_011084865.1| PREDICTED: laccase-12-like [Sesamum indicum]
Length=580

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/560 (68%), Positives = 452/560 (81%), Gaps = 8/560 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             +F++   L + A+A  +  +FVVQ T + RLCKT   ITVNG +PGPT+ V NGD +VV 
Sbjct  24    VFLIFHALPT-ADAKTHYHDFVVQATPVKRLCKTHNAITVNGMYPGPTLEVNNGDTLVVN  82

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVNRARYNVTIHWHG+RQ+RT WADGP++VTQCPI PGG+YTYRF I+ QEGTLWWHAHS
Sbjct  83    VVNRARYNVTIHWHGVRQIRTGWADGPDFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHS  142

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II PK G  +PF +PK++  +LLGEWW+ + + + RQ   TGAAPN+S+
Sbjct  143   SWLRATVYGALIIRPKEGESYPFPKPKRETSLLLGEWWDANPVDVVRQATRTGAAPNVSD  202

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY CSS++T+   V  GET LLRV+N+ALNQQLFF VANHKL VVGADA+
Sbjct  203   AYTINGQPGDLYNCSSKETITVPVDSGETNLLRVVNSALNQQLFFKVANHKLTVVGADAS  262

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+V+M+GPGQTT+VL+TADQPPARYY+AARAYA+AQ APFDNTTTTA+LEY + 
Sbjct  263   YVKPFTTSVLMLGPGQTTDVLITADQPPARYYIAARAYASAQGAPFDNTTTTAILEYESA  322

Query  1212  RPGANS--RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNC  1039
                A    +P+MP +P FNDTATATAFTT+ RS P   P V N  D +LFFTVGLGL NC
Sbjct  323   GCPAKCVVKPVMPAMPAFNDTATATAFTTRFRS-PRRVP-VPNNIDHNLFFTVGLGLNNC  380

Query  1038  TPGPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDY  868
              PG R   CQGPN TRFAASMNNVSFVLP   SLLQA+   IPG++T DFP  PPVQFDY
Sbjct  381   PPGARPRNCQGPNGTRFAASMNNVSFVLPSNFSLLQAHQQGIPGVFTTDFPANPPVQFDY  440

Query  867   TGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNF  688
             TGNVSR+LWQP  GTK+YK+KYG  VQ+VLQ T+IFT E+HPIHLHG+ F+++ +GFGNF
Sbjct  441   TGNVSRSLWQPVRGTKVYKLKYGETVQLVLQGTSIFTAENHPIHLHGFDFYIIAEGFGNF  500

Query  687   NPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIV  508
             NP  DTAKFNLVDPP+RNT  +PVGGW VIRF ADNPGVWL+HCH+D H+ WGLAMAF+V
Sbjct  501   NPSRDTAKFNLVDPPLRNTASLPVGGWTVIRFVADNPGVWLLHCHLDVHITWGLAMAFLV  560

Query  507   ENGQGEKQTVEPPPLDLPRC  448
             ENG GE QT+EPPP DLP C
Sbjct  561   ENGVGELQTLEPPPADLPVC  580



>ref|XP_009369225.1| PREDICTED: laccase-5-like [Pyrus x bretschneideri]
 ref|XP_009350695.1| PREDICTED: laccase-5-like [Pyrus x bretschneideri]
Length=554

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/555 (67%), Positives = 436/555 (79%), Gaps = 11/555 (2%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             SLA    +  EFVVQ T + RLCK++  ITVNGQFPGPT+ V NGD +VVKV NRA+YN+
Sbjct  2     SLAEPKTHKHEFVVQATPVKRLCKSRNSITVNGQFPGPTLEVNNGDTLVVKVTNRAQYNI  61

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             TIHWHG+RQMRT WADGPE+VTQCPI PGG+YTY+F I+ QEGTLWWHAHS WLRATVYG
Sbjct  62    TIHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYQFTIQGQEGTLWWHAHSSWLRATVYG  121

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A II+PK G  +PF++PK++  +LLGEWWN + I + RQ   TG APN+S+AYTINGQPG
Sbjct  122   ALIIHPKQGDSYPFTKPKRETTLLLGEWWNANPINVLRQATKTGGAPNVSDAYTINGQPG  181

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DLY CSS+DTV   +  G+T LLRVINAALNQ LFFSVANHKL VV ADA+Y KPFTT V
Sbjct  182   DLYNCSSKDTVIVPIDSGKTNLLRVINAALNQPLFFSVANHKLTVVSADASYTKPFTTTV  241

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYT------NLRPG  1204
             +M+GPGQTT+VL+  DQPPARYY+AARAY +AQNA FDNTTTTA+LEY       N + G
Sbjct  242   LMLGPGQTTDVLINGDQPPARYYLAARAYFSAQNAAFDNTTTTAILEYKSAPCSPNCKKG  301

Query  1203  ANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---  1033
               ++P+MPQLP FNDT TA+AFT   RS       V  + DE+LFFT+GLGL  C     
Sbjct  302   PTTKPIMPQLPAFNDTNTASAFTKSFRS--PRKVEVPTEIDENLFFTIGLGLNKCPKNFG  359

Query  1032  GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVS  853
               RCQGPN TRF ASMNNVSFVLP   S+LQAY  NIPG++T DFP  PP +F YTGNVS
Sbjct  360   SQRCQGPNGTRFTASMNNVSFVLPNNNSILQAYQQNIPGVFTTDFPANPPQKFGYTGNVS  419

Query  852   RALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTD  673
             R+LWQP SGT+ YK+KYGSRVQVVLQDT+I T E+HPIHLHGY F+++ +GFGNFN +TD
Sbjct  420   RSLWQPMSGTRGYKLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAKTD  479

Query  672   TAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQG  493
             T KFNLVDPP+RNT+ VP  GWAVIRF ADNPG W+MHCH+D H+ WGLAM F+V+NG G
Sbjct  480   TKKFNLVDPPLRNTVAVPANGWAVIRFVADNPGAWMMHCHLDVHIHWGLAMVFLVDNGVG  539

Query  492   EKQTVEPPPLDLPRC  448
               Q++ PPP DLP C
Sbjct  540   ALQSINPPPADLPLC  554



>ref|XP_002871156.1| hypothetical protein ARALYDRAFT_487334 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47415.1| hypothetical protein ARALYDRAFT_487334 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/563 (67%), Positives = 449/563 (80%), Gaps = 8/563 (1%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             F   LF+     ASL  A V + +FV+QET + RLCKT+  ITVNG FPGPT+ V NGD 
Sbjct  7     FSILLFLCSLFSASLIIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDT  66

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             + VKV NRARYN+TIHWHG+RQ+RT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWW
Sbjct  67    LEVKVHNRARYNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWW  126

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II+P  GS FPF +P +   ++LGEWWN + + +  Q   TGAAP
Sbjct  127   HAHSSWLRATVYGALIIHPTPGSSFPFPKPDRQTALMLGEWWNANPVDIINQATRTGAAP  186

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             NIS+AYTINGQPGDLY+CS+++TV   ++ GET L+RVINAALNQ LFF+VANHKL VVG
Sbjct  187   NISDAYTINGQPGDLYKCSTKETVVVPINSGETNLVRVINAALNQPLFFTVANHKLTVVG  246

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPF T V+M+GPGQTT+VLLTADQPP RYY+AARAY +AQNAPFDNTTTTA+L+
Sbjct  247   ADASYLKPFATKVLMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILQ  306

Query  1224  YTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLV  1045
             Y   R  A S+P++P LP FNDT T T+F+ + +S+   N  V    D++LFFT+GLGL 
Sbjct  307   YKKTR--ATSKPIVPVLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDDNLFFTIGLGLD  362

Query  1044  NCT---PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             NC    P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPV+F
Sbjct  363   NCPKNFPKNRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPSKPPVKF  422

Query  873   DYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGF  697
             DYTG N+SRAL+QP  GTKLYK+KYGSRVQVVLQDT I T+E+HPIHLHG+ F++VG+GF
Sbjct  423   DYTGNNISRALFQPVKGTKLYKLKYGSRVQVVLQDTNIVTSENHPIHLHGHDFYIVGEGF  482

Query  696   GNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMA  517
             GNFNP+ DT+KFNLV+PP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMA
Sbjct  483   GNFNPKKDTSKFNLVNPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMA  542

Query  516   FIVENGQGEKQTVEPPPLDLPRC  448
             F+V+NG GE +T+E PP DLP C
Sbjct  543   FLVDNGVGELETLEAPPHDLPIC  565



>ref|XP_004239958.1| PREDICTED: laccase-12-like [Solanum lycopersicum]
Length=570

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/573 (66%), Positives = 450/573 (79%), Gaps = 10/573 (2%)
 Frame = -3

Query  2145  LNPFCNGFLAKLFV-MLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPT  1969
             + PF N   +  FV +L + A+  +A  +  +FVVQ T + RLC+   IITVNG+FPGPT
Sbjct  1     MKPF-NPLSSLCFVCILLLFANAESAKTHYHDFVVQATLVKRLCEIHNIITVNGKFPGPT  59

Query  1968  IAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIE  1789
             + V NGD +VV VVNRARYNVTIHWHG+RQMRT WADGPE++TQCPI PG +YTYRF I+
Sbjct  60    LEVNNGDTLVVNVVNRARYNVTIHWHGVRQMRTGWADGPEFITQCPIRPGKSYTYRFTIQ  119

Query  1788  NQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQ  1609
              QEGTLWWHAHS WLRATVYGA II PK G  +PF +PK++ PILLGEWWN + I + RQ
Sbjct  120   GQEGTLWWHAHSSWLRATVYGALIINPKEGVIYPFPKPKRETPILLGEWWNTNPIDVVRQ  179

Query  1608  TQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVA  1429
                TGAAPNIS+AYTIN QPGDLY+CSSQDT    +  GE  LLRVINAALNQQLFF+VA
Sbjct  180   ATRTGAAPNISDAYTINSQPGDLYKCSSQDTAIVHMDSGEINLLRVINAALNQQLFFAVA  239

Query  1428  NHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDN  1249
             NHKL VVGADA Y KPFTT+V+M+GPGQTT+VL+ ADQ PARYYMAARAYA+AQ+APFD+
Sbjct  240   NHKLTVVGADATYVKPFTTSVLMLGPGQTTDVLIKADQQPARYYMAARAYASAQDAPFDD  299

Query  1248  TTTTAVLEYTNLRPGAN---SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDE  1078
             TTTTA+LEY       N   ++P+ P LP +NDT+TAT F+T+ RS       V  + DE
Sbjct  300   TTTTAILEYNTASCSTNCVKTKPVFPSLPAYNDTSTATTFSTKFRS--PRRVEVPKEIDE  357

Query  1077  SLFFTVGLGLVNC---TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYT  907
             +LFFTVGLGL NC    P   CQGP+ TRF ASMNNVSF LP   SLLQA+Y  I G+++
Sbjct  358   NLFFTVGLGLENCPRGAPSSYCQGPSGTRFTASMNNVSFTLPSNNSLLQAHYQGISGVFS  417

Query  906   LDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHG  727
              DFP VPPV+FDYTGNVS +LWQP  GTKLYK+KYG++VQVVLQ T+IF+ E+HP+HLHG
Sbjct  418   TDFPAVPPVKFDYTGNVSGSLWQPIRGTKLYKLKYGAKVQVVLQGTSIFSAENHPMHLHG  477

Query  726   YHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHID  547
             Y F+++ +GFGNFNP+TDT KFNL+DPP+RNT  VPV GW VIRF A+NPGVWLMHCH+D
Sbjct  478   YDFYIIAEGFGNFNPKTDTFKFNLIDPPLRNTASVPVNGWTVIRFIANNPGVWLMHCHLD  537

Query  546   SHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
              H+ WGLAMAF+VENG  E +++EPPPLDLP C
Sbjct  538   VHITWGLAMAFLVENGVCESESLEPPPLDLPVC  570



>ref|XP_009804480.1| PREDICTED: laccase-12-like isoform X1 [Nicotiana sylvestris]
Length=587

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/591 (65%), Positives = 456/591 (77%), Gaps = 20/591 (3%)
 Frame = -3

Query  2193  TTLQKHPQMDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCK  2014
             + ++K   +    N+  NP C       F  +++L   ANA      FV+Q T + RLCK
Sbjct  8     SLIKKRTIILDACNSMANPLC------YFFFISILLLFANAKTQYHHFVIQATPVKRLCK  61

Query  2013  TKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQC  1834
             T   ITVNGQFPGPT+ V NGD +V+ VVNRARYNVTIHWHG++Q+RT WADGPE++TQC
Sbjct  62    THNTITVNGQFPGPTLEVNNGDTLVINVVNRARYNVTIHWHGVKQIRTAWADGPEFITQC  121

Query  1833  PIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPIL  1654
             PI PGG+YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK G  +PF  P+++ PIL
Sbjct  122   PIRPGGSYTYRFTIQEQEGTLWWHAHSSWLRATVYGALIIHPKEGEFYPFPNPRRETPIL  181

Query  1653  LGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLR  1474
             LGEWW+ + I + RQ   TGAAPN+S+AYTINGQPGDLYRCSS+DT    V  GET LLR
Sbjct  182   LGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGDLYRCSSKDTTIVLVDSGETSLLR  241

Query  1473  VINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyym  1294
             VINAALNQQLFF+VANHKL VVGADA+Y +PFTT+V+M+GPGQTT+VL+T +QPPARYYM
Sbjct  242   VINAALNQQLFFTVANHKLTVVGADASYVQPFTTSVLMLGPGQTTDVLITGNQPPARYYM  301

Query  1293  aarayataqnaPFDNTTTTAVLEYTN---LRPGANSRPLMPQLPFFNDtatataftTQLR  1123
             AA+AYA+AQ APFDNTTTTA+LEY N      G    P+ P LP FNDTATATAFTT  R
Sbjct  302   AAQAYASAQGAPFDNTTTTAILEYKNTPCAVQGIKINPIFPSLPPFNDTATATAFTTSFR  361

Query  1122  SVPSNNPTVFNQP---DESLFFTVGLGLVNCTPGP---RCQGPNNTRFAASMNNVSFVLP  961
             S     P+    P   DE+LF TVGLGL NC  G     CQGPN TRFAASMNNVSFVLP
Sbjct  362   S-----PSKVELPTEIDENLFITVGLGLKNCPKGASSSSCQGPNGTRFAASMNNVSFVLP  416

Query  960   RRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVV  781
                S+LQA+   IPGI++ DFP VP V+FDYTGNVS++LWQP  GTK+YK+KYG++VQVV
Sbjct  417   PNFSILQAHQQGIPGIFSTDFPAVPLVKFDYTGNVSQSLWQPVPGTKVYKLKYGAKVQVV  476

Query  780   LQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAV  601
             LQ T+I T E+HPIHLHGY F+++ +GFGNFNPQTDTAKFNLVDPP RNT  +PV GW+V
Sbjct  477   LQGTSIVTGENHPIHLHGYDFYIIAEGFGNFNPQTDTAKFNLVDPPRRNTASLPVNGWSV  536

Query  600   IRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             IRF ADNPGVWLMHCH+D H+ WGLAM+F+VENG  E +++E PP+DLP C
Sbjct  537   IRFVADNPGVWLMHCHLDVHITWGLAMSFLVENGVSELESLEDPPVDLPVC  587



>ref|XP_009122370.1| PREDICTED: laccase-13 isoform X1 [Brassica rapa]
Length=566

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/565 (65%), Positives = 443/565 (78%), Gaps = 19/565 (3%)
 Frame = -3

Query  2106  VMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvv  1927
             V+L  +ASL NA+V+  EF++QET + RLC+    ITVNGQFPGPT+ VRNGD +V+  +
Sbjct  9     VLLVFVASLVNAEVHFHEFIIQETPVKRLCRVHNSITVNGQFPGPTLKVRNGDSLVITAI  68

Query  1926  nrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRW  1747
             N+A+YN+++HWHG++QMR PWADGPEY+TQCPI PGG+YTYRF IE QEGTLWWHAHSRW
Sbjct  69    NKAQYNISLHWHGIKQMRNPWADGPEYITQCPIKPGGSYTYRFNIEEQEGTLWWHAHSRW  128

Query  1746  LRATVYGAFIIYPK-SGSHFPFS-QPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             LRATVYGA II P  S  H+PF   PK++  +LLGEWW+R+ + +    QFTGAAPN+S+
Sbjct  129   LRATVYGALIIRPPLSSPHYPFPVLPKREFTLLLGEWWDRNPMDVLNMAQFTGAAPNVSD  188

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             A+TINGQPGD YRCSSQ+T++F V  GETVLLRVIN+ LNQ+LFF VANHKL VV ADA+
Sbjct  189   AFTINGQPGDFYRCSSQETLRFLVGSGETVLLRVINSGLNQELFFGVANHKLTVVAADAS  248

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN-  1216
             Y KPF+TNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A    FDNTTTT++LEY + 
Sbjct  249   YTKPFSTNVIMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAP-FDNTTTTSILEYKDA  307

Query  1215  --LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLG  1051
               +   + +R +  QLP FNDTATA AFT Q++S     P+    P   DE LFFTVGLG
Sbjct  308   PCVTSQSQARAIPAQLPGFNDTATAAAFTAQMKS-----PSKVEVPLEVDEDLFFTVGLG  362

Query  1050  LVNCTPGP---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTLDFPPVPP  883
             L NC P P   RCQGPN TRF AS+NNVSFV PR+ S+LQAYY   P G++T DFPPVPP
Sbjct  363   LFNC-PTPNTQRCQGPNGTRFTASINNVSFVFPRQNSILQAYYQGTPAGVFTTDFPPVPP  421

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
               FDYTGNVSR LWQP  GTK YK+KY S+VQV+LQDT+I T E+HP+HLHGY F+VVG 
Sbjct  422   TTFDYTGNVSRGLWQPTRGTKAYKLKYKSKVQVILQDTSIVTIENHPMHLHGYEFYVVGT  481

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             G GNFN   DT+ FNL+DPP RNTI  P GGW  IRF ADNPGVWLMHCHID+H+ WGLA
Sbjct  482   GIGNFNANKDTSSFNLIDPPRRNTIGTPPGGWIAIRFVADNPGVWLMHCHIDAHIFWGLA  541

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG+G  Q+V+ PPLDLP+C
Sbjct  542   MVFLVENGEGHLQSVQSPPLDLPQC  566



>ref|XP_010534627.1| PREDICTED: laccase-5 [Tarenaya hassleriana]
Length=574

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/562 (66%), Positives = 445/562 (79%), Gaps = 10/562 (2%)
 Frame = -3

Query  2109  FVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkv  1930
             F++  + ASL+ A V+  EF+VQ TK+ RLCKT   ITVNG FPGPT+ V NGD +VVKV
Sbjct  15    FLVAFLSASLSCAKVHEHEFIVQATKVKRLCKTHNSITVNGMFPGPTLEVYNGDTLVVKV  74

Query  1929  vnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIEN-QEGTLWWHAHS  1753
             VNRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I   QEGTLWWHAHS
Sbjct  75    VNRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGHSYTYRFTIHGGQEGTLWWHAHS  134

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA I+YP+ G+ +PF +P ++ PILLGEWW+ + I + R+   TGAAPN+S+
Sbjct  135   SWLRATVYGALIVYPQRGTDYPFPKPHRETPILLGEWWDANPIDVVREATRTGAAPNVSD  194

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CSSQDT    ++ GE  LLRVIN+ALNQ LFF+VANHKL VVGADA+
Sbjct  195   AYTINGQPGDLYKCSSQDTTIVPINVGERHLLRVINSALNQPLFFTVANHKLTVVGADAS  254

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT V+M+GPGQTT+VL+T DQPP RYYMAARAY +AQNAPFDNTTTTA+L Y   
Sbjct  255   YVKPFTTTVLMLGPGQTTDVLVTGDQPPNRYYMAARAYQSAQNAPFDNTTTTAILHYKTA  314

Query  1212  ----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLV  1045
                 + G + +P+MP LP +NDT T T F+   RS+      V  + DE+LFFT+GLGL 
Sbjct  315   PCCGKNGVSLKPIMPLLPAYNDTNTVTQFSKSFRSL--RRADVPTEVDENLFFTIGLGLD  372

Query  1044  NCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             NC       RCQGPN TRF ASMNNVSFVLPR  SLLQA+   IP ++T DFP +PPV+F
Sbjct  373   NCPKNFRARRCQGPNGTRFTASMNNVSFVLPRNYSLLQAHAQGIPRVFTTDFPAIPPVKF  432

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             DYTGNVSR+L+QP  GTKLYK+K+GSRVQ+VLQDT+I T E+HPIHLHGY F+++ +GFG
Sbjct  433   DYTGNVSRSLYQPVKGTKLYKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYILAEGFG  492

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NFNP+ DT KFNLVDPP+RNT  VPV GW VIRF ADNPGVW+MHCH+D H+ WGLAMAF
Sbjct  493   NFNPKKDTKKFNLVDPPLRNTAAVPVNGWTVIRFVADNPGVWIMHCHLDVHINWGLAMAF  552

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +V+NG G  Q++EPPP DLP C
Sbjct  553   LVDNGVGALQSLEPPPADLPVC  574



>ref|XP_006287390.1| hypothetical protein CARUB_v10000596mg [Capsella rubella]
 gb|EOA20288.1| hypothetical protein CARUB_v10000596mg [Capsella rubella]
Length=563

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/559 (67%), Positives = 441/559 (79%), Gaps = 10/559 (2%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             LF    + AS   A V + +FV+QET + RLCKT+ +ITVNG FPGPT+ V NGD + VK
Sbjct  11    LFFCSLLSASSTIAKVQHHDFVIQETPVKRLCKTRNVITVNGMFPGPTLEVNNGDTLEVK  70

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V NRARYN+TIHWHG+RQ+RT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  71    VHNRARYNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHS  130

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II+P  GS FPF +P +   ++LGEWWN + + +  Q   TGAAPNIS+
Sbjct  131   SWLRATVYGALIIHPTPGSSFPFPKPDRQTALVLGEWWNANPVDVINQAIRTGAAPNISD  190

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY CS+++T+      GET LLRVINAALNQ LFFSVANHKL VVGADA+
Sbjct  191   AYTINGQPGDLYNCSTKETIVVPTKSGETSLLRVINAALNQPLFFSVANHKLTVVGADAS  250

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT V+M+GPGQTT+VLLTADQPP RYY+AARAY +AQNAPFDNTTTT +L+Y   
Sbjct  251   YLKPFTTKVLMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTGILQYKK-  309

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT-  1036
                  S P++P LP FNDT T T+F+ + +S+   N  V    D+ LFFTVGLGL NC  
Sbjct  310   ---TTSPPILPVLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDDDLFFTVGLGLDNCPK  364

Query  1035  --PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
               P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPVQFDYTG
Sbjct  365   NFPKSRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVQFDYTG  424

Query  861   -NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFN  685
              N+SRAL+QP  GTKLYK+KYGSRVQVVLQDT I T+E+HPIHLHGY F++VG+GFGNFN
Sbjct  425   NNISRALFQPVKGTKLYKLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFN  484

Query  684   PQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVE  505
             P+ DT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+V+
Sbjct  485   PKKDTSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVD  544

Query  504   NGQGEKQTVEPPPLDLPRC  448
             NG GE +T+E PP DLP C
Sbjct  545   NGVGELETLEAPPHDLPVC  563



>emb|CDX70010.1| BnaA10g23590D [Brassica napus]
Length=567

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/562 (66%), Positives = 441/562 (78%), Gaps = 12/562 (2%)
 Frame = -3

Query  2106  VMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvv  1927
             V+L  +ASL NA+V+  EF++QET + RLC+    ITVNGQFPGPT+ VRNGD +V+  +
Sbjct  9     VLLVFVASLVNAEVHFHEFIIQETPVKRLCRVHNSITVNGQFPGPTLKVRNGDSLVITAI  68

Query  1926  nrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRW  1747
             N+A+YN+++HWHG++QMR PWADGPEY+TQCPI PGG+YTYRF IE QEGTLWWHAHSRW
Sbjct  69    NKAQYNISLHWHGIKQMRNPWADGPEYITQCPIKPGGSYTYRFNIEEQEGTLWWHAHSRW  128

Query  1746  LRATVYGAFIIYPK-SGSHFPFS-QPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             LRATVYGA II P  S  H+PF   PK++  +LLGEWW+R+ + +    QFTGAAPN+S+
Sbjct  129   LRATVYGALIIRPPLSSPHYPFPVLPKREFTLLLGEWWDRNPMDVLNMAQFTGAAPNVSD  188

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             A+TINGQPGD YRCSSQ+T++F V  GETVLLRVIN+ LNQ+LFF VANHKL VV ADA+
Sbjct  189   AFTINGQPGDFYRCSSQETLRFLVGSGETVLLRVINSGLNQELFFGVANHKLTVVAADAS  248

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN-  1216
             Y KPF+TNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A    FDNTTTTA+LEY   
Sbjct  249   YTKPFSTNVIMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAP-FDNTTTTAILEYKYA  307

Query  1215  --LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVN  1042
               +   + +R +  QLP FNDTATA AFT Q++S PS       + DE LFFTVGLGL N
Sbjct  308   PCVTSQSQARAIPAQLPGFNDTATAAAFTAQMKS-PSKVEVPL-EVDEDLFFTVGLGLFN  365

Query  1041  C---TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTLDFPPVPPVQF  874
             C   T   RCQGPN TRF AS+NNVSFV PR+ S++QAYY   P G++T DFPPVPP  F
Sbjct  366   CPTSTNTQRCQGPNGTRFTASINNVSFVFPRQNSIMQAYYQGTPAGVFTTDFPPVPPTTF  425

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             DYTGNVSR LWQP  GTK YK+KY S+VQV+LQDT+I T E+HP+HLHGY F+VVG G G
Sbjct  426   DYTGNVSRGLWQPTRGTKAYKLKYKSKVQVILQDTSIVTIENHPMHLHGYEFYVVGTGIG  485

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NFN   DT+ FNL+DPP RNTI  P GGW  IRF ADNPGVWLMHCHID+H+ WGLAM F
Sbjct  486   NFNANKDTSSFNLIDPPRRNTIGTPPGGWIAIRFVADNPGVWLMHCHIDAHIFWGLAMVF  545

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +VENG+G  Q+V+ PPLDLP+C
Sbjct  546   LVENGEGHLQSVQSPPLDLPQC  567



>ref|XP_010491073.1| PREDICTED: laccase-12-like [Camelina sativa]
Length=565

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/559 (67%), Positives = 439/559 (79%), Gaps = 8/559 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             LF    + AS   A V + +FV+QET + RLCKT+  ITVNG FPGPT+ V NGD + VK
Sbjct  11    LFFCSLLSASSTIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVK  70

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V NRAR N+TIHWHG+RQ+RT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  71    VHNRARNNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHS  130

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II P  GS FPF +P +   ++LGEWWN + + +  Q   TGAAPNIS+
Sbjct  131   SWLRATVYGALIIQPTPGSSFPFPKPDRQTALVLGEWWNANPVDVINQAIRTGAAPNISD  190

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY CS+++TV   ++ GET LLRVINAALNQ LFFSVA HKL VVGADA+
Sbjct  191   AYTINGQPGDLYNCSTKETVVVPINSGETSLLRVINAALNQPLFFSVAKHKLTVVGADAS  250

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT V+M+GPGQTT+VLL ADQ P RYY+AARAY +AQNAPFDNTTTTA+L+Y N 
Sbjct  251   YVKPFTTKVLMLGPGQTTDVLLNADQQPKRYYIAARAYQSAQNAPFDNTTTTAILQYKNT  310

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT-  1036
                 +S P++P LP FNDT T T+F+ + +S+   N  V    D+ LFFTVGLGL NC  
Sbjct  311   T--TSSPPILPVLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDDGLFFTVGLGLDNCPK  366

Query  1035  --PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
               P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPV+FDYTG
Sbjct  367   NFPKSRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTG  426

Query  861   -NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFN  685
              N+SRAL+QP  GTKLY +KYGSRVQVVLQDT I T+E+HPIHLHGY F++VG+GFGNFN
Sbjct  427   NNISRALFQPVKGTKLYNLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFN  486

Query  684   PQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVE  505
             P+ DT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE
Sbjct  487   PKKDTSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVE  546

Query  504   NGQGEKQTVEPPPLDLPRC  448
             NG GE +T+E PP DLP C
Sbjct  547   NGVGELETLEAPPHDLPVC  565



>emb|CDX99004.1| BnaC09g48310D [Brassica napus]
Length=566

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/565 (65%), Positives = 442/565 (78%), Gaps = 19/565 (3%)
 Frame = -3

Query  2106  VMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvv  1927
             V+L  +ASL NA+V+  EF++QET + RLC+    ITVNGQFPGP + VRNGD +V+  +
Sbjct  9     VLLAFVASLVNAEVHFHEFIIQETPVKRLCRVHNSITVNGQFPGPPLEVRNGDSLVITAI  68

Query  1926  nrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRW  1747
             N+ARYN+++HWHG+RQMR PWADGPEY+TQCPI PGG+Y+YRF IE QEGTLWWHAHSRW
Sbjct  69    NKARYNISLHWHGIRQMRNPWADGPEYITQCPIKPGGSYSYRFNIEEQEGTLWWHAHSRW  128

Query  1746  LRATVYGAFIIYPK-SGSHFPFS-QPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             LRATVYGA II P  S  H+PF   PK++  +LLGEWW+R+ + +    QFTGAAPN+S+
Sbjct  129   LRATVYGALIIRPPLSSPHYPFPVLPKREFTLLLGEWWDRNPMDVLNLAQFTGAAPNVSD  188

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             A+TINGQPGD YRCSSQ+T++F V  GETVLLRVIN+ALNQ+LFF VANHKL VV ADA+
Sbjct  189   AFTINGQPGDFYRCSSQETLRFLVGSGETVLLRVINSALNQELFFGVANHKLTVVAADAS  248

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN-  1216
             Y KPFTTNVIM+GPGQTT+VLLTADQPPA YYMAA AY +A    FDNTTTTA+L+Y + 
Sbjct  249   YTKPFTTNVIMLGPGQTTDVLLTADQPPAHYYMAAHAYNSANAP-FDNTTTTAILQYKDA  307

Query  1215  --LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLG  1051
               +   + +  +  QLP FNDTATA AFT Q++S     P+    P   +E LFFTVGLG
Sbjct  308   PCVTSKSQAGAIPAQLPGFNDTATAAAFTAQMKS-----PSKVEVPLEIEEDLFFTVGLG  362

Query  1050  LVNCTPGP---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTLDFPPVPP  883
             L NC P P   RCQGPN TRF AS+NNVSFV P+R S++QAYY   P G++T DFPPVPP
Sbjct  363   LFNC-PTPNTQRCQGPNGTRFTASINNVSFVFPKRNSIMQAYYQGTPAGVFTTDFPPVPP  421

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
               FDYTGNVSR LWQP  GTK YK+KY S+VQV+LQDT+I TTE+HP+HLHGY F+VVG 
Sbjct  422   TTFDYTGNVSRGLWQPTRGTKAYKLKYKSKVQVILQDTSIVTTENHPMHLHGYEFYVVGT  481

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             G GNFN   DT  FNL+DPP RNTI  P GGW  IRF ADNPGVWLMHCH+DSH+ WGLA
Sbjct  482   GIGNFNANKDTPSFNLIDPPRRNTIGTPPGGWIAIRFVADNPGVWLMHCHLDSHILWGLA  541

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG+G  Q+V+ PPLDLP+C
Sbjct  542   MVFLVENGEGHLQSVQSPPLDLPQC  566



>ref|XP_003544045.1| PREDICTED: laccase-5-like [Glycine max]
Length=569

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/565 (65%), Positives = 443/565 (78%), Gaps = 9/565 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             FLA   V+ + L S ANA +   EFV+Q T + RLC T + ITVNGQFPGPT+ V NGD 
Sbjct  8     FLAIFVVLASALYS-ANAKIQEHEFVIQATPVKRLCNTHSTITVNGQFPGPTLEVNNGDT  66

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWW
Sbjct  67    LVVKVTNKARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGESYTYRFTIQGQEGTLWW  126

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II+P+ G  +PF++PK++ PILLGEWW+ + I + RQ   TGAAP
Sbjct  127   HAHSSWLRATVYGALIIHPREGEAYPFTKPKRETPILLGEWWDANPIDVVRQATQTGAAP  186

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N S+AYTINGQPGDLY+CSSQ T    +  GET LLRVINAALNQ LFF+VANHKL VVG
Sbjct  187   NTSDAYTINGQPGDLYKCSSQGTTIVPIDSGETNLLRVINAALNQPLFFTVANHKLTVVG  246

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTTNVIM+GPGQTT+VL+  DQPP RYYMAARAY +AQNAPFDNTTTTA+LE
Sbjct  247   ADASYLKPFTTNVIMLGPGQTTDVLIQGDQPPTRYYMAARAYQSAQNAPFDNTTTTAILE  306

Query  1224  YTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGL  1054
             Y +      G++ +P+MP LP +NDT T TAF+   RS       V  + D++LFFT+GL
Sbjct  307   YKSAPCPTKGSSIKPVMPSLPAYNDTNTVTAFSKSFRS--PRKVEVPAEIDDNLFFTIGL  364

Query  1053  GLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             GL NC       +CQGPN TRF ASMNNVSFVLP   S+LQA++  + G++T DFP  PP
Sbjct  365   GLNNCPKNFNANQCQGPNGTRFTASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPP  424

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             V+FDYTGNVSR+LWQP  GTK+ K+K+GSRVQ+VLQDT+I T E+HPIHLHGY F++V +
Sbjct  425   VKFDYTGNVSRSLWQPVQGTKVTKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAE  484

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNF+P  DT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPG W+MHCH+D H+ WGLA
Sbjct  485   GFGNFDPNKDTSKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLA  544

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
                +V+NG G  Q++EPPP DLP C
Sbjct  545   TVLLVDNGVGLLQSIEPPPEDLPLC  569



>ref|XP_009386858.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=572

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/546 (66%), Positives = 436/546 (80%), Gaps = 5/546 (1%)
 Frame = -3

Query  2076  NADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIH  1897
             +A+V   +FVVQ T + RLCK   IITVNGQFPGPTI V+NGD +V+ VVNRARYNVT+H
Sbjct  29    DAEVQYHDFVVQATPVKRLCKAHNIITVNGQFPGPTIEVKNGDTLVINVVNRARYNVTLH  88

Query  1896  WHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFI  1717
             WHG+RQMRT WADGPE+VTQCPI PGG+YTYRF IE QEGTLWWHAHS WLRATVYGA I
Sbjct  89    WHGVRQMRTAWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGALI  148

Query  1716  IYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLY  1537
             I PK  S +PF++PK+++P++LGEWW+R+ I + R+   TGAAPNIS+A+TINGQPGDLY
Sbjct  149   ILPKENSSYPFTKPKREVPVILGEWWDRNPIDVVREATRTGAAPNISDAFTINGQPGDLY  208

Query  1536  RCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMV  1357
              CS++DT    V  GET LLR INAALN +LF ++ANHK+ VV ADA+Y KPFTT+V+M+
Sbjct  209   NCSNKDTTMIPVKAGETNLLRFINAALNTELFVAIANHKMTVVSADASYTKPFTTSVLML  268

Query  1356  GPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYT--NLRPGANSRPLM  1183
             GPGQTT+VL+T DQP +RYY+AARAYA+AQ   FDNTTTTA+LEY      PG    P+ 
Sbjct  269   GPGQTTDVLVTMDQPASRYYIAARAYASAQGVAFDNTTTTAILEYDCGCSEPGQGVPPVF  328

Query  1182  PQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNT  1003
             P LP +NDT  A+AF+  LRS+ + +  +    DE+LFFTVGLGL  C PG  C GPNNT
Sbjct  329   PALPAYNDTGAASAFSAGLRSLSTVD--IPGPVDENLFFTVGLGLFGCPPGKTCGGPNNT  386

Query  1002  RFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPSG  826
             R AAS+NNVSFVLP   S+LQA+Y  +PG++T DFP VPPVQFDYT  NVSR+LWQP + 
Sbjct  387   RMAASINNVSFVLPDSYSILQAHYQRVPGVFTTDFPAVPPVQFDYTAQNVSRSLWQPVAA  446

Query  825   TKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDP  646
             TK+YK+KYGS VQ+VLQ T IF  E+HPIH+HGY F+++ +GFGNFN   D AKFNLVDP
Sbjct  447   TKVYKLKYGSVVQLVLQGTNIFAAENHPIHIHGYDFYILAEGFGNFNAAKDNAKFNLVDP  506

Query  645   PVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPP  466
             P+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+V++G GE Q++E PP
Sbjct  507   PMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVDDGVGELQSLEAPP  566

Query  465   LDLPRC  448
             +DLP C
Sbjct  567   VDLPAC  572



>ref|XP_010452444.1| PREDICTED: laccase-12-like [Camelina sativa]
Length=565

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/551 (68%), Positives = 439/551 (80%), Gaps = 8/551 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             AS   A V + +FV+QET + RLCKT+  ITVNG FPGPT+ V NGD + VKV NRARYN
Sbjct  19    ASSTIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVHNRARYN  78

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             +TIHWHG+RQ+RT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVY
Sbjct  79    ITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  138

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA II+P  GS FPF +P +   ++LGEWWN + + +  Q   TGAAPNIS+AYTINGQP
Sbjct  139   GALIIHPTPGSSFPFPKPDRQTALVLGEWWNANPVDVINQAIRTGAAPNISDAYTINGQP  198

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLY CS+++TV   ++ GET LLRVINAALNQ LFFSVANHKL VVGADA+Y KPFTT 
Sbjct  199   GDLYNCSTKETVVVPINSGETSLLRVINAALNQPLFFSVANHKLTVVGADASYLKPFTTK  258

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRP  1189
             V+M+GPGQTT+VLLTADQ P RYY+AARAY +AQNAPFDNTTTTA+L+Y   +   +S P
Sbjct  259   VLMLGPGQTTDVLLTADQQPKRYYIAARAYQSAQNAPFDNTTTTAILQYK--KTTTSSPP  316

Query  1188  LMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT---PGPRCQ  1018
             ++P LP FNDT T T+F+ + +S+   N  V    D+ LFFTVGLGL NC    P  RCQ
Sbjct  317   ILPVLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDDDLFFTVGLGLDNCPKNFPKSRCQ  374

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALW  841
             G N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPV+FDYTG N+SRAL+
Sbjct  375   GLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISRALF  434

Query  840   QPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKF  661
             QP  GTKLY +KYGSRVQVVLQDT I T+E+HPIHLHGY F++VG+GFGNFNP+ DT+KF
Sbjct  435   QPVKGTKLYNLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFNPKKDTSKF  494

Query  660   NLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQT  481
             NLVDPP+RNT+ V V GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+V+NG GE +T
Sbjct  495   NLVDPPLRNTVAVLVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVDNGVGELET  554

Query  480   VEPPPLDLPRC  448
             +E PP DLP C
Sbjct  555   LEAPPHDLPVC  565



>ref|XP_006367545.1| PREDICTED: laccase-5-like [Solanum tuberosum]
Length=574

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/580 (63%), Positives = 438/580 (76%), Gaps = 12/580 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             MD   N   N  C  F      +L V  + + A+ +  +FV+Q T + RLCK    ITVN
Sbjct  1     MDHACNRIANTLCYFFF---IAILLVFINASTAETHYHDFVIQATPVKRLCKIHNTITVN  57

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQFPGPT+ V NGD +V+ VVNRARYNVTIHWHG++Q+RT WADGPE++TQCPI PGG+Y
Sbjct  58    GQFPGPTLEVNNGDTLVINVVNRARYNVTIHWHGIKQIRTAWADGPEFITQCPIRPGGSY  117

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYRF I+ QEGTLWWHAHS WLRATVYGA IIYPK G  +PFS+PK++ PILLGEWW+ +
Sbjct  118   TYRFTIQGQEGTLWWHAHSSWLRATVYGALIIYPKEGEFYPFSKPKRETPILLGEWWDAN  177

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              I + RQ   TGAAPN+S+AYTINGQPGDLYRCSS+DT    V  GET LLRVINAALNQ
Sbjct  178   PIDVVRQATRTGAAPNVSDAYTINGQPGDLYRCSSKDTTVVIVDSGETNLLRVINAALNQ  237

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
              LFF+VANHKL VV ADA+Y +PFTT+V+M+GPGQTT+VL+  +Q P   Y  A     +
Sbjct  238   ALFFAVANHKLTVVAADASYVQPFTTSVLMLGPGQTTDVLIDGNQ-PPGRYYIAVRAYAS  296

Query  1269  qnaPFDNTTTTAVLEYTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPT  1099
                PFDNTT+TA+LEY +      G    P+ P LP FNDTATAT F+T  RS       
Sbjct  297   AQGPFDNTTSTAILEYKDTPCSVQGIKINPIFPSLPAFNDTATATTFSTSFRS--PRQVE  354

Query  1098  VFNQPDESLFFTVGLGLVNCTPGP---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYN  928
             V  + DE+LFFTVGLGL NC  G     CQGPN TRF ASMNN+SFVLP   S+LQA++ 
Sbjct  355   VPTEIDENLFFTVGLGLNNCPRGSSSRSCQGPNGTRFTASMNNMSFVLPPNFSILQAHHQ  414

Query  927   NIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTED  748
              IPG+++ DFP VPP++FDYTGNVSR+LWQP  GTK+YK+KYG+RVQVVLQ T+I T E+
Sbjct  415   GIPGVFSTDFPAVPPLKFDYTGNVSRSLWQPIRGTKVYKLKYGARVQVVLQGTSIVTGEN  474

Query  747   HPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVW  568
             HPIHLHGY F+++ +GFGNFNPQTDTAKFNLVDPP RNT  VPV GW+VIRF A+NPGVW
Sbjct  475   HPIHLHGYDFYIIAEGFGNFNPQTDTAKFNLVDPPTRNTASVPVNGWSVIRFVANNPGVW  534

Query  567   LMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LMHCH+D H+ WGLAM+F+VENG  E +++E PP+DLP C
Sbjct  535   LMHCHLDVHITWGLAMSFLVENGVSELESLEEPPVDLPVC  574



>gb|KDO50911.1| hypothetical protein CISIN_1g039963mg [Citrus sinensis]
Length=578

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/583 (63%), Positives = 451/583 (77%), Gaps = 14/583 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             MD     ++ P+ +  L  +  +   +ASL++A++   EF+ +   + RLC+T   +TVN
Sbjct  1     MDIPALITVKPWSSCLLLGVLFIFAFVASLSHAEIQFHEFI-EAKPVKRLCRTHNTVTVN  59

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQFPGPT+ VR+GD +++  +NRA+YN+T+HWHG+     PWADGPEYVTQCPI PG +Y
Sbjct  60    GQFPGPTLQVRDGDTLIITTINRAQYNITLHWHGVNLKGNPWADGPEYVTQCPIQPGRSY  119

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TY+F IE QEGTLWWHAHSRW+RATVYGA IIYP+ GS +PF  P ++IPILLGEWW+++
Sbjct  120   TYQFTIEGQEGTLWWHAHSRWIRATVYGAIIIYPRIGSSYPFPVPNREIPILLGEWWDKN  179

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              + +  Q  FTGAAPN+S+A+TINGQPGDLYRCS ++TV+F V  GETVLLR+INAA+NQ
Sbjct  180   PMDVLMQAIFTGAAPNVSDAFTINGQPGDLYRCSRRETVRFQVEAGETVLLRIINAAMNQ  239

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             +LFF VANH L VVG D +Y K F+T+VIM+ PGQTTNVLLTADQPPARYYMAARAY +A
Sbjct  240   ELFFGVANHNLTVVGVDTSYTKAFSTSVIMIAPGQTTNVLLTADQPPARYYMAARAYNSA  299

Query  1269  qnaPFDNTTTTAVLEY----TNLRPGAN--SRPLMPQLPFFNDtatataftTQLRSVPSN  1108
               A FDNTTTTA+L Y     N + G +  S P+ P LP FNDTATATA+T Q+RS+   
Sbjct  300   NVA-FDNTTTTAILAYKSAPCNAKNGGSNSSAPVFPTLPGFNDTATATAYTAQIRSLHEV  358

Query  1107  N-PTVFNQPDESLFFTVGLGLVNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQA  937
               PTV    DE LFFTVGLGL+NC+    PRCQGPN TRFAAS+NNVSF  P   SL+QA
Sbjct  359   KVPTVI---DEDLFFTVGLGLINCSNPNSPRCQGPNGTRFAASINNVSFEFPTGNSLMQA  415

Query  936   YYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFT  757
             Y+ + PG++T DFPPVPP++FDYTGNVSR LWQP  GTKLYK+K+GS VQ+V QDT+I T
Sbjct  416   YFQDQPGVFTTDFPPVPPIKFDYTGNVSRVLWQPLKGTKLYKLKFGSSVQLVWQDTSIVT  475

Query  756   TEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNP  577
              EDHP+HLHG+ F+VVG GFGNFNP TDT KFNL+DPP RNTI +P GGW  IRF A+NP
Sbjct  476   VEDHPMHLHGHEFYVVGSGFGNFNPSTDTPKFNLIDPPRRNTIGMPPGGWVAIRFVANNP  535

Query  576   GVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             G+W MHCH+DSHL WGLAMAF+VENG  E Q V+ PPLDLP C
Sbjct  536   GIWFMHCHLDSHLTWGLAMAFLVENGDEELQAVQSPPLDLPPC  578



>gb|KHN04792.1| Laccase-5 [Glycine soja]
Length=587

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/575 (65%), Positives = 450/575 (78%), Gaps = 21/575 (4%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
              LA +FV+  +LAS ANA ++  EFVV+ T + RLCKT   ITVNGQ+PGPT+ + NGD 
Sbjct  18    LLALIFVL--ILAS-ANAKIHEHEFVVEATPVKRLCKTHNSITVNGQYPGPTLEINNGDT  74

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF ++ QEGTLWW
Sbjct  75    LVVKVTNKARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWW  134

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II P+ G  +PF +PK + PILLGEWW+ + I + RQ   TG AP
Sbjct  135   HAHSSWLRATVYGALIIRPREGEPYPFPKPKHETPILLGEWWDANPIDVVRQATRTGGAP  194

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLY+CSS+DT    +  GET LLRVINAALNQ LFF+VANHKL VVG
Sbjct  195   NVSDAYTINGQPGDLYKCSSKDTTIVPIHSGETNLLRVINAALNQPLFFTVANHKLTVVG  254

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTT V+M+GPGQTT+VL+T DQPP+RYYMAARAY +AQNA FDNTTTTA+LE
Sbjct  255   ADASYLKPFTTKVLMLGPGQTTDVLITGDQPPSRYYMAARAYQSAQNAAFDNTTTTAILE  314

Query  1224  YT---------NLRPGA---NSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPD  1081
             Y          +   GA    ++P+MP LP +NDT T TAF+   RS       V ++ D
Sbjct  315   YKSPHHSNHSHHHSKGALKKKTKPIMPSLPAYNDTNTVTAFSKSFRS--PRKVEVPDEID  372

Query  1080  ESLFFTVGLGLVNCTP--GP-RCQGP-NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGI  913
             +SLFFTVGLG+  C    GP RCQGP N TRF ASMNNVSFVLP   S+LQA++  IPG+
Sbjct  373   QSLFFTVGLGINKCPKNFGPKRCQGPINGTRFTASMNNVSFVLPNNVSILQAHHLGIPGV  432

Query  912   YTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHL  733
             +T DFP  PPV+FDYTGNVSR+LWQP  GTK +K+K+GSRVQ+VLQDT+I T E+HPIHL
Sbjct  433   FTTDFPGKPPVKFDYTGNVSRSLWQPVPGTKAHKLKFGSRVQIVLQDTSIVTPENHPIHL  492

Query  732   HGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCH  553
             HGY F++V +GFGNF+ + DTAKFNLVDPP+RNT+ VPV GWAVIRF ADNPG WL+HCH
Sbjct  493   HGYDFYIVAEGFGNFDAKKDTAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLLHCH  552

Query  552   IDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +D H+ WGLA   +VENG G+ Q++EPPPLDLP C
Sbjct  553   LDVHIGWGLATVLLVENGVGKLQSIEPPPLDLPLC  587



>emb|CDX93188.1| BnaC04g47080D [Brassica napus]
Length=569

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/559 (65%), Positives = 446/559 (80%), Gaps = 7/559 (1%)
 Frame = -3

Query  2109  FVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             F +L +  S+A A+  ++ EF++Q TK+ RLC+T   ITVNG FPGP + + NGD +VVK
Sbjct  13    FAVLLLFTSMAEANRAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVINNGDTLVVK  72

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+NRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  73    VINRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHS  132

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYG+ +I P +GS +PF  P +++P+LLGEWW+ + + + R+   TGAAPNIS+
Sbjct  133   SWLRATVYGSLLILPPAGSSYPFPNPHRNVPLLLGEWWDGNPVDVLREATRTGAAPNISD  192

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CSSQDT    +S GET+LLRVINAALNQ LFF+VANHK  VVGADA+
Sbjct  193   AYTINGQPGDLYKCSSQDTTIVPISVGETILLRVINAALNQPLFFTVANHKFTVVGADAS  252

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTTN I++GPGQTT+VL+T DQPP  YYMAARAY +AQNAPF NTTTTA+L+Y + 
Sbjct  253   YLKPFTTNAIVLGPGQTTDVLITGDQPPNHYYMAARAYQSAQNAPFGNTTTTAILQYKSA  312

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP  1033
                  ++P+MP LP +NDT TAT F+   RS+      V  + DE+LF T+GLGL NC  
Sbjct  313   PCCGGAKPIMPLLPAYNDTNTATRFSQSFRSL--KRAEVPPELDENLFITIGLGLNNCPK  370

Query  1032  ---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
                  RCQGPN TRF ASMNNVSF LP   SLLQA++++IPG++T DFP  PPV+FDYTG
Sbjct  371   NFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHSIPGVFTTDFPARPPVKFDYTG  430

Query  861   -NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFN  685
              N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHGY F++V +GFGNFN
Sbjct  431   SNISRSLYQPVRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNFN  490

Query  684   PQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVE  505
             P+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D+H++WGLAMAF+VE
Sbjct  491   PKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLVE  550

Query  504   NGQGEKQTVEPPPLDLPRC  448
             NG G  +T+E PP DLP C
Sbjct  551   NGSGLLETMEEPPADLPVC  569



>ref|XP_003519418.1| PREDICTED: laccase-5-like [Glycine max]
Length=569

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/565 (65%), Positives = 442/565 (78%), Gaps = 9/565 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             FLA   V+ + L S+ NA +   EFV+Q T + RLC T   ITVNGQFPGPT+ V NGD 
Sbjct  8     FLALSVVLASALYSV-NAKIQEHEFVIQATPVKRLCNTHNTITVNGQFPGPTLEVNNGDT  66

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWW
Sbjct  67    LVVKVTNKARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGESYTYRFTIQGQEGTLWW  126

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II+P+ G  +PF++PK++ PILLGEWW+ + I + RQ   TGAAP
Sbjct  127   HAHSSWLRATVYGALIIHPREGEAYPFTKPKRETPILLGEWWDANPIDVVRQATQTGAAP  186

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             NIS+AYTINGQPGDLY+CSSQ +    +  GET LLRVINAALNQ LFF VANHKL VVG
Sbjct  187   NISDAYTINGQPGDLYKCSSQGSTIVPIDSGETNLLRVINAALNQPLFFKVANHKLTVVG  246

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTTNVIM+GPGQTT+VL+  DQPP RYYMAARAY +AQNAPFDNTTTTA+LE
Sbjct  247   ADASYLKPFTTNVIMLGPGQTTDVLIQGDQPPTRYYMAARAYQSAQNAPFDNTTTTAILE  306

Query  1224  YTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGL  1054
             Y +      G++ +P+MP LP +NDT T TAF+   RS       V  + DE+LFFT+GL
Sbjct  307   YKSAPCPAKGSSIKPVMPSLPAYNDTNTVTAFSKSFRS--PRKVEVPAEIDENLFFTIGL  364

Query  1053  GLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             GL NC       +CQGPN TRF ASMNNVSFVLP   S+LQA++  + G++T DFP  PP
Sbjct  365   GLNNCPKNFNANQCQGPNGTRFTASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPP  424

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             V+FDYTGNVSR+LWQP  GTK+ K+K+GSRVQ+VLQDT+I T E+HPIHLHGY F++V +
Sbjct  425   VKFDYTGNVSRSLWQPVPGTKVTKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAE  484

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNF+P  DT+KFNL+DPP+RNT+ VPV GWAVIRF ADNPG W+MHCH+D H+ WGLA
Sbjct  485   GFGNFDPNKDTSKFNLIDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLA  544

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
                +V+NG G  Q++EPPP DLP C
Sbjct  545   TVLLVDNGVGLLQSIEPPPEDLPLC  569



>ref|XP_003538485.1| PREDICTED: laccase-5-like [Glycine max]
Length=587

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/575 (65%), Positives = 448/575 (78%), Gaps = 21/575 (4%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
              LA +FV+  +LAS ANA ++  EFVV+ T + RLCKT   ITVNGQ+PGPT+ + NGD 
Sbjct  18    LLAMIFVL--ILAS-ANAKIHEHEFVVEATPVKRLCKTHNSITVNGQYPGPTLEINNGDT  74

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF ++ QEGTLWW
Sbjct  75    LVVKVTNKARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWW  134

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II P+ G  +PF +PK + PILLGEWW+ + I + RQ   TG AP
Sbjct  135   HAHSSWLRATVYGALIIRPREGEPYPFPKPKHETPILLGEWWDANPIDVVRQATRTGGAP  194

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLY+CSS+DT    +  GET LLRVINAALNQ LFF+VANHKL VVG
Sbjct  195   NVSDAYTINGQPGDLYKCSSKDTTIVPIHSGETNLLRVINAALNQPLFFTVANHKLTVVG  254

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTT V+M+GPGQTT+VL+T DQPP+ YYMAARAY +AQNA FDNTTTTA+LE
Sbjct  255   ADASYLKPFTTKVLMLGPGQTTDVLITGDQPPSPYYMAARAYQSAQNAAFDNTTTTAILE  314

Query  1224  YT---------NLRPGA---NSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPD  1081
             Y          +   GA    ++P+MP LP +NDT T TAF+   RS       V  + D
Sbjct  315   YKSPHHSNHSHHHSKGALKKKTKPIMPSLPAYNDTNTVTAFSKSFRS--PRKVEVPAEID  372

Query  1080  ESLFFTVGLGLVNCTP--GP-RCQGP-NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGI  913
             +SLFFTVGLG+  C    GP RCQGP N TRF ASMNNVSFVLP   S+LQA++  IPG+
Sbjct  373   QSLFFTVGLGINKCPKNFGPKRCQGPINGTRFTASMNNVSFVLPNNVSILQAHHLGIPGV  432

Query  912   YTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHL  733
             +T DFP  PPV+FDYTGNVSR+LWQP  GTK +K+K+GSRVQ+VLQDT+I T E+HPIHL
Sbjct  433   FTTDFPGKPPVKFDYTGNVSRSLWQPVPGTKAHKLKFGSRVQIVLQDTSIVTPENHPIHL  492

Query  732   HGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCH  553
             HGY F++V +GFGNF+ + DTAKFNLVDPP+RNT+ VPV GWAVIRF ADNPG WL+HCH
Sbjct  493   HGYDFYIVAEGFGNFDAKKDTAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLLHCH  552

Query  552   IDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +D H+ WGLA   +VENG G+ Q++EPPPLDLP C
Sbjct  553   LDVHIGWGLATVLLVENGVGKLQSIEPPPLDLPLC  587



>ref|XP_010423473.1| PREDICTED: laccase-12 [Camelina sativa]
Length=565

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/559 (67%), Positives = 443/559 (79%), Gaps = 8/559 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             LF    + AS + A V + +FV+QET + RLCKT+  ITVNG FPGPT+ V NGD + VK
Sbjct  11    LFFCSLLSASSSIAKVQHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVK  70

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V NRARYN+TIHWHG+RQ+RT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  71    VHNRARYNITIHWHGVRQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHS  130

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II+P  GS FPF +P +   ++LGEWWN + + +  Q   TGAAPNIS+
Sbjct  131   SWLRATVYGALIIHPTPGSSFPFPKPDRQTALVLGEWWNANPVDVINQAIRTGAAPNISD  190

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY CS+++TV   ++ GET LLRVINAALNQ LFFSVANHKL VVGADA+
Sbjct  191   AYTINGQPGDLYNCSTKETVVVPINSGETSLLRVINAALNQPLFFSVANHKLTVVGADAS  250

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT V+M+GPGQTT+VLLTADQ P RYY+AARAY +AQNAPFDNTTTTA+L+Y N 
Sbjct  251   YLKPFTTKVLMLGPGQTTDVLLTADQQPKRYYIAARAYQSAQNAPFDNTTTTAILQYKNT  310

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT-  1036
                 +S P++P LP FNDT T T+F+ + +S+   N  V    D+ LFFTVGLGL NC  
Sbjct  311   T--TSSPPILPVLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDDDLFFTVGLGLDNCPK  366

Query  1035  --PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
               P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPV+FDYTG
Sbjct  367   NFPKSRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTG  426

Query  861   -NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFN  685
              N+SRAL+QP   TKLY +KYGSRVQVVLQDT I T+E+HPIHLHGY F++VG+GFGNFN
Sbjct  427   NNISRALFQPVKSTKLYNLKYGSRVQVVLQDTNIVTSENHPIHLHGYDFYIVGEGFGNFN  486

Query  684   PQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVE  505
             P+ DT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+V+
Sbjct  487   PKKDTSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVD  546

Query  504   NGQGEKQTVEPPPLDLPRC  448
             NG GE +T+E PP DLP C
Sbjct  547   NGVGELETLEAPPHDLPVC  565



>ref|XP_008799813.1| PREDICTED: laccase-3 [Phoenix dactylifera]
Length=573

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/550 (65%), Positives = 447/550 (81%), Gaps = 6/550 (1%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             S   A+V+  +FVVQ T + RLCKT  IITVNGQ+PGPT+ V+NGD +V+ VVNRA YNV
Sbjct  26    SHTKAEVHYHDFVVQATPVKRLCKTHNIITVNGQYPGPTLEVKNGDTLVINVVNRASYNV  85

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             T+HWHG+RQMRT WADGPE VTQCPI PGG+YTYRF IE QEGTLWWHAHS WLRATVYG
Sbjct  86    TLHWHGVRQMRTAWADGPEMVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYG  145

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A II+PK  + +PF++P ++IPILLGEWW+ + I + R+   TGAAPNIS+A+TINGQPG
Sbjct  146   ALIIHPKENTSYPFAKPAREIPILLGEWWDANPIDVVREATRTGAAPNISDAFTINGQPG  205

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DLY CSS+DT    V+PG+T LLR+INAALN +LFF++A H++ VVGADA+Y KPFTT+V
Sbjct  206   DLYNCSSKDTTVIPVAPGDTNLLRIINAALNTELFFAIAGHQMTVVGADASYTKPFTTSV  265

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---TNLRPGANS  1195
             +M+GPGQTT+VL++ DQPP+RYYMAARAYA+AQ  PFDNTTTTA+L+Y    + +PG   
Sbjct  266   VMLGPGQTTDVLVSMDQPPSRYYMAARAYASAQGVPFDNTTTTAILDYDCGCSAKPGQGI  325

Query  1194  RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQG  1015
             +P  P LP +NDTATATAF+T LRS+  N  ++ +  DE+LFFTVGLGL NC PG  C G
Sbjct  326   QPAFPNLPAYNDTATATAFSTGLRSL--NKVSIPSPVDENLFFTVGLGLFNCPPGKTCGG  383

Query  1014  PNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQ  838
             PN TRF AS+NN+SFVLP   S+LQA+++ + G++T DFP  PPVQF YT  NV+RALWQ
Sbjct  384   PNGTRFGASVNNISFVLPASFSILQAHHHGVAGVFTTDFPANPPVQFHYTATNVTRALWQ  443

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P + TK+YK++YGS VQ+VLQ T+IF  E+HPIH+HGY F+++ +GFGNF+   DTAKFN
Sbjct  444   PVAATKVYKLRYGSVVQLVLQGTSIFAAENHPIHIHGYDFYILAEGFGNFDAAKDTAKFN  503

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             LVDPP++NT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++
Sbjct  504   LVDPPMKNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVGELQSL  563

Query  477   EPPPLDLPRC  448
             EPPP DLP C
Sbjct  564   EPPPADLPVC  573



>ref|XP_010087027.1| hypothetical protein L484_012271 [Morus notabilis]
 gb|EXB25845.1| hypothetical protein L484_012271 [Morus notabilis]
Length=571

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/552 (66%), Positives = 435/552 (79%), Gaps = 12/552 (2%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             A    ++ +FV+Q T + RLCKT   ITVNGQFPGPT+ V NGD +V+K+ N+ARYNVTI
Sbjct  24    AGGKTHHHDFVIQATPVKRLCKTHNSITVNGQFPGPTLEVNNGDTLVIKITNKARYNVTI  83

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQ+R+ WADGPE+VTQCPI PGG+YTYRF IE QEGTLWWHAHS WLRATVYGA 
Sbjct  84    HWHGIRQLRSGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGAL  143

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             II P+ G  +PF +PK++ PILLGEWW+ + I + RQ   TGAAPN SNA+TINGQPGDL
Sbjct  144   IIRPREGESYPFQKPKRETPILLGEWWDANPIDVVRQATRTGAAPNNSNAFTINGQPGDL  203

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y CSS+DTV   +  GET LLRVINAALNQ LFF +ANHKL VV ADA+Y KPFTT+V+M
Sbjct  204   YNCSSKDTVVVPIEVGETNLLRVINAALNQPLFFKIANHKLTVVSADASYTKPFTTDVLM  263

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPG----ANSR  1192
             +GPGQTT+VL+T DQPPAR+Y+AARAY +A  + FDNTTTTA+L+Y +        A ++
Sbjct  264   LGPGQTTDVLITGDQPPARFYIAARAYQSASAS-FDNTTTTAILQYKSAPCSSTNCAATK  322

Query  1191  PLMPQLPFFNDtatataftTQLRS-VPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPR  1024
             P+MPQLP FNDTAT TAF+   RS  P   PT     DE+LFFT+GLGL  C       R
Sbjct  323   PVMPQLPAFNDTATVTAFSRSFRSPRPVEVPTDI---DENLFFTIGLGLNRCPTKFNSRR  379

Query  1023  CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRAL  844
             CQGPN TRFA+SMNNVSFVLP   S+LQA+   IPG++T DFP  PPV+FDYTGNVSR+L
Sbjct  380   CQGPNGTRFASSMNNVSFVLPSTISILQAFQQRIPGVFTADFPANPPVKFDYTGNVSRSL  439

Query  843   WQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAK  664
             WQP  GTK Y++KYGSRVQ+VLQDT I T E+HPIHLHGY F++V +GFGNFNP+TDT K
Sbjct  440   WQPVPGTKGYRLKYGSRVQIVLQDTNIVTPENHPIHLHGYDFYIVAEGFGNFNPKTDTKK  499

Query  663   FNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQ  484
             FNLVDPP+RNT+ VP  GWAVIRF ADNPG WLMHCH+D H+ WGLAM F+V+NG GE Q
Sbjct  500   FNLVDPPLRNTVAVPANGWAVIRFVADNPGAWLMHCHLDVHITWGLAMVFLVDNGVGELQ  559

Query  483   TVEPPPLDLPRC  448
             T++PPP DLP C
Sbjct  560   TMQPPPEDLPLC  571



>ref|XP_007163585.1| hypothetical protein PHAVU_001G246700g [Phaseolus vulgaris]
 gb|ESW35579.1| hypothetical protein PHAVU_001G246700g [Phaseolus vulgaris]
Length=580

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/574 (64%), Positives = 442/574 (77%), Gaps = 17/574 (3%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             FLA   +  +   S A A ++  EF+V+ T + RLCKT   ITVNGQFPGPT+ + NGD 
Sbjct  9     FLAIFLLFTSPFMSSAYAKIHAHEFLVEATPVKRLCKTHNAITVNGQFPGPTLEINNGDT  68

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF ++ QEGTLWW
Sbjct  69    LVVKVTNKARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWW  128

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA II P+ G  +PF +P  + PILLGEWW+ + I + R+ + TG AP
Sbjct  129   HAHSSWLRATVYGALIIRPREGELYPFPKPNHETPILLGEWWDANPIDVVREARRTGGAP  188

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLY+CS++DT    +  GET LLRVINAALNQ LFF+VANHKL VVG
Sbjct  189   NVSDAYTINGQPGDLYKCSTKDTSIVPIHGGETNLLRVINAALNQPLFFTVANHKLTVVG  248

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTT V+M+GPGQTT+VL+T DQPP+RYYMAARAY +AQNA FDNTTTTA+LE
Sbjct  249   ADASYLKPFTTKVLMLGPGQTTDVLITGDQPPSRYYMAARAYQSAQNAAFDNTTTTAILE  308

Query  1224  YTNLRPGA------------NSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPD  1081
             Y +L  G              ++P+MP LP +NDT T TAF+   RS       V  + D
Sbjct  309   YKSLHHGNHSKHHHSKGVKNKTKPIMPPLPAYNDTNTVTAFSKSFRS--PRKVEVPAEID  366

Query  1080  ESLFFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIY  910
             +SLFFTVGLGL  C       RCQGPN TRF ASMNNVSFVLP   S+LQA+Y+  PG++
Sbjct  367   QSLFFTVGLGLNKCPKNFKANRCQGPNGTRFTASMNNVSFVLPNNVSILQAHYHRTPGVF  426

Query  909   TLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLH  730
             T DFP  PPV+FDYTGNVSR+LWQP  GTK +K+K+GSRV++VLQDT+I T E+HPIHLH
Sbjct  427   TTDFPGKPPVKFDYTGNVSRSLWQPIPGTKAHKLKFGSRVEIVLQDTSIVTPENHPIHLH  486

Query  729   GYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHI  550
             GY F++V +GFGNF+P+ D AKFNLVDPP+RNT+ VPV GWAVIRF ADNPG WLMHCH+
Sbjct  487   GYDFYIVAEGFGNFDPKKDRAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLMHCHL  546

Query  549   DSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             D H+ WGLA   +VENG G+ Q++EPPPLDLP C
Sbjct  547   DVHIGWGLATVLLVENGVGKLQSIEPPPLDLPLC  580



>ref|XP_010543702.1| PREDICTED: laccase-12 [Tarenaya hassleriana]
Length=575

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/553 (66%), Positives = 445/553 (80%), Gaps = 14/553 (3%)
 Frame = -3

Query  2070  DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWH  1891
             +V++ +FV+QET + RLCKT+ +ITVNG FPGPT+ V NGD +VVKVVNRA++NVTIHWH
Sbjct  25    EVHHHDFVIQETPVKRLCKTQNVITVNGMFPGPTLEVNNGDTLVVKVVNRAQHNVTIHWH  84

Query  1890  GLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIY  1711
             G+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVYGA +I+
Sbjct  85    GVRQMRTGWADGPEFVTQCPIRPGNSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALLIH  144

Query  1710  PKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRC  1531
             P   S +PF +P +   +LLGEWWN + I + ++   TGAAPN+S+AYT+NGQPGDLY C
Sbjct  145   PPPASSYPFPKPDRQTTLLLGEWWNANPIDVLKEAIRTGAAPNVSDAYTVNGQPGDLYNC  204

Query  1530  SSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGP  1351
             S+QDT+      GET L+RVIN+A+NQ LFF+VANHKL VVGADA+Y KPF+TNVIM+GP
Sbjct  205   SNQDTIVVPTGSGETSLIRVINSAMNQPLFFTVANHKLTVVGADASYLKPFSTNVIMLGP  264

Query  1350  GQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSR-------  1192
             GQTT+VLLTADQPP RYYMAARAY +AQNAPFDNTTTTA+L+Y +    +N         
Sbjct  265   GQTTDVLLTADQPPNRYYMAARAYQSAQNAPFDNTTTTAILQYKSSPCCSNGTAKGIKKT  324

Query  1191  -PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT---PGPR  1024
              P+MP LP FNDT + T+F+ + RS+   +  V  + DESLFFT+GLGL NC    P  R
Sbjct  325   PPIMPFLPAFNDTNSVTSFSGKFRSL--RDIVVPKEIDESLFFTIGLGLDNCPKSFPKSR  382

Query  1023  CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRA  847
             CQGPN TRF ASMNNVSFVLP   SLLQA+   IPG++T DFP  PPV+FD+TG NVSR+
Sbjct  383   CQGPNGTRFTASMNNVSFVLPSNFSLLQAHSKGIPGVFTTDFPAKPPVRFDFTGNNVSRS  442

Query  846   LWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTA  667
             L+QP  GTKLYK+KYGSRVQ+VLQDT+I T E+HPIHLHGY F++V +GFGNF+P+ DT+
Sbjct  443   LFQPVRGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPKKDTS  502

Query  666   KFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEK  487
             KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H++WGLAMAF+V+NG GE 
Sbjct  503   KFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHISWGLAMAFLVDNGSGEL  562

Query  486   QTVEPPPLDLPRC  448
             QT+E PP DLP C
Sbjct  563   QTLEAPPEDLPVC  575



>ref|XP_006411293.1| hypothetical protein EUTSA_v10016439mg [Eutrema salsugineum]
 gb|ESQ52746.1| hypothetical protein EUTSA_v10016439mg [Eutrema salsugineum]
Length=573

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/566 (64%), Positives = 448/566 (79%), Gaps = 10/566 (2%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
             L    V+L     +     ++ EF++Q TK+ RLC+T   ITVNG FPGPT+ V NGD +
Sbjct  10    LISFTVLLLFTVVVEANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNNGDTL  69

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
             VVKV+NRARYN+TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF IE QEGTLWWH
Sbjct  70    VVKVINRARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIEGQEGTLWWH  129

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHS WLRATVYG+ +I P +GS +PF  P +++P+LLGEWW+ + + + R++Q TGAAPN
Sbjct  130   AHSSWLRATVYGSILILPPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRESQRTGAAPN  189

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             IS+AYTINGQPG+LY+CSSQDT    ++ GET+LLRVINAALNQ LFF+VANHK  VVGA
Sbjct  190   ISDAYTINGQPGNLYKCSSQDTTIVPINVGETILLRVINAALNQPLFFTVANHKFTVVGA  249

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             DA+Y KPFTTNV+++GPGQTT+VL+T DQPP RYYMAARAY +AQNAPF NTTTTA+L+Y
Sbjct  250   DASYLKPFTTNVVVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQY  309

Query  1221  TNL----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGL  1054
              +       G + +P+MP LP +NDT T T F+   RS+      V  + DE+LF TVGL
Sbjct  310   KSAPCCTNKGISVKPIMPLLPAYNDTNTVTRFSQSFRSL--KRAEVPTEIDENLFVTVGL  367

Query  1053  GLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             GL NC       RCQGPN TRF ASMNNVSF LP   SLLQA+++NIPG++T DFP  PP
Sbjct  368   GLNNCPKNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHNIPGVFTTDFPAKPP  427

Query  882   VQFDYTGN-VSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVG  706
             V+FDYTG+ +SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHGY F+++ 
Sbjct  428   VKFDYTGSKISRSLYQPVRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYILA  487

Query  705   QGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGL  526
             +GFGNFNP+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D+H++WGL
Sbjct  488   EGFGNFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGL  547

Query  525   AMAFIVENGQGEKQTVEPPPLDLPRC  448
             AMAF+VE+G+G  +T+E PP DLP C
Sbjct  548   AMAFLVEDGKGLLETMEEPPADLPVC  573



>ref|XP_011015306.1| PREDICTED: laccase-12-like [Populus euphratica]
 ref|XP_011035865.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=582

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/546 (68%), Positives = 441/546 (81%), Gaps = 11/546 (2%)
 Frame = -3

Query  2058  QEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQ  1879
              +FV+Q T + RLCKT+  ITVNG FPGPT+ V NGD +VV VVN+ARYNVTIHWHG+RQ
Sbjct  39    HDFVIQATPVKRLCKTQNSITVNGMFPGPTLEVNNGDTLVVNVVNKARYNVTIHWHGVRQ  98

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT WADGPE+VTQCPI PGG+YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK G
Sbjct  99    MRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPKEG  158

Query  1698  SHFPFS-QPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQ  1522
             S +PFS QPK++  ILLGEWWN + I + R+   TG APN S+AYTINGQPGDLY CSSQ
Sbjct  159   SSYPFSKQPKRETAILLGEWWNANPIDVVREATRTGGAPNSSDAYTINGQPGDLYNCSSQ  218

Query  1521  DTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQT  1342
             DTV   +  GET LLRVINAALNQ LFF+VANHKL VVGADA+Y KPFTT+V+M+GPGQT
Sbjct  219   DTVIVPIDSGETNLLRVINAALNQPLFFTVANHKLTVVGADASYVKPFTTSVLMLGPGQT  278

Query  1341  TNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN----LRPGANSRPLMPQL  1174
             T+VL++ DQ P+RYYMAARAY +AQNAPFDNTTTTA+LEY +     +  ++++P+MP L
Sbjct  279   TDVLISGDQNPSRYYMAARAYQSAQNAPFDNTTTTAILEYKSSLCAAKNCSSNKPIMPPL  338

Query  1173  PFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP----GPRCQGPNN  1006
             P FNDTAT TAFT+  +S  ++   V    DESLFFTVGLGL  C P      +CQGPN 
Sbjct  339   PSFNDTATVTAFTSSFKS--TDKTFVPTDIDESLFFTVGLGLNPCPPNFNKSRQCQGPNG  396

Query  1005  TRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSG  826
             TRF ASMNNVSFVLP   SLLQA++  I G++T DFP  PP +FDYTGNVSR+L+ P  G
Sbjct  397   TRFTASMNNVSFVLPSNFSLLQAHHQRIQGVFTTDFPANPPRKFDYTGNVSRSLFTPVPG  456

Query  825   TKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDP  646
             TKLY++KYGSRVQ+VLQDT+I T+E+HPIHLHGY F+++ QGFGN+NP+TD +KFNLVDP
Sbjct  457   TKLYRLKYGSRVQIVLQDTSIVTSENHPIHLHGYDFYIIAQGFGNYNPRTDPSKFNLVDP  516

Query  645   PVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPP  466
             P+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLA AF+VENG GE Q++E PP
Sbjct  517   PLRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLATAFLVENGVGELQSIESPP  576

Query  465   LDLPRC  448
              DLP C
Sbjct  577   EDLPLC  582



>ref|XP_011004433.1| PREDICTED: laccase-12-like [Populus euphratica]
Length=582

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/552 (66%), Positives = 441/552 (80%), Gaps = 11/552 (2%)
 Frame = -3

Query  2076  NADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIH  1897
             NA  ++ +FV+Q T + RLCKT+  ITVNG FPGPT+ V NGD +VV VVN+A+YNVTIH
Sbjct  33    NAKTHSHDFVIQATPVKRLCKTQNSITVNGMFPGPTLEVNNGDTLVVNVVNKAKYNVTIH  92

Query  1896  WHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFI  1717
             WHG+RQMRT WADGPE+VTQCPI PGG+YTY+F I+ QEGTLWWHAHS WLRATVYGA I
Sbjct  93    WHGVRQMRTGWADGPEFVTQCPIRPGGSYTYKFTIQGQEGTLWWHAHSSWLRATVYGALI  152

Query  1716  IYPKSGSHFPFS-QPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             ++PK GS +PFS QPK++  I+LGEWWN + I + R+   TG APN+S+AYT+NGQPGDL
Sbjct  153   VHPKEGSPYPFSKQPKRETAIVLGEWWNANPIDVVREATRTGGAPNVSDAYTVNGQPGDL  212

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y CSSQDTV   +  GET LLRVIN+ALNQ LFF+VANHKL VVGADA+Y KPFTT+V+M
Sbjct  213   YNCSSQDTVIVPIDSGETNLLRVINSALNQPLFFTVANHKLTVVGADASYVKPFTTSVLM  272

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANS----R  1192
             +GPGQTT+VL++ DQ P+RYYMAARAY +AQNAPFDNTTTTA+LEY +    A +    +
Sbjct  273   LGPGQTTDVLISGDQTPSRYYMAARAYQSAQNAPFDNTTTTAILEYKSSSCAAKNCSANK  332

Query  1191  PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNC----TPGPR  1024
             P+MP LP +NDTAT T FTT  +S   N   V    DESLFFT+GLGL  C        +
Sbjct  333   PIMPPLPAYNDTATVTNFTTSFKSADKN--LVPTDIDESLFFTIGLGLNPCPSNFNKSSQ  390

Query  1023  CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRAL  844
             CQGPN TRF ASMNNVSFVLP   SLLQA++  I G++T DFP  PP +FDYTGNVSR+L
Sbjct  391   CQGPNGTRFTASMNNVSFVLPSNFSLLQAHHQRIQGVFTTDFPANPPRKFDYTGNVSRSL  450

Query  843   WQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAK  664
             +QP +GT+LY +KYGSRVQ+VLQDT+I T E+HPIHLHGY F+++ QGFGN+NP+TD +K
Sbjct  451   FQPVAGTRLYNLKYGSRVQLVLQDTSIVTPENHPIHLHGYDFYIIAQGFGNYNPRTDPSK  510

Query  663   FNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQ  484
             FNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLA AF+VENG GE Q
Sbjct  511   FNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLATAFLVENGVGELQ  570

Query  483   TVEPPPLDLPRC  448
             ++E PP DLP C
Sbjct  571   SIESPPEDLPLC  582



>ref|XP_010922645.1| PREDICTED: laccase-3-like [Elaeis guineensis]
Length=573

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/578 (65%), Positives = 456/578 (79%), Gaps = 9/578 (2%)
 Frame = -3

Query  2169  MDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVN  1990
             M+S +NTS+ P    +L    +   +L S   A+V+  +FVVQ T + RLCKT  IITVN
Sbjct  1     MESHSNTSVIP---SWLLCFLLSFFLLCSHIKAEVHYHDFVVQATPVKRLCKTHNIITVN  57

Query  1989  GQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTY  1810
             GQ+PGPT+ V+NGD +V+ VVNRARYNVT+HWHG+RQMRT WADGPE VTQCPI PGG+Y
Sbjct  58    GQYPGPTLEVKNGDTLVINVVNRARYNVTLHWHGIRQMRTGWADGPEMVTQCPIRPGGSY  117

Query  1809  TYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRD  1630
             TYRF IE QEGTLWWHAHS WLRATVYGA II+PK  + +PF+ P ++IPILLGEWW+ +
Sbjct  118   TYRFTIEGQEGTLWWHAHSSWLRATVYGALIIHPKENNSYPFTNPTREIPILLGEWWDAN  177

Query  1629  IIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQ  1450
              I + R+   TGAAPNIS+A+TINGQPGD Y CS +DT    V  G+T LLRVINAALN 
Sbjct  178   PIDVVREATRTGAAPNISDAFTINGQPGDFYNCSGKDTTVIPVGAGDTNLLRVINAALNT  237

Query  1449  QLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayata  1270
             +LFF++A H++ VVGADA+Y KPFTT+VIM+GPGQTT+VL+T DQPP+RYYMAARAYA+A
Sbjct  238   ELFFAIAGHQMTVVGADASYTKPFTTSVIMLGPGQTTDVLVTMDQPPSRYYMAARAYASA  297

Query  1269  qnaPFDNTTTTAVLEY---TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPT  1099
             Q  PFDNTTTTA+L+Y    + +PG   +P  P LP +NDT+TATAF+T LRS+  +   
Sbjct  298   QGVPFDNTTTTAILDYDCGCSTKPGLAIQPAFPALPAYNDTSTATAFSTGLRSL--DKVR  355

Query  1098  VFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP  919
             + +  DE LFFTVGLGL NC PG  C GPN TRF AS+NNVSFVLP   S+LQA+++ +P
Sbjct  356   IPSPVDEDLFFTVGLGLFNCPPGKTCGGPNGTRFGASVNNVSFVLPTSFSILQAHHHGVP  415

Query  918   GIYTLDFPPVPPVQFDYT-GNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHP  742
             G++T DFP  PPVQFDYT  NVSRALWQP   TK+YK+KYGS VQ+VLQ T+IF  E+HP
Sbjct  416   GVFTTDFPANPPVQFDYTAANVSRALWQPVPATKVYKLKYGSVVQLVLQGTSIFAAENHP  475

Query  741   IHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLM  562
             IH+HGY F+++ +GFGNF+   DTAKFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLM
Sbjct  476   IHIHGYDFYILAEGFGNFDAAKDTAKFNLVDPPMRNTVGVPVNGWAVIRFVADNPGVWLM  535

Query  561   HCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             HCH+D H+ WGLAMAF+VE+G GE Q++EPPP DLP C
Sbjct  536   HCHLDVHITWGLAMAFLVEDGVGELQSLEPPPADLPLC  573



>emb|CDP13965.1| unnamed protein product [Coffea canephora]
Length=571

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/552 (65%), Positives = 438/552 (79%), Gaps = 8/552 (1%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             SL NA V++ +FV+Q T + RLC T + ITVNGQ+PGPT+ V NGD + ++V+N+A+YN+
Sbjct  22    SLGNAVVHSHQFVIQATPVKRLCNTHSTITVNGQYPGPTLEVNNGDSLEIEVINKAQYNL  81

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             TIHWHG+RQMRT W+DGPE+VTQCPI PGG+YTYRF I+ QEGTLWWHAHS WLRATVYG
Sbjct  82    TIHWHGVRQMRTAWSDGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYG  141

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
               II PK G  +PF +PK++  +LLGEWW+ + + + R+   TGA PN+S+A+TINGQPG
Sbjct  142   GLIIRPKEGDSYPFPKPKRESLLLLGEWWDANPMDVVREATRTGATPNVSDAFTINGQPG  201

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DL +CSS  T    V  GET L+RV+N+ LNQQLF ++ANHKL VVGADA+Y KPFTT+V
Sbjct  202   DLLKCSSNGTTIVPVDSGETNLIRVVNSGLNQQLFLTIANHKLTVVGADASYVKPFTTSV  261

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL---RPGANS  1195
             +M+GPGQTT+VL+T DQPPARYY+AARAYA+AQ APFDNTTTTA+LEY        G + 
Sbjct  262   LMLGPGQTTDVLITTDQPPARYYIAARAYASAQGAPFDNTTTTAILEYKTAPCPAKGVSI  321

Query  1194  RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR---  1024
             +P++P LP FNDTATATAF+   RS P   P V    DESLFFTVGLGL NC PG     
Sbjct  322   KPILPSLPAFNDTATATAFSKSFRS-PRKVP-VPTDIDESLFFTVGLGLQNCPPGASSQN  379

Query  1023  CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRAL  844
             CQGPN TRF ASMNNVSFVLP   SLLQ++   IPG++T DFP  PPVQFDYTGNVSR+L
Sbjct  380   CQGPNGTRFTASMNNVSFVLPSSFSLLQSHQQGIPGVFTTDFPAAPPVQFDYTGNVSRSL  439

Query  843   WQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAK  664
             WQP   TK+YK+KYG+RVQ+VLQ T+IFT E+HPIHLHGY F+++ +GFGNFNP+TDTAK
Sbjct  440   WQPVRATKVYKLKYGARVQLVLQGTSIFTAENHPIHLHGYDFYLIAEGFGNFNPKTDTAK  499

Query  663   FNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQ  484
             FNLVDPP+RNT  VPV GW+VIRF ADNPGVWL+HCH+D H+ WGLAMAFIVE+G G  +
Sbjct  500   FNLVDPPLRNTASVPVQGWSVIRFVADNPGVWLLHCHLDVHITWGLAMAFIVEDGAGLLE  559

Query  483   TVEPPPLDLPRC  448
              +E  P DLP C
Sbjct  560   KLEEAPADLPVC  571



>ref|XP_006399003.1| hypothetical protein EUTSA_v10015589mg [Eutrema salsugineum]
 gb|ESQ40456.1| hypothetical protein EUTSA_v10015589mg [Eutrema salsugineum]
Length=565

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/551 (68%), Positives = 438/551 (79%), Gaps = 8/551 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             AS   A V +  FV+QET + RLCKT+  ITVNG FPGPT+ V NGD + VKV+NRARYN
Sbjct  19    ASTIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVLNRARYN  78

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             +TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVY
Sbjct  79    ITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  138

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA II P  GS FPF +P     ++LGEWWN + + +  Q   TGAAPNIS+AYTINGQP
Sbjct  139   GALIIQPTPGSSFPFPKPDHQTALMLGEWWNANPVDVINQATQTGAAPNISDAYTINGQP  198

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLY CS+ +TV   ++ GET LLRVINAALNQ LFF+VANHKL VVGADA+Y KPFTT 
Sbjct  199   GDLYNCSTNETVVVPINSGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTTT  258

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRP  1189
             V+M+GPGQTT+VLLTADQPP RYY+AARAY +AQNAPFDNTTTTA+L+Y   +    S P
Sbjct  259   VLMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILQYN--KTTTTSPP  316

Query  1188  LMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT---PGPRCQ  1018
             ++P LP FNDT T T+F+ + +S+   N  V    D++L FT+GLGL NC    P  RCQ
Sbjct  317   IVPFLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDDNLVFTIGLGLDNCPKNFPKNRCQ  374

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALW  841
             G N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPV+FDYTG N+SRAL+
Sbjct  375   GLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYTGNNISRALF  434

Query  840   QPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKF  661
             QP  GTKLYK+KYGSRVQVVLQDT+I T+E+HPIHLHGY F++V +GFGNFNP+ DT+KF
Sbjct  435   QPVKGTKLYKLKYGSRVQVVLQDTSIVTSENHPIHLHGYDFYIVAEGFGNFNPKKDTSKF  494

Query  660   NLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQT  481
             NLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+V+NG G  +T
Sbjct  495   NLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLAMAFLVDNGVGTLET  554

Query  480   VEPPPLDLPRC  448
             +E PPLDLP C
Sbjct  555   LEAPPLDLPVC  565



>ref|XP_004241090.2| PREDICTED: laccase-12-like isoform X1 [Solanum lycopersicum]
Length=583

 Score =   684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/586 (63%), Positives = 448/586 (76%), Gaps = 13/586 (2%)
 Frame = -3

Query  2187  LQKHPQMDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTK  2008
             L +   MD   N   N  C  F    F+ + +  + + A+++  +FV+Q T + RLCK  
Sbjct  5     LLEQNTMDHACNRITNTLCYFF----FITILLFVNASTAEIHYHDFVIQATPVKRLCKIH  60

Query  2007  TIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPI  1828
               ITVNGQFPGPT+ V NGD +V+ VVNRA+YNVTIHWHG++Q+RT WADGPE++TQCPI
Sbjct  61    NTITVNGQFPGPTLQVNNGDALVINVVNRAQYNVTIHWHGVKQIRTAWADGPEFITQCPI  120

Query  1827  MPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLG  1648
              PGG+YTYRF I+ QEGTLWWHAHS WLRATVYGA IIYPK G  +PFS+PK++ PILLG
Sbjct  121   RPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIYPKEGEFYPFSKPKRETPILLG  180

Query  1647  EWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVI  1468
             EWW+ + I + RQ   TGAAP +S+AYTINGQPG+LYRCSS+DT    V  GET LLRVI
Sbjct  181   EWWDVNPIDVVRQATRTGAAPKVSDAYTINGQPGNLYRCSSKDTTVVIVDSGETNLLRVI  240

Query  1467  NAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaa  1288
             NAALNQ LFF+VANHKL VV ADA+Y +PFTT+V+M+GPGQTT+VL+  +QPP RYY+A 
Sbjct  241   NAALNQALFFAVANHKLTVVAADASYVQPFTTSVLMLGPGQTTDVLIDGNQPPGRYYIAV  300

Query  1287  rayataqnaPFDNTTTTAVLEYTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSV  1117
             RAYA+AQ   FDNTT+TA+LEY N      G    P+ P LP FNDTATAT F+T  RS 
Sbjct  301   RAYASAQGP-FDNTTSTAILEYKNTPCSVQGIKINPIFPSLPAFNDTATATTFSTSFRS-  358

Query  1116  PSNNPTVFNQPDESLFFTVGLGLVNCTPGPR---CQGPNNTRFAASMNNVSFVLPRRTSL  946
                   V  + DE+L FTVGLGL NC  G     CQGPN TRF ASMNN+SFVLP   S+
Sbjct  359   -PRQVDVPTEIDENLLFTVGLGLNNCPRGSSSRSCQGPNGTRFTASMNNMSFVLPPNFSI  417

Query  945   LQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTA  766
             LQA+Y  I G+++ DFP VPPV+FDYTGNVSR+LWQP  GTK+YK+KYG+RVQVVLQ T+
Sbjct  418   LQAHYQGIAGVFSTDFPAVPPVKFDYTGNVSRSLWQPVRGTKVYKLKYGARVQVVLQGTS  477

Query  765   IFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFA  586
             I T E+HPIHLHGY F+++ +GFGNFNPQTDTAKFNLVDPP+RNT  VPV GW+VIRF A
Sbjct  478   IVTGENHPIHLHGYDFYIIAEGFGNFNPQTDTAKFNLVDPPIRNTASVPVNGWSVIRFVA  537

Query  585   DNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +NPGVWLMHCH+D H+ WGLAM+F+VENG  E +++  PPLDLP C
Sbjct  538   NNPGVWLMHCHLDVHITWGLAMSFLVENGVSELESLVEPPLDLPVC  583



>ref|NP_181568.1| laccase 5 [Arabidopsis thaliana]
 sp|Q9SIY8.1|LAC5_ARATH RecName: Full=Laccase-5; AltName: Full=Benzenediol:oxygen oxidoreductase 
5; AltName: Full=Diphenol oxidase 5; AltName: Full=Urishiol 
oxidase 5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM77221.1|AF506030_1 laccase [Arabidopsis thaliana]
 gb|AAD25671.1| putative laccase (diphenol oxidase) [Arabidopsis thaliana]
 gb|AEC09819.1| laccase 5 [Arabidopsis thaliana]
Length=580

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/570 (64%), Positives = 451/570 (79%), Gaps = 18/570 (3%)
 Frame = -3

Query  2109  FVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             FV   + +S+A A+  ++ EF++Q TK+ RLC+T   ITVNG FPGP + V NGD +VVK
Sbjct  13    FVAFLLFSSVAEANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPMLVVNNGDTLVVK  72

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+NRARYN+TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  73    VINRARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHS  132

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYG+ +++P +GS +PF++P +++P+LLGEWW+ + + + R++  TG APN S+
Sbjct  133   SWLRATVYGSLLVFPPAGSSYPFTKPHRNVPLLLGEWWDANPVDVLRESIRTGGAPNNSD  192

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CSSQDT    ++ GET+LLRVIN+ALNQ LFF+VANHKL VVGADA+
Sbjct  193   AYTINGQPGDLYKCSSQDTTVVPINVGETILLRVINSALNQPLFFTVANHKLTVVGADAS  252

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---  1222
             Y KPFTTNVI++GPGQTT+VL+T DQPP RYYMAARAY +AQNAPF NTTTTA+L+Y   
Sbjct  253   YLKPFTTNVIVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKSA  312

Query  1221  --------TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFF  1066
                     +  + G + +P+MP LP +NDT T T F+   RS+      V  + DE+LF 
Sbjct  313   PCCGVGGGSGTKKGNSFKPIMPILPAYNDTNTVTRFSQSFRSL--RRAEVPTEIDENLFV  370

Query  1065  TVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFP  895
             T+GLGL NC       RCQGPN TRF ASMNNVSF LP   SLLQA+++ IPG++T DFP
Sbjct  371   TIGLGLNNCPKNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHGIPGVFTTDFP  430

Query  894   PVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHF  718
               PPV+FDYTG N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHGY F
Sbjct  431   AKPPVKFDYTGNNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDF  490

Query  717   WVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHL  538
             +++ +GFGNFNP+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D+H+
Sbjct  491   YIIAEGFGNFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFIADNPGVWIMHCHLDAHI  550

Query  537   AWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +WGLAMAF+VENG G  QT+E PP DLP C
Sbjct  551   SWGLAMAFLVENGNGVLQTIEQPPHDLPVC  580



>ref|XP_008792257.1| PREDICTED: laccase-3-like [Phoenix dactylifera]
Length=576

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/552 (66%), Positives = 440/552 (80%), Gaps = 8/552 (1%)
 Frame = -3

Query  2085  SLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynV  1906
             S   A+V+  +FVVQ   + RLCKT  IITVNGQFPGPT+ V+NGD +V+ VVNRARYNV
Sbjct  27    SHIKAEVHYHDFVVQAKPVKRLCKTHNIITVNGQFPGPTLEVKNGDTLVISVVNRARYNV  86

Query  1905  TIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYG  1726
             T+HWHG+RQMRT WADGPE VTQCPI PGG+YTYRF +E QEGTLWWHAHS WLRATVYG
Sbjct  87    TLHWHGVRQMRTAWADGPEMVTQCPIRPGGSYTYRFTVEGQEGTLWWHAHSSWLRATVYG  146

Query  1725  AFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPG  1546
             A II+PK  + +PF++PK++IPILLGEWW+ + I + R+   TGAAPN S+A+TINGQPG
Sbjct  147   ALIIHPKEYTSYPFAKPKREIPILLGEWWDANPIDVVRKATRTGAAPNTSDAFTINGQPG  206

Query  1545  DLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNV  1366
             DLY CSS+ T   SV+ GE  LLR+INAALN +LFF++A HK+ VVGADA+Y KPFTT+V
Sbjct  207   DLYNCSSEGTTVISVAAGEANLLRIINAALNTELFFTIAGHKMTVVGADASYTKPFTTSV  266

Query  1365  IMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSR--  1192
             +M+GPGQTT+VL+T DQPP+RYYMAARAYA+AQ  PFDNTTTTA+L+Y      A  R  
Sbjct  267   LMLGPGQTTDVLVTMDQPPSRYYMAARAYASAQGVPFDNTTTTAILDYDCGCSVAKPRQG  326

Query  1191  ---PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRC  1021
                P  P LP +NDTATA AF+T L+S+   +  +  + DE+LFFTVGLGL NC PG RC
Sbjct  327   IAQPAFPILPAYNDTATAAAFSTGLKSLKKVD--IPGRVDENLFFTVGLGLFNCRPGKRC  384

Query  1020  QGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT-GNVSRAL  844
              GPN TRF ASMNN SFVLP   S+LQA+++ +PG++T DFP  PPVQFDYT  NVSR+L
Sbjct  385   GGPNGTRFGASMNNFSFVLPANFSILQAHHHRMPGVFTADFPAQPPVQFDYTAANVSRSL  444

Query  843   WQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAK  664
             WQP + TK+YK+KYGS VQ+VLQ T IF  E+HPIHLHGY F+++ QGFGNFN   D AK
Sbjct  445   WQPVAATKVYKLKYGSVVQLVLQGTNIFAAENHPIHLHGYDFYILAQGFGNFNAAKDAAK  504

Query  663   FNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQ  484
             FNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q
Sbjct  505   FNLVDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGLGELQ  564

Query  483   TVEPPPLDLPRC  448
             ++EPPP DLP C
Sbjct  565   SLEPPPADLPIC  576



>ref|XP_009141888.1| PREDICTED: laccase-5-like [Brassica rapa]
Length=569

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/560 (65%), Positives = 447/560 (80%), Gaps = 9/560 (2%)
 Frame = -3

Query  2109  FVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             F +L +  S+A A+  ++ EF++Q TK+ RLC+T   ITVNG FPGP + + NGD +VVK
Sbjct  13    FAVLLLFTSMAEANRAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVINNGDSLVVK  72

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+NRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  73    VINRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHS  132

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYG+ +I P +GS +PF  P +++P+LLGEWW+ + + + R+   TGAAPNIS+
Sbjct  133   SWLRATVYGSLLILPPAGSSYPFPNPHRNVPLLLGEWWDGNPVDVLREAIRTGAAPNISD  192

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CSSQDT    ++ GET+LLRVINAALNQ LFF+VANHK  VVGADA+
Sbjct  193   AYTINGQPGDLYKCSSQDTTIVPINVGETILLRVINAALNQPLFFTVANHKFTVVGADAS  252

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTTN I++GPGQTT+VL+T DQPP  YYMAARAY +AQNAPF NTTTTA+L+Y + 
Sbjct  253   YLKPFTTNAIVLGPGQTTDVLITGDQPPNHYYMAARAYQSAQNAPFGNTTTTAILQYKSA  312

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVP-SNNPTVFNQPDESLFFTVGLGLVNCT  1036
                  ++P+MP LP +NDT TAT F+   RS+  +  PT   + DE+LF T+GLGL NC 
Sbjct  313   PCCGGAKPIMPLLPAYNDTNTATRFSQSFRSLKRAEFPT---ELDENLFITIGLGLNNCP  369

Query  1035  P---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT  865
                   RCQGPN TRF ASMNNVSF LP   SLLQA+++ IPG++T DFP  PPV+FDYT
Sbjct  370   KNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHAIPGVFTTDFPARPPVKFDYT  429

Query  864   G-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNF  688
             G N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHGY F++V +GFGNF
Sbjct  430   GSNISRSLYQPVRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGFGNF  489

Query  687   NPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIV  508
             NP+ DTAKFNL +PP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D+H++WGLAMAF+V
Sbjct  490   NPKKDTAKFNLENPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMAFLV  549

Query  507   ENGQGEKQTVEPPPLDLPRC  448
             ENG G  +T+E PP DLP C
Sbjct  550   ENGNGLLETMEEPPADLPVC  569



>ref|XP_002315130.1| hypothetical protein POPTR_0010s19080g [Populus trichocarpa]
 gb|EEF01301.1| hypothetical protein POPTR_0010s19080g [Populus trichocarpa]
Length=582

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/546 (68%), Positives = 441/546 (81%), Gaps = 11/546 (2%)
 Frame = -3

Query  2058  QEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQ  1879
              +FV+Q T + RLCKT+  ITVNG FPGPT+ V NGD +VV VVN+ARYNVTIHWHG+RQ
Sbjct  39    HDFVIQATPVKRLCKTQNSITVNGMFPGPTLEVNNGDTLVVNVVNKARYNVTIHWHGIRQ  98

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT WADGPE+VTQCPI PGG+YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK G
Sbjct  99    MRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPKEG  158

Query  1698  SHFPFS-QPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQ  1522
             S +PFS QPK++  ILLGEWWN + I + R++  TG  PN S+AYTINGQPGDLY CSSQ
Sbjct  159   SSYPFSKQPKRETAILLGEWWNANPIDVVRESTRTGGTPNSSDAYTINGQPGDLYNCSSQ  218

Query  1521  DTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQT  1342
             DTV   +  GET LLRV+N+ALNQ LFF+VANHKL VVGADA+Y KPFTT+V+M+GPGQT
Sbjct  219   DTVIVPIDSGETNLLRVVNSALNQPLFFTVANHKLTVVGADASYVKPFTTSVLMLGPGQT  278

Query  1341  TNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN----LRPGANSRPLMPQL  1174
             T+VL++ DQ P+RYYMAARAY +AQNAPFDNTTTTA+LEY +     +  ++++P+MP L
Sbjct  279   TDVLISGDQNPSRYYMAARAYQSAQNAPFDNTTTTAILEYKSSPCAAKNCSSNKPIMPPL  338

Query  1173  PFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP----GPRCQGPNN  1006
             P FNDTAT TAFT+  +S  ++   V    DESLFFTVGLGL  C P      +CQGPN 
Sbjct  339   PTFNDTATVTAFTSSFKS--TDKTFVPTDIDESLFFTVGLGLNPCPPNFNKSSQCQGPNG  396

Query  1005  TRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSG  826
             TRF ASMNNVSFVLP   SLLQA++  I G++T DFP  PP +FDYTGNVSR+L+ P  G
Sbjct  397   TRFTASMNNVSFVLPSNFSLLQAHHQRIQGVFTTDFPANPPRKFDYTGNVSRSLFTPVPG  456

Query  825   TKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDP  646
             TKLY++KYGSRVQ+VLQDT+I T+E+HPIHLHGY F+++ QGFGN+NP+TD +KFNLVDP
Sbjct  457   TKLYRLKYGSRVQIVLQDTSIVTSENHPIHLHGYDFYIIAQGFGNYNPRTDPSKFNLVDP  516

Query  645   PVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPP  466
             P+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLA AF+VENG GE Q++E PP
Sbjct  517   PLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLATAFLVENGVGELQSIESPP  576

Query  465   LDLPRC  448
              DLP C
Sbjct  577   EDLPLC  582



>ref|NP_001044679.1| Os01g0827300 [Oryza sativa Japonica Group]
 sp|Q941X2.1|LAC3_ORYSJ RecName: Full=Laccase-3; AltName: Full=Benzenediol:oxygen oxidoreductase 
3; AltName: Full=Diphenol oxidase 3; AltName: Full=Urishiol 
oxidase 3; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB68098.1| putative laccase [Oryza sativa Japonica Group]
 dbj|BAF06593.1| Os01g0827300 [Oryza sativa Japonica Group]
 dbj|BAG92758.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55611.1| hypothetical protein OsJ_03932 [Oryza sativa Japonica Group]
Length=567

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/553 (64%), Positives = 428/553 (77%), Gaps = 6/553 (1%)
 Frame = -3

Query  2094  VLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrar  1915
             VLA LA A+V++ EF+VQET + RLCKT  +ITVNGQ PGPT+ VR GD VV+ VVN A+
Sbjct  17    VLALLAGAEVHHHEFIVQETPVKRLCKTHNVITVNGQLPGPTLEVREGDTVVINVVNHAQ  76

Query  1914  ynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRAT  1735
             YNVTIHWHG+RQ RT WADGPE+VTQCPI PGG+Y YRF IE QEGTLWWHAHS WLRAT
Sbjct  77    YNVTIHWHGIRQFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRAT  136

Query  1734  VYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTING  1555
             VYGA II P+    +PF +P +++P++LGEWW+ D I + R+ Q TGAAPNIS+AYTING
Sbjct  137   VYGALIIRPRENKTYPFEKPAREVPLILGEWWDADPIQVIREAQRTGAAPNISDAYTING  196

Query  1554  QPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFT  1375
             QPGDLY CS ++T    V PGET LLR INAALNQ+LF S+A HK+ VVG DA+Y KPFT
Sbjct  197   QPGDLYNCSKEETTAVPVKPGETALLRFINAALNQELFVSIAQHKMTVVGVDASYTKPFT  256

Query  1374  TNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---TNLRPG  1204
             T+V+M+ PGQTT+VL+T DQ P RYY+AARAY +AQ   FDNTTTTAV+EY        G
Sbjct  257   TSVLMIAPGQTTDVLVTMDQAPTRYYLAARAYDSAQGVAFDNTTTTAVIEYDCGCATDFG  316

Query  1203  ANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR  1024
              +  P  P LP FNDT TATAF   +RS   +   +    DE+LFFTVG+GL NC PG +
Sbjct  317   PSIPPAFPVLPAFNDTNTATAFAAGIRS--PHEVKIPGPVDENLFFTVGVGLFNCEPGQQ  374

Query  1023  CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRA  847
             C GPNNTRF ASMNN+SFV P+ TSLL A+Y  IPG++T DFP  PPVQFDYT  NV R 
Sbjct  375   CGGPNNTRFTASMNNISFVFPQTTSLLHAHYYGIPGVFTTDFPAYPPVQFDYTAQNVPRY  434

Query  846   LWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTA  667
             LWQP   TKLYK+K+GS VQ+VLQDT+I + E+HPIH+HGY F+++ +GFGNF+P+ D  
Sbjct  435   LWQPVPATKLYKLKFGSVVQIVLQDTSIVSPENHPIHIHGYDFYILAEGFGNFDPKKDAK  494

Query  666   KFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEK  487
             KFN VDPP RNT+ VP  GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+G G+ 
Sbjct  495   KFNYVDPPQRNTVAVPTNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGKL  554

Query  486   QTVEPPPLDLPRC  448
             +T+E PP+DLP C
Sbjct  555   ETLEAPPVDLPMC  567



>emb|CDX70152.1| BnaA10g25010D [Brassica napus]
Length=565

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/560 (66%), Positives = 440/560 (79%), Gaps = 9/560 (2%)
 Frame = -3

Query  2112  LFVMLTVL-ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvv  1936
             LF   ++L AS   A V +  FV+QET + RLCKT+  ITVNG FPGPT+ V +GD + V
Sbjct  10    LFFFCSLLSASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNDGDTLEV  69

Query  1935  kvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAH  1756
             KV+NRARYN+TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAH
Sbjct  70    KVLNRARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAH  129

Query  1755  SRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             S WLRATVYGA II+P  GS FPF +P +   ++LGEWW+ + + +  Q   TGAAPNIS
Sbjct  130   SSWLRATVYGALIIHPALGSSFPFPKPDRQTALVLGEWWDANPVDVINQATRTGAAPNIS  189

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
             +AYTINGQPGDLY CS+++TV   V+ GET LLRVINAALNQ LFF+VANHKL VVGADA
Sbjct  190   DAYTINGQPGDLYNCSNKETVVVPVNSGETSLLRVINAALNQPLFFTVANHKLTVVGADA  249

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             +Y KPFTT V+M+GPGQTT+VLLTADQPP RYYMAARAY +AQNAPFDNTTTTA+L Y N
Sbjct  250   SYLKPFTTKVLMLGPGQTTDVLLTADQPPKRYYMAARAYQSAQNAPFDNTTTTAILHYRN  309

Query  1215  LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT  1036
                   S P+ P LP FNDT T T+F+ + +S+   N  V    DE+LFFT+GLGL NC 
Sbjct  310   TT--KTSLPITPSLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDENLFFTIGLGLDNCP  365

Query  1035  ---PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT  865
                P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPV+FDYT
Sbjct  366   KNFPKNRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYT  425

Query  864   G-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNF  688
             G N+SR L+QP  GTKLYK+KYG+RVQ+VLQDT I T+E+HPIHLHGY F++V +GFGNF
Sbjct  426   GNNISRGLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGYDFYIVAEGFGNF  485

Query  687   NPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIV  508
             NP+ D +KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGL MAF+V
Sbjct  486   NPKKDNSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLGMAFLV  545

Query  507   ENGQGEKQTVEPPPLDLPRC  448
             ENG G+ +T+E  P DLP C
Sbjct  546   ENGVGDLETLEAAPHDLPVC  565



>ref|XP_006644937.1| PREDICTED: laccase-3-like [Oryza brachyantha]
Length=566

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/559 (64%), Positives = 430/559 (77%), Gaps = 6/559 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
              F+  +V A LA A+V++ EF+VQET + RLC T  +ITVNGQ PGPT+ VR GD VV+ 
Sbjct  10    FFLACSVFALLAGAEVHHHEFIVQETPVKRLCNTHKVITVNGQLPGPTLEVREGDTVVIN  69

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVN A+YNVTIHWHG+RQ RT WADGPE+VTQCPI PGG+Y YRF IE QEGTLWWHAHS
Sbjct  70    VVNHAQYNVTIHWHGIRQFRTGWADGPEFVTQCPIKPGGSYRYRFTIEGQEGTLWWHAHS  129

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II P+    +PF +P  ++P+LLGEWW+ D I + R+ Q TGAAPNIS+
Sbjct  130   SWLRATVYGALIIRPRENKTYPFEKPATEVPLLLGEWWDADPIQVIREAQRTGAAPNISD  189

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             A+TINGQPGDLY CS Q+T    V PGET LLR INAALNQ+LF S+A H++ VVG DA+
Sbjct  190   AFTINGQPGDLYNCSKQETTAVPVKPGETALLRFINAALNQELFVSIAQHRMTVVGVDAS  249

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---  1222
             Y KP+TT+V+M+ PGQTT+VL+T DQ P RYY+AARAY T QNA FDNTTTTAV+EY   
Sbjct  250   YTKPYTTSVLMIAPGQTTDVLVTMDQAPTRYYIAARAYDTVQNAAFDNTTTTAVIEYDCG  309

Query  1221  TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVN  1042
                  G +  P  P LP FNDT TATAF   ++S   +   V    DE+LFFTVGLGL N
Sbjct  310   CATDFGPSIPPAFPALPAFNDTKTATAFAAGIKS--PHEVKVPGPVDENLFFTVGLGLFN  367

Query  1041  CTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
             C PG +C GPNNTRF ASMNN+SFV P+ TSLL A+Y  IPG++T DFP  PPVQFDYT 
Sbjct  368   CEPGQQCGGPNNTRFTASMNNISFVFPQTTSLLHAHYYGIPGVFTTDFPAYPPVQFDYTA  427

Query  861   -NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFN  685
              NV RALWQP   TKLYK+K+GS VQ+VLQDT+I + E+HPIH+HGY F+++ +GFGNF+
Sbjct  428   QNVPRALWQPVPATKLYKLKFGSVVQIVLQDTSIVSPENHPIHIHGYDFYILAEGFGNFD  487

Query  684   PQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVE  505
              + D  KFN VDPP RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE
Sbjct  488   AKKDAEKFNYVDPPQRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVE  547

Query  504   NGQGEKQTVEPPPLDLPRC  448
             +G G+ +T+E PP+DLP C
Sbjct  548   DGYGKLETLEAPPVDLPMC  566



>ref|XP_006828131.1| hypothetical protein AMTR_s00023p00051360 [Amborella trichopoda]
 gb|ERM95547.1| hypothetical protein AMTR_s00023p00051360 [Amborella trichopoda]
Length=589

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/561 (64%), Positives = 439/561 (78%), Gaps = 7/561 (1%)
 Frame = -3

Query  2109  FVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkv  1930
              V+L  +   +  +V    F++Q T++TRLCKT  +ITVNGQ PGPT+ V NGD +++  
Sbjct  29    IVLLCCMTVYSVGEVQTHNFIIQSTRVTRLCKTINVITVNGQLPGPTLEVNNGDTLIINA  88

Query  1929  vnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSR  1750
             VNRARYNVT+HWHG+RQ+RT WADGPE+VTQCPI PGG+YTYRF IENQEGTLWWHAHS 
Sbjct  89    VNRARYNVTLHWHGIRQIRTGWADGPEFVTQCPIRPGGSYTYRFTIENQEGTLWWHAHSS  148

Query  1749  WLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNA  1570
             WLRATVYGA II+PK G+ +PF++PK++ PI+LGEWWNR+ I +  Q   TGAAPNIS+A
Sbjct  149   WLRATVYGALIIHPKPGASYPFTKPKREAPIILGEWWNRNPIDVVNQATRTGAAPNISDA  208

Query  1569  YTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAY  1390
             YTINGQPGDLY CSS+DTV   V+ GET L R+INAALN +LFF +ANHK  VV  DA+Y
Sbjct  209   YTINGQPGDLYNCSSKDTVVIPVASGETNLFRIINAALNAELFFKIANHKFTVVAVDASY  268

Query  1389  NKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL-  1213
              KP+TT+V+M+ PGQTT++L+TADQ P RYY+AARAYA+  N  FDNTTTTA+L+Y  L 
Sbjct  269   TKPYTTDVLMIAPGQTTDLLVTADQAPGRYYIAARAYASNINVAFDNTTTTAILQYQGLP  328

Query  1212  --RPGANS-RPLMPQLPFFNDtatataftTQLRSVPSNN--PTVFNQPDESLFFTVGLGL  1048
                PG ++ +P+MP LPF+NDT TAT FTT LRS+ S      V    DE+LFFTVGLGL
Sbjct  329   CPAPGTSAPQPIMPSLPFYNDTNTATRFTTSLRSLNSREFPARVPQSVDENLFFTVGLGL  388

Query  1047  VNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDY  868
              NC  G  C GPNNTRFAAS+NN+SF LP+  S+LQA+   + G++T DFP VPPVQFDY
Sbjct  389   FNCRTGQMCGGPNNTRFAASVNNISFALPQSLSILQAHTYGVNGVFTRDFPRVPPVQFDY  448

Query  867   TG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             T  NVSRALWQP  GT++ ++K+GS VQVVLQ T I   E+HP+HLHG+ F+V+ +GFGN
Sbjct  449   TAQNVSRALWQPVRGTRVKQMKFGSVVQVVLQGTNIVNGENHPMHLHGHDFYVLAEGFGN  508

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             FNP  DT+ FNLVDPP+RNT+ VP+ GWAVIRF ADNPGVWLMHCH D H+ WGLAM F+
Sbjct  509   FNPSRDTSNFNLVDPPLRNTMGVPINGWAVIRFVADNPGVWLMHCHFDVHINWGLAMVFL  568

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             VENG  E +++EPPP+DLP C
Sbjct  569   VENGISELESLEPPPIDLPPC  589



>ref|XP_007141728.1| hypothetical protein PHAVU_008G220300g [Phaseolus vulgaris]
 gb|ESW13722.1| hypothetical protein PHAVU_008G220300g [Phaseolus vulgaris]
Length=610

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/565 (65%), Positives = 439/565 (78%), Gaps = 9/565 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             FL    V+ + L S ANA +   +FV+Q T + RLC T   ITVNGQFPGPT+ V NGD 
Sbjct  49    FLPLFLVLASALYS-ANAKIQEHQFVIQATPVKRLCSTHNTITVNGQFPGPTLEVNNGDT  107

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF IE QEGTLWW
Sbjct  108   LVVKVTNKARYNVTIHWHGIRQMRTGWADGPEFVTQCPIRPGESYTYRFTIEGQEGTLWW  167

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYGA IIYP+ G  +PF +PK+  PILLGEWW+ + I + RQ   TGAAP
Sbjct  168   HAHSSWLRATVYGALIIYPREGEAYPFPKPKRQTPILLGEWWDANPIDVLRQATRTGAAP  227

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             NIS+AYTINGQPGDLY+CS+Q T    +  GET LLRVINAALNQ LFF+VANHKL+VVG
Sbjct  228   NISDAYTINGQPGDLYKCSTQGTTIVPIDSGETNLLRVINAALNQPLFFTVANHKLKVVG  287

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTT+VIM+GPGQTT+VL+  DQPP+RYYMAARAY +AQNAPFDNTTTTA+L 
Sbjct  288   ADASYLKPFTTSVIMLGPGQTTDVLIQGDQPPSRYYMAARAYQSAQNAPFDNTTTTAILN  347

Query  1224  YTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGL  1054
             Y +      G + +PLMP LP +NDT T T F+   RS       V  + D+ LFFT+GL
Sbjct  348   YKSAPCPAKGVSIKPLMPSLPAYNDTNTVTTFSNSFRS--PRKVEVPAEIDDDLFFTIGL  405

Query  1053  GLVNCTPG---PRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             GL NC P     +CQGPN TRF ASMNNVSFVLP   S+LQA++  + G++T DFP  PP
Sbjct  406   GLNNCPPNFSPNQCQGPNGTRFTASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPP  465

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             ++FDYTGNVSR+LWQP  GTK+ K+K+GSRVQ+VLQDT+I T E+HPIHLHGY F++V +
Sbjct  466   LKFDYTGNVSRSLWQPVPGTKVTKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAE  525

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNF+P+ DT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPG W+MHCH+D H+ WGLA
Sbjct  526   GFGNFDPKKDTSKFNLVDPPMRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLA  585

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
                +V+NG G  Q++E PP DLP C
Sbjct  586   TVLLVDNGVGLLQSIEAPPEDLPLC  610



>ref|NP_001236616.1| diphenol oxidase laccase precursor [Glycine max]
 gb|AAM54731.1| diphenol oxidase laccase [Glycine max]
 gb|AAM89257.1| diphenol oxidase laccase [Glycine max]
Length=589

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/592 (62%), Positives = 449/592 (76%), Gaps = 21/592 (4%)
 Frame = -3

Query  2175  PQMDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIIT  1996
             P     NN   +P    FLA   ++L    S ANA ++  EFVV+ T + RLCKT   IT
Sbjct  3     PAKTIHNNVKYSPI---FLAIFVLILASALSSANAKIHEHEFVVEATPVKRLCKTHNSIT  59

Query  1995  VNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGG  1816
             VNGQ+PGPT+ + NGD +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VT  P  PGG
Sbjct  60    VNGQYPGPTLEINNGDTLVVKVTNKARYNVTIHWHGVRQMRTGWADGPEFVTSVPDCPGG  119

Query  1815  TYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWN  1636
             +YTYRF ++ QEGTLWWHAHS WLRATVYGA II P+ G  +PF +PK++ PILLGEWW+
Sbjct  120   SYTYRFTVQGQEGTLWWHAHSSWLRATVYGALIIRPREGEPYPFPKPKRETPILLGEWWD  179

Query  1635  RDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAAL  1456
              + I + RQ   TG APN+S+AYTINGQPGDLY+CSS+DT    +  GET LLRVINAAL
Sbjct  180   ANPIDVVRQATRTGGAPNVSDAYTINGQPGDLYKCSSKDTTIVPIHAGETNLLRVINAAL  239

Query  1455  NQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaaraya  1276
             NQ LFF+VANHKL VVGADA+Y KPFTT V+++GPGQTT+VL+T DQPP+RYYMAARAY 
Sbjct  240   NQPLFFTVANHKLTVVGADASYLKPFTTKVLILGPGQTTDVLITGDQPPSRYYMAARAYQ  299

Query  1275  taqnaPFDNTTTTAVLEY---------TNLRPGA---NSRPLMPQLPFFNDtatataftT  1132
             +AQNA FDNTTTTA+LEY         ++ R       ++P+MP LP +NDT   T+F+ 
Sbjct  300   SAQNAAFDNTTTTAILEYKSPNHHNKHSHHRAKGVKNKTKPIMPPLPAYNDTNAVTSFSK  359

Query  1131  QLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP--GP-RCQGP-NNTRFAASMNNVSFVL  964
               RS       V  + D+SLFFTVGLG+  C    GP RCQGP N TRF ASMNNVSFVL
Sbjct  360   SFRS--PRKVEVPTEIDQSLFFTVGLGIKKCPKNFGPKRCQGPINGTRFTASMNNVSFVL  417

Query  963   PRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQV  784
             P   S+LQA++  IPG++T DFP  PPV+FDYTGNVSR+LWQP  GTK +K+++GSRVQ+
Sbjct  418   PNNVSILQAHHLGIPGVFTTDFPGKPPVKFDYTGNVSRSLWQPVPGTKAHKLEFGSRVQI  477

Query  783   VLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWA  604
             VLQDT+I T E+HPIHLHGY F++V +GFGNF+P+ DTAKFNLVDPP+RNT+ VPV GWA
Sbjct  478   VLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPKKDTAKFNLVDPPLRNTVAVPVNGWA  537

Query  603   VIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             VIRF ADNPG WL+HCH+D H+ WGLA   +VENG G+ Q++EPPP+DLP C
Sbjct  538   VIRFVADNPGAWLLHCHLDVHIGWGLATVLLVENGVGKLQSIEPPPVDLPLC  589



>ref|XP_002881718.1| hypothetical protein ARALYDRAFT_903327 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57977.1| hypothetical protein ARALYDRAFT_903327 [Arabidopsis lyrata subsp. 
lyrata]
Length=581

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/574 (63%), Positives = 448/574 (78%), Gaps = 17/574 (3%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             F++   V+L    + AN   ++ EF++Q TK+ RLC+T   ITVNG FPGP + V NGD 
Sbjct  9     FISLAVVLLFASIAEANIKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPMLVVNNGDT  68

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV+NRARYN+TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWW
Sbjct  69    LVVKVINRARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWW  128

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYG+ ++ P +GS +PF+ P +++P+LLGEWW+ + + + R++  TG AP
Sbjct  129   HAHSSWLRATVYGSLLVLPPAGSSYPFTNPHRNVPLLLGEWWDANPVDVLRESIRTGGAP  188

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N S+AYTINGQPGDLY+CSSQDT    ++ GET+LLRVIN+ALNQ LFF+VANHKL VVG
Sbjct  189   NNSDAYTINGQPGDLYKCSSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKLTVVG  248

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTTNVI++GPGQTT+VL+T DQPP RYYMAARAY +AQNAPF NTTTTA+L+
Sbjct  249   ADASYLKPFTTNVIVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQ  308

Query  1224  Y-----------TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDE  1078
             Y           +  + G + + +MP LP +NDT T T F+   RS+      V  + DE
Sbjct  309   YKSAPCCGVGGGSGTKKGISVKLIMPILPAYNDTNTVTRFSQSFRSL--RRAEVPTEIDE  366

Query  1077  SLFFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYT  907
             +LF TVGLGL NC       RCQGPN TRF ASMNN+SF LP   SLLQA+++ IPG++T
Sbjct  367   NLFVTVGLGLNNCPKNFRSRRCQGPNGTRFTASMNNISFALPSNYSLLQAHHHGIPGVFT  426

Query  906   LDFPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLH  730
              DFP  PPV+FDYTG N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLH
Sbjct  427   TDFPAKPPVKFDYTGNNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLH  486

Query  729   GYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHI  550
             GY F+++ +GFGNFNP+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+
Sbjct  487   GYDFYIIAEGFGNFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHL  546

Query  549   DSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             D+H++WGLAMAF+VENG G  QT+E PP DLP C
Sbjct  547   DAHISWGLAMAFLVENGNGVLQTMEQPPADLPVC  580



>ref|XP_009125599.1| PREDICTED: laccase-12 [Brassica rapa]
Length=565

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/572 (65%), Positives = 444/572 (78%), Gaps = 12/572 (2%)
 Frame = -3

Query  2151  TSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGP  1972
             T+LN F       LF  L   +S+  A V +  FV+QET + RLCKT+  ITVNG FPGP
Sbjct  2     TTLNTFS---FWLLFCSLLSASSII-AKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGP  57

Query  1971  TIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKI  1792
             T+ V +GD + VKV NRARYN+TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I
Sbjct  58    TLEVNDGDTLEVKVHNRARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTI  117

Query  1791  ENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQR  1612
             + QEGTLWWHAHS WLRATVYGA II+P  GS FPF +P +   ++LGEWWN + + +  
Sbjct  118   QGQEGTLWWHAHSSWLRATVYGALIIHPAPGSSFPFPKPDRQTALVLGEWWNANPVNVIN  177

Query  1611  QTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSV  1432
             Q   TGAAPN+S+AYTINGQPGDLY CS++ TV   V+ GET LLRVINAALNQ LFF+V
Sbjct  178   QATRTGAAPNVSDAYTINGQPGDLYNCSTKGTVVVPVNSGETSLLRVINAALNQPLFFTV  237

Query  1431  ANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFD  1252
             ANHKL VVGADA+Y KPFTT V+M+GPGQTT+VLLTA+QPP RYY+AARAY +AQNAPFD
Sbjct  238   ANHKLTVVGADASYLKPFTTKVLMLGPGQTTDVLLTANQPPKRYYIAARAYQSAQNAPFD  297

Query  1251  NTTTTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESL  1072
             NTTTTA+L+Y+  +    S+P+MP LP FN T T T+F+ + +S+   N  V    DE+L
Sbjct  298   NTTTTAILQYS--KKTTTSKPIMPPLPAFNHTKTVTSFSRKFKSL--RNVVVPKTIDENL  353

Query  1071  FFTVGLGLVNCT---PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLD  901
             FFT+GLGL  C    P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IP ++T D
Sbjct  354   FFTIGLGLDKCPKNFPKSRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPNVFTTD  413

Query  900   FPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGY  724
             FP  PPV+FDYTG N+SR L+QP  GTKLYK+KYG+RVQ+VLQDT I T+E+HPIHLHGY
Sbjct  414   FPAKPPVKFDYTGNNISRGLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGY  473

Query  723   HFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDS  544
              F++V +GFGNFNP+ DT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D 
Sbjct  474   DFYIVAEGFGNFNPKKDTSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDV  533

Query  543   HLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             H+ WGL MAF+VENG GE +T+E  P DLP C
Sbjct  534   HIKWGLGMAFLVENGVGELETLEAAPHDLPVC  565



>emb|CDX98841.1| BnaC09g49940D [Brassica napus]
Length=565

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/560 (66%), Positives = 437/560 (78%), Gaps = 9/560 (2%)
 Frame = -3

Query  2112  LFVMLTVL-ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvv  1936
             LF   ++L AS   A V +  FV+QET + RLCKT+  ITVNG FPGPT+ V +GD + V
Sbjct  10    LFFFCSLLSASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNDGDTLEV  69

Query  1935  kvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAH  1756
             KV+NRARYN+TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAH
Sbjct  70    KVLNRARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAH  129

Query  1755  SRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             S WLRATVYGA II+P  GS FPF +P +   ++LGEWWN + + +  Q   TGAAPNIS
Sbjct  130   SSWLRATVYGALIIHPAPGSSFPFPKPDRQTALVLGEWWNANPVDVINQATRTGAAPNIS  189

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
             +AYTINGQPGDLY CS+++TV   V  GET LLRVINAALNQ LFF+VANHKL VVGADA
Sbjct  190   DAYTINGQPGDLYNCSNKETVVVPVKSGETSLLRVINAALNQPLFFTVANHKLTVVGADA  249

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             +Y KPFTT  +M+GPGQTT+VLLTADQPP RYY+AARAY +AQNAPFDNTTTTA+L Y N
Sbjct  250   SYLKPFTTKFLMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILHYRN  309

Query  1215  LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT  1036
                   S P+   LP FNDT T T+F+ + +S+   N  V    DE+LFFT+GLGL NC 
Sbjct  310   T--SKTSPPIAASLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDENLFFTIGLGLDNCP  365

Query  1035  ---PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT  865
                P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPV+FDYT
Sbjct  366   KNFPKNRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYT  425

Query  864   G-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNF  688
             G N+SR L+QP  GTKLYK+KYG+RVQ+VLQDT I T+E+HPIHLHGY F++V +GFGNF
Sbjct  426   GNNISRGLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGYDFYIVAEGFGNF  485

Query  687   NPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIV  508
             NP+ D +KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGL MAF+V
Sbjct  486   NPKKDNSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLGMAFLV  545

Query  507   ENGQGEKQTVEPPPLDLPRC  448
             ENG GE +T+E  P DLP C
Sbjct  546   ENGVGELETLEAAPHDLPVC  565



>emb|CDY04949.1| BnaAnng01310D [Brassica napus]
Length=565

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/572 (65%), Positives = 443/572 (77%), Gaps = 12/572 (2%)
 Frame = -3

Query  2151  TSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGP  1972
             T+LN F       LF  L   +S+  A V +  FV+QET + RLCKT+  ITVNG FPGP
Sbjct  2     TTLNTFS---FWLLFCSLLSASSII-AKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGP  57

Query  1971  TIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKI  1792
             T+ V +GD + VKV NRARYN+TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I
Sbjct  58    TLEVNDGDTLEVKVHNRARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTI  117

Query  1791  ENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQR  1612
             + QEGTLWWHAHS WLRATVYG  II+P  GS FPF +P +   ++LGEWWN + + +  
Sbjct  118   QGQEGTLWWHAHSSWLRATVYGTLIIHPAPGSSFPFPKPDRQTALVLGEWWNANPVNVIN  177

Query  1611  QTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSV  1432
             Q   TGAAPN+S+AYTINGQPGDLY CS++ TV   V+ GET LLRVINAALNQ LFF+V
Sbjct  178   QATRTGAAPNVSDAYTINGQPGDLYNCSTKGTVVVPVNAGETSLLRVINAALNQPLFFTV  237

Query  1431  ANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFD  1252
             ANHKL VVGADA+Y KPFTT V+M+GPGQTT+VLLTA+QPP RYY+AARAY +AQNAPFD
Sbjct  238   ANHKLTVVGADASYLKPFTTKVLMLGPGQTTDVLLTANQPPKRYYIAARAYQSAQNAPFD  297

Query  1251  NTTTTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESL  1072
             NTTTTA+L+Y   +    S P+MP LP FN T T T+F+ + +S+   N  V    DE+L
Sbjct  298   NTTTTAILQYK--KTTKTSPPIMPPLPAFNHTKTVTSFSRKFKSL--RNVVVPKTIDENL  353

Query  1071  FFTVGLGLVNCT---PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLD  901
             FFT+GLGL  C    P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IPG++T D
Sbjct  354   FFTIGLGLDKCPKNFPKSRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTD  413

Query  900   FPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGY  724
             FP  PPV+FDYTG N+SR L+QP  GTKLYK+KYG+RVQ+VLQDT I T+E+HPIHLHGY
Sbjct  414   FPAKPPVKFDYTGNNISRGLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGY  473

Query  723   HFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDS  544
              F++VG+GFGNFNP+ DT+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D 
Sbjct  474   DFYIVGEGFGNFNPKKDTSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDV  533

Query  543   HLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             H+ WGL MAF+VENG GE +T+E  P DLP C
Sbjct  534   HIKWGLGMAFLVENGVGELETLEAAPHDLPAC  565



>ref|XP_004491004.1| PREDICTED: laccase-5-like [Cicer arietinum]
Length=569

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/564 (63%), Positives = 445/564 (79%), Gaps = 11/564 (2%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             +  +  + ASLANA ++  EFVVQ T + RLC T + ITVNGQFPGPT+ V NGD +VVK
Sbjct  8     ILAIFVLFASLANAKIHEHEFVVQATPVKRLCNTHSSITVNGQFPGPTLEVNNGDTLVVK  67

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+N+A YNVTIHWHG+RQ+RT WADGPE++TQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  68    VINKAHYNVTIHWHGIRQIRTGWADGPEFITQCPIRPGESYTYRFTIQGQEGTLWWHAHS  127

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II PK G  +PF++PK++ P+LLGEWW+ + I + +Q   TGAAPNIS+
Sbjct  128   SWLRATVYGALIIRPKEGETYPFTKPKRETPLLLGEWWDANPIDVIKQATQTGAAPNISD  187

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CSSQ+T    +  GET LLRVINAALNQ LFF+VANHKL VVGADA+
Sbjct  188   AYTINGQPGDLYKCSSQETTIVPIDSGETNLLRVINAALNQPLFFTVANHKLIVVGADAS  247

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTTN +M+GPGQTT+VL+ ADQPP+RYY+AARAY +AQNAPFDNTTTT++LEY + 
Sbjct  248   YVKPFTTNTLMLGPGQTTDVLIVADQPPSRYYIAARAYQSAQNAPFDNTTTTSILEYKSA  307

Query  1212  ----RPGANS-RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGL  1048
                 + GA+S +P+MP LP +NDT T T+F+   RS+      V  + DE LFFT+GLGL
Sbjct  308   PCPKKGGASSNKPIMPSLPSYNDTNTVTSFSKSFRSL--RKVEVPLEIDEDLFFTIGLGL  365

Query  1047  VNC----TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPV  880
              NC        +CQGPN TRF +SMNNVSFVLP   S+LQA+   + G++T DFP  PPV
Sbjct  366   NNCPKNFDAKKQCQGPNGTRFTSSMNNVSFVLPSNFSILQAHKLGVQGVFTDDFPAKPPV  425

Query  879   QFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQG  700
             +FDYTGNVSR+LWQP  GTK+ K+++GSRVQ+VLQDT+I T E+HPIHLHGY F++V +G
Sbjct  426   KFDYTGNVSRSLWQPIQGTKVTKLRFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEG  485

Query  699   FGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAM  520
             FGNF+ + D +KFNLVDPP+RNT+ VP  GWAVIRF ADNPGVW++HCH+D H+AWGLA 
Sbjct  486   FGNFDSKKDASKFNLVDPPMRNTVAVPANGWAVIRFVADNPGVWILHCHLDVHIAWGLAT  545

Query  519   AFIVENGQGEKQTVEPPPLDLPRC  448
               +VE+G+G  +++E PP DLP C
Sbjct  546   VLLVEDGEGLLESIEAPPEDLPLC  569



>ref|XP_006293898.1| hypothetical protein CARUB_v10022891mg [Capsella rubella]
 gb|EOA26796.1| hypothetical protein CARUB_v10022891mg [Capsella rubella]
Length=579

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/567 (64%), Positives = 447/567 (79%), Gaps = 16/567 (3%)
 Frame = -3

Query  2106  VMLTVLASLANADV--YNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             V+L    S+A A V  ++ EF++Q TK+ RLC+T   ITVNG FPGPT+ V NGD +VVK
Sbjct  15    VVLLFTTSMAEAHVKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNNGDTLVVK  74

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+NRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  75    VINRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHS  134

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYG+ ++ P +GS +PF+ P +++P+LLGEWW+ + + + R++  TG APN S+
Sbjct  135   SWLRATVYGSLLVLPPAGSSYPFTNPHRNVPLLLGEWWDANPVDVLRESIRTGGAPNNSD  194

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGD Y+CSSQDT    ++ GET+LLRVIN+ALNQ LFF+VANHKL VVGADA+
Sbjct  195   AYTINGQPGDFYKCSSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKLTVVGADAS  254

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYT--  1219
             Y KPFTTNVI++GPGQTT+VL+T DQPP RYYMAARAY +AQNAPF NTTTTA+L+Y   
Sbjct  255   YLKPFTTNVIVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKSA  314

Query  1218  ------NLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
                   + + G + +P+MP LP +NDT T T F+   RS+      V  + DE+LF T+G
Sbjct  315   PCCGGGSAKKGISVKPIMPLLPAYNDTNTVTRFSQSFRSL--RRAEVPTEIDENLFITIG  372

Query  1056  LGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             LGL NC       RCQGPN TRF ASMNNVSF LP   SLLQA+++ IPG++T DFP  P
Sbjct  373   LGLNNCPKNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHGIPGVFTTDFPAKP  432

Query  885   PVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PV+FDYTG N+SR+L+QP  GTKLYK+KYGS VQ+VLQDT I T E+HPIHLHGY F++V
Sbjct  433   PVKFDYTGNNISRSLYQPDRGTKLYKLKYGSTVQIVLQDTGIVTPENHPIHLHGYDFYIV  492

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
              +GFGNFNP+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D+H++WG
Sbjct  493   AEGFGNFNPKKDTAKFNLEDPPLRNTVSVPVNGWAVIRFVADNPGVWIMHCHLDAHISWG  552

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAMAF+VENG G  QT+E PP DLP C
Sbjct  553   LAMAFLVENGNGVLQTMEQPPPDLPVC  579



>ref|XP_010508873.1| PREDICTED: laccase-5-like [Camelina sativa]
Length=578

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/573 (65%), Positives = 453/573 (79%), Gaps = 17/573 (3%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADV---YNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrn  1954
             +   L V+L ++ S+A A+V   ++ EF++Q TK+ RLC+T   ITVNG FPGPT+ V N
Sbjct  9     YFISLAVVLLLITSMAEANVVKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNN  68

Query  1953  gddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGT  1774
             GD +VVKVVNRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGT
Sbjct  69    GDTLVVKVVNRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGT  128

Query  1773  LWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTG  1594
             LWWHAHS WLRATVYG+ ++ P +GS +PF  P +++P+LLGEWW+ + + + R++  TG
Sbjct  129   LWWHAHSSWLRATVYGSLLVLPPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRKSIRTG  188

Query  1593  AAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQ  1414
              AP+ S+AYTINGQPGDLY+CSS+DT    ++ GET+LLRVIN+ALNQ LFF+VANHKL 
Sbjct  189   GAPSNSDAYTINGQPGDLYKCSSRDTTIVPINVGETILLRVINSALNQPLFFTVANHKLT  248

Query  1413  VVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTA  1234
             VVGADA+Y KPFTTNVI++GPGQTT+VL+  DQPP RYYMAARAY +AQNAPF NTTTTA
Sbjct  249   VVGADASYLKPFTTNVIVLGPGQTTDVLIKGDQPPNRYYMAARAYQSAQNAPFGNTTTTA  308

Query  1233  VLEY-TNLRPGANS-----RPLMPQLPFFNDtatataftTQLRSV-PSNNPTVFNQPDES  1075
             VL+Y T    G  S     +P+MP LP +NDT T T F+   RS+  +  PTV    DE+
Sbjct  309   VLQYKTAPCCGGGSAKNGIKPVMPLLPSYNDTNTVTRFSQSFRSLRRAEVPTVI---DEN  365

Query  1074  LFFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTL  904
             LF T+GLGL NC       RCQGPN TRF ASMNNVSF LP   SLLQA+++ IPG++T 
Sbjct  366   LFVTIGLGLDNCPKNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHGIPGVFTT  425

Query  903   DFPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHG  727
             DFP  PPV+FDYTG N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHG
Sbjct  426   DFPAKPPVKFDYTGNNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHG  485

Query  726   YHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHID  547
             Y F++V +GFGNFNP+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D
Sbjct  486   YDFYIVAEGFGNFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLD  545

Query  546   SHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
              H++WGLAMAF+VENG+G  QT+E PP DLP C
Sbjct  546   VHISWGLAMAFVVENGKGVLQTMEQPPPDLPVC  578



>emb|CDY52925.1| BnaA04g29320D [Brassica napus]
Length=573

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/563 (64%), Positives = 444/563 (79%), Gaps = 11/563 (2%)
 Frame = -3

Query  2109  FVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNG----QFPGPTIAvrngdd  1945
             F +L +  S+A A+  ++ EF++Q TK+ RLC+T   ITVNG     FPGP + + NGD 
Sbjct  13    FAVLLLFTSMAEANRAHHHEFIIQATKVKRLCETHNSITVNGILSNMFPGPQLVINNGDT  72

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             +VVKV+NRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWW
Sbjct  73    LVVKVINRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWW  132

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRATVYG+ +I P +GS +PF  P +++P+LLGEWW+ + + + R+   TGAAP
Sbjct  133   HAHSSWLRATVYGSLLILPPAGSSYPFPNPHRNVPLLLGEWWDGNPVDVLREAIRTGAAP  192

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             NIS+AYTINGQPGDLY+CSSQDT    ++ GET+LLRVINAALNQ LFF+VANHK  VVG
Sbjct  193   NISDAYTINGQPGDLYKCSSQDTTIVPINVGETILLRVINAALNQPLFFTVANHKFTVVG  252

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLE  1225
             ADA+Y KPFTTN I++GPGQTT+VL+T DQPP  YYMAARAY +AQNAPF NTTTTA+L+
Sbjct  253   ADASYLKPFTTNAIVLGPGQTTDVLITGDQPPNHYYMAARAYQSAQNAPFGNTTTTAILQ  312

Query  1224  YTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLV  1045
             Y +      ++P+MP LP +NDT TAT F+   RS+      V  + DE+LF T+GLGL 
Sbjct  313   YKSAPCCGGAKPIMPLLPAYNDTNTATRFSQSFRSL--KRAEVPTELDENLFITIGLGLN  370

Query  1044  NCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             NC       RCQGPN TRF ASMNNVSF LP   SLLQA+++ IPG++T DFP  PPV+F
Sbjct  371   NCPKNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHAIPGVFTTDFPARPPVKF  430

Query  873   DYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGF  697
             DYTG N+SR+L+Q   GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHGY F++V +GF
Sbjct  431   DYTGSNISRSLYQSVRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIVAEGF  490

Query  696   GNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMA  517
             GNFNP+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D+H++WGLAMA
Sbjct  491   GNFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWGLAMA  550

Query  516   FIVENGQGEKQTVEPPPLDLPRC  448
             F+VENG G  +T+E PP DLP C
Sbjct  551   FLVENGNGLLETMEEPPADLPVC  573



>ref|XP_009122149.1| PREDICTED: laccase-12 [Brassica rapa]
Length=565

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/560 (66%), Positives = 438/560 (78%), Gaps = 9/560 (2%)
 Frame = -3

Query  2112  LFVMLTVL-ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvv  1936
             LF   ++L AS   A V +  FV+QET + RLCKT+  ITVNG FPGPT+ V +GD + V
Sbjct  10    LFFFCSLLSASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGVFPGPTLEVNDGDTLEV  69

Query  1935  kvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAH  1756
             KV+NRARYN+TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAH
Sbjct  70    KVLNRARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAH  129

Query  1755  SRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             S WLRATVYGA II+P  GS FPF +P     ++LGEWWN + + +  Q   TGAAPNIS
Sbjct  130   SSWLRATVYGALIIHPALGSSFPFPKPDSQTALVLGEWWNANPVDVINQATRTGAAPNIS  189

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
             +AYTINGQPGDLY CS+++TV   V+ GET LLRVINAALNQ LFF+VANHKL VVGADA
Sbjct  190   DAYTINGQPGDLYNCSNKETVVVPVNSGETSLLRVINAALNQPLFFTVANHKLTVVGADA  249

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             +Y KPFTT V+M+GPGQTT+VLLTADQPP RYY+AARAY +AQNAPFDNTTTTA+L Y N
Sbjct  250   SYLKPFTTKVLMLGPGQTTDVLLTADQPPKRYYIAARAYQSAQNAPFDNTTTTAILHYRN  309

Query  1215  LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT  1036
                   S P+   LP FNDT T T+F+ + +S+   N  V    DE+LFFT+GLGL NC 
Sbjct  310   TT--KTSPPVTLSLPAFNDTNTVTSFSRKFKSL--RNVVVPKTIDENLFFTIGLGLDNCP  365

Query  1035  ---PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT  865
                P  RCQG N TRF ASMNNVSFVLP   SLLQA+ N IPG++T DFP  PPV+FDYT
Sbjct  366   KNFPKNRCQGLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPGVFTTDFPAKPPVKFDYT  425

Query  864   G-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNF  688
             G N+SR L+QP  GTKLYK+KYG+RVQ+VLQDT I T+E+HPIHLHGY F++V +GFGNF
Sbjct  426   GNNISRGLFQPVKGTKLYKLKYGTRVQIVLQDTNIVTSENHPIHLHGYDFYIVAEGFGNF  485

Query  687   NPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIV  508
             NP+ D +KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGL MAF+V
Sbjct  486   NPKKDNSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLGMAFLV  545

Query  507   ENGQGEKQTVEPPPLDLPRC  448
             ENG G+ +T+E  P DLP C
Sbjct  546   ENGVGDLETLEAAPHDLPVC  565



>emb|CDY14115.1| BnaC02g02320D [Brassica napus]
Length=564

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/551 (66%), Positives = 433/551 (79%), Gaps = 8/551 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             AS   A V +  FV+QET + RLCKT+  ITVNG FPGPT+ V +GD + VKV NRARYN
Sbjct  18    ASSIIAKVQHHNFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNDGDTLEVKVHNRARYN  77

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             +TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVY
Sbjct  78    ITIHWHGVRQMRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVY  137

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             G  II+P  GS FPF +P +   ++LGEWWN + + +  Q   TGAAPN+S+AYTINGQP
Sbjct  138   GTLIIHPAPGSSFPFPKPDRQTALVLGEWWNANPVNVINQATRTGAAPNVSDAYTINGQP  197

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLY CS++ TV   V+ GET LLRVINAALNQ LFF+VANHKL VVGADA+Y KPFTT 
Sbjct  198   GDLYNCSTKGTVVVPVNAGETSLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTTK  257

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRP  1189
             V+M+GPGQTT+VLLTA+QPP RYY+A+RAY +AQNAPFDNTTTTA+L+YT  +    S P
Sbjct  258   VLMLGPGQTTDVLLTANQPPKRYYIASRAYQSAQNAPFDNTTTTAILQYT--KTTTTSPP  315

Query  1188  LMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT---PGPRCQ  1018
             +MP LP FN T T T+F+ + +S+   N  V    DE+LFFT+GLGL  C    P  RCQ
Sbjct  316   IMPPLPAFNHTKTVTSFSRKFKSL--RNVVVPKTIDENLFFTIGLGLDKCPKHFPKNRCQ  373

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALW  841
             G N TRF ASMNNVSFVLP   SLLQA+ N IP ++T DFP  PPV+FDYTG N+SR L+
Sbjct  374   GLNGTRFTASMNNVSFVLPSNFSLLQAHSNGIPNVFTTDFPAKPPVKFDYTGKNISRGLF  433

Query  840   QPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKF  661
             QP  GTKLYK+KYGSRVQ+VLQDT I T+E+HPIHLHGY F++V +GFGNFNP+ D +KF
Sbjct  434   QPVKGTKLYKLKYGSRVQIVLQDTNIVTSENHPIHLHGYDFYIVAEGFGNFNPKKDNSKF  493

Query  660   NLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQT  481
             NLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGL+MAF+VENG GE +T
Sbjct  494   NLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHIKWGLSMAFLVENGVGELET  553

Query  480   VEPPPLDLPRC  448
             +E  P DLP C
Sbjct  554   LEAAPHDLPVC  564



>ref|XP_009343323.1| PREDICTED: laccase-3-like [Pyrus x bretschneideri]
Length=563

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/548 (66%), Positives = 429/548 (78%), Gaps = 5/548 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             AS + A+ +  EFVV+   + RLC+T + ITVNGQFPGPT+ VRNGD V VKV N A+YN
Sbjct  20    ASFSAAEDHFHEFVVEARPVRRLCRTHSRITVNGQFPGPTLEVRNGDSVAVKVTNIAKYN  79

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             +TIHWHGL+Q   PWADGPEYVTQCPI PG TYTYRF I +QEGTLWWHAHSRWLRATVY
Sbjct  80    ITIHWHGLKQQNNPWADGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRATVY  139

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             G  IIYP+ GS +PF  PK+++P+LLGEW++R+   + R   FTG APN+SNAYTINGQP
Sbjct  140   GVLIIYPRLGSPYPFPMPKREVPLLLGEWFDRNPHDVMRLAAFTGGAPNVSNAYTINGQP  199

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLYRCS ++T++  V  GE++LLRVIN+ALNQ+LFF+VANH+L VVGADA+Y KPF T 
Sbjct  200   GDLYRCSKKETIRIPVVSGESLLLRVINSALNQELFFTVANHQLTVVGADASYTKPFATR  259

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANS-R  1192
             VIM+GPGQTT+VLLTADQ PARYYMAARAY T  N  FDNTTTTA+LEY N         
Sbjct  260   VIMLGPGQTTDVLLTADQGPARYYMAARAYQTDLNVAFDNTTTTAILEYKNAASSNQGLA  319

Query  1191  PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGP  1012
             P+ P LP  NDTA ATA+T Q++S PS    V  + DE+LFFTVGLGL       R    
Sbjct  320   PVFPTLPASNDTAPATAYTAQIKS-PS-QVKVPTRIDENLFFTVGLGLYLLH--IRNSIT  375

Query  1011  NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPP  832
             NNTRFAASMNNVSFVLPR  SL+QA Y  +PG++T DFPPVP VQF+YTGNV R LW P 
Sbjct  376   NNTRFAASMNNVSFVLPRTNSLMQAAYYGVPGVFTTDFPPVPLVQFNYTGNVPRGLWSPR  435

Query  831   SGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLV  652
              GTKLYK+KYG+ VQ+V QDT+I TT+DHP+HLHGY F+V+G GFGN+NP TD A+FNL+
Sbjct  436   RGTKLYKLKYGANVQIVFQDTSIVTTDDHPMHLHGYQFYVIGSGFGNYNPSTDPARFNLI  495

Query  651   DPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEP  472
             DPP+RNTI    GGW  IRF ADNPGVWLMHCH++SHL+ GLAMAF+VENG G  Q+V P
Sbjct  496   DPPLRNTIGTGPGGWVAIRFKADNPGVWLMHCHLESHLSLGLAMAFLVENGNGPLQSVIP  555

Query  471   PPLDLPRC  448
             PP DLPRC
Sbjct  556   PPPDLPRC  563



>ref|XP_008343632.1| PREDICTED: laccase-12-like [Malus domestica]
Length=583

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/553 (66%), Positives = 431/553 (78%), Gaps = 11/553 (2%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             A    +  EFV+Q TK+ RLCKT   ITVNGQ+PGPT+   NGD + +KV N+ARYNVTI
Sbjct  33    AEPKTHQHEFVIQATKVKRLCKTHNSITVNGQYPGPTLEANNGDTLFIKVTNKARYNVTI  92

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQ+RT WADGPE+VTQCPI PGG+YTYRF I+ QEGTLWWHAHS WLRATVYGA 
Sbjct  93    HWHGIRQIRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGAL  152

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             II+PK G  +PF++PK++  +LLGEWW+ + I + RQ   TG APN+S+AYTINGQPGDL
Sbjct  153   IIHPKQGDSYPFTKPKRETTLLLGEWWDANPIDVIRQATRTGGAPNVSDAYTINGQPGDL  212

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y CSS+DTV   +  GET LLRVINA LNQ LFFSVANHKL VV ADA+Y KPFTT V+M
Sbjct  213   YNCSSKDTVIVPIDSGETNLLRVINAGLNQPLFFSVANHKLTVVSADASYTKPFTTTVLM  272

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN------LRPGAN  1198
             +GPGQTT+VL+T DQPPARYY+AA AY +AQNA F NTTTTA+LEY +       + G  
Sbjct  273   LGPGQTTDVLITGDQPPARYYLAASAYFSAQNAAFXNTTTTAILEYKSAPCSPSCKNGPT  332

Query  1197  SRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---GP  1027
             ++P+MPQLP FNDT TA+AFT   RS       V  + DE+LFFT+GLGL NC       
Sbjct  333   AKPIMPQLPAFNDTNTASAFTKSFRS--PRKVEVPTEIDENLFFTIGLGLNNCPKHFRAR  390

Query  1026  RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRA  847
             RCQGPN TRF ASMNNVSFVLP   S+LQAY  NIPG++T DFP  PP +FDYTGNVS +
Sbjct  391   RCQGPNGTRFTASMNNVSFVLPNNMSILQAYQQNIPGVFTNDFPANPPKKFDYTGNVSSS  450

Query  846   LWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTA  667
             LWQP SGT+ Y +KYGSRVQVVLQDT+I T E+HPIHLHGY F+++ +GFGNFN +TDT 
Sbjct  451   LWQPLSGTRGYNLKYGSRVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFNAKTDTK  510

Query  666   KFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEK  487
             KFNLVDPP+RNT+ VP  GWAVIRF ADNPG W+MHCH+D H+ WGLAM F+V+NG GE 
Sbjct  511   KFNLVDPPMRNTVAVPANGWAVIRFVADNPGAWIMHCHLDVHINWGLAMVFLVDNGVGEL  570

Query  486   QTVEPPPLDLPRC  448
             Q +EPPP DLP C
Sbjct  571   QXIEPPPADLPVC  583



>ref|XP_009407324.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=562

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/547 (65%), Positives = 433/547 (79%), Gaps = 6/547 (1%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             + A+V+  EFVVQ T + RLCK   IITVNGQFPGPTI V+NGD +V+ VVNRARYNVT+
Sbjct  19    SGAEVHYHEFVVQATPVKRLCKAHNIITVNGQFPGPTIEVKNGDTLVINVVNRARYNVTL  78

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQMRT WADGPE+VTQCPI P G+Y YRF IE QEGTLWWHAHS WLRAT+YGA 
Sbjct  79    HWHGVRQMRTAWADGPEFVTQCPIRPSGSYRYRFTIEGQEGTLWWHAHSSWLRATIYGAL  138

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             II+PK  S  PF++PK++IP+LLGEWWNR+ I + R+ + TGAAPN S+A+TING+PGDL
Sbjct  139   IIHPKDNS-CPFTKPKREIPVLLGEWWNRNPIDVVRRAKRTGAAPNNSDAFTINGEPGDL  197

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y+CS +DT       GET L R INAALN +LF ++A HK+ VVGADA+Y KPFTT+V+M
Sbjct  198   YKCSRKDTTVIPAMAGETNLFRFINAALNTELFVAIAGHKMTVVGADASYTKPFTTSVLM  257

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN--LRPGANSRPL  1186
             +GPGQTT+VL+T DQP +RYY+AARAYA+AQ  PFDNTTTTA+LEY      P    +P 
Sbjct  258   LGPGQTTDVLVTMDQPVSRYYIAARAYASAQGVPFDNTTTTAILEYDCGCSEPVRVVQPA  317

Query  1185  MPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNN  1006
              P LP +NDT  A+AF+  ++S+  +   V    DE+LFFTVGLGL  C  G  C GPNN
Sbjct  318   FPALPAYNDTRAASAFSAGIKSL--SRVRVPGPVDENLFFTVGLGLFGCPAGKTCGGPNN  375

Query  1005  TRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPS  829
             TRF ASMNNVSFVLP   S+LQA+Y  +PG++T DFP VPPVQFDYT  N+SR+LWQP +
Sbjct  376   TRFGASMNNVSFVLPDSYSILQAHYQGVPGVFTTDFPAVPPVQFDYTSQNISRSLWQPIA  435

Query  828   GTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVD  649
             GTK+YK+KYGS VQ+VLQ T IF  E+HPIH+HGY F+++ +GFGNFNP  D AKFNLVD
Sbjct  436   GTKVYKLKYGSVVQLVLQGTNIFAAENHPIHIHGYDFYILAEGFGNFNPAKDNAKFNLVD  495

Query  648   PPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPP  469
             PP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++E P
Sbjct  496   PPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVGELQSLEAP  555

Query  468   PLDLPRC  448
             P+DLP C
Sbjct  556   PVDLPPC  562



>emb|CAN75316.1| hypothetical protein VITISV_024159 [Vitis vinifera]
Length=566

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/555 (66%), Positives = 427/555 (77%), Gaps = 26/555 (5%)
 Frame = -3

Query  2082  LANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVT  1903
                A+ ++ +FVVQ T + RLCKT   ITVNGQ+PGPT+   NGD + VKV N+ARYNVT
Sbjct  28    FTEAETHHHDFVVQATPVKRLCKTHNTITVNGQYPGPTLEXNNGDTLEVKVTNKARYNVT  87

Query  1902  IHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGA  1723
             IHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF  + QEGTLWWHAHS WLRATVYGA
Sbjct  88    IHWHGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTXQGQEGTLWWHAHSSWLRATVYGA  147

Query  1722  FIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGD  1543
              II+PK GS +PF++PK++ PILLGEWW+ + I + RQ   TGAAPN+S+AYTINGQPGD
Sbjct  148   LIIHPKPGSSYPFTKPKRETPILLGEWWDANPIDVVRQATRTGAAPNVSDAYTINGQPGD  207

Query  1542  LYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVI  1363
             LY CSS+DTV   +  GET LLRVIN+ LNQ+LFF+VANHK  VV ADA+Y KPFTT+VI
Sbjct  208   LYNCSSKDTVIVPIDSGETNLLRVINSGLNQELFFTVANHKFTVVSADASYTKPFTTSVI  267

Query  1362  MVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN----LRPGANS  1195
             M+GPGQTT+VL+T DQPPARYYMAARAY +AQ APFDNTTTTA+LEY +     + G ++
Sbjct  268   MLGPGQTTDVLITGDQPPARYYMAARAYQSAQGAPFDNTTTTAILEYKSAPCPAKKGVST  327

Query  1194  RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTP---  1033
              P+ P LP FNDTAT TAF+   RS     P     P   DESLFFTVGLGL  C P   
Sbjct  328   TPVFPSLPAFNDTATVTAFSKSFRS-----PAKVEVPTDIDESLFFTVGLGLNRCPPKFK  382

Query  1032  GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVS  853
               +CQGPN TRF ASMNNVSFVLP   SLLQA+   IPG++T D+P  PPV+FDYTGNVS
Sbjct  383   SSQCQGPNGTRFTASMNNVSFVLPSNFSLLQAHQQGIPGVFTTDYPAAPPVKFDYTGNVS  442

Query  852   RALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTD  673
             R+LWQP               QVVLQ T+IFT E+HPIHLHGY F+++ +GFGNFNP TD
Sbjct  443   RSLWQPV-----------PEFQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPSTD  491

Query  672   TAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQG  493
             T+KFNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG G
Sbjct  492   TSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVG  551

Query  492   EKQTVEPPPLDLPRC  448
               Q++E PP DLP C
Sbjct  552   ALQSIEXPPADLPLC  566



>emb|CDX74795.1| BnaA05g05410D [Brassica napus]
Length=574

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/567 (63%), Positives = 447/567 (79%), Gaps = 15/567 (3%)
 Frame = -3

Query  2109  FVMLTVLAS-LANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvv  1936
             F+   VL + +A A+  ++ EF++Q TK+ RLC+T   ITVNG FPGP + + NGD +VV
Sbjct  10    FISFAVLFNPMAEANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVINNGDTLVV  69

Query  1935  kvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAH  1756
             KV+NRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAH
Sbjct  70    KVINRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAH  129

Query  1755  SRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             S WLRATVYG+ ++ P +GS +PF  P +++P+LLGEWW+ + + + R++  TGAAPNIS
Sbjct  130   SSWLRATVYGSLLVLPPAGSSYPFPTPHRNVPLLLGEWWDANPVDVLRESIRTGAAPNIS  189

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
             +AYTI+GQPGDLY+CSSQDT    ++ GET+LLRVIN+ALNQ LFF+VANHK  VVGADA
Sbjct  190   DAYTIDGQPGDLYKCSSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKFTVVGADA  249

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             +Y KPFTTNVI++GPGQTT+VL+T DQPP RYYMAARAY +AQN PF NTTTTA+L+Y +
Sbjct  250   SYLKPFTTNVIVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNVPFGNTTTTAILQYKS  309

Query  1215  -------LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
                     + G + +P+MP LP +NDT T T F+   +S+      V  + DE+LF T+G
Sbjct  310   APCCIGGAKKGTSIKPIMPLLPAYNDTNTVTRFSQSFKSL--RKAEVPTELDENLFITIG  367

Query  1056  LGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             LGL NC       RCQG N TRF ASMNNVSF LP   SLLQA+++NIPG++T DFP  P
Sbjct  368   LGLNNCPKNFRSRRCQGLNGTRFTASMNNVSFALPSNYSLLQAHHHNIPGVFTTDFPAKP  427

Query  885   PVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PV+FDYTG N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHGY F++V
Sbjct  428   PVKFDYTGSNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIV  487

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
              +GFGNFNP+ D  KFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D+H++WG
Sbjct  488   AEGFGNFNPKKDIGKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWG  547

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAMAF+VENG+G  +T+E PP DLP C
Sbjct  548   LAMAFLVENGKGLLETIEEPPADLPVC  574



>ref|XP_009143220.1| PREDICTED: laccase-5 [Brassica rapa]
Length=574

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/567 (63%), Positives = 447/567 (79%), Gaps = 15/567 (3%)
 Frame = -3

Query  2109  FVMLTVLAS-LANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvv  1936
             F+   VL + +A A+  ++ EF++Q TK+ RLC+T   ITVNG FPGP + + NGD +VV
Sbjct  10    FISFAVLFNPMAEANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVINNGDTLVV  69

Query  1935  kvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAH  1756
             KV+NRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAH
Sbjct  70    KVINRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAH  129

Query  1755  SRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             S WLRATVYG+ ++ P +GS +PF  P +++P+LLGEWW+ + + + R++  TGAAPNIS
Sbjct  130   SSWLRATVYGSLLVLPPAGSSYPFPTPHRNVPLLLGEWWDANPVDVLRESIRTGAAPNIS  189

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
             +AYTI+GQPGDLY+CSSQDT    ++ GET+LLRVIN+ALNQ LFF+VANHK  VVGADA
Sbjct  190   DAYTIDGQPGDLYKCSSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKFTVVGADA  249

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             +Y KPFTTNVI++GPGQTT+VL+T DQPP RYYMAARAY +AQN PF NTTTTA+L+Y +
Sbjct  250   SYLKPFTTNVIVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNVPFGNTTTTAILQYKS  309

Query  1215  -------LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
                     + G + +P+MP LP +NDT T T F+   +S+      V  + DE+LF T+G
Sbjct  310   APCCIGGAKKGTSIKPIMPLLPAYNDTNTVTRFSQSFKSL--RKAEVPTELDENLFITIG  367

Query  1056  LGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVP  886
             LGL NC       RCQG N TRF ASMNNVSF LP   SLLQA+++NIPG++T DFP  P
Sbjct  368   LGLNNCPKNFRSRRCQGLNGTRFTASMNNVSFALPSNYSLLQAHHHNIPGVFTTDFPAKP  427

Query  885   PVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PV+FDYTG N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHGY F++V
Sbjct  428   PVKFDYTGSNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDFYIV  487

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
              +GFGNFNP+ D  KFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D+H++WG
Sbjct  488   AEGFGNFNPKKDIRKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDAHISWG  547

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAMAF+VENG+G  +T+E PP DLP C
Sbjct  548   LAMAFLVENGKGLLETIEEPPADLPVC  574



>gb|EPS73068.1| hypothetical protein M569_01687, partial [Genlisea aurea]
Length=561

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/558 (65%), Positives = 433/558 (78%), Gaps = 7/558 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             L ++ ++  + A AD +   FVVQET + RLC  +  +TVNG+FPGPT+ VR GD +VV 
Sbjct  8     LLILSSLFLTTAFADTHYHNFVVQETPVKRLCNVRDRLTVNGKFPGPTLKVREGDTLVVN  67

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             VVNRARYNVTIHWHG+RQ RT WADGPE+VTQCPI PG  YTYRF +  QEGTLWWHAHS
Sbjct  68    VVNRARYNVTIHWHGIRQFRTGWADGPEFVTQCPIRPGDGYTYRFTVWGQEGTLWWHAHS  127

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II PK G  +PF++P  + PILLG+WW+ + + +  +   TGAAPN+S+
Sbjct  128   SWLRATVYGALIIRPKKGIPYPFAKPDHESPILLGQWWDENPMDVINRATRTGAAPNVSD  187

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLYRCSSQDT    +  GET LLRVINAA+NQQLFF +A H+  VV ADA+
Sbjct  188   AYTINGQPGDLYRCSSQDTKIIHIDNGETKLLRVINAAMNQQLFFKIAGHRFTVVAADAS  247

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+VIM+GPGQTT+VL+T DQ P RYY+AARAYA+A+ APFDNTTTTA+L+Y + 
Sbjct  248   YVKPFTTSVIMLGPGQTTDVLITGDQQPNRYYIAARAYASARGAPFDNTTTTAILQYAS-  306

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP  1033
                 NS+P+MPQ+P FNDTAT TAF+  LRS P   P   N  D +LFF VGLG+ NC P
Sbjct  307   -GSKNSKPIMPQMPAFNDTATVTAFSASLRS-PRQVPVPGNV-DHNLFFAVGLGVTNCPP  363

Query  1032  GPR---CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
             G     CQGPN  R AASMNNVSFVLP   SLLQAY   IPG++T DFP  PPV+FDYTG
Sbjct  364   GASNSSCQGPNGKRLAASMNNVSFVLPSSVSLLQAYKLGIPGVFTRDFPETPPVRFDYTG  423

Query  861   NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNP  682
             NVS +LW    GTK+Y +KYG  VQ+V+Q T+I   E+HPIHLHGY+F+++ +GFGNF+P
Sbjct  424   NVSTSLWNTVKGTKVYPLKYGETVQLVIQGTSIVGAENHPIHLHGYNFYILAEGFGNFDP  483

Query  681   QTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVEN  502
              TDTAKFNL+DPP RNT  +PVGGW+VIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+
Sbjct  484   NTDTAKFNLIDPPQRNTASLPVGGWSVIRFVADNPGVWLMHCHLDIHITWGLAMAFLVED  543

Query  501   GQGEKQTVEPPPLDLPRC  448
             G GE ++VEPPPLDLP C
Sbjct  544   GVGELESVEPPPLDLPFC  561



>gb|KFK36912.1| hypothetical protein AALP_AA4G189000 [Arabis alpina]
Length=578

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/568 (63%), Positives = 446/568 (79%), Gaps = 16/568 (3%)
 Frame = -3

Query  2109  FVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             F +L + +++  A+  ++ EF++Q TK+ RLC+T   ITVNG FPGP + V NGD +VVK
Sbjct  13    FAVLLLFSTMVEANKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPQLVVNNGDTLVVK  72

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+NRARYN+TIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS
Sbjct  73    VINRARYNITIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHS  132

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYG+ ++ P +GS +PF  P +++P+LLGEWW+ + + + R++  TG APNIS+
Sbjct  133   SWLRATVYGSLLVLPPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRESIRTGGAPNISD  192

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLY+CSS+DT    ++ GET+LLRVIN+ALNQ LFF+VANHKL VVGADA+
Sbjct  193   AYTINGQPGDLYKCSSKDTTIVPINVGETILLRVINSALNQALFFTVANHKLTVVGADAS  252

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTTNV+++GPGQTT+VL+T DQPP RYYMAARAY +AQNAPF NTTTTA+L+Y + 
Sbjct  253   YLKPFTTNVVVLGPGQTTDVLITGDQPPNRYYMAARAYQSAQNAPFGNTTTTAILQYKSA  312

Query  1212  ---------RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTV  1060
                        G + +P+MP LP +NDT T T F+   RS+      V  + DE+LF TV
Sbjct  313   PCCGVGGGNNKGLSVKPIMPLLPAYNDTNTVTRFSQSFRSL--KRAEVPTEIDENLFVTV  370

Query  1059  GLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             GLGL NC       RCQGPN TRF ASMNNVSF LP   SLLQA+++NIPG++T DFP  
Sbjct  371   GLGLNNCPKNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHNIPGVFTTDFPAK  430

Query  888   PPVQFDYT-GNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWV  712
             PPV+FDYT  N+SR+L+QP  GTKLYKIKYGSRVQVVLQDT I T E+HPIHLHGY F++
Sbjct  431   PPVKFDYTSSNISRSLYQPVRGTKLYKIKYGSRVQVVLQDTGIVTPENHPIHLHGYDFYI  490

Query  711   VGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAW  532
             + +GFGNFNP+ D AKFNL DPP+RNT+ V V GWAVIRF ADNPGVW+MHCH+D+H++W
Sbjct  491   IAEGFGNFNPKKDIAKFNLEDPPLRNTVGVNVNGWAVIRFVADNPGVWIMHCHLDAHISW  550

Query  531   GLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GLAMAF+VE+G+G  + +E PP DLP C
Sbjct  551   GLAMAFLVEDGKGLLERIEEPPADLPVC  578



>ref|XP_002456566.1| hypothetical protein SORBIDRAFT_03g038550 [Sorghum bicolor]
 gb|EES01686.1| hypothetical protein SORBIDRAFT_03g038550 [Sorghum bicolor]
Length=568

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/545 (64%), Positives = 423/545 (78%), Gaps = 6/545 (1%)
 Frame = -3

Query  2070  DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWH  1891
             +V++ EFVVQET + RLCKT  IITVNGQFPGP + VR GD +V+ VVNRA+YNVTIHWH
Sbjct  26    EVHHHEFVVQETPVKRLCKTHNIITVNGQFPGPMLEVREGDTLVINVVNRAQYNVTIHWH  85

Query  1890  GLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIY  1711
             G+RQMRT WADGPE+VTQCPI PGG+Y YRF IE QEGTLWWHAHS WLRATVYG  II 
Sbjct  86    GIRQMRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVYGGLIIR  145

Query  1710  PKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRC  1531
             P+    +PF++P +++P++LGEWW+ + I + R+ Q TG  PN+S+A+TINGQPGDL++C
Sbjct  146   PRENKTYPFAKPSREVPLILGEWWDANPIDVIREAQKTGGGPNVSDAFTINGQPGDLFKC  205

Query  1530  SSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGP  1351
             S ++T    V  GET LLR INAALN +LF ++A HK+ VV  DA+Y KPFTT+V+M+ P
Sbjct  206   SQKETTAIPVKAGETALLRFINAALNHELFVTIAQHKMTVVATDASYTKPFTTSVLMIAP  265

Query  1350  GQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---TNLRPGANSRPLMP  1180
             GQTT+VL+T DQ P RYY+AARAY + QN  FDNTTTTAVLEY        G   +P  P
Sbjct  266   GQTTDVLVTMDQAPTRYYVAARAYVSGQNVAFDNTTTTAVLEYDCGCASDFGPKIQPAFP  325

Query  1179  QLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNN-T  1003
              LP FNDT+ ATAF   ++S   N   +    DE LFFTVGLGL NC PG  C+GPNN T
Sbjct  326   ALPAFNDTSAATAFAAGIKS--PNRVKIHENVDEYLFFTVGLGLFNCKPGQLCKGPNNNT  383

Query  1002  RFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGT  823
             RF ASMNNVSFV P+  SLL A+Y  +PG++T DFP  PPVQFDYTGNVS+ALWQP  GT
Sbjct  384   RFTASMNNVSFVFPKSDSLLHAHYYKVPGVFTTDFPAYPPVQFDYTGNVSQALWQPVPGT  443

Query  822   KLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPP  643
             KLY +++GS VQVVLQDT+I T E+HPIH+HGY F+++ +GFGNF+P+ D  KFN VDPP
Sbjct  444   KLYPLRFGSVVQVVLQDTSIVTPENHPIHIHGYDFFILAEGFGNFDPKKDVEKFNYVDPP  503

Query  642   VRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPL  463
              RNT+ VPV GWAVI+F ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++EPPP+
Sbjct  504   QRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGELQSLEPPPV  563

Query  462   DLPRC  448
             DLP C
Sbjct  564   DLPMC  568



>ref|XP_010921047.1| PREDICTED: LOW QUALITY PROTEIN: laccase-3-like [Elaeis guineensis]
Length=572

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/563 (65%), Positives = 442/563 (79%), Gaps = 14/563 (2%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             + + L  + +  NA V+  +FV+Q+T + RLCKT  IITVNGQ+PGPT+ VRNGD +V+ 
Sbjct  16    ILLCLCFVFNYTNAKVHYYDFVIQDTPVKRLCKTHRIITVNGQYPGPTLEVRNGDTLVIN  75

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
              VNRA+YN+T+HWHG+ Q RT WADGPEY+TQCPIMPGG+YTYRF IENQEGTLWWHAHS
Sbjct  76    AVNRAKYNITLHWHGVHQNRTGWADGPEYLTQCPIMPGGSYTYRFTIENQEGTLWWHAHS  135

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATV+GA II+PK GS++PF +P K+IP++LGEWWNR+ I + RQ   TGAAPNIS+
Sbjct  136   SWLRATVHGALIIHPKEGSNYPFPKPNKEIPVILGEWWNRNPIDVLRQALKTGAAPNISD  195

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             A+ INGQPGDLY CSS+DT    V+ GET LLR++NAALN +LFFS+A HK+ VV ADAA
Sbjct  196   AFLINGQPGDLYNCSSKDTTVIPVASGETNLLRIVNAALNNELFFSIAGHKMTVVAADAA  255

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+V+ +GPG+TT+VL+T DQPP RYYMAARA+ATAQ  PFDNTTTTA+LEY + 
Sbjct  256   YTKPFTTSVLKMGPGETTDVLVTTDQPPGRYYMAARAFATAQGVPFDNTTTTAILEYNSN  315

Query  1212  RPGANSR----PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGL  1054
              P    +    P  P LP FNDTATA A+   +RS     P   N P   DE LFFTVGL
Sbjct  316   CPTTEIQPKTPPKFPVLPAFNDTATAAAYDAGIRS-----PHPVNLPGPVDEHLFFTVGL  370

Query  1053  GLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             GL NC  G +C GPNNTRF ASMNNVSF  PR  S+L+AYY +  G++T DFP  PPVQF
Sbjct  371   GLFNCPRGKQCGGPNNTRFGASMNNVSFTFPRY-SILEAYYQHKNGVFTTDFPAFPPVQF  429

Query  873   DYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGF  697
             DYT  N+SRAL QP  GTKLY +KYGS VQ+V+Q T IF  E+HP+H+HGY F+++ QGF
Sbjct  430   DYTAKNISRALQQPARGTKLYPLKYGSVVQLVMQGTNIFAGEEHPMHIHGYQFYILAQGF  489

Query  696   GNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMA  517
             GNF+P+TDTAKFNLVDPP+ NT+ VPV GWAVIRF A+NPGVWL+HCH+D HL WGLAMA
Sbjct  490   GNFDPRTDTAKFNLVDPPLXNTVGVPVNGWAVIRFVANNPGVWLVHCHLDVHLTWGLAMA  549

Query  516   FIVENGQGEKQTVEPPPLDLPRC  448
             F+VENG GE Q++EPPP DLP+C
Sbjct  550   FLVENGVGELQSLEPPPADLPKC  572



>gb|KGN65840.1| hypothetical protein Csa_1G533470 [Cucumis sativus]
Length=531

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/475 (71%), Positives = 393/475 (83%), Gaps = 4/475 (1%)
 Frame = -3

Query  1896  WHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFI  1717
             WHG+RQ+R PWADGPE++TQC I PGGTYTYRF IE QEGTLWWHAHSRWLRATVYGA I
Sbjct  49    WHGIRQLRNPWADGPEFITQCSIKPGGTYTYRFTIEGQEGTLWWHAHSRWLRATVYGALI  108

Query  1716  IYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLY  1537
             IYPK GS  PF  PKK+ P+LLGEW++RD I++ RQ  FTGA PN+S+AYTINGQPGD Y
Sbjct  109   IYPKLGSPRPFIMPKKEFPLLLGEWFDRDPISVLRQALFTGAGPNVSDAYTINGQPGDFY  168

Query  1536  RCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMV  1357
              CS ++T++ +V  GET+LLR+IN+ALNQ+LFFS+ANH++ VV  DAAY KPF TNVIMV
Sbjct  169   ICSKKETMRLAVDSGETILLRIINSALNQELFFSIANHQMTVVAVDAAYTKPFATNVIMV  228

Query  1356  GPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRPLMPQ  1177
             GPGQTT+VL+TA+QPPA YYMAA AY TAQNAPFDNTTTTA+L+Y NL P  N +P++ Q
Sbjct  229   GPGQTTDVLVTANQPPAYYYMAATAYNTAQNAPFDNTTTTAILQYNNLPPQQNPQPILAQ  288

Query  1176  LPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP--GPRCQGPNNT  1003
             LP FNDT TAT FT QLRS   N  +V    DE+LFFTVGLGL NCT    PRCQGPN T
Sbjct  289   LPNFNDTPTATRFTDQLRS--PNRVSVPLHIDENLFFTVGLGLNNCTNPNSPRCQGPNGT  346

Query  1002  RFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGT  823
             RF AS+NNVSFV P+  S++QAYY  +PG++T DFPP PP+QFDYTGNVSR LWQP  GT
Sbjct  347   RFTASINNVSFVFPKSNSIMQAYYQGVPGVFTADFPPFPPLQFDYTGNVSRGLWQPRRGT  406

Query  822   KLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPP  643
             K YK+KYGS VQ+VLQDT+I T E+HP+HLHGYHF+VVG GFGNFNP+TD A+FNL+DPP
Sbjct  407   KAYKLKYGSSVQIVLQDTSIVTPENHPMHLHGYHFYVVGSGFGNFNPRTDPARFNLIDPP  466

Query  642   VRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             VRNTI  P GGW  IRF ADNPG WLMHCHIDSHLAWGLAM F+VENG+GE Q+V
Sbjct  467   VRNTIGTPTGGWVAIRFIADNPGAWLMHCHIDSHLAWGLAMVFLVENGEGEMQSV  521



>ref|XP_010517456.1| PREDICTED: laccase-5-like [Camelina sativa]
Length=577

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/572 (64%), Positives = 450/572 (79%), Gaps = 17/572 (3%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADV---YNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrn  1954
             F++   V+L    S+A A+V   ++ EF++Q TK+ RLC+T   ITVNG FPGPT+ V N
Sbjct  10    FISLAVVLL--FTSMAEANVVKAHHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNN  67

Query  1953  gddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGT  1774
             GD +VVKV+NRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGT
Sbjct  68    GDTLVVKVINRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGT  127

Query  1773  LWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTG  1594
             LWWHAHS WLRATVYG+ ++ P +GS +PF  P +++P+LLGEWW+ + + + R++  TG
Sbjct  128   LWWHAHSSWLRATVYGSLLVLPPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRKSIRTG  187

Query  1593  AAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQ  1414
              AP+ S+AYTINGQPGDLY+CSS+DT    ++ GET+LLRVIN+ALNQ LFF+VANHKL 
Sbjct  188   GAPSNSDAYTINGQPGDLYKCSSRDTTIVPINVGETILLRVINSALNQPLFFTVANHKLT  247

Query  1413  VVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTA  1234
             VVGADA+Y KPFTTNVI++GPGQTT+VL+  DQPP RYYMAARAY +AQNAPF NTTTTA
Sbjct  248   VVGADASYLKPFTTNVIVLGPGQTTDVLIKGDQPPNRYYMAARAYQSAQNAPFGNTTTTA  307

Query  1233  VLEY-TNLRPGANS-----RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESL  1072
             +L+Y T    G  S     +P+MP LP +NDT T T F+   RS+      V  + DE+L
Sbjct  308   ILQYKTAPCCGGGSAKNGIKPIMPLLPAYNDTNTVTRFSQSFRSL--RRAEVPTEIDENL  365

Query  1071  FFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLD  901
             F T+GLGL NC       RCQGPN TRF ASMNNVSF LP   SLLQA+++ IPG++T D
Sbjct  366   FVTIGLGLDNCPKNFRSRRCQGPNGTRFTASMNNVSFTLPSNYSLLQAHHHGIPGVFTTD  425

Query  900   FPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGY  724
             FP  PPV+FDYTG N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHGY
Sbjct  426   FPAKPPVKFDYTGNNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGY  485

Query  723   HFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDS  544
              F++V +GFGNFNP+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D 
Sbjct  486   DFYIVAEGFGNFNPKKDTAKFNLEDPPLRNTVGVPVKGWAVIRFVADNPGVWIMHCHLDV  545

Query  543   HLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             H++WGLAMAF+VENG+G  QT+E PP DLP C
Sbjct  546   HISWGLAMAFLVENGKGVLQTMEQPPPDLPVC  577



>emb|CAA74104.1| laccase [Populus trichocarpa]
 emb|CAC14720.1| laccase [Populus trichocarpa]
Length=574

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/548 (67%), Positives = 433/548 (79%), Gaps = 9/548 (2%)
 Frame = -3

Query  2073  ADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHW  1894
             A  ++ +F VQ TK+ RLCKT   ITVNG FPGPT+ V+NGD +VVKVVNRARYNVTIHW
Sbjct  30    AKTHHHDFTVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTLVVKVVNRARYNVTIHW  89

Query  1893  HGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIEN-QEGTLWWHAHSRWLRATVYGAFI  1717
             HG+RQMRT WADGPE+VTQCPI PGG+YTYRF IE  +  TL WHAHS WLRATVYGA I
Sbjct  90    HGIRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIEGTRRNTLGWHAHSSWLRATVYGALI  149

Query  1716  IYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLY  1537
             I+P+ GS + FS+PK++ PILLGEWW+ + I + R+   TGAAPNIS+AYTINGQPGDL+
Sbjct  150   IHPREGSSYSFSKPKRETPILLGEWWDTNPIDVVREATRTGAAPNISDAYTINGQPGDLF  209

Query  1536  RCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMV  1357
              CSS+DT    +  GET LLRVINAALNQ LFF++ANHK  VVGADA+Y KPFTT+VIM+
Sbjct  210   NCSSKDTTIVPIDSGETNLLRVINAALNQPLFFTIANHKFTVVGADASYLKPFTTSVIML  269

Query  1356  GPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN--SRPLM  1183
             GPGQTT+VL++ DQ P RYYMAARAY +AQNAPFDNTTTTA+LEY ++   A    +P M
Sbjct  270   GPGQTTDVLISGDQLPGRYYMAARAYQSAQNAPFDNTTTTAILEYKSVLCPAKCTKKPFM  329

Query  1182  PQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRCQGP  1012
             P LP +NDTAT TAF+   RS       V    DE+LFFT+GLGL NC       RCQGP
Sbjct  330   PPLPAYNDTATVTAFSRSFRS--PRKVEVPTDIDENLFFTIGLGLNNCPKNFRARRCQGP  387

Query  1011  NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPP  832
             N TRF ASMN VSFV   + SLLQAY   IPG++T DFP  P V+FDYTGNVSR+L+QP 
Sbjct  388   NGTRFTASMNMVSFVF-FKASLLQAYKQKIPGVFTTDFPAKPQVKFDYTGNVSRSLFQPA  446

Query  831   SGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLV  652
              GTKLYK+KYGSRVQ+VLQDT+I T E+HPIHLHGY F+++ +GFGNFNP+TD +KFNLV
Sbjct  447   RGTKLYKLKYGSRVQIVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFNPKTDKSKFNLV  506

Query  651   DPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEP  472
             DPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE G G  Q+VEP
Sbjct  507   DPPMRNTVAVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEEGIGILQSVEP  566

Query  471   PPLDLPRC  448
             PP DLP C
Sbjct  567   PPADLPIC  574



>ref|XP_010505765.1| PREDICTED: laccase-5 [Camelina sativa]
Length=575

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/570 (64%), Positives = 449/570 (79%), Gaps = 15/570 (3%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngd  1948
             F++   V+L    S+A A+  Y+ EF++Q TK+ RLC+T   ITVNG FPGPT+ V NGD
Sbjct  10    FISLAVVLL--FTSMAEANKAYHHEFIIQATKVKRLCETHNSITVNGMFPGPTLVVNNGD  67

Query  1947  dvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLW  1768
              +VVKV+NRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLW
Sbjct  68    TLVVKVINRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLW  127

Query  1767  WHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAA  1588
             WHAHS WLRATVYG+ ++ P +GS +PF  P +++P+LLGEWW+ + + + R++  TG A
Sbjct  128   WHAHSSWLRATVYGSLLVLPPAGSSYPFPNPHRNVPLLLGEWWDANPVDVLRKSIRTGGA  187

Query  1587  PNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVV  1408
             P+ S+AYTINGQPGDLY+CSS+DT    ++ GET+LLRVIN+ALNQ LFF+VANHKL VV
Sbjct  188   PSNSDAYTINGQPGDLYKCSSRDTTIVPINVGETILLRVINSALNQPLFFTVANHKLTVV  247

Query  1407  GADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVL  1228
             GADA+Y KPFTTNVI++GPGQTT+VL+  DQPP RYYMAARAY +AQNAPF NTTTTA+L
Sbjct  248   GADASYLKPFTTNVIVLGPGQTTDVLVKGDQPPNRYYMAARAYQSAQNAPFGNTTTTAIL  307

Query  1227  EY-TNLRPGANS-----RPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFF  1066
             +Y T    G  S     +P+MP LP +NDT T T F+   RS+      V  + DE+LF 
Sbjct  308   QYKTAPCCGGGSAKNGIKPIMPLLPAYNDTNTVTRFSQSFRSL--RRAEVPTEIDENLFV  365

Query  1065  TVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFP  895
             T+GLGL NC       RCQGPN TRF ASMNNVSF LP   SLLQA+++ IPG++T DFP
Sbjct  366   TIGLGLDNCPKNFRSRRCQGPNGTRFTASMNNVSFALPSNYSLLQAHHHGIPGVFTTDFP  425

Query  894   PVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHF  718
               PPV+FDYTG N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLHGY F
Sbjct  426   AKPPVKFDYTGNNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLHGYDF  485

Query  717   WVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHL  538
             ++V +GFG+FNP+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+D H+
Sbjct  486   YIVAEGFGSFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDVHI  545

Query  537   AWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +WGLAMAF+VENG+G  QT+E PP DLP C
Sbjct  546   SWGLAMAFLVENGKGVLQTMEQPPPDLPVC  575



>ref|XP_010931307.1| PREDICTED: laccase-3-like [Elaeis guineensis]
Length=574

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/552 (65%), Positives = 436/552 (79%), Gaps = 14/552 (3%)
 Frame = -3

Query  2076  NADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIH  1897
              A+V+  +FVVQ T + RLCKT  IITVNGQ+PGPT+ V+NGD +V+ VVNRARYNVTIH
Sbjct  28    KAEVHYHDFVVQATPVKRLCKTHNIITVNGQYPGPTLEVKNGDTLVINVVNRARYNVTIH  87

Query  1896  WHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFI  1717
             WHG+RQMRT WADGPE VTQCPI PG +YTYRF IE QEGTLWWHAHS WLRATV+GA I
Sbjct  88    WHGIRQMRTAWADGPEMVTQCPIRPGRSYTYRFTIEGQEGTLWWHAHSSWLRATVHGALI  147

Query  1716  IYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLY  1537
             I+PK  + +PF++PK++IPI+LGEWW+ + I + RQ   TGAAPN S+A+TINGQPGDLY
Sbjct  148   IHPKEKTSYPFTKPKREIPIILGEWWDANPIDVVRQATRTGAAPNTSDAFTINGQPGDLY  207

Query  1536  RCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMV  1357
             +CS + T    V+ GET LLR+INAALN +LFF++A HK+ VVGADA+Y KPFTT+V+M+
Sbjct  208   KCSGKGTTVIPVAAGETNLLRIINAALNTELFFTIAGHKMTVVGADASYTKPFTTSVLML  267

Query  1356  GPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANS-----R  1192
             GPGQTT+VL+T DQP +RYYMAARAYA+AQ  PFDNTTTTA+L+Y        S     +
Sbjct  268   GPGQTTDVLVTMDQPVSRYYMAARAYASAQGVPFDNTTTTAILDYDCGFSAGKSGQGIVQ  327

Query  1191  PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTPGPRC  1021
             P  P+LP +NDTATATAF+T LRS     P   + P   DE+LFFTVGLGL  C  G RC
Sbjct  328   PKFPKLPAYNDTATATAFSTGLRS-----PRKVDIPGPVDENLFFTVGLGLFKCPRGKRC  382

Query  1020  QGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT-GNVSRAL  844
              GPN TRF ASMNN+SFVLP   S+LQA++  +PG++T DFP  PPVQFDYT  NVSR+L
Sbjct  383   GGPNGTRFGASMNNISFVLPANFSILQAHHLGVPGVFTTDFPAQPPVQFDYTAANVSRSL  442

Query  843   WQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAK  664
             WQP + TK+YK+KYGS VQ+VLQ T IF  E+HPIH+HG+ F+++ +GFGNFN   D A+
Sbjct  443   WQPVAATKVYKLKYGSVVQLVLQGTNIFAAENHPIHIHGHDFYILAEGFGNFNAAKDAAR  502

Query  663   FNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQ  484
             FNLVDPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG G  Q
Sbjct  503   FNLVDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGVGMLQ  562

Query  483   TVEPPPLDLPRC  448
             ++EPPP DLP C
Sbjct  563   SLEPPPADLPIC  574



>gb|KHN40112.1| Laccase-3 [Glycine soja]
Length=490

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/488 (70%), Positives = 398/488 (82%), Gaps = 8/488 (2%)
 Frame = -3

Query  1893  HGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFII  1714
             HGLR +R PWADGP YVTQCPI PGG+YTYRF I+NQEGTLWWHAH+ +LRATVYGA II
Sbjct  5     HGLRMLRNPWADGPSYVTQCPIQPGGSYTYRFTIQNQEGTLWWHAHTGFLRATVYGALII  64

Query  1713  YPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYR  1534
             YPK GS +PFS P ++ P+LL EW++RD + L RQTQFTGA PN+S AYTINGQPGDLYR
Sbjct  65    YPKLGSPYPFSMPNREYPLLLAEWFDRDPMVLLRQTQFTGAPPNVSVAYTINGQPGDLYR  124

Query  1533  CSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVG  1354
             CSSQ+TV+  V  GET+LLR+IN+ALNQ+LFF++ANH++ VV  DAAY KPFTTNV+M+G
Sbjct  125   CSSQETVRVPVDAGETILLRIINSALNQELFFAIANHRMTVVATDAAYTKPFTTNVLMIG  184

Query  1353  PGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL----RPGANSRPL  1186
             PGQT NVL+TADQ P RYYMAARAY TA NA FDNTTTTA+LEY +     + G   RP+
Sbjct  185   PGQTINVLVTADQTPGRYYMAARAYQTAMNAAFDNTTTTAILEYKSASCSKKNGQLPRPI  244

Query  1185  MPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP--GPRCQGP  1012
             +P LP FNDTATATA+TT +R +   N  VF + D +L+F VGLGL+NCT    PRCQGP
Sbjct  245   LPVLPAFNDTATATAYTTGIRGLSKIN--VFTKVDVNLYFIVGLGLINCTNPNSPRCQGP  302

Query  1011  NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPP  832
             N TRFAAS+NN SFVLP  TSL+QAYYN IPG++T DFPPVPP+QF+YTGNV R LW P 
Sbjct  303   NGTRFAASINNHSFVLPTTTSLMQAYYNGIPGVFTTDFPPVPPLQFNYTGNVPRGLWTPA  362

Query  831   SGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLV  652
              GTKL+K+KYGS VQ+VLQDT+I TTEDHP+H+HG+HF+VVG GFGNFNP TD A+FNLV
Sbjct  363   RGTKLFKLKYGSNVQIVLQDTSIVTTEDHPMHIHGFHFFVVGSGFGNFNPATDPARFNLV  422

Query  651   DPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEP  472
             DPPVRNTI  P GGW  IRF ADNPG+W +HCHIDSHL WGLA A +VENG G  Q+V P
Sbjct  423   DPPVRNTIGTPPGGWVAIRFVADNPGIWFLHCHIDSHLNWGLATALLVENGVGPSQSVIP  482

Query  471   PPLDLPRC  448
             PP DLP+C
Sbjct  483   PPPDLPQC  490



>emb|CDM84828.1| unnamed protein product [Triticum aestivum]
Length=566

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/565 (63%), Positives = 431/565 (76%), Gaps = 10/565 (2%)
 Frame = -3

Query  2118  AKLFVMLTVLAS--LANA-DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngd  1948
             + L + L  LAS  LA A  V++ EF+VQET + RLC+   IITVNGQFPGPT+ VR GD
Sbjct  4     SGLLLFLGCLASALLAGATKVHHHEFIVQETPVKRLCEEHNIITVNGQFPGPTLEVREGD  63

Query  1947  dvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLW  1768
              +VV VVN+A+YNVTIHWHG+RQ RT WADGPE+VTQCPI PGG+Y YRF IE QEGTLW
Sbjct  64    TLVVNVVNQAQYNVTIHWHGIRQFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLW  123

Query  1767  WHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAA  1588
             WHAHS WLRATVYGA II P+    +PF +P +++PILLGEWWN + + + R+ Q TG A
Sbjct  124   WHAHSSWLRATVYGALIIRPREDKPYPFDKPAREVPILLGEWWNANPVEVIREAQRTGGA  183

Query  1587  PNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVV  1408
             PN+S+A+T+NGQPGDLY CS QDT   SV PGET LLR IN+ALN +LF S+A+HK+ VV
Sbjct  184   PNVSDAFTVNGQPGDLYNCSRQDTTAISVKPGETALLRFINSALNHELFVSIASHKMTVV  243

Query  1407  GADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVL  1228
             G DA+Y KPF T+V+M+ PGQTT+VL+T DQ P RYY+AAR Y T Q   FDNTTTTA+L
Sbjct  244   GVDASYTKPFVTSVLMIAPGQTTDVLVTMDQAPTRYYIAARGYVTTQGVAFDNTTTTAIL  303

Query  1227  EY---TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVG  1057
             EY        G +  P  P LP FNDT  ATAF   ++S       + +  DE+LFFTVG
Sbjct  304   EYDCGCTTDFGPSIPPAFPTLPAFNDTGAATAFAAGIKS--PRKVEIPSPVDENLFFTVG  361

Query  1056  LGLVNCTPGPRCQGP-NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPV  880
             LGL NC PG  C GP NNTRF ASMNNVSFV P+ TSLL A+Y ++PG+YT DFP  PPV
Sbjct  362   LGLFNCEPGQLCAGPNNNTRFTASMNNVSFVFPKATSLLHAHYYDMPGVYTTDFPANPPV  421

Query  879   QFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             QFDYT  NVS++LWQP   TKLYK+++GS VQVVLQDT+I T E+HPIHLHGY F+++ +
Sbjct  422   QFDYTAQNVSQSLWQPIPATKLYKLRFGSVVQVVLQDTSIVTPENHPIHLHGYDFYILAE  481

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGN++ + D AKFNL +PP RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLA
Sbjct  482   GFGNYDAEKDAAKFNLENPPQRNTVAVPVNGWAVIRFRADNPGVWLMHCHLDVHITWGLA  541

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             MAF+VE+G GE Q++E PP+DLP C
Sbjct  542   MAFLVEDGYGELQSLEAPPVDLPMC  566



>ref|XP_008804167.1| PREDICTED: laccase-3-like [Phoenix dactylifera]
Length=576

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/567 (64%), Positives = 443/567 (78%), Gaps = 18/567 (3%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             + + L+++ + ANA V+  +FV+QET + RLCKT  IITVNGQ+PGPT+ VR+GD +V+ 
Sbjct  16    ILLWLSLMFNYANAKVHYYDFVIQETPVKRLCKTHQIITVNGQYPGPTLEVRDGDTLVIN  75

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
              VNRA+YN+T+HWHG+ Q RT WADGPEY+TQCPIMPGG+YTYRF IENQ GTLWWHAHS
Sbjct  76    AVNRAKYNITLHWHGVHQNRTGWADGPEYLTQCPIMPGGSYTYRFTIENQVGTLWWHAHS  135

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLR TV+GA IIYPK GS++PF +P K+IP++LGEWWNR+ + + RQ   TGAAPNIS+
Sbjct  136   SWLRVTVHGALIIYPKEGSYYPFPKPNKEIPVILGEWWNRNPLDVLRQALKTGAAPNISD  195

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             A+ INGQPGDLY CSS+DT    VS GET LLR+INAALN +LFF++A H++ VVGADAA
Sbjct  196   AFLINGQPGDLYNCSSKDTTIIPVSFGETNLLRIINAALNNELFFTIAGHEMTVVGADAA  255

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+V+ + PG+TT+VL+T +QPP RYYMAARAYA+AQ  PFDNTTTTA+L+Y   
Sbjct  256   YTKPFTTSVLKISPGETTDVLVTTNQPPGRYYMAARAYASAQGVPFDNTTTTAILQYNGN  315

Query  1212  RP-------GANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFT  1063
              P        A   P+ P LP FNDTATATAF   ++S     P   N P   D  LF+T
Sbjct  316   CPTTSKAGQAAGIPPMFPALPAFNDTATATAFAAGIKS-----PHPVNLPGPVDVHLFYT  370

Query  1062  VGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYN-NIPGIYTLDFPPVP  886
             VGLGL NC PG +C GPNNTRF ASMNNVSF  P R ++LQAYY+  + G++T DFP  P
Sbjct  371   VGLGLFNCPPGKQCGGPNNTRFGASMNNVSFTFP-RLAILQAYYSQRMRGVFTADFPAFP  429

Query  885   PVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             P QFDYT  N+SRAL QP  GTK+Y +KYGS VQ+VLQ T IF  E+HP+H+HGY F+++
Sbjct  430   PTQFDYTAKNISRALQQPVRGTKVYPLKYGSVVQLVLQGTNIFAGEEHPMHIHGYQFYIL  489

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWG  529
               GFGNF+PQTD AKFNLVDPP+RNT+ VPV GWAVIRF A+NPGVWL+HCH+D HL WG
Sbjct  490   AAGFGNFDPQTDAAKFNLVDPPLRNTVGVPVNGWAVIRFAANNPGVWLVHCHLDVHLTWG  549

Query  528   LAMAFIVENGQGEKQTVEPPPLDLPRC  448
             LAMAF+VENG GE Q++EPPP DLPRC
Sbjct  550   LAMAFLVENGVGELQSLEPPPADLPRC  576



>ref|XP_004970425.1| PREDICTED: laccase-3-like [Setaria italica]
Length=567

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/547 (63%), Positives = 423/547 (77%), Gaps = 7/547 (1%)
 Frame = -3

Query  2073  ADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHW  1894
             A+V++ EFVVQET + RLCKT  IITVNGQFPGPT+ VR GD +V+ VVNRA+Y+VTIHW
Sbjct  23    AEVHHHEFVVQETPVKRLCKTHNIITVNGQFPGPTLEVREGDTLVINVVNRAQYDVTIHW  82

Query  1893  HGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFII  1714
             HG+RQ+RT WADGPE+VTQCPI PGG+Y YRF IE QEGTLWWHAHS WLRATVYGA II
Sbjct  83    HGIRQLRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVYGALII  142

Query  1713  YPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYR  1534
              P+    +PF +P +++P++LGEWWN + + + R+ Q TG APN+S+A+TINGQPGD  +
Sbjct  143   RPRENKTYPFEKPSREVPVILGEWWNANPVDVIREAQRTGGAPNVSDAFTINGQPGDFLK  202

Query  1533  CSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVG  1354
             CS ++T    V PGET LLR INAALN +LF ++A HK+ VV ADA+Y KPFTT+V+M+ 
Sbjct  203   CSEKETTAIPVKPGETALLRFINAALNHELFVTIAQHKMTVVAADASYTKPFTTSVLMIA  262

Query  1353  PGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---TNLRPGANSRPLM  1183
             PGQTT+VL+T DQ P RYY+AARAY + QN  FDNTTTTAV+EY        G   +P  
Sbjct  263   PGQTTDVLVTMDQAPTRYYVAARAYVSGQNVAFDNTTTTAVIEYDCGCASDFGPKIQPAF  322

Query  1182  PQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGP-NN  1006
             P LP FNDTA ATAF   ++S   +   V    DE LFFTVGLGL NC PG  C GP NN
Sbjct  323   PALPAFNDTAAATAFAAGIKS--PDRVKVHENVDEYLFFTVGLGLFNCKPGELCAGPNNN  380

Query  1005  TRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPS  829
             TRF ASMNNVSFV P++ SLL A+Y  +PG++T DFP  PPVQFDYT  NVS+ALWQP  
Sbjct  381   TRFTASMNNVSFVFPKKDSLLHAHYYKVPGVFTTDFPAYPPVQFDYTAKNVSQALWQPVP  440

Query  828   GTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVD  649
              TKLY +++GS VQ+VLQDT+I T E+HPIH+HGY F+++ +GFGNF+P+ D  KFN VD
Sbjct  441   ATKLYPLRFGSVVQLVLQDTSIVTPENHPIHIHGYDFFILAEGFGNFDPKKDVEKFNYVD  500

Query  648   PPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPP  469
             PP RNT+ VPV GW VI+F ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++EPP
Sbjct  501   PPQRNTVAVPVNGWTVIQFVADNPGVWLMHCHLDVHINWGLAMAFLVEDGYGELQSLEPP  560

Query  468   PLDLPRC  448
             P+DLP C
Sbjct  561   PVDLPMC  567



>gb|EMT06365.1| Laccase-3 [Aegilops tauschii]
Length=566

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/545 (64%), Positives = 420/545 (77%), Gaps = 7/545 (1%)
 Frame = -3

Query  2067  VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHG  1888
             V++ EFVVQET + RLC+   IITVNGQFPGPT+ VR GD +VV VVN+A+YNVTIHWHG
Sbjct  24    VHHHEFVVQETPVKRLCEEHNIITVNGQFPGPTLEVREGDTLVVNVVNQAQYNVTIHWHG  83

Query  1887  LRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYP  1708
             +RQ RT WADGPE+VTQCPI PGG+Y YRF IE QEGTLWWHAHS WLRATVYGA II P
Sbjct  84    IRQFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVYGALIIRP  143

Query  1707  KSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCS  1528
             +    +PF +P +++PILLGEWWN + + + R+ Q TG APN+S+A+T+NGQPGDLY CS
Sbjct  144   REDKPYPFEKPAREVPILLGEWWNANPVEVIREAQRTGGAPNVSDAFTVNGQPGDLYNCS  203

Query  1527  SQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPG  1348
              QDT   SV PGET LLR IN+ALN +LF S+A+HK+ VVG DA+Y KPF T+V+M+ PG
Sbjct  204   RQDTTAISVKPGETALLRFINSALNHELFVSIASHKMTVVGVDASYTKPFVTSVLMIAPG  263

Query  1347  QTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---TNLRPGANSRPLMPQ  1177
             QTT+VL+T DQ P RYY+AAR Y T Q   FDNTTTTA+LEY        G    P  P 
Sbjct  264   QTTDVLVTMDQAPTRYYIAARGYVTTQGVAFDNTTTTAILEYDCGCTTDFGPTIPPAFPT  323

Query  1176  LPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGP-NNTR  1000
             LP FNDT  ATAF   ++S       + +  DE+LFFTVGLGL NC PG  C GP NNTR
Sbjct  324   LPAFNDTGAATAFAAGIKS--PRKVEIPSPVDENLFFTVGLGLFNCEPGQLCAGPNNNTR  381

Query  999   FAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPSGT  823
             F ASMNNVSFV P+ TSLL A+Y ++PG+YT DFP  PPVQFDYT  NVS++LWQP   T
Sbjct  382   FTASMNNVSFVFPKATSLLHAHYYDMPGVYTTDFPANPPVQFDYTAQNVSQSLWQPIPAT  441

Query  822   KLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPP  643
             KLYK+++GS VQVVLQDT+I T E+HPIHLHGY F+++ +GFGN++ + D AKFNL +PP
Sbjct  442   KLYKLRFGSVVQVVLQDTSIVTPENHPIHLHGYDFYILAEGFGNYDAEKDAAKFNLENPP  501

Query  642   VRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPL  463
              RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++E PP+
Sbjct  502   QRNTVAVPVNGWAVIRFRADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGELQSLEAPPV  561

Query  462   DLPRC  448
             DLP C
Sbjct  562   DLPMC  566



>ref|XP_003564513.1| PREDICTED: laccase-3 [Brachypodium distachyon]
Length=566

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/550 (63%), Positives = 421/550 (77%), Gaps = 16/550 (3%)
 Frame = -3

Query  2070  DVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWH  1891
             +V++ EF+VQET + RLCK   IITVNGQFPGPT+ VR GD +VV VVN+A+YNVTIHWH
Sbjct  24    EVHHHEFIVQETPVKRLCKEHNIITVNGQFPGPTLEVREGDTLVVNVVNQAQYNVTIHWH  83

Query  1890  GLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIY  1711
             G+RQ RT WADGPE+VTQCPI PGG+Y Y+F IE QEGTLWWHAHS WLRATVYGA II 
Sbjct  84    GIRQFRTGWADGPEFVTQCPIKPGGSYKYKFTIEGQEGTLWWHAHSSWLRATVYGALIIR  143

Query  1710  PKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRC  1531
             P+    +PF +P +++P++LGEWW+ + I + R+ Q TG  PN+S+A+T+NGQPGDLY C
Sbjct  144   PREDKAYPFEKPSREVPLMLGEWWDANPIDVIREAQRTGGGPNVSDAFTVNGQPGDLYNC  203

Query  1530  SSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGP  1351
             S ++T   SV PGET LLR IN+ALN +LF S+ANHK+ VVGADA+Y +PF T+V+M+ P
Sbjct  204   SREETTAISVKPGETALLRFINSALNHELFVSIANHKMTVVGADASYTEPFVTSVLMIAP  263

Query  1350  GQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY-----TNLRPGANSRPL  1186
             GQTT+VL+T DQ P RYY+AAR Y T Q   FDNTTTTA+LEY     T+  P    RP 
Sbjct  264   GQTTDVLVTMDQAPTRYYIAARGYVTTQGVAFDNTTTTAILEYDCGCSTDFGPAI--RPA  321

Query  1185  MPQLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTPGPRCQG  1015
              P LP FNDT+ ATAF   ++S     P     P   DE+LFFTVGLGL NC PG +C  
Sbjct  322   FPTLPAFNDTSAATAFAAGIKS-----PRKVEIPSPVDENLFFTVGLGLFNCKPGQQCGA  376

Query  1014  PNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQ  838
             PNNTRF ASMNN+SFV P+ TSLL A+Y +IP ++T DFP  P VQFDYT  NVSR+LWQ
Sbjct  377   PNNTRFTASMNNISFVFPKATSLLHAHYYDIPDVFTTDFPAYPSVQFDYTAQNVSRSLWQ  436

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P   TKLYK++Y S VQ+VLQDT+I T E+HPIHLHGY F+++ +GFGNF+ + D  KFN
Sbjct  437   PIPATKLYKLRYNSVVQIVLQDTSIVTPENHPIHLHGYDFYILAEGFGNFDAKKDAEKFN  496

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             L +PP RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+G G+ QT+
Sbjct  497   LENPPQRNTVAVPVNGWAVIRFRADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGKLQTL  556

Query  477   EPPPLDLPRC  448
             E PP+DLP C
Sbjct  557   EAPPVDLPMC  566



>gb|EEC71732.1| hypothetical protein OsI_04280 [Oryza sativa Indica Group]
Length=599

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/586 (61%), Positives = 429/586 (73%), Gaps = 38/586 (6%)
 Frame = -3

Query  2097  TVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnra  1918
             +VLA LA A+V++ EF+VQET + RLCKT  +ITVNGQ PGPT+ VR GD VV+ VVN A
Sbjct  16    SVLALLAGAEVHHHEFIVQETPVKRLCKTHNVITVNGQLPGPTLEVREGDTVVINVVNHA  75

Query  1917  rynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRA  1738
             +YNVTIHWHG+RQ RT WADGPE+VTQCPI PGG+Y YRF IE QEGTLWWHAHS WLRA
Sbjct  76    QYNVTIHWHGIRQFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRA  135

Query  1737  TVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTIN  1558
             TVYGA II P+    +PF +P +++P++LGEWW+ D I + R+ Q TGAAPNIS+AYTIN
Sbjct  136   TVYGALIIRPRENKTYPFEKPAREVPLILGEWWDADPIQVIREAQRTGAAPNISDAYTIN  195

Query  1557  GQPGDLYRCSSQ--------------------------------DTVKFSVSPGETVLLR  1474
             GQPGDLY CS +                                +T    V PGET LLR
Sbjct  196   GQPGDLYNCSKEGRKSLTLVCVFYQPVCVRQCVANLQRHDNMHAETTAVPVKPGETALLR  255

Query  1473  VINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyym  1294
              INAALNQ+LF S+A HK+ VVG DA+Y KPFTT+V+M+ PGQTT+VL+T DQ P RYY+
Sbjct  256   FINAALNQELFVSIAQHKMTVVGVDASYTKPFTTSVLMIAPGQTTDVLVTMDQAPTRYYL  315

Query  1293  aarayataqnaPFDNTTTTAVLEY---TNLRPGANSRPLMPQLPFFNDtatataftTQLR  1123
             AARAY +AQ   FDNTTTTAV+EY        G +  P  P LP FNDT TATAF   +R
Sbjct  316   AARAYDSAQGVAFDNTTTTAVIEYDCGCATDFGPSIPPAFPVLPAFNDTNTATAFAAGIR  375

Query  1122  SVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLL  943
             S   +   +    DE+LFFTVG+GL NC PG +C GPNNTRF ASMNN+SFV P+ TSLL
Sbjct  376   S--PHEVKIPGPVDENLFFTVGVGLFNCEPGQQCGGPNNTRFTASMNNISFVFPQTTSLL  433

Query  942   QAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTA  766
              A+Y  IPG++T DFP  PPVQFDYT  NV R LWQP   TKLYK+K+GS VQ+VLQDT+
Sbjct  434   HAHYYGIPGVFTTDFPAYPPVQFDYTAQNVPRYLWQPVPATKLYKLKFGSVVQIVLQDTS  493

Query  765   IFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFA  586
             I + E+HPIH+HGY F+++ +GFGNF+P+ D  KFN VDPP RNT+ VP  GWAVIRF A
Sbjct  494   IVSPENHPIHIHGYDFYILAEGFGNFDPKKDAKKFNYVDPPQRNTVAVPTNGWAVIRFVA  553

Query  585   DNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             DNPGVWLMHCH+D H+ WGLAMAF+VE+G G+ +T+E PP+DLP C
Sbjct  554   DNPGVWLMHCHLDVHITWGLAMAFLVEDGYGKLETLEAPPVDLPMC  599



>tpg|DAA57028.1| TPA: putative laccase family protein [Zea mays]
Length=572

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/550 (63%), Positives = 428/550 (78%), Gaps = 8/550 (1%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             A+A+V++ EFV+QET + RLCKT  IITVNGQ+PGPT+ VR GD +V+ VVNRA+YN TI
Sbjct  25    ADAEVHHHEFVIQETPVKRLCKTHNIITVNGQYPGPTLEVREGDTLVINVVNRAQYNATI  84

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQ+RT WADGPE+VTQCPI PGG+Y YRF I+ QEGTLWWHAHS WLRATVYGA 
Sbjct  85    HWHGIRQIRTGWADGPEFVTQCPIRPGGSYKYRFTIQGQEGTLWWHAHSSWLRATVYGAL  144

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             II P+    +PF++P +++P++LGEWW+ + I + R+ Q TG  PN+S+A+TINGQPGDL
Sbjct  145   IIRPRENKTYPFAKPSREVPVILGEWWDANPIDVIREAQRTGGGPNVSDAFTINGQPGDL  204

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y+CS+++T    V  GET LLR INAALN +LF ++A HK+ VV  DA+Y KPFTT+V+M
Sbjct  205   YKCSNKETTAIPVKAGETALLRFINAALNHELFVTIAQHKMTVVATDASYTKPFTTSVLM  264

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---TNLRPGANSRP  1189
             + PGQTT+VL+T DQPP RYY+AARAY + QN  FDNTTTTAVLEY        G   +P
Sbjct  265   LAPGQTTDVLVTMDQPPTRYYVAARAYVSGQNVAFDNTTTTAVLEYDCGCASDFGPKIQP  324

Query  1188  LMP-QLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGP  1012
               P  LP FNDT+ ATAF   +RS   +   V    DE LFFTVGLGL NC PG  C GP
Sbjct  325   AFPAALPAFNDTSAATAFAAGIRS--PDRVKVHENVDEYLFFTVGLGLFNCKPGQLCAGP  382

Query  1011  -NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQ  838
              NNTRFAASMNNVSFV P+  SLL A+Y  IPG++T DFP  PPVQFDYTG NVS+ALWQ
Sbjct  383   NNNTRFAASMNNVSFVFPQTDSLLHAHYYKIPGVFTTDFPAYPPVQFDYTGQNVSQALWQ  442

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P   TKLY +++GS VQ+VLQDT+I T E+HPIH+HGY F+++ +GFGNF+P+ D  KFN
Sbjct  443   PVPATKLYPLRFGSVVQLVLQDTSIVTPENHPIHIHGYDFFILAEGFGNFDPKKDVEKFN  502

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
              VDPP RNT+ VPV GWAVI+F ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++
Sbjct  503   YVDPPQRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGELQSL  562

Query  477   EPPPLDLPRC  448
             EPPP+DLP C
Sbjct  563   EPPPVDLPMC  572



>ref|NP_001148479.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG31666.1| L-ascorbate oxidase precursor [Zea mays]
Length=572

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/550 (63%), Positives = 428/550 (78%), Gaps = 8/550 (1%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             A+A+V++ EFV+QET + RLCKT  IITVNGQ+PGPT+ VR GD +V+ VVNRA+YN TI
Sbjct  25    ADAEVHHHEFVIQETPVKRLCKTHNIITVNGQYPGPTLEVREGDTLVINVVNRAQYNATI  84

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQ+RT WADGPE+VTQCPI PGG+Y YRF I+ QEGTLWWHAHS WLRATVYGA 
Sbjct  85    HWHGIRQIRTGWADGPEFVTQCPIRPGGSYKYRFTIQGQEGTLWWHAHSSWLRATVYGAL  144

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             II P+    +PF++P +++P++LGEWW+ + I + R+ Q TG  PN+S+A+TINGQPGDL
Sbjct  145   IIRPRENKTYPFAKPSREVPVILGEWWDANPIDVIREAQRTGGGPNVSDAFTINGQPGDL  204

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y+CS+++T    V  GET LLR INAALN +LF ++A HK+ VV  DA+Y KPFTT+V+M
Sbjct  205   YKCSNKETTAIPVEAGETALLRFINAALNHELFVTIAQHKMTVVATDASYTKPFTTSVLM  264

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---TNLRPGANSRP  1189
             + PGQTT+VL+T DQPP RYY+AARAY + QN  FDNTTTTAVLEY        G   +P
Sbjct  265   LAPGQTTDVLVTMDQPPTRYYVAARAYVSGQNVAFDNTTTTAVLEYDCGCASDFGPKIQP  324

Query  1188  LMP-QLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGP  1012
               P  LP FNDT+ ATAF   +RS   +   V    DE LFFTVGLGL NC PG  C GP
Sbjct  325   AFPAALPAFNDTSAATAFAAGIRS--PDRVKVHENVDEYLFFTVGLGLFNCKPGQLCAGP  382

Query  1011  -NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQ  838
              NNTRFAASMNNVSFV P+  SLL A+Y  IPG++T DFP  PPVQFDYTG NVS+ALWQ
Sbjct  383   NNNTRFAASMNNVSFVFPQTDSLLHAHYYKIPGVFTTDFPAYPPVQFDYTGQNVSQALWQ  442

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P   TKLY +++GS VQ+VLQDT+I T E+HPIH+HGY F+++ +GFGNF+P+ D  KFN
Sbjct  443   PVPATKLYPLRFGSVVQLVLQDTSIVTPENHPIHIHGYDFFILAEGFGNFDPKKDVEKFN  502

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
              VDPP RNT+ VPV GWAVI+F ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++
Sbjct  503   YVDPPQRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGELQSL  562

Query  477   EPPPLDLPRC  448
             EPPP+DLP C
Sbjct  563   EPPPVDLPMC  572



>emb|CDY18869.1| BnaC04g04810D [Brassica napus]
Length=574

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/574 (62%), Positives = 442/574 (77%), Gaps = 18/574 (3%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLAN-----ADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvr  1957
             + K F      A L N     +  ++ EF++Q TK+ RLC+T   ITVNG FPGP + + 
Sbjct  3     IIKSFFCFISFAVLFNPMAEASKAHHHEFIIQATKVKRLCETHNSITVNGIFPGPQLVIN  62

Query  1956  ngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEG  1777
             NGD +VVKV+NRARYNVTIHWHG+RQMRT WADGPE+VTQCPI PG +Y YRF I+ QEG
Sbjct  63    NGDTLVVKVINRARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGSSYIYRFTIQGQEG  122

Query  1776  TLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFT  1597
             TLWWHAHS WLRATVYG+ ++ P +GS  PF  P +++P+LLGEWW+ + + +  ++  T
Sbjct  123   TLWWHAHSSWLRATVYGSLLVLPSAGSSHPFPTPHRNVPLLLGEWWDANPVDVLGESIRT  182

Query  1596  GAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKL  1417
             GAAPNIS+AYTI+GQPGDLY+CSSQDT    ++ GET+LLRVIN+ALNQ LFF+VANHK 
Sbjct  183   GAAPNISDAYTIDGQPGDLYKCSSQDTTIVPINVGETILLRVINSALNQPLFFTVANHKF  242

Query  1416  QVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTT  1237
              VVGADA+Y KPFTTNVI++GPGQTT+ L+T DQPP RYYMAARAY +AQN PF NTTTT
Sbjct  243   TVVGADASYLKPFTTNVIVLGPGQTTDALITGDQPPNRYYMAARAYQSAQNVPFGNTTTT  302

Query  1236  AVLEYTN-------LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDE  1078
             A+L+Y +        + G + +P+MP LP +NDT T T F+   +S+      V  + DE
Sbjct  303   AILQYKSAPCCIGGAKKGISIKPIMPLLPAYNDTNTVTRFSQSFKSL--RKAEVPTELDE  360

Query  1077  SLFFTVGLGLVNCTP---GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYT  907
             +LF T+GLGL NC       RCQG N TRF ASMNNVSF LP   SLLQA++++I G++T
Sbjct  361   NLFITIGLGLNNCPKNFRSRRCQGLNGTRFTASMNNVSFALPSNYSLLQAHHHSIHGVFT  420

Query  906   LDFPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLH  730
              DFP  PPV+FDYTG N+SR+L+QP  GTKLYK+KYGSRVQ+VLQDT I T E+HPIHLH
Sbjct  421   TDFPAKPPVKFDYTGSNISRSLYQPDRGTKLYKLKYGSRVQIVLQDTGIVTPENHPIHLH  480

Query  729   GYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHI  550
             GY F++V +GFGNFNP+ DTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVW+MHCH+
Sbjct  481   GYDFYIVAEGFGNFNPKKDTAKFNLEDPPLRNTVGVPVNGWAVIRFVADNPGVWIMHCHL  540

Query  549   DSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             D+H++WGLAMAF+VENG+G  +T+E PP DLP C
Sbjct  541   DAHISWGLAMAFLVENGKGLLETIEEPPADLPVC  574



>ref|NP_001183899.1| putative laccase family protein precursor [Zea mays]
 gb|ACN28316.1| unknown [Zea mays]
 gb|ACR38706.1| unknown [Zea mays]
 gb|AFW84716.1| putative laccase family protein [Zea mays]
Length=571

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/548 (64%), Positives = 423/548 (77%), Gaps = 7/548 (1%)
 Frame = -3

Query  2076  NADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIH  1897
             +A+V++ EFVVQET + RLCKT  +ITVNGQ+PGPT+ VR GD +V+ VVNRA+YNVTIH
Sbjct  26    DAEVHHHEFVVQETPVKRLCKTHNVITVNGQYPGPTLEVREGDTLVINVVNRAQYNVTIH  85

Query  1896  WHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFI  1717
             WHG+RQMRT WADGPE+VTQCPI PGG+Y YRF IE QEGTLWWHAHS WLRATVYGA I
Sbjct  86    WHGIRQMRTGWADGPEFVTQCPIRPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVYGALI  145

Query  1716  IYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLY  1537
             I P+    +PF++P +++P++LGEWW+ + I + R+ Q TG APN+S+A+TINGQPGDLY
Sbjct  146   IRPRENKTYPFAKPSREVPVILGEWWDANPIDVIREAQRTGGAPNVSDAFTINGQPGDLY  205

Query  1536  RCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMV  1357
             +CS ++T    V PGET LLR INAALN +LF ++A H++ VV  DA+Y KPFTT+V+MV
Sbjct  206   KCSQKETTAIPVKPGETALLRFINAALNHELFVTIAQHRMTVVATDASYTKPFTTSVLMV  265

Query  1356  GPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---TNLRPGANSRPL  1186
              PGQTT+VL+T DQ PARYY+AARAY + QN  FDNTTTTAV+EY        G   +P 
Sbjct  266   APGQTTDVLVTMDQAPARYYVAARAYVSGQNVAFDNTTTTAVVEYDCGCASDFGPKIQPA  325

Query  1185  MPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNN  1006
              P LP FNDTA A AF   ++S       V    DE LFFTVGLGL NC PG  C GPNN
Sbjct  326   FPSLPAFNDTAAAAAFAAGIKS--PGRVRVHESVDEHLFFTVGLGLFNCEPGQLCAGPNN  383

Query  1005  -TRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPP  832
              TRF ASMNNVSFV PR  SLL A+Y   PG++T DFP  PPVQFDYT  NVS+ALWQP 
Sbjct  384   STRFTASMNNVSFVFPRTDSLLHAHYFKTPGVFTTDFPAHPPVQFDYTAQNVSQALWQPV  443

Query  831   SGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLV  652
               TKLY +++GS VQ+VLQDT+I T E+HPIH+HGY F+++ +GFGNF+P+ D  KFN V
Sbjct  444   PATKLYPLRFGSVVQLVLQDTSIVTPENHPIHIHGYDFFILAEGFGNFDPEKDVDKFNYV  503

Query  651   DPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEP  472
              PP RNT+ VPV GWAVI+F ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++EP
Sbjct  504   VPPQRNTVAVPVNGWAVIQFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGYGELQSLEP  563

Query  471   PPLDLPRC  448
             PP+DLP C
Sbjct  564   PPVDLPMC  571



>ref|XP_003600994.1| Laccase [Medicago truncatula]
Length=575

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/570 (62%), Positives = 438/570 (77%), Gaps = 14/570 (2%)
 Frame = -3

Query  2130  NGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrng  1951
             +  L  +FV+ +   +LAN   +  EFVV+ T + RLCKT   ITVNGQ+PGPT+ + NG
Sbjct  11    SSILIAIFVLSSFALALANPKTHEHEFVVEATPVKRLCKTHNTITVNGQYPGPTLEINNG  70

Query  1950  ddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTL  1771
             D +VVKV N+ARYNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF +  QEGTL
Sbjct  71    DTLVVKVTNKARYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVNGQEGTL  130

Query  1770  WWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGA  1591
             WWHAHS WLRATVYGA II P+ G  +PF +P  +  ILLGEWW+ + I + RQ Q TGA
Sbjct  131   WWHAHSSWLRATVYGALIIRPREGEPYPFPKPNHETSILLGEWWDGNPIDVVRQAQRTGA  190

Query  1590  APNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             APNIS+AYTINGQPGDLY+CS++ T    +  GET L+RVINAALNQ LFF++ANHKL V
Sbjct  191   APNISDAYTINGQPGDLYKCSTKGTTIIPIHSGETNLVRVINAALNQPLFFTIANHKLTV  250

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             VGADA+Y KPFTTN++M+GPGQTT+VL+ A+QPP++YY+AARAY +AQNAPFDNTTTTA+
Sbjct  251   VGADASYVKPFTTNILMLGPGQTTDVLIHANQPPSKYYIAARAYQSAQNAPFDNTTTTAI  310

Query  1230  LEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLG  1051
             L+Y N      ++P+MP LP +N+T   T F+    S+      V  + DE+LFFT+GLG
Sbjct  311   LQYHN---SIKTKPIMPPLPSYNNTNIVTKFSRSFFSL--RKAEVPTEIDENLFFTIGLG  365

Query  1050  LVNCTPG---PRCQGP-NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPP  883
             L NC       RCQGP N TRF ASMNNVSF LP   S+LQA+Y+ IPG++T DFP  PP
Sbjct  366   LNNCPKNFRKRRCQGPINGTRFTASMNNVSFTLPNNISILQAHYHGIPGVFTTDFPAKPP  425

Query  882   VQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             V+FDYTGNVSR+LWQP  GTK YK+K+GSRVQ+VLQDT+I T E+HPIHLHGY F++V +
Sbjct  426   VKFDYTGNVSRSLWQPVPGTKAYKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAE  485

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGV-----WLMHCHIDSHL  538
             GFGNF+ + DT+KFNLVDPP+RNT+ VPV GWAVIRF ADN  +     W++HCH+D H+
Sbjct  486   GFGNFDAKKDTSKFNLVDPPMRNTVAVPVNGWAVIRFVADNTRIKKVSAWILHCHLDVHI  545

Query  537   AWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
              WGLA   +VE+G G+ Q+++ PP DLP C
Sbjct  546   GWGLATILLVEDGVGKLQSIQSPPQDLPIC  575



>ref|XP_008441484.1| PREDICTED: laccase-12 [Cucumis melo]
Length=574

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/550 (64%), Positives = 433/550 (79%), Gaps = 16/550 (3%)
 Frame = -3

Query  2064  YNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGL  1885
             +  +F++Q T + RLCKT   ITVNGQFPGPT+ + NGD ++V V+N+A+YNVTIHWHG+
Sbjct  30    HRHQFIIQATPVKRLCKTHNAITVNGQFPGPTLEINNGDTLIVNVINKAKYNVTIHWHGI  89

Query  1884  RQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPK  1705
             RQ+RT WADGPE+VTQCPI PGG+YTYRF ++ QEGTLWWHAHS WLRATVYGA II+PK
Sbjct  90    RQLRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLRATVYGALIIHPK  149

Query  1704  SGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSS  1525
              G  +PF +P ++  +L+GEWW+ + I + RQ   TGAAPN+S+AYT NGQPGDLY+CSS
Sbjct  150   EGDSYPFPKPNREATLLMGEWWDANPIDVLRQATRTGAAPNVSDAYTFNGQPGDLYKCSS  209

Query  1524  QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQ  1345
             +DT+   +  GET LLRV+N+ALNQ LFF+VANHKL VVGADA+Y KPFTT+V+M+GPGQ
Sbjct  210   KDTIIVPIDSGETNLLRVVNSALNQALFFTVANHKLTVVGADASYTKPFTTSVLMLGPGQ  269

Query  1344  TTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANS-----RPLMP  1180
             TT+VL++ +Q PARYY+AARAY +AQNAPF NTTTTA+L Y +    A       +P+MP
Sbjct  270   TTDVLISGNQVPARYYIAARAYQSAQNAPFGNTTTTAILNYKSAPCPAKKGSPTIKPIMP  329

Query  1179  QLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR------CQ  1018
              LP FNDTAT TAF+ + RS P   P V  + DE+LFFTVGLGL NC   PR      CQ
Sbjct  330   FLPAFNDTATVTAFSRKFRS-PRPVP-VPTKIDENLFFTVGLGLNNC---PRNFKPSQCQ  384

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             GPN TRF ASMNNVSFVLP   S+LQA+   IPG+ T DFP  PPV+FDYTGNVSR+L+Q
Sbjct  385   GPNGTRFTASMNNVSFVLPSNISILQAFQQGIPGVVTSDFPANPPVKFDYTGNVSRSLFQ  444

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTK Y++KYGS VQVVLQDT+I T E+HPIHLHGY F+++ +GFGNF+P+ DT KFN
Sbjct  445   PVPGTKGYRLKYGSTVQVVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFDPKKDTKKFN  504

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             LVDPP+RNT+ VPV GWAVIRF ADNPG W+MHCH+D H+ WGLAM F+V+NG G  Q++
Sbjct  505   LVDPPLRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHITWGLAMVFLVDNGVGHLQSI  564

Query  477   EPPPLDLPRC  448
             E PP DLP C
Sbjct  565   EAPPPDLPIC  574



>ref|XP_009417976.1| PREDICTED: laccase-3-like [Musa acuminata subsp. malaccensis]
Length=578

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/545 (66%), Positives = 426/545 (78%), Gaps = 9/545 (2%)
 Frame = -3

Query  2097  TVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnra  1918
             +V+ + A+A+V+  EFVVQ T + RLCKT  IITVNGQ+PGPT+AVRNGD +VV VVNRA
Sbjct  26    SVMFTCADAEVHYHEFVVQATPVKRLCKTHNIITVNGQYPGPTLAVRNGDTLVVNVVNRA  85

Query  1917  rynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRA  1738
             +YNVT+HWHG+RQMRT WADGPE+VTQCPI PGG+YTYRF IE+QEGTLWWHAHS WLRA
Sbjct  86    KYNVTLHWHGVRQMRTAWADGPEFVTQCPIRPGGSYTYRFTIEDQEGTLWWHAHSSWLRA  145

Query  1737  TVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTIN  1558
             TV+GA IIYP+  S +PF +P ++ P++LGEWWN D I++ R+   TGAAPN+S+A+TIN
Sbjct  146   TVHGALIIYPRDASSYPFPKPHREFPVILGEWWNEDPISVVRRATRTGAAPNVSDAFTIN  205

Query  1557  GQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPF  1378
             GQPGDLY CS++DT  F V+ GET LLR INAALN +LF S+A H + VV ADAAY KPF
Sbjct  206   GQPGDLYNCSNKDTTVFPVALGETNLLRFINAALNNELFVSIAGHMMTVVAADAAYTKPF  265

Query  1377  TTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN----LR  1210
             TT V+M+GPGQTT+V +T +QPP RYYMAA AYA+A+   FDNTTTTAVLEY N     +
Sbjct  266   TTAVLMLGPGQTTDVFVTTNQPPGRYYMAAHAYASARGVAFDNTTTTAVLEYKNSGCPTK  325

Query  1209  PGANSRPLMPQLPFFNDtatataftTQLRS-VPSNNPTVFNQPDESLFFTVGLGLVNCTP  1033
              G    P  P LP FNDT TATAF   +RS  P   P      D  LFFTVGLGL NC P
Sbjct  326   NGPGLPPPFPVLPDFNDTPTATAFAAGIRSPYPVQIP---GPVDHHLFFTVGLGLFNCPP  382

Query  1032  GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYT-GNV  856
             G RC GPN TRF ASMNNVSF LP   SLLQA++  +PG++T DFP VPPV FDYT  NV
Sbjct  383   GRRCGGPNGTRFGASMNNVSFQLPTGLSLLQAHHLGVPGVFTTDFPAVPPVPFDYTAANV  442

Query  855   SRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQT  676
             SR LWQP  GTKLY +KYGS VQ+VLQ T IF  E+HP+H+HGYHF+V+  GFGNF+P  
Sbjct  443   SRGLWQPVLGTKLYPLKYGSVVQLVLQGTNIFAGEEHPMHIHGYHFYVLATGFGNFDPAR  502

Query  675   DTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQ  496
             D+A+FNLVDPP+RNT+ VPV GWAVIRF ADNPGVWL+HCH+D H+ WGLAMAF+VENG 
Sbjct  503   DSARFNLVDPPLRNTVGVPVNGWAVIRFVADNPGVWLVHCHLDVHITWGLAMAFLVENGV  562

Query  495   GEKQT  481
             GE Q+
Sbjct  563   GELQS  567



>ref|XP_008359050.1| PREDICTED: laccase-3-like [Malus domestica]
Length=567

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/550 (66%), Positives = 426/550 (77%), Gaps = 5/550 (1%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             AS + A+ +  EF V+   + RLC+T + ITVNGQFPGPT+ VRNGD V VKV N  +YN
Sbjct  20    ASFSAAEDHFHEFFVEAXPVKRLCRTHSRITVNGQFPGPTLEVRNGDSVAVKVTNXXKYN  79

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             VTIHWHG +Q   PW +GPEYVTQCPI PG TYTYRF I +QEGTLWWHAHSRWLRA+VY
Sbjct  80    VTIHWHGXKQQNNPWEEGPEYVTQCPIQPGATYTYRFTITDQEGTLWWHAHSRWLRASVY  139

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA IIYP+ GS +PF  P++++P+LLGEW++R+   + R   FTG APN+S+AYTINGQP
Sbjct  140   GALIIYPRLGSPYPFPMPQREVPLLLGEWFDRNPQDVMRLAAFTGGAPNVSDAYTINGQP  199

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDLYRCS ++T++  V  GE++LLRVIN+ALNQ+L F+VANH+L VVGADA+Y +P TT 
Sbjct  200   GDLYRCSKKETIRIPVXSGESLLLRVINSALNQELXFTVANHQLTVVGADASYTEPLTTR  259

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANS-R  1192
             VIM+GPGQTT+VLLTADQ PARYYMAARAY TAQN PFDNTTTTA+LEY N         
Sbjct  260   VIMIGPGQTTDVLLTADQRPARYYMAARAYQTAQNVPFDNTTTTAILEYKNAASSNQGLA  319

Query  1191  PLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT--PGPRCQ  1018
             P+ P LP +NDTATATA+T Q++S PS    V  Q DE+LFFTVGLG  NCT    P CQ
Sbjct  320   PVFPTLPAYNDTATATAYTAQIKS-PSQV-KVPTQIDENLFFTVGLGPYNCTVPNSPWCQ  377

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             GPNNTRFAASMNNVSF LP   S +QA Y  + G++T DFPPVP VQF+YTGNV R LW 
Sbjct  378   GPNNTRFAASMNNVSFALPSTNSSMQAAYYGVLGVFTTDFPPVPLVQFNYTGNVPRGLWS  437

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTKLYK+KYG+ VQ+V QDT+  T +DHP+H HG H +V+G GFGN+NP TD A+FN
Sbjct  438   PCRGTKLYKLKYGANVQIVFQDTSTVTIDDHPMHFHGCHSYVIGSGFGNYNPSTDPARFN  497

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             L+DPP RNTI  P GGW  IRF ADNPGVWLMHCH+DSHL  GLAMA +VENG G  QTV
Sbjct  498   LIDPPQRNTIGTPPGGWVAIRFKADNPGVWLMHCHLDSHLFLGLAMACLVENGIGPLQTV  557

Query  477   EPPPLDLPRC  448
              PPP DLPRC
Sbjct  558   IPPPPDLPRC  567



>ref|XP_010322117.1| PREDICTED: laccase-12-like isoform X2 [Solanum lycopersicum]
Length=574

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/586 (62%), Positives = 439/586 (75%), Gaps = 22/586 (4%)
 Frame = -3

Query  2187  LQKHPQMDSQNNTSLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTK  2008
             L +   MD   N   N  C  F    F+ + +  + + A+++  +FV+Q T + RLCK  
Sbjct  5     LLEQNTMDHACNRITNTLCYFF----FITILLFVNASTAEIHYHDFVIQATPVKRLCKIH  60

Query  2007  TIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPI  1828
               ITVNGQFPGPT+ V NGD +V+ VVNRA+YNVTIHWHG++Q+RT WADGPE++TQCPI
Sbjct  61    NTITVNGQFPGPTLQVNNGDALVINVVNRAQYNVTIHWHGVKQIRTAWADGPEFITQCPI  120

Query  1827  MPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLG  1648
              PGG+YTYRF I+ QEGTLWWHAHS WLRATVYGA IIYPK G  +PFS+PK++ PILLG
Sbjct  121   RPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIYPKEGEFYPFSKPKRETPILLG  180

Query  1647  EWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVI  1468
             EWW+ + I + RQ   TGAAP +S+AYTINGQP         DT    V  GET LLRVI
Sbjct  181   EWWDVNPIDVVRQATRTGAAPKVSDAYTINGQP---------DTTVVIVDSGETNLLRVI  231

Query  1467  NAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaa  1288
             NAALNQ LFF+VANHKL VV ADA+Y +PFTT+V+M+GPGQTT+VL+  +QPP RYY+A 
Sbjct  232   NAALNQALFFAVANHKLTVVAADASYVQPFTTSVLMLGPGQTTDVLIDGNQPPGRYYIAV  291

Query  1287  rayataqnaPFDNTTTTAVLEYTNL---RPGANSRPLMPQLPFFNDtatataftTQLRSV  1117
             RAYA+AQ   FDNTT+TA+LEY N      G    P+ P LP FNDTATAT F+T  RS 
Sbjct  292   RAYASAQGP-FDNTTSTAILEYKNTPCSVQGIKINPIFPSLPAFNDTATATTFSTSFRS-  349

Query  1116  PSNNPTVFNQPDESLFFTVGLGLVNCTPGPR---CQGPNNTRFAASMNNVSFVLPRRTSL  946
                   V  + DE+L FTVGLGL NC  G     CQGPN TRF ASMNN+SFVLP   S+
Sbjct  350   -PRQVDVPTEIDENLLFTVGLGLNNCPRGSSSRSCQGPNGTRFTASMNNMSFVLPPNFSI  408

Query  945   LQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTA  766
             LQA+Y  I G+++ DFP VPPV+FDYTGNVSR+LWQP  GTK+YK+KYG+RVQVVLQ T+
Sbjct  409   LQAHYQGIAGVFSTDFPAVPPVKFDYTGNVSRSLWQPVRGTKVYKLKYGARVQVVLQGTS  468

Query  765   IFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFA  586
             I T E+HPIHLHGY F+++ +GFGNFNPQTDTAKFNLVDPP+RNT  VPV GW+VIRF A
Sbjct  469   IVTGENHPIHLHGYDFYIIAEGFGNFNPQTDTAKFNLVDPPIRNTASVPVNGWSVIRFVA  528

Query  585   DNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             +NPGVWLMHCH+D H+ WGLAM+F+VENG  E +++  PPLDLP C
Sbjct  529   NNPGVWLMHCHLDVHITWGLAMSFLVENGVSELESLVEPPLDLPVC  574



>emb|CDY10719.1| BnaA05g12170D [Brassica napus]
Length=543

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/562 (64%), Positives = 423/562 (75%), Gaps = 37/562 (7%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
                +L   A LA+A+++ +EFV+Q   + RLC+T   ITVNGQFPGPT+ VRNGD + + 
Sbjct  12    FIALLAYFAFLASAELHVREFVIQPKPVKRLCRTHESITVNGQFPGPTLEVRNGDSLAIT  71

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V+N+ARYN++IH+                           YTYRF IE+QEGTLWWHAHS
Sbjct  72    VINKARYNISIHY---------------------------YTYRFTIEDQEGTLWWHAHS  104

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
             RWLRATVYGA IIYP+ GS +PF  PK+DIPILLGEWW+R+ + + RQ QFTGAA N+S+
Sbjct  105   RWLRATVYGALIIYPRLGSPYPFHMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAANVSD  164

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             AYTINGQPGDLYRCS  +TV+F + PGE V LRVINA LNQ+LFFSVANH+L VV  D+A
Sbjct  165   AYTINGQPGDLYRCSRSETVRFPIFPGEAVQLRVINAGLNQELFFSVANHQLTVVETDSA  224

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPFTT+VIM+GPGQTTNVLLTA+Q P RYYMAARAY +A    FDNTTTTA+LEY N 
Sbjct  225   YTKPFTTSVIMIGPGQTTNVLLTANQRPGRYYMAARAYNSANAP-FDNTTTTAILEYVNA  283

Query  1212  -----RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGL  1048
                  R      P+ P LP FNDTATATAFT +LR        V  Q DE+LFFTVGLGL
Sbjct  284   PTRRGRGCGQIAPVFPVLPGFNDTATATAFTNRLRYW--KRAPVPLQVDENLFFTVGLGL  341

Query  1047  VNCTP--GPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             +NC+    PRCQGPN TRFAAS+NN SFVLPRR S++QAYY  +PGI+T DFPPVPPVQF
Sbjct  342   INCSNPNSPRCQGPNGTRFAASINNQSFVLPRRNSIMQAYYQGMPGIFTTDFPPVPPVQF  401

Query  873   DYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFG  694
             DYTGNVSR LWQP  GTK YK+KY + VQ+VLQDT+I T E+HP+HLHGY F+VVG GFG
Sbjct  402   DYTGNVSRGLWQPVKGTKAYKLKYKANVQIVLQDTSIVTPENHPMHLHGYQFYVVGSGFG  461

Query  693   NFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAF  514
             NFN +TD A+FNL DPP RNTI  P GGW  IRF ADNPG W MHCHIDSHL WGLAM F
Sbjct  462   NFNRRTDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVF  521

Query  513   IVENGQGEKQTVEPPPLDLPRC  448
             +VENG+G+ Q+V+ PPLDLPRC
Sbjct  522   LVENGRGQLQSVQAPPLDLPRC  543



>ref|XP_004138412.1| PREDICTED: laccase-12-like [Cucumis sativus]
 ref|XP_004172777.1| PREDICTED: laccase-12-like [Cucumis sativus]
Length=574

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/550 (64%), Positives = 433/550 (79%), Gaps = 16/550 (3%)
 Frame = -3

Query  2064  YNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGL  1885
             +  +FV+Q T + RLCKT   ITVNGQFPGPT+ +RNGD ++V V+N+A+YNVTIHWHG+
Sbjct  30    HRHQFVIQATPVKRLCKTHNAITVNGQFPGPTLEMRNGDTLIVTVINKAKYNVTIHWHGI  89

Query  1884  RQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPK  1705
             RQ+RT WADGPE+VTQCPI PG +YTYRF ++ QEGTLWWHAHS WLRATVYGA II P+
Sbjct  90    RQLRTGWADGPEFVTQCPIKPGRSYTYRFTVQGQEGTLWWHAHSSWLRATVYGALIIRPR  149

Query  1704  SGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSS  1525
              G  +PF +P ++  +L+GEWW+ + I + RQ   TGAAPNIS+AYT NGQPGDLY+CSS
Sbjct  150   EGESYPFPKPHREATLLMGEWWDANPIDVVRQATRTGAAPNISDAYTFNGQPGDLYKCSS  209

Query  1524  QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQ  1345
             +DT+   +  GET LLRV+N+ALNQ LFF+VANHKL VVGADA+Y KPFTT+V+M+GPGQ
Sbjct  210   KDTIIVPIDSGETNLLRVVNSALNQALFFTVANHKLTVVGADASYTKPFTTSVLMLGPGQ  269

Query  1344  TTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANS-----RPLMP  1180
             TT+VL++ +Q PARYY+AARAY +AQNAPF NTTTTA+L Y +    A       +P+MP
Sbjct  270   TTDVLISGNQVPARYYIAARAYQSAQNAPFGNTTTTAILNYKSAPCPAKKGSPTIKPIMP  329

Query  1179  QLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR------CQ  1018
              LP FNDTAT TAF+ + RS P   P V  + DE+LFFTVGLGL NC   PR      CQ
Sbjct  330   FLPAFNDTATVTAFSRKFRS-PRPVP-VPTKIDENLFFTVGLGLNNC---PRNFKPSQCQ  384

Query  1017  GPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             GPN TRF ASMNNVSFVLP   S+LQA+   IPG+ T DFP  PPV+FDYTGNVS++L+Q
Sbjct  385   GPNGTRFTASMNNVSFVLPSNISILQAFQQGIPGVLTSDFPANPPVKFDYTGNVSQSLFQ  444

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTK Y++KYGS VQVVLQDT+I T E+HPIHLHGY F+++ +GFGNF+P+ DT KFN
Sbjct  445   PVPGTKGYRLKYGSTVQVVLQDTSIVTPENHPIHLHGYDFYIIAEGFGNFDPKKDTKKFN  504

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             LVDPP+RNT+ VPV GWAVIRF ADNPG W+MHCH+D H+ WGLAM F+V+NG G+ Q++
Sbjct  505   LVDPPLRNTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHITWGLAMVFLVDNGVGQLQSI  564

Query  477   EPPPLDLPRC  448
             E PP DLP C
Sbjct  565   EAPPPDLPLC  574



>ref|XP_010424027.1| PREDICTED: laccase-3-like [Camelina sativa]
Length=557

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/529 (66%), Positives = 409/529 (77%), Gaps = 12/529 (2%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
                   +L   A LA+A+ + ++FV+    +TRLC+T   ITVNGQFPGPT+ VRNGD V
Sbjct  9     FVSCIALLAYFAFLASAEHHVRQFVIAPRPVTRLCRTHQSITVNGQFPGPTLEVRNGDSV  68

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
              + V+NRARYN++IHWHGLRQMR PWADGPEY+TQCPI PG +YTY+F IE+QEGTLWWH
Sbjct  69    AITVINRARYNISIHWHGLRQMRNPWADGPEYITQCPIRPGQSYTYKFTIEDQEGTLWWH  128

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHSRWLRATVYGA IIYP+ GS +PFS PK+DIPILLGEWW+R+ + + RQ QFTGAA N
Sbjct  129   AHSRWLRATVYGALIIYPRLGSPYPFSMPKRDIPILLGEWWDRNPMDVLRQAQFTGAAAN  188

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+AYTINGQPGDLYRCS   T++F + PGETV LRVINA +NQ+LFFSVANH+L VV  
Sbjct  189   VSDAYTINGQPGDLYRCSRAGTMRFPIFPGETVQLRVINAGMNQELFFSVANHQLTVVET  248

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             D+AY KPFTTNVIM+GPGQTTNVL+TA+Q     Y  A     + NAPFDNTTTTA+L+Y
Sbjct  249   DSAYTKPFTTNVIMLGPGQTTNVLITANQ-RPGRYYMAARAYNSANAPFDNTTTTAILQY  307

Query  1221  TN-------LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFT  1063
              N        R      P+ P LP FNDTATATAFT +LR        V  Q DE+LFFT
Sbjct  308   VNAPTRRGRGRGRGQMAPVFPVLPGFNDTATATAFTNRLRYW--KRAPVPQQIDENLFFT  365

Query  1062  VGLGLVNCT--PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             VGLGL+NC     PRCQGPN TRFAAS+NN+SFVLPRR S++QAYY  +PGI+T DFPPV
Sbjct  366   VGLGLINCANPNSPRCQGPNGTRFAASINNMSFVLPRRNSVMQAYYQGMPGIFTTDFPPV  425

Query  888   PPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVV  709
             PPVQFDYTGNVSRALWQP  GTK YK+KY + VQ+VLQDT+I T E+HP+HLHGY F+VV
Sbjct  426   PPVQFDYTGNVSRALWQPIKGTKAYKLKYRANVQIVLQDTSIVTPENHPMHLHGYQFYVV  485

Query  708   GQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLM  562
             G GFGNFNP+TD A+FNL DPP RNTI  P GGW  IRF ADNPG W M
Sbjct  486   GSGFGNFNPRTDPARFNLFDPPERNTIGTPPGGWVAIRFVADNPGAWFM  534



>gb|AFV52377.1| laccase [Picea abies]
Length=575

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/561 (61%), Positives = 424/561 (76%), Gaps = 5/561 (1%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
              A + V LT+L ++A+A +    FV+Q T + +LC T+ IITVNGQFPGPTI  RNGD V
Sbjct  17    FALMVVCLTLLTAMASAKLRTATFVLQSTTVKKLCGTQNIITVNGQFPGPTIHARNGDTV  76

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
             +VKV N A+YN TIHWHG+RQ RT W+DGPE++TQCPI PGG+YTY+F + +QEGTLWWH
Sbjct  77    IVKVYNNAQYNATIHWHGVRQFRTGWSDGPEFITQCPIRPGGSYTYKFTLTDQEGTLWWH  136

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
              HS WLRATVYGA II P+ GS +P+++P   +PILLGEWWNR+ I +  Q   TGAAP+
Sbjct  137   GHSSWLRATVYGALIISPRLGSTYPYTKPHGQVPILLGEWWNRNPIDVVNQATQTGAAPS  196

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+A+TING+PGDLY+CSS DT+  SV  GET LLRVINAALN  LFFSV++H + VV  
Sbjct  197   VSDAFTINGRPGDLYQCSSSDTLHISVKNGETKLLRVINAALNTDLFFSVSSHTMTVVAV  256

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             DA Y KPF TNV+M+GPGQTT+VL+TADQ   RYYMAARAY++ Q  PFDNTTT A+LEY
Sbjct  257   DALYTKPFQTNVLMLGPGQTTDVLVTADQSIGRYYMAARAYSSGQGVPFDNTTTVAILEY  316

Query  1221  TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVF--NQPDESLFFTVGLGL  1048
                     S P MP LPF+NDT +AT+F   LRS+ SN+  VF     D++L +T+GLGL
Sbjct  317   EG-SSSTTSNPNMPNLPFYNDTQSATSFANGLRSLASNDHPVFVPRSVDKNLLYTIGLGL  375

Query  1047  VNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDY  868
             +NC PG  C GPN +RFAASMNN+SFVLP  +S+LQA +  + G+++ DFP  PPVQFDY
Sbjct  376   INC-PGQSCGGPNGSRFAASMNNISFVLPTTSSILQAQHFGVKGVFSGDFPDNPPVQFDY  434

Query  867   TG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             T  NV+R LW    GTK+  + Y + VQV+LQ T IF  E HPIHLHGY F++VG GFGN
Sbjct  435   TAQNVNRGLWSTVKGTKVKVLNYNTTVQVILQGTNIFAGESHPIHLHGYDFYIVGTGFGN  494

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             ++PQ D  KFNLVDPP+RNT++VPV GWA IRF ADNPG WLMHCH+D+H+ WGLAM F+
Sbjct  495   YSPQNDPQKFNLVDPPMRNTVNVPVNGWAAIRFVADNPGAWLMHCHLDAHITWGLAMVFL  554

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             V NG     ++E PP+DLP+C
Sbjct  555   VNNGPNSLLSLESPPVDLPQC  575



>gb|AFV52378.1| laccase [Picea abies]
Length=570

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/558 (61%), Positives = 419/558 (75%), Gaps = 5/558 (1%)
 Frame = -3

Query  2112  LFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvk  1933
             L V LT+  ++ +A +  + FV+Q T + RLC    IITVNGQFPGPT+ VRNGD ++VK
Sbjct  15    LDVWLTLWTAMVSAKLRGETFVIQSTSVKRLCGMHNIITVNGQFPGPTLHVRNGDTLMVK  74

Query  1932  vvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHS  1753
             V N A+YN TIHWHG+RQ RT WADGPE++TQCPI PGG+YTYRF I +QEGTLWWH HS
Sbjct  75    VYNNAQYNATIHWHGVRQFRTGWADGPEFITQCPIRPGGSYTYRFNITDQEGTLWWHGHS  134

Query  1752  RWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISN  1573
              WLRATVYGA II P+ G+ +PF++P   +PILLGEWWNR+ + +  Q   TGAAPN+S+
Sbjct  135   SWLRATVYGALIITPRPGTTYPFTKPHGQVPILLGEWWNRNPMDVVNQATRTGAAPNVSD  194

Query  1572  AYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAA  1393
             A+TINGQPGDLY+CSS DT + SV  GET LLRVINAALN  LFFSV +HK+ VV  DA 
Sbjct  195   AFTINGQPGDLYQCSSSDTFRVSVKSGETKLLRVINAALNTDLFFSVGSHKMTVVAVDAL  254

Query  1392  YNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL  1213
             Y KPF TN +M+GPGQTT+VL+TADQ   RYYMAARAY++ Q  PFDNTTT A+LEY   
Sbjct  255   YTKPFQTNFLMLGPGQTTDVLITADQATGRYYMAARAYSSGQGVPFDNTTTVAILEYKG-  313

Query  1212  RPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVF--NQPDESLFFTVGLGLVNC  1039
                + S P MP LPF+NDT TAT F   L+S+ SN+  VF   + +E+LF+TVGLGL+ C
Sbjct  314   SSSSKSTPTMPSLPFYNDTKTATKFANGLKSLASNDHPVFVPQKVNENLFYTVGLGLIKC  373

Query  1038  TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-  862
              PG  C GPN +RFAASMNNVSFVLP  +S+LQA +    G+++ DFP  P V FDYT  
Sbjct  374   -PGQSCGGPNGSRFAASMNNVSFVLPSTSSILQAQHFGTKGVFSRDFPDNPAVLFDYTAQ  432

Query  861   NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNP  682
             NVSR +W P   TK+  + Y + VQ++LQ T IF  E HPIHLHGY F++VG GFGN+NP
Sbjct  433   NVSRGIWSPVKDTKVKVLNYNTTVQIILQGTNIFAGESHPIHLHGYDFYIVGAGFGNYNP  492

Query  681   QTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVEN  502
             QTD+ KFNLVDPP+RNT++VPV GW+ IRF ADNPG WLMHCH+D H+ WGLAM F+V N
Sbjct  493   QTDSQKFNLVDPPMRNTVNVPVNGWSAIRFVADNPGAWLMHCHLDVHITWGLAMVFVVNN  552

Query  501   GQGEKQTVEPPPLDLPRC  448
             G     ++E PPLDLP+C
Sbjct  553   GPDSLLSLESPPLDLPQC  570



>gb|KFK25107.1| hypothetical protein AALP_AA8G066900 [Arabis alpina]
Length=1134

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/549 (65%), Positives = 429/549 (78%), Gaps = 15/549 (3%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
             ASL NA+V+  EFV+Q+T + RLC  +  ITVNGQFPGPT+ VRNGD +V+  +N+A+YN
Sbjct  16    ASLVNAEVHFHEFVIQKTPVKRLCNVQNSITVNGQFPGPTLEVRNGDSLVITAINKAQYN  75

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             +T+HWHG+RQ+R PWADGPEY+TQCPI PGG+YTYRF IE+QEGTLWWHAHSRWLRATVY
Sbjct  76    ITLHWHGIRQVRNPWADGPEYITQCPIQPGGSYTYRFNIEDQEGTLWWHAHSRWLRATVY  135

Query  1728  GAFIIYPKSGS-HFPF-SQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTING  1555
             GA II P   S H+PF   PK++I +LLGEWWNR+ + +  Q QFTGAAPN+S+A TING
Sbjct  136   GALIIRPPLASPHYPFPVLPKREITLLLGEWWNRNPMDVLNQAQFTGAAPNVSDALTING  195

Query  1554  QPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFT  1375
             QPGD YRCSSQ+T+++ V  GET+LLRVIN+ALN ++FF VANHKL VV ADA+Y KPF+
Sbjct  196   QPGDFYRCSSQETLRYLVGSGETILLRVINSALNAEMFFGVANHKLTVVAADASYMKPFS  255

Query  1374  TNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN-----LR  1210
             TNVIM+GPGQTT+VLLTADQPPA YYMAA  Y +A    FDNTTTTA+L+Y +     L+
Sbjct  256   TNVIMLGPGQTTDVLLTADQPPAHYYMAAHTYNSANAP-FDNTTTTAILQYKDATCVTLQ  314

Query  1209  PGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPG  1030
               + +  +  QLP FNDTATA AFT Q++S PS       + DE LFFTVGLGL NC P 
Sbjct  315   GKSQAGAIPAQLPGFNDTATAAAFTAQMKS-PSKVEVPL-EIDEDLFFTVGLGLFNC-PT  371

Query  1029  P---RCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTLDFPPVPPVQFDYTG  862
             P   RCQGPN TRF AS+NNVSF  P+R S++QAYY   P G++T DFPPVPP+ FDYTG
Sbjct  372   PNTQRCQGPNGTRFTASINNVSFAFPKRNSIMQAYYQGTPAGVFTTDFPPVPPLAFDYTG  431

Query  861   NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNP  682
             NVSR+LWQP  GTK YK+K+ S VQ++LQDT+I T E+HP+HLHGY F+VVG G GNFN 
Sbjct  432   NVSRSLWQPTRGTKAYKLKFKSNVQIILQDTSIVTIENHPMHLHGYEFYVVGTGIGNFNA  491

Query  681   QTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVEN  502
              TDT+ FNL+DPP RNTI  P GGW  IRF ADNPGVWLMHCHIDSH+ WGLAM F+VEN
Sbjct  492   STDTSSFNLIDPPRRNTIGTPPGGWVAIRFIADNPGVWLMHCHIDSHIFWGLAMVFLVEN  551

Query  501   GQGEKQTVE  475
                   T+E
Sbjct  552   VATMASTLE  560



>gb|AFV52382.1| laccase [Picea abies]
Length=574

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/568 (61%), Positives = 417/568 (73%), Gaps = 7/568 (1%)
 Frame = -3

Query  2142  NPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIA  1963
             +PF   F+ K+ V LT L ++A+A++    FV+Q T + +LC T  IITVNGQFPGPT+ 
Sbjct  11    HPFAAKFV-KMVVWLTFLTAMASAEIQTHTFVLQSTSVKKLCGTHNIITVNGQFPGPTLN  69

Query  1962  vrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQ  1783
             V NGD ++VKV N+A+YN TIHWHG+RQ RT WADGPE+VTQCPI PGG+YTYRF I  Q
Sbjct  70    VSNGDTLIVKVYNKAQYNATIHWHGVRQFRTAWADGPEFVTQCPIRPGGSYTYRFTITGQ  129

Query  1782  EGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQ  1603
             EGTLWWHAHS WLRA+VYGA II P  G+ +PF++P + IPI LGEWWNR+ I +  Q  
Sbjct  130   EGTLWWHAHSSWLRASVYGALIISPTMGTTYPFTKPDRQIPIALGEWWNRNPIDVVNQAT  189

Query  1602  FTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANH  1423
              TGAAPN+S+A+TINGQPGDLY CSS D  + SV  GET LLR++N+A+N  LFFSVANH
Sbjct  190   RTGAAPNVSDAFTINGQPGDLYPCSSSDIFRVSVKAGETNLLRIMNSAMNTDLFFSVANH  249

Query  1422  KLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTT  1243
              + VV  DA Y KP  TNV+M+GPGQTT+VLL ADQ   RYYMAARAY++ Q  PFDNTT
Sbjct  250   TMTVVAVDALYTKPLKTNVLMLGPGQTTDVLLVADQGIGRYYMAARAYSSGQGVPFDNTT  309

Query  1242  TTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVF--NQPDESLF  1069
             TTA+LEY        S P MP LPF+NDT T T F   LRS+ S++  VF     DE+LF
Sbjct  310   TTAILEYEG--SSTTSAPTMPSLPFYNDTKTVTTFADGLRSLGSHDHPVFVPQSVDENLF  367

Query  1068  FTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPV  889
             +TVGLGL+NCT G  C GPN +RFAASMNNVSFVLP   S+LQA      G++T DFP  
Sbjct  368   YTVGLGLINCT-GQSCGGPNGSRFAASMNNVSFVLPSSFSILQAQLLGKKGVFTADFPDN  426

Query  888   PPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWV  712
             P  QFDYT  N+SR LW P   T++  +KY + VQ++LQ T IF  E HPIHLHG+ F++
Sbjct  427   PSTQFDYTAQNISRGLWSPVKDTRVKVLKYNTTVQLILQGTNIFAGESHPIHLHGHDFYI  486

Query  711   VGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAW  532
             VG GFGN+N +TD  KFNLVDPP+RNT++VPV GWA IRF ADNPG WLMHCH+D H+ W
Sbjct  487   VGAGFGNYNSRTDPQKFNLVDPPMRNTVNVPVNGWAAIRFVADNPGAWLMHCHLDVHITW  546

Query  531   GLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             GLAM F+V NG     ++E PP DLP C
Sbjct  547   GLAMVFVVNNGPDSLLSLESPPSDLPLC  574



>ref|XP_004978572.1| PREDICTED: putative laccase-17-like [Setaria italica]
Length=586

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/558 (63%), Positives = 433/558 (78%), Gaps = 11/558 (2%)
 Frame = -3

Query  2100  LTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnr  1921
             LT+  ++A    +  EFV+QE  +TRLC+  +I+TVNGQFPGP + +  GD ++V+V+NR
Sbjct  33    LTIQPAIAKEQYH--EFVIQEASVTRLCREHSIMTVNGQFPGPALEIDEGDSLIVRVINR  90

Query  1920  arynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLR  1741
              RYN+T+HWHG+RQMRT W+DGPEYVTQCPI PG +YTYRF +  QEGTLWWHAHS WLR
Sbjct  91    GRYNMTVHWHGVRQMRTGWSDGPEYVTQCPIRPGQSYTYRFTVAGQEGTLWWHAHSSWLR  150

Query  1740  ATVYGAFIIYPKSG-SHFPFSQ----PKKDIPILLGEWWNRDIIALQRQTQFTGAAPNIS  1576
             ATV+GA II P++G + +PF      P ++IPILLGEWW+ + I + R    TGAAPNIS
Sbjct  151   ATVHGALIIRPRAGVTAYPFDAAGKPPAREIPILLGEWWDMNPIDVVRTATRTGAAPNIS  210

Query  1575  NAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADA  1396
             +A T+NGQPGDLYRCSS+DT  F V  GET LLR INAALN +LF S+A H + VVG DA
Sbjct  211   DALTVNGQPGDLYRCSSKDTTTFPVKSGETNLLRFINAALNTELFVSLAGHTMTVVGTDA  270

Query  1395  AYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN  1216
             +Y KP++T+V+M+ PGQTT+VL+T DQPP RYY+AARAYA+AQ  PFDNTTTTA+ +Y++
Sbjct  271   SYTKPYSTSVLMIAPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYSS  330

Query  1215  LRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT  1036
                  +S P MP LP +NDTATAT FTT LR +      + ++ DE+LFFTVG+GL NC+
Sbjct  331   SSSSGSSSPAMPTLPAYNDTATATTFTTNLRGL--RKAELPSRVDENLFFTVGVGLFNCS  388

Query  1035  PGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTLDFPPVPPVQFDYTG-  862
              G  C GPNNTRFAASMNNVSFVLP   S+LQA+Y     G++T DFP  PPVQFDYT  
Sbjct  389   RGQTCGGPNNTRFAASMNNVSFVLPSTVSILQAHYGGAQQGVFTADFPANPPVQFDYTAQ  448

Query  861   NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNP  682
             NVSRALWQP  GTK+Y++KYG+ VQ+VLQ T IF  E+HPIH+HGY F+++ +GFGNF+ 
Sbjct  449   NVSRALWQPAPGTKVYRLKYGAAVQLVLQGTNIFAGENHPIHIHGYDFYILAEGFGNFDA  508

Query  681   QTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVEN  502
              TDTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+
Sbjct  509   ATDTAKFNLDDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVED  568

Query  501   GQGEKQTVEPPPLDLPRC  448
             G GE Q++E PP DLP C
Sbjct  569   GVGELQSLEAPPPDLPLC  586



>ref|XP_002312187.2| hypothetical protein POPTR_0008s07380g [Populus trichocarpa]
 gb|EEE89554.2| hypothetical protein POPTR_0008s07380g [Populus trichocarpa]
Length=520

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/521 (67%), Positives = 419/521 (80%), Gaps = 11/521 (2%)
 Frame = -3

Query  1983  FPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTY  1804
             FPGPT+ V NGD +VV VVN+A+YNVTIHWHG+RQMRT WADGPE+VTQCPI PGG+YTY
Sbjct  2     FPGPTLEVNNGDTLVVNVVNKAQYNVTIHWHGVRQMRTGWADGPEFVTQCPIRPGGSYTY  61

Query  1803  RFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFS-QPKKDIPILLGEWWNRDI  1627
             +F I+ QEGTLWWHAHS WLRATVYGA I++PK GS +PFS QPK++  ILLGEWWN + 
Sbjct  62    KFTIQGQEGTLWWHAHSSWLRATVYGALIVHPKEGSPYPFSKQPKRETAILLGEWWNANP  121

Query  1626  IALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQ  1447
             I + R+   TG APN+S+AYT+NGQPGDLY CSSQDTV   +  GET LLRV+N+ALNQ 
Sbjct  122   IDVVREATRTGGAPNVSDAYTVNGQPGDLYNCSSQDTVIVPIDSGETNLLRVVNSALNQP  181

Query  1446  LFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataq  1267
             LFF+VANHK  VVGADA+Y KPFTT+V+M+GPGQTT+VL++ DQ P+RYYMAARAY +AQ
Sbjct  182   LFFTVANHKFTVVGADASYVKPFTTSVLMLGPGQTTDVLISGDQTPSRYYMAARAYQSAQ  241

Query  1266  naPFDNTTTTAVLEYTNLRPGA----NSRPLMPQLPFFNDtatataftTQLRSVPSNNPT  1099
             NAPFDNTTTTA+LEY +    A    +++P+MP LP +NDTAT T FTT  +S  ++   
Sbjct  242   NAPFDNTTTTAILEYKSSACAAKNCSSNKPIMPPLPAYNDTATVTTFTTSFKS--ADKTL  299

Query  1098  VFNQPDESLFFTVGLGLVNC----TPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYY  931
             V    DESLFFT+GLGL  C        +CQGPN TRF ASMNNVSFVLP   SLLQA++
Sbjct  300   VPTDIDESLFFTIGLGLNPCPSNFNKSSQCQGPNGTRFTASMNNVSFVLPSNFSLLQAHH  359

Query  930   NNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTE  751
               I G++T DFP  PP +FDYTGNVSR+L+QP +GTKLY +KYGSRVQ+VLQDT+I T E
Sbjct  360   QRIQGVFTTDFPANPPRKFDYTGNVSRSLFQPVAGTKLYNLKYGSRVQIVLQDTSIVTPE  419

Query  750   DHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGV  571
             +HPIHLHGY F+++ QGFGN+NP+ D +KFNLVDPP+RNT+ VPV GWAVIRF ADNPGV
Sbjct  420   NHPIHLHGYDFYIIAQGFGNYNPRADPSKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGV  479

Query  570   WLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             WLMHCH+D H+ WGLA AF+VENG G+ Q++E PP DLP C
Sbjct  480   WLMHCHLDVHITWGLATAFLVENGVGQLQSIESPPEDLPLC  520



>ref|XP_003558123.1| PREDICTED: laccase-3 [Brachypodium distachyon]
Length=599

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/563 (61%), Positives = 415/563 (74%), Gaps = 30/563 (5%)
 Frame = -3

Query  2055  EFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQM  1876
             EFVVQET + RLCKT+ IITVNGQFPGPTI V +GD + ++ VN A+YNVT+HWHGLRQ+
Sbjct  35    EFVVQETVVKRLCKTQKIITVNGQFPGPTIEVHDGDTLAIRAVNMAQYNVTLHWHGLRQL  94

Query  1875  RTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSGS  1696
             R  WADGPE+VTQCPI PG +YTYR+ I+ QEGTLWWHAHS WLRATV+GA II+PK G 
Sbjct  95    RNGWADGPEFVTQCPIRPGSSYTYRYTIQGQEGTLWWHAHSSWLRATVHGALIIHPKRGL  154

Query  1695  HFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQDT  1516
              +PF +P K+ P+LL EWW +D IA+ RQ+  TGA PNIS+   INGQPGD   CSSQ+T
Sbjct  155   PYPFPKPNKEFPVLLAEWWRKDPIAVIRQSMVTGAPPNISDTILINGQPGDFLECSSQET  214

Query  1515  VKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTTN  1336
                 V  GET LLR+INAA+N +LF S+A HK+ VV ADA Y +PF T V+++GPGQTT+
Sbjct  215   SIIPVVAGETNLLRIINAAMNSELFVSLAGHKMTVVAADAVYTRPFETTVVLLGPGQTTD  274

Query  1335  VLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL----------------RPG  1204
             VL+TAD  PARYY+AAR YA+AQ  PFDNTT TA+ +Y N                 RP 
Sbjct  275   VLVTADAAPARYYLAARVYASAQGVPFDNTTATAIFQYKNAAGCPTTTNPALNGPVGRPS  334

Query  1203  ANSR---------PLMPQLPFFNDtatataftTQLRS-VPSNNPTVFNQPDESLFFTVGL  1054
               S          PLMP LP FNDT TATAF+  +RS  P   P    Q    +F TVG 
Sbjct  335   QRSSAHPGRAGPAPLMPALPAFNDTNTATAFSKSIRSPRPVKVPGPVTQ---EVFTTVGF  391

Query  1053  GLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQF  874
             GL NC PGP CQGPNNTRFAASMNNVSF LP   SLLQA+Y+++PG++T DFP VPPV F
Sbjct  392   GLFNCRPGPFCQGPNNTRFAASMNNVSFQLPNTVSLLQAHYHHVPGVFTEDFPAVPPVIF  451

Query  873   DYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGF  697
             D+T  NV R+LWQP  GT+LY++KYG+ VQ+V QDT IF  E+HP+H+HGYHF+V+  GF
Sbjct  452   DFTSQNVPRSLWQPVKGTRLYRVKYGAVVQMVFQDTGIFAAEEHPMHIHGYHFYVLATGF  511

Query  696   GNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMA  517
             GN++ + D AKFN+VDPP RNTI VPVGGWAV+RF ADNPGVWL+HCHID+HL  GL MA
Sbjct  512   GNYDARRDAAKFNMVDPPSRNTIGVPVGGWAVVRFVADNPGVWLVHCHIDAHLTGGLGMA  571

Query  516   FIVENGQGEKQTVEPPPLDLPRC  448
              +VE+G+ E Q   PPPLDLP C
Sbjct  572   LLVEDGKAELQATVPPPLDLPIC  594



>ref|XP_002448873.1| hypothetical protein SORBIDRAFT_05g000680 [Sorghum bicolor]
 gb|EES07861.1| hypothetical protein SORBIDRAFT_05g000680 [Sorghum bicolor]
Length=587

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/549 (63%), Positives = 423/549 (77%), Gaps = 16/549 (3%)
 Frame = -3

Query  2058  QEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQ  1879
              EF V+E  +TRLC T+ I+TVNG+FPGPT+ V  GD ++V+VVNR  YNVT+HWHG+RQ
Sbjct  43    HEFEVKEATVTRLCGTQRIMTVNGEFPGPTVEVAEGDALIVRVVNRGSYNVTVHWHGVRQ  102

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT W+DGPE+VTQCPI PG +YTYRF +  QEGTLWWHAHS WLRATV+GA +I P++G
Sbjct  103   MRTGWSDGPEFVTQCPIRPGNSYTYRFTVAGQEGTLWWHAHSSWLRATVHGALLIRPRAG  162

Query  1698  SHFPFSQ----PKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRC  1531
               +PF+     P ++IPI+LGEWWN + I + R    TGAAPNIS+A T+NGQPGDLY+C
Sbjct  163   VPYPFNDGNKPPAREIPIILGEWWNMNPIDVVRTATRTGAAPNISDALTVNGQPGDLYKC  222

Query  1530  SSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGP  1351
             SS  T  F+V  GET LLR INAALN +LF S+A H + VVGADA+Y KP+TT+V+M+ P
Sbjct  223   SSNGTTTFAVKSGETNLLRFINAALNTELFVSLAGHTMTVVGADASYTKPYTTSVLMIAP  282

Query  1350  GQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRPLMPQLP  1171
             GQTT+VL+T DQ P RYY+AARAYA+AQ  PFDNTTTTA+ +Y        S P MP LP
Sbjct  283   GQTTDVLVTFDQAPGRYYLAARAYASAQGVPFDNTTTTAIFDYGT--GATTSSPAMPTLP  340

Query  1170  FFNDtatataftTQLRSV-PSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTRFA  994
              +NDTATAT FTT LR +  +  PT   + DESLFFTVG+GL NC+ G  C GPNNTRFA
Sbjct  341   AYNDTATATTFTTSLRGLRKAELPTT--RVDESLFFTVGVGLFNCSSGQTCGGPNNTRFA  398

Query  993   ASMNNVSFVLPRRTSLLQAYYNNI------PGIYTLDFPPVPPVQFDYTG-NVSRALWQP  835
             ASMNNVSFVLP  TS+LQA+Y +        G++T DFP  PPV FDYT  NVSRALWQP
Sbjct  399   ASMNNVSFVLPSTTSILQAHYASGGATSAPAGVFTADFPANPPVTFDYTAQNVSRALWQP  458

Query  834   PSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNL  655
               GTK+Y++KYG+ VQ+VLQ T +F  E+HPIHLHGY F+++ +GFGNF+  TDTAKFN+
Sbjct  459   VPGTKVYRLKYGAAVQLVLQGTNVFAAENHPIHLHGYDFYILAEGFGNFDAATDTAKFNM  518

Query  654   VDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVE  475
              DPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE +++E
Sbjct  519   DDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVGELESLE  578

Query  474   PPPLDLPRC  448
              PP DLP C
Sbjct  579   APPADLPVC  587



>gb|AFV52384.1| laccase [Picea abies]
Length=573

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/565 (61%), Positives = 420/565 (74%), Gaps = 8/565 (1%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             +  L V LT LA  A A+ V    FV++   +TRLCKT  +I VNGQFPGPT+ VRNGD 
Sbjct  10    ILALVVCLTFLAVTALAEHVIRHTFVIEAKPVTRLCKTHNVIIVNGQFPGPTLHVRNGDT  69

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             + VKV NRA+YN T+HWHG+RQ RT WADGPE++TQCPI PGG+YTYRF I  QEGTLWW
Sbjct  70    LSVKVYNRAQYNATVHWHGIRQFRTGWADGPEFITQCPIRPGGSYTYRFTITGQEGTLWW  129

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRA+VYGA II+P+ G+ +PF+ P ++ PI+LGEWWNR+ I +  Q   TGAAP
Sbjct  130   HAHSSWLRASVYGALIIHPRLGTTYPFTAPHRETPIMLGEWWNRNPIDVVNQATRTGAAP  189

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLY CS ++T +  +   E  LLR++NAALNQ+LFF+VANHKL VV 
Sbjct  190   NVSDAYTINGQPGDLYPCSRRETFRVRIYNEEIHLLRIVNAALNQELFFTVANHKLTVVA  249

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLT-ADQpparyymaarayataqnaPFDNTTTTAVL  1228
              DA+Y KPF T  +M+GPGQTT+VLL  A     RYYMAARAY +AQ  PFDNTTTTA+L
Sbjct  250   VDASYTKPFRTKTVMLGPGQTTDVLLRGARHRVGRYYMAARAYDSAQGVPFDNTTTTAIL  309

Query  1227  EYTNLRPGANS--RPLMPQLPFFNDtatataftTQLRSVPSNNPTVF--NQPDESLFFTV  1060
             EY   RP  +S  RP+MP LP +NDT TAT F   LRS+ +    V+     DESLF+T+
Sbjct  310   EYRTRRPPPSSSFRPVMPILPAYNDTRTATNFARGLRSLGTREHPVYVPQTVDESLFYTI  369

Query  1059  GLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPV  880
             GLGL NC P   C GPN TRF ASMNN+SFVLP   S+LQA+Y    G++T  FP  PPV
Sbjct  370   GLGLFNC-PNRSCGGPNGTRFTASMNNISFVLPSTYSVLQAHYFGKKGVFTTGFPDNPPV  428

Query  879   QFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             QF+YT  NVSR+LW P  GTK+  +KY ++VQV+LQDT I   E+HPIHLHGY F++VG+
Sbjct  429   QFNYTAQNVSRSLWSPVRGTKVKVLKYNAKVQVILQDTNIVNAENHPIHLHGYDFYIVGE  488

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGN+NP+TD  KFNLVDPP+RNT+ VPV GWA IRF ADNPG WLMHCH+D H+ WGLA
Sbjct  489   GFGNYNPRTDPQKFNLVDPPLRNTVAVPVNGWAAIRFVADNPGAWLMHCHLDVHITWGLA  548

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG     T+E PP DLP C
Sbjct  549   MVFLVENGPSYMTTIESPPPDLPVC  573



>gb|AAK37826.1|AF132122_1 laccase [Pinus taeda]
Length=570

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/561 (61%), Positives = 423/561 (75%), Gaps = 5/561 (1%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddv  1942
             L  + + LT+L ++A+A +  + FV+Q T + RLC T  IITVNGQFPGPT+ VRNGD +
Sbjct  12    LVLMAIWLTLLTAMASAKLRTETFVLQSTSVKRLCGTHNIITVNGQFPGPTLHVRNGDTL  71

Query  1941  vvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWH  1762
             VVKV N A+YN TIHWHG+RQ RT W+DGPEY+TQCPI PGG+YTYRF I  QEGTLWWH
Sbjct  72    VVKVYNNAQYNATIHWHGVRQFRTGWSDGPEYITQCPIRPGGSYTYRFTITGQEGTLWWH  131

Query  1761  AHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPN  1582
             AHS WLRATVYGA +I P  G+ +PF++P   +PILLGEWW+R+ I +  Q   TGAAPN
Sbjct  132   AHSSWLRATVYGALVISPSPGATYPFTRPHGQVPILLGEWWSRNPIDVVDQATRTGAAPN  191

Query  1581  ISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGA  1402
             +S+A+TINGQPGDLY+CSS DT++ S++ GET LLRVINAALN  LFF+V  H + VV  
Sbjct  192   VSDAFTINGQPGDLYQCSSSDTIRVSINNGETKLLRVINAALNTDLFFTVGGHTMTVVAV  251

Query  1401  DAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY  1222
             DA Y KPF TN++M+GPGQTT+VL+TADQ   RYYMAARAY++ Q  PFDNTTT A+LEY
Sbjct  252   DALYTKPFQTNLLMLGPGQTTDVLVTADQTTGRYYMAARAYSSGQGVPFDNTTTVAILEY  311

Query  1221  TNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVF--NQPDESLFFTVGLGL  1048
                   + S P +P LP +NDT TAT F   LRS+ S++  VF     D++LF+T+GLGL
Sbjct  312   KGSSS-STSVPTVPNLPAYNDTQTATRFANALRSLASHDHPVFVPQSVDQNLFYTIGLGL  370

Query  1047  VNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDY  868
             +NC PG  C GPN +RFAASMNN SFVLP  +S+L+A +  + G+++ DFP  PPVQFDY
Sbjct  371   INC-PGQSCGGPNGSRFAASMNNASFVLPTTSSILEAQHFGMKGVFSGDFPDNPPVQFDY  429

Query  867   TG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGN  691
             T  NVSR LW P   T++  + Y + VQV+LQ T IF  E HPIHLHGY F++VG GFGN
Sbjct  430   TAQNVSRGLWSPVKSTRVKILNYNTTVQVILQGTNIFAGESHPIHLHGYDFYIVGSGFGN  489

Query  690   FNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFI  511
             +NP+TD  KFNLVDPP+RNT++VPV GWA IRF ADNPG W+MHCH+D H+ WGLAM F+
Sbjct  490   YNPKTDPQKFNLVDPPMRNTVNVPVNGWAAIRFVADNPGAWVMHCHLDVHITWGLAMVFV  549

Query  510   VENGQGEKQTVEPPPLDLPRC  448
             V NG     ++E PPLDLP+C
Sbjct  550   VSNGPSSLLSIESPPLDLPQC  570



>gb|AFV52383.1| laccase [Picea abies]
Length=573

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/565 (61%), Positives = 420/565 (74%), Gaps = 8/565 (1%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             +  L V LT LA  A A+ V    FV++   +TRLCKT  +I VNGQFPGPT+ VRNGD 
Sbjct  10    ILALVVCLTFLAVTALAEHVIRHTFVIEAKPVTRLCKTHNVIIVNGQFPGPTLHVRNGDT  69

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             + VKV NRA+YN T+HWHG+RQ RT WADGPE++TQCPI PGG+YTYRF I  QEGTLWW
Sbjct  70    LSVKVYNRAQYNATVHWHGIRQFRTGWADGPEFITQCPIRPGGSYTYRFTITGQEGTLWW  129

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRA+VYGA II+P+ G+ +PF+ P ++ PI+LGEWWNR+ I +  Q   TGAAP
Sbjct  130   HAHSSWLRASVYGALIIHPRLGTTYPFTPPHRETPIMLGEWWNRNPIDVVNQATRTGAAP  189

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLY CS ++T +  +   E  LLR++NAALNQ+LFF+VANHKL VV 
Sbjct  190   NVSDAYTINGQPGDLYPCSRRETFRVRIYNEEIHLLRIVNAALNQELFFTVANHKLTVVA  249

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLT-ADQpparyymaarayataqnaPFDNTTTTAVL  1228
              DA+Y KPF T  +M+GPGQTT+VLL  A     RYYMAARAY +AQ  PFDNTTTTA+L
Sbjct  250   VDASYTKPFRTKTVMLGPGQTTDVLLRGARHRVGRYYMAARAYDSAQGVPFDNTTTTAIL  309

Query  1227  EYTNLRPGANS--RPLMPQLPFFNDtatataftTQLRSVPSNNPTVF--NQPDESLFFTV  1060
             EY   RP  +S  RP+MP LP +NDT TAT F   LRS+ +    V+     DESLF+T+
Sbjct  310   EYRTRRPPPSSSFRPVMPILPAYNDTRTATNFARGLRSLGTREHPVYVPQTVDESLFYTI  369

Query  1059  GLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPV  880
             GLGL NC P   C GPN TRF ASMNN+SFVLP   S+LQA+Y    G++T  FP  PPV
Sbjct  370   GLGLFNC-PNRSCGGPNGTRFTASMNNISFVLPSTYSVLQAHYFGKKGVFTTGFPDNPPV  428

Query  879   QFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             QF+YT  NVSR+LW P  GTK+  +KY ++VQV+LQDT I   E+HPIHLHGY F++VG+
Sbjct  429   QFNYTAQNVSRSLWSPVRGTKVKVLKYNAKVQVILQDTNIVNAENHPIHLHGYDFYIVGE  488

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGN+NP+TD  KFNLVDPP+RNT+ VPV GWA IRF ADNPG WLMHCH+D H+ WGLA
Sbjct  489   GFGNYNPRTDPQKFNLVDPPLRNTVAVPVNGWAAIRFVADNPGAWLMHCHLDVHITWGLA  548

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG     T+E PP DLP C
Sbjct  549   MVFLVENGPSYMTTIESPPPDLPVC  573



>ref|XP_004977611.1| PREDICTED: laccase-23-like [Setaria italica]
Length=595

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/550 (63%), Positives = 428/550 (78%), Gaps = 15/550 (3%)
 Frame = -3

Query  2058  QEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQ  1879
              EFV+QE  +TRLC+  +I+TVNGQFPGP + +  GD ++V+V+NR  YNVT+HWHG+RQ
Sbjct  48    HEFVIQEASVTRLCREHSIMTVNGQFPGPAVEISEGDSLIVRVINRGSYNVTVHWHGVRQ  107

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT W+DGPE+VTQCPI PG +YTYRF +  QEGTLWWHAHS WLRATV+GA II P++G
Sbjct  108   MRTGWSDGPEFVTQCPIRPGQSYTYRFTVAGQEGTLWWHAHSSWLRATVHGALIIRPRAG  167

Query  1698  -SHFPFSQ-------PKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGD  1543
              + +PF+        P  +IPILLGEWW+ + I + R    TGAAPNIS+A T+NGQPGD
Sbjct  168   VTAYPFNAVAGGGKPPAGEIPILLGEWWDMNPIDVVRTATRTGAAPNISDALTVNGQPGD  227

Query  1542  LYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVI  1363
             LYRCSS+DT  F V  GET LLR INAALN +LF S+A H + VVGADA+Y KP++T+V+
Sbjct  228   LYRCSSKDTTTFPVKSGETNLLRFINAALNTELFVSLAGHTMTVVGADASYTKPYSTSVL  287

Query  1362  MVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSR-PL  1186
             M+ PGQTT+VL+T DQPP RYY+AARAYA+AQ  PFDNTTTTA+ +Y++    ++S  P 
Sbjct  288   MIAPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYSSSSGSSSSSSPA  347

Query  1185  MPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNN  1006
             MP LP +NDTATAT FTT LR +      + ++ DE+LFFTVG+GL NC+ G +C GPNN
Sbjct  348   MPTLPAYNDTATATTFTTSLRGL--RKAELPSRIDENLFFTVGVGLFNCSSGQKCGGPNN  405

Query  1005  TRFAASMNNVSFVLPRRTSLLQAYYNNIP---GIYTLDFPPVPPVQFDYTG-NVSRALWQ  838
             TRFAASMNNVSFVLP   S+LQA+Y       G++T DFP  PPVQFDYT  NVSRALWQ
Sbjct  406   TRFAASMNNVSFVLPSTVSILQAHYGGAQVQQGVFTDDFPANPPVQFDYTAQNVSRALWQ  465

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTK+Y++KYG+ VQ+VLQ T IF  E+HPIH+HGY F+++ +GFGNF+  TDTAKFN
Sbjct  466   PAPGTKVYRLKYGAAVQLVLQGTNIFAGENHPIHIHGYDFYILAEGFGNFDAATDTAKFN  525

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             L DPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++
Sbjct  526   LDDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVGELQSL  585

Query  477   EPPPLDLPRC  448
             E PP DLP C
Sbjct  586   EAPPPDLPLC  595



>gb|ABR17539.1| unknown [Picea sitchensis]
Length=573

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/565 (61%), Positives = 419/565 (74%), Gaps = 8/565 (1%)
 Frame = -3

Query  2121  LAKLFVMLTVLASLANAD-VYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngdd  1945
             +  L V LT LA  A A+ V    FV++   +TRLCKT  +I VNGQFPGPT+ VRNGD 
Sbjct  10    ILALVVCLTFLAVTALAEHVIRHTFVIEAKPVTRLCKTHNVIIVNGQFPGPTLHVRNGDT  69

Query  1944  vvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWW  1765
             + VKV NRA+YN T+HWHG+RQ RT WADGPE++TQCPI PGG+YTYRF I  QEGTLWW
Sbjct  70    LSVKVYNRAQYNATVHWHGIRQFRTGWADGPEFITQCPIRPGGSYTYRFTITGQEGTLWW  129

Query  1764  HAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAP  1585
             HAHS WLRA+VYGA II+P+ G+ +PF+ P ++ PI+LGEWWNR+ I +  Q   TGAAP
Sbjct  130   HAHSSWLRASVYGALIIHPRLGTTYPFTAPHRETPIMLGEWWNRNPIDVVNQATRTGAAP  189

Query  1584  NISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVG  1405
             N+S+AYTINGQPGDLY CS ++T +  +   E  LLR++NAALNQ+LFF+VANHKL VV 
Sbjct  190   NVSDAYTINGQPGDLYPCSRRETFRVPIYNEEIHLLRIVNAALNQELFFTVANHKLTVVA  249

Query  1404  ADAAYNKPFTTNVIMVGPGQTTNVLLT-ADQpparyymaarayataqnaPFDNTTTTAVL  1228
              DA+Y KPF T  + +GPGQTT+VLL  A     RYYMAARAY +AQ  PFDNTTTTA+L
Sbjct  250   VDASYTKPFRTKTVKLGPGQTTDVLLRGARHRVGRYYMAARAYDSAQGVPFDNTTTTAIL  309

Query  1227  EYTNLRPGANS--RPLMPQLPFFNDtatataftTQLRSVPSNNPTVF--NQPDESLFFTV  1060
             EY   RP  +S  RP+MP LP +NDT TAT F   LRS+ +    V+     DESLF+T+
Sbjct  310   EYRTRRPPPSSSFRPVMPILPAYNDTRTATNFARGLRSLGTREHPVYVPQTVDESLFYTI  369

Query  1059  GLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPV  880
             GLGL NC P   C GPN TRF ASMNN+SFVLP   S+LQA+Y    G++T  FP  PPV
Sbjct  370   GLGLFNC-PNQSCGGPNGTRFTASMNNISFVLPSTYSILQAHYFGKKGVFTTGFPDNPPV  428

Query  879   QFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             QF+YT  NVSR+LW P  GTK+  +KY ++VQV+LQDT I   E+HPIHLHGY F++VG+
Sbjct  429   QFNYTAQNVSRSLWSPVRGTKVKVLKYNAKVQVILQDTNIVNAENHPIHLHGYDFYIVGE  488

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGN+NP+TD  KFNLVDPP+RNT+ VPV GWA IRF ADNPG WLMHCH+D H+ WGLA
Sbjct  489   GFGNYNPRTDPQKFNLVDPPLRNTVAVPVNGWAAIRFVADNPGAWLMHCHLDVHITWGLA  548

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             M F+VENG     T+E PP DLP C
Sbjct  549   MVFLVENGPSYMTTIESPPPDLPVC  573



>gb|EMS46935.1| Laccase-3 [Triticum urartu]
Length=600

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/581 (60%), Positives = 416/581 (72%), Gaps = 31/581 (5%)
 Frame = -3

Query  2106  VMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvv  1927
             ++L+ L   A A+    EFVVQET + RLC+T  IITVNGQFPGPTI V NGD + ++ V
Sbjct  21    ILLSFLLPGALAEERFYEFVVQETVVKRLCQTNRIITVNGQFPGPTIEVHNGDTLAIRAV  80

Query  1926  nrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRW  1747
             N A+YNVT+HWHGLRQ+R  WADGPE+VTQCPI PG +YTYR+ I+ QEGTLWWHAHS W
Sbjct  81    NMAQYNVTLHWHGLRQLRNGWADGPEFVTQCPIRPGSSYTYRYTIQEQEGTLWWHAHSSW  140

Query  1746  LRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAY  1567
             LRATV+GA II PK G  +PF +P K+ P++L EWW RD IA+ RQ+  TGA PN+S+  
Sbjct  141   LRATVHGALIILPKRGMPYPFPKPNKEFPVVLAEWWRRDPIAVLRQSMVTGAPPNVSDTI  200

Query  1566  TINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYN  1387
              INGQPGD   CSSQ+T    V  GET LLR+INAA+N +LF S+A HK+ VV ADA Y 
Sbjct  201   LINGQPGDFLPCSSQETSIIPVVAGETNLLRIINAAMNSELFVSLAGHKMTVVAADAVYT  260

Query  1386  KPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL--  1213
             KPF T V+++GPGQTT+VL+TA   P RYY+ AR YA+AQN PFDNTT TAV +Y N   
Sbjct  261   KPFETTVVLLGPGQTTDVLVTAHAAPGRYYLGARVYASAQNVPFDNTTATAVFQYKNAAG  320

Query  1212  -----------------------RPG-ANSRPLMPQLPFFNDtatataftTQLRS-VPSN  1108
                                     PG A   P+ P LP  NDT TAT F+  +RS  P  
Sbjct  321   CPPTGAGAGLGDHTGLGRPRSSGNPGRAGPAPMFPMLPANNDTNTATGFSNLIRSPRPVK  380

Query  1107  NPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYN  928
              P    Q    +F T+G GL NC PGP CQGPNNTRF ASMNNVSF LP   SLLQA+Y+
Sbjct  381   VPGPVTQ---EVFTTIGFGLFNCQPGPFCQGPNNTRFGASMNNVSFQLPNTVSLLQAHYH  437

Query  927   NIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTE  751
              IPG++T DFP  PPV FDYT  NV RALWQP  GT+LY++KYG+ VQ+V QDT IF  E
Sbjct  438   RIPGVFTEDFPARPPVVFDYTSQNVPRALWQPVKGTRLYRVKYGAVVQMVFQDTGIFAAE  497

Query  750   DHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGV  571
             +HP+H+HGYHF+V+  GFGN+NP+ D AKFN+VDPP RNTI VPVGGWAV+RF ADNPGV
Sbjct  498   EHPMHIHGYHFYVLATGFGNYNPRRDEAKFNMVDPPSRNTIGVPVGGWAVVRFLADNPGV  557

Query  570   WLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             WL+HCHID+HL  GLAMA +VE+G+ E QT  PPPLDLP C
Sbjct  558   WLVHCHIDAHLTGGLAMALVVEDGKTELQTTMPPPLDLPVC  598



>ref|XP_003579045.1| PREDICTED: laccase-23-like [Brachypodium distachyon]
Length=569

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/565 (62%), Positives = 424/565 (75%), Gaps = 11/565 (2%)
 Frame = -3

Query  2124  FLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTK-TIITVNGQFPGPTIAvrngd  1948
             F++ +  +L   + L  A     EFV+QET + RLC    +I+T NGQFPGPT+ V  GD
Sbjct  10    FISIIAALLLCCSQLTAAKEQQHEFVIQETAVKRLCNGGMSIVTANGQFPGPTVEVSEGD  69

Query  1947  dvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLW  1768
              +VV VVN A YNVTIHWHG+RQMRT W+DGPE+VTQCPI PG +YTYRF +  QEGTLW
Sbjct  70    SLVVNVVNNATYNVTIHWHGVRQMRTGWSDGPEFVTQCPIRPGQSYTYRFTVTGQEGTLW  129

Query  1767  WHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAA  1588
             WHAHS WLRATVYGA +I P+ G  +PF    + +PILLGEWW+ + I + R    TGAA
Sbjct  130   WHAHSSWLRATVYGALLIRPRDGVPYPFDFAAETVPILLGEWWDMNPIDVIRAATRTGAA  189

Query  1587  PNISNAYTINGQPGDLYRCSS-QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQV  1411
             PN+S+A T+NGQPGDLY CSS QDT  F V  GET LLR INAALN +LF S+A H + V
Sbjct  190   PNVSDALTVNGQPGDLYSCSSSQDTTVFPVKSGETNLLRFINAALNTELFVSLAGHAMTV  249

Query  1410  VGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAV  1231
             VGADA+Y KP+ T+V+++GPGQTT+VL+T DQPP RYY+AARAYA+AQ  PFDNTTTTA+
Sbjct  250   VGADASYTKPYNTSVLVLGPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAI  309

Query  1230  LEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNN-PTVFNQPDESLFFTVGL  1054
              +Y        + P MP LP +NDTAT TAFTT LR++ S   P+V    DE LFFTVG+
Sbjct  310   FDYG--AGDGTTSPAMPTLPAYNDTATVTAFTTSLRNLHSIGLPSVV---DEDLFFTVGV  364

Query  1053  GLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP--GIYTLDFPPVPPV  880
             GL NC+ G  C GPNNTRFAAS+NNVSFVLP   S+LQA+Y+     G++T DFP  PPV
Sbjct  365   GLFNCSKGQSCGGPNNTRFAASINNVSFVLPSTVSILQAHYDGGANAGVFTTDFPANPPV  424

Query  879   QFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQ  703
             QFDYT  NVSR LWQP  GTKLY +KYG+ VQVVLQ T IF  E+HPIH+HGY F+++ +
Sbjct  425   QFDYTAQNVSRGLWQPVPGTKLYNLKYGAVVQVVLQGTNIFAGENHPIHIHGYDFYILAE  484

Query  702   GFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLA  523
             GFGNF+  TDTAKFNL DPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLA
Sbjct  485   GFGNFDAATDTAKFNLDDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLA  544

Query  522   MAFIVENGQGEKQTVEPPPLDLPRC  448
             MAF+V++G GE Q++  PP DLP C
Sbjct  545   MAFLVKDGVGELQSLGAPPPDLPIC  569



>ref|XP_010452666.1| PREDICTED: laccase-13-like isoform X2 [Camelina sativa]
Length=484

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/490 (68%), Positives = 388/490 (79%), Gaps = 19/490 (4%)
 Frame = -3

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPK-S  1702
             MR PWADGPEY+TQCPI PGG+YTYRF IE+QEGTLWWHAHSRWLRATVYGA II P  S
Sbjct  1     MRNPWADGPEYITQCPIQPGGSYTYRFTIEDQEGTLWWHAHSRWLRATVYGALIIRPPLS  60

Query  1701  GSHFPFSQ-PKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSS  1525
               H+PF   PK++I +LLGEWW+R+ + +    QFTGAAPNIS+A+TINGQPGDLYRCSS
Sbjct  61    SPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGAAPNISDAFTINGQPGDLYRCSS  120

Query  1524  QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQ  1345
             Q+T++F V  GE VLLRVIN+ALNQ+LFF VANHKL VV ADA+Y KPF+TNVIM+GPGQ
Sbjct  121   QETLRFLVGSGEIVLLRVINSALNQELFFGVANHKLTVVAADASYTKPFSTNVIMLGPGQ  180

Query  1344  TTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN-----LRPGANSRPLMP  1180
             TT+VLLTADQPPA YYMAA AY +A  A FDNTTTTA+L+Y +     L   + +R ++ 
Sbjct  181   TTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLLGKSQARAILA  239

Query  1179  QLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTP--GPRCQG  1015
             QLP FNDTATA AFT Q++S     P+    P   DE+LFFTVGLGL NCT     RCQG
Sbjct  240   QLPGFNDTATAAAFTAQMKS-----PSKVEVPLEIDENLFFTVGLGLFNCTTPNTQRCQG  294

Query  1014  PNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             PN TRF AS+NNVSFV P+R S++QAYY   P G++T DFPP PPV FDYTGNVSR LWQ
Sbjct  295   PNGTRFTASINNVSFVFPKRNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGNVSRGLWQ  354

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTK YK+K+ S+VQ++LQDT+I TTE+HP+HLHGY F+VVG G GNFN  TDTA FN
Sbjct  355   PTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNANTDTASFN  414

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             L+DPP RNTI  P GGW  IRF A+NPG WLMHCHIDSH+ WGLAM F+VENG+G  Q+V
Sbjct  415   LIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVFLVENGEGHLQSV  474

Query  477   EPPPLDLPRC  448
             + PPLDLP+C
Sbjct  475   QSPPLDLPQC  484



>ref|XP_002468016.1| hypothetical protein SORBIDRAFT_01g038130 [Sorghum bicolor]
 gb|EER95014.1| hypothetical protein SORBIDRAFT_01g038130 [Sorghum bicolor]
Length=600

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/576 (60%), Positives = 420/576 (73%), Gaps = 35/576 (6%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
              +LA    Y  EFVV+ET + RLCK++ I+TVNGQFPGPTI V +GD + +K VN A YN
Sbjct  29    GALAEERFY--EFVVKETLVKRLCKSQKIVTVNGQFPGPTIEVYSGDTLAIKAVNLAPYN  86

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             VT+HWHGLRQ+R  WADGPE+VTQCPI PGG+YTYRF  + QEGTLWWHAHS WLRATV+
Sbjct  87    VTLHWHGLRQLRNGWADGPEFVTQCPIRPGGSYTYRFTTQGQEGTLWWHAHSSWLRATVH  146

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA II+P+ G  +PF +P+ + P++L EWW R+ IA+ RQ+  TGA PN+S+A  INGQP
Sbjct  147   GALIIHPRRGLPYPFPKPQMEAPVILAEWWMRNPIAVLRQSMITGAPPNVSDALLINGQP  206

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDL  CSSQ+T    V  GET LLR+INAA+N +LF S+A H++ VV ADA Y KPF T+
Sbjct  207   GDLLPCSSQETSIIPVVAGETSLLRIINAAMNTELFVSLAGHRMTVVAADAMYTKPFETD  266

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPG-----  1204
             V+++GPGQTT+VL+TA   P RYY+AARAYA+AQ  PFDNTT TA+ +Y N  PG     
Sbjct  267   VVLLGPGQTTDVLVTAHAAPGRYYLAARAYASAQGVPFDNTTATAIFQYKN-APGCPTAS  325

Query  1203  ----------------------ANSRPLMPQLPFFNDtatataftTQLRS-VPSNNPTVF  1093
                                   A  +P++P LP FNDT TATAF+  LRS  P   P   
Sbjct  326   AGAGAFSGPVGRSTRSSGHLGRAGPQPMLPFLPAFNDTNTATAFSNSLRSPAPVKVPGPV  385

Query  1092  NQPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGI  913
              Q    +F TVG GL NC PGP CQGPNNTRF ASMNNVSF LP   SLLQA+Y++IPG+
Sbjct  386   TQ---EVFTTVGFGLFNCRPGPFCQGPNNTRFGASMNNVSFQLPNTVSLLQAHYHHIPGV  442

Query  912   YTLDFPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIH  736
             +T DFP  PPV FD+T  NV RALWQP  GTKLY+++YG+ VQ+V QDT IF  E+HP+H
Sbjct  443   FTEDFPAFPPVFFDFTSQNVPRALWQPVKGTKLYRVEYGAVVQMVFQDTGIFAAEEHPMH  502

Query  735   LHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHC  556
             +HGYHF+V+  GFGN++P+ D AKFNLVDPP RNTI VPVGGWAV+RF ADNPGVWL+HC
Sbjct  503   IHGYHFFVLATGFGNYDPRRDEAKFNLVDPPSRNTIGVPVGGWAVVRFVADNPGVWLVHC  562

Query  555   HIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             HID+HL  GLAMA +VE+G+ E +    PPLDLP C
Sbjct  563   HIDAHLTGGLAMALLVEDGEAELEATIAPPLDLPIC  598



>ref|NP_001145891.1| putative laccase family protein precursor [Zea mays]
 gb|ACL52797.1| unknown [Zea mays]
 tpg|DAA44912.1| TPA: putative laccase family protein [Zea mays]
Length=607

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/582 (59%), Positives = 421/582 (72%), Gaps = 40/582 (7%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnraryn  1909
              +LA    Y  EFVV+ T + RLCKT+ IITVNGQFPGPTI V +GD + V+ VN ARYN
Sbjct  29    GALAEERFY--EFVVRGTPVKRLCKTQEIITVNGQFPGPTIEVYSGDTLAVRAVNLARYN  86

Query  1908  VTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVY  1729
             VT+HWHGLRQ+R  WADGPE+VTQCPI PGG+YTYRF +E QEGTLWWHAHS WLRATV+
Sbjct  87    VTLHWHGLRQLRNGWADGPEFVTQCPIRPGGSYTYRFTVEGQEGTLWWHAHSSWLRATVH  146

Query  1728  GAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQP  1549
             GA II+P+ G  +PF +P  + P++L EWW RD IA+ RQ+  TGA PN+S+A  INGQP
Sbjct  147   GALIIHPRRGVPYPFPKPHTEAPVILAEWWRRDPIAVLRQSMITGAPPNVSDALLINGQP  206

Query  1548  GDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTN  1369
             GDL  CSSQ+T    V  GET LLR+INAA+N +LF S+A H++ VV ADA Y KPF T+
Sbjct  207   GDLLPCSSQETSIIPVVAGETSLLRIINAAMNTELFVSLAGHRMTVVAADAMYTKPFETD  266

Query  1368  VIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPG-----  1204
             V+++GPGQTT+VL+TA   P RYY+AARAYA+AQ  PFDNTT TA+ +Y N  PG     
Sbjct  267   VVLLGPGQTTDVLVTAHAAPGRYYLAARAYASAQGVPFDNTTATAIFQYKNA-PGCPTTS  325

Query  1203  -----------------------------ANSRPLMPQLPFFNDtatataftTQLRSVPS  1111
                                          A  +P++P LP FNDT TATAF+ +LRS   
Sbjct  326   GAGAGAGAGAGTFSGPVGRSSRSSGYLGRAGPQPMLPFLPAFNDTNTATAFSNRLRS--P  383

Query  1110  NNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYY  931
                 V     + +F TVG GL NC PGP CQGPNNTRF ASMNNVSF LP   SLLQA+Y
Sbjct  384   VPVKVPGPVTQEVFTTVGFGLFNCRPGPFCQGPNNTRFGASMNNVSFQLPDTVSLLQAHY  443

Query  930   NNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTT  754
             ++IPG++T DFP +PPV FD+T  NV RALWQP  GT+LY+++YG+ VQ+V QDT IF  
Sbjct  444   HHIPGVFTDDFPALPPVFFDFTSQNVPRALWQPVKGTRLYRVRYGAVVQIVFQDTGIFAA  503

Query  753   EDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPG  574
             E+HP+H+HGYHF+V+  GFGN++P+ D A+FNLVDPP RNTI VPVGGWAV+RF ADNPG
Sbjct  504   EEHPMHIHGYHFYVLATGFGNYDPRRDAARFNLVDPPSRNTIGVPVGGWAVVRFVADNPG  563

Query  573   VWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             VWL+HCHID+HL  GLAMA +VE+G+ E +    PPLDLP C
Sbjct  564   VWLVHCHIDAHLTGGLAMALLVEDGESELEATVAPPLDLPIC  605



>emb|CBW38080.1| laccase-like multicopper oxidase [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/593 (58%), Positives = 416/593 (70%), Gaps = 35/593 (6%)
 Frame = -3

Query  2136  FCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvr  1957
              C      L +   + ++LA    Y  EFVVQET + RLC+T  IITVNGQFPGPTI V 
Sbjct  3     LCCCLSGVLLLSFLLPSALAEERFY--EFVVQETVVKRLCQTNRIITVNGQFPGPTIEVH  60

Query  1956  ngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEG  1777
             NGD + ++ VN A+YNVT+HWHGLRQ+R  WADGPE+VTQCPI PG +YTYR+ I+ QEG
Sbjct  61    NGDTLAIRAVNMAQYNVTLHWHGLRQLRNGWADGPEFVTQCPIRPGSSYTYRYTIQEQEG  120

Query  1776  TLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFT  1597
             TLWWHAHS WLRATV+GA +I PK G  +PF +P K+ P++L EWW RD IA+ RQ+  T
Sbjct  121   TLWWHAHSSWLRATVHGALVILPKRGVPYPFPKPHKEFPVVLAEWWRRDPIAVLRQSMVT  180

Query  1596  GAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKL  1417
             GA PN+S+   INGQPGD   CSSQ+T    V  GET LLR+INAA+N +LF S+A HK+
Sbjct  181   GAPPNVSDTILINGQPGDFLPCSSQETSIIPVVAGETNLLRIINAAMNSELFVSLAGHKM  240

Query  1416  QVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTT  1237
              VV ADA Y KPF T V+++GPGQTT+VL+TA   P RYY+ AR YA+AQ  PFDNTT T
Sbjct  241   TVVAADAVYTKPFETTVVLLGPGQTTDVLVTAHAAPGRYYLGARVYASAQGVPFDNTTAT  300

Query  1236  AVLEYTNL-----------------------RPGAN-----SRPLMPQLPFFNDtatata  1141
             A+ +Y +                        RP  N       P+ P LP  NDT TAT 
Sbjct  301   AIFQYKDAAGCPPTGAVAVAGAGAKTGLGHRRPSGNPGRAGPAPMFPMLPANNDTNTATG  360

Query  1140  ftTQLRS-VPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVL  964
             F+  +RS  P   P    Q    +F T+G GL NC PGP CQGPNNTRF ASMNNVSF L
Sbjct  361   FSNLIRSPRPVKVPGPVTQ---EVFTTIGFGLFNCRPGPFCQGPNNTRFGASMNNVSFQL  417

Query  963   PRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQ  787
             P   SLLQA+Y+ IPG++T DFP  PPV FDYT  NV RALWQP  GT+LY++KYG+ VQ
Sbjct  418   PNTVSLLQAHYHRIPGVFTEDFPARPPVVFDYTSQNVPRALWQPVKGTRLYRVKYGAVVQ  477

Query  786   VVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGW  607
             +V QDT IF  E+HP+H+HGYHF+V+  GFGN+NP+ D AKFN+VDPP RNTI VPVGGW
Sbjct  478   IVFQDTGIFAAEEHPMHIHGYHFYVLATGFGNYNPRRDEAKFNMVDPPSRNTIGVPVGGW  537

Query  606   AVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             AV+RF ADNPGVWL+HCHID+HL  GLAMA +VE+G+ E QT  PPP+DLP C
Sbjct  538   AVVRFLADNPGVWLVHCHIDAHLTGGLAMALVVEDGKTELQTTMPPPVDLPIC  590



>gb|KHG22243.1| Laccase-5 -like protein [Gossypium arboreum]
Length=483

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/485 (67%), Positives = 389/485 (80%), Gaps = 10/485 (2%)
 Frame = -3

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT WADGPE+VTQCPI PGG+YTYRF IE QEGTLWWHAHS WLRATVYGA II P+ G
Sbjct  1     MRTGWADGPEFVTQCPIRPGGSYTYRFTIEGQEGTLWWHAHSSWLRATVYGAIIIRPREG  60

Query  1698  SHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQD  1519
               +PF +PK++  I+LGEWW+ + + + RQ   TGAAPN S+AYTINGQPGDLY+CSS+D
Sbjct  61    ESYPFPKPKRETEIILGEWWDANPMDVVRQATMTGAAPNNSDAYTINGQPGDLYKCSSKD  120

Query  1518  TVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTT  1339
             T    +  GET LLRVINAALNQ LFF+VANHK  VVGADA+Y KPFTT+VIM+GPGQTT
Sbjct  121   TTIVPIDVGETNLLRVINAALNQPLFFTVANHKFTVVGADASYLKPFTTSVIMLGPGQTT  180

Query  1338  NVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL----RPGANS-RPLMPQL  1174
             +VL+  +Q PARYYMAARAY +AQNAPFDNTTTTA+LEY +     + G N  +P+MP L
Sbjct  181   DVLIQGNQLPARYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKKGINGPKPIMPSL  240

Query  1173  PFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRCQGPNNT  1003
             P +NDT T T+F+  LRS       V  + DESLFFTVGLGL NC P     RCQGPN T
Sbjct  241   PAYNDTNTVTSFSQSLRS--PRKVEVPTEIDESLFFTVGLGLNNCPPNFPSSRCQGPNGT  298

Query  1002  RFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGT  823
             RF ASMNNVSFV P+  SLLQA+ + IPG++T DFP  PP++FDYTGNVS++L+QP  GT
Sbjct  299   RFTASMNNVSFVFPQNFSLLQAHQHGIPGVFTTDFPATPPLKFDYTGNVSQSLYQPVPGT  358

Query  822   KLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPP  643
             KLYK+KYGS+VQ+VLQDT+I T E+HPIHLHGY F++V +GFGNF+P+TDT+KFNLVDPP
Sbjct  359   KLYKLKYGSKVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPKTDTSKFNLVDPP  418

Query  642   VRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPL  463
              RNT+ VPV GWAVIRF ADNPGVW+MHCH+D H+ WGLAMAF+VENG GE Q+++ PP 
Sbjct  419   QRNTVGVPVNGWAVIRFVADNPGVWIMHCHLDVHITWGLAMAFVVENGLGELQSLQAPPP  478

Query  462   DLPRC  448
             DLP C
Sbjct  479   DLPIC  483



>gb|EMT02387.1| hypothetical protein F775_52333 [Aegilops tauschii]
Length=564

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/545 (63%), Positives = 411/545 (75%), Gaps = 6/545 (1%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             A A     EFV+QE  +TRLC +++I+T NGQFPGP + +  GD +VV VVN A YNVTI
Sbjct  25    ATAKEQRHEFVIQEAAVTRLCNSRSIVTANGQFPGPAVELNEGDSLVVSVVNNATYNVTI  84

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQMRT W+DGPE+VTQCPI PGG+YTYRF +  QEGTLWWHAHS WLRATVYGA 
Sbjct  85    HWHGVRQMRTGWSDGPEFVTQCPIRPGGSYTYRFTVAGQEGTLWWHAHSSWLRATVYGAL  144

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             II P+    +PF    +  PI+LGEWW+ + I + R    TGAAPN+S+A T+NGQPGDL
Sbjct  145   IIRPRDPVPYPFDFHGELAPIMLGEWWDMNPIDVIRTATRTGAAPNVSDAITVNGQPGDL  204

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y CSSQDT  F V  GET LLR INAALN +LF S+A H + VVGADA+Y KP+ T VI+
Sbjct  205   YSCSSQDTTVFPVKSGETNLLRFINAALNTELFVSLAGHTMTVVGADASYLKPYNTTVIV  264

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRPLMP  1180
             +GPGQTT+VL+T DQPP RYY+AARAYA+AQ  PFDNTTTTA+ +Y     G  + P MP
Sbjct  265   LGPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDY---GAGGTASPAMP  321

Query  1179  QLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTR  1000
              LP +NDTAT T FTT LR++ S    + +  DE LFFTVG+GL NC+ G  C GPNNTR
Sbjct  322   TLPAYNDTATVTTFTTSLRNLHSVG--LPSAVDEDLFFTVGVGLFNCSSGQNCGGPNNTR  379

Query  999   FAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPSGT  823
             FAAS+NN SFVLP   S+LQA+    PG+   D P  PPVQFDYT  NVSRALWQP  GT
Sbjct  380   FAASINNASFVLPSTVSILQAHIPPAPGVSPPDSPATPPVQFDYTAQNVSRALWQPVPGT  439

Query  822   KLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPP  643
             K+YK+KYGS VQ+VLQ T IF  E+HPIH HGY F+++ +GFGNF+  TDTAKFNL DPP
Sbjct  440   KVYKLKYGSVVQIVLQGTNIFAGENHPIHTHGYDFFILAEGFGNFDAATDTAKFNLDDPP  499

Query  642   VRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPL  463
             +RNT+ VP+ GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE+G GE Q++ PPP 
Sbjct  500   MRNTVGVPLNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVEDGVGELQSLGPPPP  559

Query  462   DLPRC  448
              LP C
Sbjct  560   ALPIC  564



>gb|KHG11797.1| Laccase-12 -like protein [Gossypium arboreum]
Length=478

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/480 (67%), Positives = 379/480 (79%), Gaps = 5/480 (1%)
 Frame = -3

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT WADGPE+VTQCPI PGG+YTYRF I+ QEGTLWWHAHS WLRATVYGA II P+ G
Sbjct  1     MRTGWADGPEFVTQCPIRPGGSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIRPRLG  60

Query  1698  SHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQD  1519
               +PF +P  + PI+LG+WW+ + I + R+   TGAAPN+S+AYTIN QPGDLY+CSS+D
Sbjct  61    ESYPFPKPNLETPIVLGQWWDANPIDVVREATRTGAAPNVSDAYTINAQPGDLYKCSSKD  120

Query  1518  TVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTT  1339
             T    +  GET LLRVINAALNQ LFF+VANHKL VVGADA Y KPFTT+V+M+G GQTT
Sbjct  121   TTIIPIDAGETNLLRVINAALNQPLFFAVANHKLTVVGADATYIKPFTTSVLMLGAGQTT  180

Query  1338  NVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRPLMPQLPFFND  1159
             +VL+ ADQ P RYYMAARAY +AQN PFDNTTTTA+LEY + + G   +P+MP LP +ND
Sbjct  181   DVLIKADQRPVRYYMAARAYQSAQNVPFDNTTTTAILEYKSSKKGNAPKPIMPSLPAYND  240

Query  1158  tatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPG---PRCQGPNNTRFAAS  988
             T T TAF+   RS       V  + +ESLFFT+GLGL NC P     RCQGPN TR AAS
Sbjct  241   TNTVTAFSRSFRS--PRKVQVPTEINESLFFTIGLGLNNCPPNFRRSRCQGPNGTRLAAS  298

Query  987   MNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKLYKI  808
             MNNVSF+LPR  SLLQA+   IPG++T DFP  PPV+FDYTGNVSR L+QP +GTKLYK+
Sbjct  299   MNNVSFMLPRSISLLQAHQQGIPGVFTTDFPGTPPVKFDYTGNVSRTLFQPITGTKLYKL  358

Query  807   KYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTI  628
             K+GSRVQVVLQ T+I   E+HPIHLHGY F+++  GFGNFNP+ DT+KFNLVDPP+RNT+
Sbjct  359   KFGSRVQVVLQGTSIIAPENHPIHLHGYDFYIIADGFGNFNPKRDTSKFNLVDPPLRNTV  418

Query  627   DVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
              VP  GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VENG GE Q++  PP DLP C
Sbjct  419   AVPANGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVENGFGELQSLPAPPSDLPLC  478



>ref|XP_009628838.1| PREDICTED: laccase-12-like isoform X1 [Nicotiana tomentosiformis]
Length=596

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/503 (69%), Positives = 409/503 (81%), Gaps = 8/503 (2%)
 Frame = -3

Query  2064  YNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGL  1885
             ++ +FV+Q T + RLC T   ITVNGQFPGPT+ V NGD +VVKVVN+A+YNVTIHWHG+
Sbjct  32    HHHDFVIQATPVKRLCMTHNTITVNGQFPGPTLEVNNGDTLVVKVVNKAQYNVTIHWHGV  91

Query  1884  RQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPK  1705
             RQ+RT WADGPE++TQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVYGA II+PK
Sbjct  92    RQIRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPK  151

Query  1704  SGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSS  1525
              G  +PF +PK++ PILLGEWW+ + I + R+   TGAAPN+S+AYTINGQPGDLY+CSS
Sbjct  152   EGDSYPFPKPKRETPILLGEWWDANPIDVIRRATRTGAAPNVSDAYTINGQPGDLYKCSS  211

Query  1524  QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQ  1345
             QDT    V  GET LLRVINAALNQQLFFSVANHKL VVGADA+Y KPFTT+V+M+GPGQ
Sbjct  212   QDTTIVPVDSGETNLLRVINAALNQQLFFSVANHKLTVVGADASYVKPFTTSVLMLGPGQ  271

Query  1344  TTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGAN---SRPLMPQL  1174
             TT+VL+T DQP A+YYMAARAYA+AQ APFDNTTTTA+LEY      +N   + P+ P L
Sbjct  272   TTDVLITTDQPRAKYYMAARAYASAQGAPFDNTTTTAILEYKTASCSSNCVKTNPVFPSL  331

Query  1173  PFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGP---RCQGPNNT  1003
             P +NDTATATAFTT+ RS       V  + DE+LFFTVGLGL NC  G     CQGPN T
Sbjct  332   PAYNDTATATAFTTKFRS--PRKVEVPTEIDENLFFTVGLGLNNCPRGASSSNCQGPNGT  389

Query  1002  RFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGT  823
             RFAASMNNVSFVLP   SLLQA++  IPG+++ DFP  PPV+FDYTGNVSR+LWQP  GT
Sbjct  390   RFAASMNNVSFVLPSNFSLLQAHHQGIPGVFSTDFPANPPVKFDYTGNVSRSLWQPVPGT  449

Query  822   KLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPP  643
             KLYK+KYG+RVQVVLQ T+IFT E+HPIHLHGY F+++ +GFGNFNP+ DTAKFNL+DPP
Sbjct  450   KLYKLKYGARVQVVLQGTSIFTAENHPIHLHGYDFYIIAEGFGNFNPKRDTAKFNLIDPP  509

Query  642   VRNTIDVPVGGWAVIRFFADNPG  574
             +RNT  VPV GWAVIRF ADNPG
Sbjct  510   LRNTASVPVNGWAVIRFVADNPG  532



>ref|NP_001065948.1| Os12g0108000 [Oryza sativa Japonica Group]
 sp|Q2QYS3.1|LAC23_ORYSJ RecName: Full=Laccase-23; AltName: Full=Benzenediol:oxygen oxidoreductase 
23; AltName: Full=Diphenol oxidase 23; AltName: 
Full=Urishiol oxidase 23; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|ABA96185.1| Multicopper oxidase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28967.1| Os12g0108000 [Oryza sativa Japonica Group]
Length=567

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/543 (62%), Positives = 423/543 (78%), Gaps = 8/543 (1%)
 Frame = -3

Query  2058  QEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQ  1879
              EFV++ET + RLCK+++I+TVNGQFPGPT+ ++ GD +++ ++NR RYNVT+HWHG+RQ
Sbjct  27    HEFVIRETTVKRLCKSQSIMTVNGQFPGPTLEIKEGDSLIINLINRGRYNVTLHWHGVRQ  86

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT W+DGPEYVTQCP+ PG +Y YRF +  QEGTLWWHAHS WLRATVYGA +I P+ G
Sbjct  87    MRTGWSDGPEYVTQCPVRPGQSYRYRFTVAAQEGTLWWHAHSSWLRATVYGALLIRPRDG  146

Query  1698  SHFPFS-QPKKDI-PILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSS  1525
             + +PF  QP +++ PILLGEWW+ + + + R    TGAAPNIS+A T+N QPGDLY CSS
Sbjct  147   TSYPFHVQPTRELAPILLGEWWDMNPVDVVRAATRTGAAPNISDALTVNAQPGDLYSCSS  206

Query  1524  QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQ  1345
              DT  F V+ GET LLR INAALN +LF S+A H + VV ADA+Y KP+TT+++++ PGQ
Sbjct  207   HDTAFFPVTSGETNLLRFINAALNTELFVSLAGHNMTVVAADASYTKPYTTSLLLLAPGQ  266

Query  1344  TTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRPLMPQLPFF  1165
             TT+VL+T DQPP RYY+AARAYA+AQ  PFDNTTTTA+ +Y      +++   MP LP +
Sbjct  267   TTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYGAANNASSAAIAMPTLPAY  326

Query  1164  NDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT--PGPRCQGPNNTRFAA  991
             NDT  ATAFTT LR +      + ++ DESLFFTVG+GL NCT     +C GPN TRFAA
Sbjct  327   NDTTAATAFTTNLRGL--RKAELPSRVDESLFFTVGVGLFNCTNATAQQCGGPNGTRFAA  384

Query  990   SMNNVSFVLPRRTSLLQAYYNNIPG-IYTLDFPPVPPVQFDYTG-NVSRALWQPPSGTKL  817
             S+NNVSFVLP  TS+LQA+++  PG ++T DFP  PPVQFDYT  NVSRALWQP  GTK+
Sbjct  385   SINNVSFVLPSSTSILQAHHHGAPGGVFTADFPASPPVQFDYTAQNVSRALWQPVPGTKV  444

Query  816   YKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVR  637
             YK+KYGS VQVVLQ T IF  E+HPIHLHGY F+++ +G GNF+   DTAKFN+ DPP+R
Sbjct  445   YKLKYGSAVQVVLQGTNIFAGENHPIHLHGYDFYILAEGLGNFDAGADTAKFNMEDPPMR  504

Query  636   NTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDL  457
             NT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+V++G GE Q++E PP DL
Sbjct  505   NTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVDDGVGELQSLEAPPPDL  564

Query  456   PRC  448
             P C
Sbjct  565   PLC  567



>ref|XP_010423250.1| PREDICTED: laccase-13-like isoform X2 [Camelina sativa]
Length=484

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/490 (67%), Positives = 388/490 (79%), Gaps = 19/490 (4%)
 Frame = -3

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPK-S  1702
             MR PWADGPEY+TQCPI PGG+YTY F IE+QEGTLWWHAHSRWLRATVYGA II P  S
Sbjct  1     MRNPWADGPEYITQCPIQPGGSYTYSFTIEDQEGTLWWHAHSRWLRATVYGALIIRPPLS  60

Query  1701  GSHFPFSQ-PKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSS  1525
               H+PF   PK++I +LLGEWW+R+ + +    QFTGAAPNIS+A+TINGQPGDLYRCSS
Sbjct  61    SPHYPFPVIPKREITLLLGEWWDRNPMDVLNVAQFTGAAPNISDAFTINGQPGDLYRCSS  120

Query  1524  QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQ  1345
             Q+T++F V  GE VLLRVIN+ALNQ+LFF+VANHKL VV ADA+Y KPF+TNVIM+GPGQ
Sbjct  121   QETLRFLVGSGEIVLLRVINSALNQELFFAVANHKLTVVAADASYTKPFSTNVIMLGPGQ  180

Query  1344  TTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN-----LRPGANSRPLMP  1180
             TT+VLLTADQPPA YYMAA AY +A  A FDNTTTTA+L+Y +     L+  + +R +  
Sbjct  181   TTDVLLTADQPPAHYYMAAHAYNSANAA-FDNTTTTAILKYKDASCVTLQGKSLARAIPA  239

Query  1179  QLPFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTP--GPRCQG  1015
             QLP FNDTATA AFT Q++S     P+    P   DE+LFFTVGLGL NCT     RCQG
Sbjct  240   QLPGFNDTATAAAFTAQMKS-----PSKVEVPLEIDENLFFTVGLGLFNCTTPNTQRCQG  294

Query  1014  PNNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTLDFPPVPPVQFDYTGNVSRALWQ  838
             PN TRF AS+NNVSFV P++ S++QAYY   P G++T DFPP PPV FDYTGNVSR LWQ
Sbjct  295   PNGTRFTASINNVSFVFPKQNSIMQAYYQGTPAGVFTTDFPPTPPVTFDYTGNVSRGLWQ  354

Query  837   PPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFN  658
             P  GTK YK+K+ S+VQ++LQDT+I TTE+HP+HLHGY F+VVG G GNFN  TDTA FN
Sbjct  355   PTRGTKAYKLKFNSKVQIILQDTSIVTTENHPMHLHGYEFYVVGTGVGNFNANTDTASFN  414

Query  657   LVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTV  478
             L+DPP RNTI  P GGW  IRF A+NPG WLMHCHIDSH+ WGLAM F+VENG+G  Q+V
Sbjct  415   LIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVFLVENGEGHLQSV  474

Query  477   EPPPLDLPRC  448
             + PPLDLP+C
Sbjct  475   QSPPLDLPQC  484



>gb|AAK37824.1|AF132120_1 laccase [Pinus taeda]
Length=576

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/572 (58%), Positives = 422/572 (74%), Gaps = 9/572 (2%)
 Frame = -3

Query  2148  SLNPFCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPT  1969
             S  PF   F+ ++ + LT+  ++ +A ++   FV++ T + RLC T  IITVNGQFPGPT
Sbjct  9     SAQPFAARFV-EMVICLTLFTAMVSAKLHTHIFVLRSTPVKRLCGTHNIITVNGQFPGPT  67

Query  1968  IAvrngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIE  1789
             + VRNGD + VKV N+A+YN TIHWHG+RQ RT W+DGPE++TQCPI PG +YTY+F I 
Sbjct  68    LHVRNGDKLKVKVHNQAQYNATIHWHGVRQFRTGWSDGPEFITQCPIRPGRSYTYKFTIT  127

Query  1788  NQEGTLWWHAHSRWLRATVYGAFIIYPKSGSHFPFS--QPKKDIPILLGEWWNRDIIALQ  1615
              QEGTLWWHAHS WLRATVYGA II P+  + +PF+  +P + IPILLGEWWNR+ + + 
Sbjct  128   GQEGTLWWHAHSSWLRATVYGALIILPRLDTTYPFTFTRPHRQIPILLGEWWNRNPMDVV  187

Query  1614  RQTQFTGAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFS  1435
              Q   TGAAPN+S+A+TINGQPGDLY+CS+ DT   S+  GET LLRVINAALN  LFFS
Sbjct  188   NQATQTGAAPNVSDAFTINGQPGDLYKCSTSDTFSVSMKGGETNLLRVINAALNSDLFFS  247

Query  1434  VANHKLQVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPF  1255
             + +H + VV  DA Y KPF TNV+M+GPGQTT++LLTA+Q   RYYMAARAY++ Q  PF
Sbjct  248   IGSHTMTVVAVDALYTKPFQTNVLMLGPGQTTDILLTANQATGRYYMAARAYSSGQGVPF  307

Query  1254  DNTTTTAVLEYTNLRPGANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVF--NQPD  1081
             DNTTTTA+LEY        S P+MP LPF+NDT +AT+F   LRS+ S++  VF     +
Sbjct  308   DNTTTTAILEYEG--SSKTSTPVMPNLPFYNDTNSATSFANGLRSLGSHDHPVFVPQSVE  365

Query  1080  ESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLD  901
             E+LF+T+GLGL+ C PG  C GPN +RFAASMNN+SFV P  +S+LQA +  + G+++ D
Sbjct  366   ENLFYTIGLGLIKC-PGQSCGGPNGSRFAASMNNISFVPPTTSSILQAQHFGMKGVFSAD  424

Query  900   FPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGY  724
             FP  P V FDYT  N+SR LW P   T++  +KY S VQ++LQ T IF  E HPIHLHGY
Sbjct  425   FPDNPSVGFDYTAQNISRDLWSPVKATRVKVLKYNSTVQLILQGTNIFAGESHPIHLHGY  484

Query  723   HFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDS  544
              F++VG GFGN+N QTD  KFNLVDPP+RNT++VPV GWA IRF ADNPG W+MHCH+D 
Sbjct  485   DFYIVGAGFGNYNAQTDPHKFNLVDPPMRNTVNVPVNGWAAIRFVADNPGAWVMHCHLDV  544

Query  543   HLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             H+ WGLAM F+V NG     +++ PP DLP C
Sbjct  545   HITWGLAMVFVVNNGPDALLSLQSPPRDLPLC  576



>gb|AET79245.1| multicopper oxidase [Glycine max]
Length=502

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/498 (65%), Positives = 390/498 (78%), Gaps = 18/498 (4%)
 Frame = -3

Query  1893  HGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFII  1714
             HG+RQMRT WADGPE+VTQCPI PGG+YTYRF ++ QEGTLWWHAHS WLRATVYGA II
Sbjct  7     HGVRQMRTGWADGPEFVTQCPIRPGGSYTYRFTVQGQEGTLWWHAHSSWLRATVYGALII  66

Query  1713  YPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYR  1534
              P+ G  +PF +PK + PILLGEWW+ + I + RQ   TG APN+S+AYTINGQPGDLY+
Sbjct  67    RPREGEPYPFPKPKHETPILLGEWWDANPIDVVRQATRTGGAPNVSDAYTINGQPGDLYK  126

Query  1533  CSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVG  1354
             CSS+DT    +  GET LLRVINAALNQ LFF+VANHKL VVGADA+Y KPFTT V+++G
Sbjct  127   CSSKDTTIVPIHAGETNLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTTKVLILG  186

Query  1353  PGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEY---------TNLRPGA  1201
             PGQTT+VL+T DQPP+RYYMAARAY +AQNA FDNTTTTA+LEY         ++ R   
Sbjct  187   PGQTTDVLITGDQPPSRYYMAARAYQSAQNAAFDNTTTTAILEYKSPNHHNKHSHHRAKG  246

Query  1200  ---NSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP-  1033
                 ++P+MP LP +NDT   T+F+   RS       V  + D+SLFFTVGLG+  C   
Sbjct  247   VKNKTKPIMPPLPAYNDTNAVTSFSKSFRS--PRKVEVPTEIDQSLFFTVGLGIKKCPKN  304

Query  1032  -GP-RCQGP-NNTRFAASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG  862
              GP RCQGP N TRF ASMNNVSFVLP   S+LQA++  IPG++T DFP  PPV+FDYTG
Sbjct  305   FGPKRCQGPINGTRFTASMNNVSFVLPNNVSILQAHHLGIPGVFTTDFPGKPPVKFDYTG  364

Query  861   NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNP  682
             NVSR+LWQP  GTK +K+K+GSRVQ+VLQDT+I T E+HPIHLHGY F++V +GFGNF+P
Sbjct  365   NVSRSLWQPVPGTKAHKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDP  424

Query  681   QTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVEN  502
             + DTAKFNLVDPP+RNT+ VPV GWAVIRF ADNPG WL+HCH+D H+ WGLA   +VEN
Sbjct  425   KKDTAKFNLVDPPLRNTVAVPVNGWAVIRFVADNPGAWLLHCHLDVHIGWGLATVLLVEN  484

Query  501   GQGEKQTVEPPPLDLPRC  448
             G G+ Q++EPPP+DLP C
Sbjct  485   GVGKLQSIEPPPVDLPLC  502



>ref|XP_008679334.1| PREDICTED: LOW QUALITY PROTEIN: laccase-23-like [Zea mays]
Length=664

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/559 (62%), Positives = 427/559 (76%), Gaps = 15/559 (3%)
 Frame = -3

Query  2088  ASLANADVYNQEFVVQETKITRLCKTK--TIITVNGQFPGPTIAvrngddvvvkvvnrar  1915
             + LA A     EFVV+E  +TRLC T+   I+TVNGQFPGPT+ V  GD ++V+V NR  
Sbjct  109   SQLAIAKEQYHEFVVKEATVTRLCGTQQQRIMTVNGQFPGPTVEVAEGDALIVRVRNRGS  168

Query  1914  ynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRAT  1735
             YNVT+HWHG+RQMRT WADGPE+VTQCPI PG +YTYRF +  QEGTLWWHAHS WLRAT
Sbjct  169   YNVTVHWHGVRQMRTAWADGPEFVTQCPIRPGTSYTYRFTVAGQEGTLWWHAHSSWLRAT  228

Query  1734  VYGAFIIYPKSGSHFPFSQ---PKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYT  1564
             V+GA II P++G  +PF+    P ++I I+LGEWWN + I + R    TGAAPNIS+A T
Sbjct  229   VHGALIIRPRAGVPYPFNAGDTPAREITIILGEWWNMNPIDVVRTATRTGAAPNISDALT  288

Query  1563  INGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNK  1384
             +NGQPGDLY+CSS  T  FSV+ GET LLR INAALN +LF S+A H + VVGADA+Y K
Sbjct  289   VNGQPGDLYKCSSNGTTTFSVTSGETNLLRFINAALNTELFVSLAGHTMTVVGADASYTK  348

Query  1383  PFTTNVIMVGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPG  1204
             P+ T VI+V PGQTT+VL+T DQPP+RYY+AARAYA+AQ  PFDNTTTTA+ +Y      
Sbjct  349   PYATPVILVAPGQTTDVLVTFDQPPSRYYLAARAYASAQGVPFDNTTTTAIFDYGTGASN  408

Query  1203  ANSRPLMPQLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPR  1024
             ++S P MP LP +NDTATATAFTT LR + + +  +  + DESLFFTVG+GL NC+ G  
Sbjct  409   SSS-PAMPTLPAYNDTATATAFTTSLRGLRAAD--LPARVDESLFFTVGVGLFNCSSGQT  465

Query  1023  CQGPNNTRFAASMNNVSFVLPRRTSLLQAYYNNI------PGIYTLDFPPVPPVQFDYTG  862
             C GPNNTRFAAS+NNVSFVLP  TS+LQA+Y          G++T DFP  PPV+FDYT 
Sbjct  466   CGGPNNTRFAASINNVSFVLPSTTSILQAHYAYAAGGATPAGVFTADFPANPPVRFDYTA  525

Query  861   -NVSRALWQPPSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFN  685
              NVSRALWQP  GT++Y +KYG+ VQ+VLQ T +F  E+HPIHLHGY F+++ +GFGNF+
Sbjct  526   PNVSRALWQPVPGTRVYSLKYGAAVQLVLQGTNVFAAENHPIHLHGYDFYILAEGFGNFD  585

Query  684   PQTDTAKFNLVDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVE  505
                DTA FN+ DPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+VE
Sbjct  586   AAADTASFNMDDPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVE  645

Query  504   NGQGEKQTVEPPPLDLPRC  448
             +G GE Q++E PP DLP C
Sbjct  646   DGVGELQSLEAPPSDLPIC  664



>ref|XP_009122371.1| PREDICTED: laccase-13 isoform X2 [Brassica rapa]
 ref|XP_009122372.1| PREDICTED: laccase-13 isoform X2 [Brassica rapa]
 ref|XP_009122373.1| PREDICTED: laccase-13 isoform X2 [Brassica rapa]
Length=482

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/489 (67%), Positives = 382/489 (78%), Gaps = 19/489 (4%)
 Frame = -3

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPK-S  1702
             MR PWADGPEY+TQCPI PGG+YTYRF IE QEGTLWWHAHSRWLRATVYGA II P  S
Sbjct  1     MRNPWADGPEYITQCPIKPGGSYTYRFNIEEQEGTLWWHAHSRWLRATVYGALIIRPPLS  60

Query  1701  GSHFPFS-QPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSS  1525
               H+PF   PK++  +LLGEWW+R+ + +    QFTGAAPN+S+A+TINGQPGD YRCSS
Sbjct  61    SPHYPFPVLPKREFTLLLGEWWDRNPMDVLNMAQFTGAAPNVSDAFTINGQPGDFYRCSS  120

Query  1524  QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQ  1345
             Q+T++F V  GETVLLRVIN+ LNQ+LFF VANHKL VV ADA+Y KPF+TNVIM+GPGQ
Sbjct  121   QETLRFLVGSGETVLLRVINSGLNQELFFGVANHKLTVVAADASYTKPFSTNVIMLGPGQ  180

Query  1344  TTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTN---LRPGANSRPLMPQL  1174
             TT+VLLTADQPPA YYMAA AY +A    FDNTTTT++LEY +   +   + +R +  QL
Sbjct  181   TTDVLLTADQPPAHYYMAAHAYNSANAP-FDNTTTTSILEYKDAPCVTSQSQARAIPAQL  239

Query  1173  PFFNDtatataftTQLRSVPSNNPTVFNQP---DESLFFTVGLGLVNCTPGP---RCQGP  1012
             P FNDTATA AFT Q++S     P+    P   DE LFFTVGLGL NC P P   RCQGP
Sbjct  240   PGFNDTATAAAFTAQMKS-----PSKVEVPLEVDEDLFFTVGLGLFNC-PTPNTQRCQGP  293

Query  1011  NNTRFAASMNNVSFVLPRRTSLLQAYYNNIP-GIYTLDFPPVPPVQFDYTGNVSRALWQP  835
             N TRF AS+NNVSFV PR+ S+LQAYY   P G++T DFPPVPP  FDYTGNVSR LWQP
Sbjct  294   NGTRFTASINNVSFVFPRQNSILQAYYQGTPAGVFTTDFPPVPPTTFDYTGNVSRGLWQP  353

Query  834   PSGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNL  655
               GTK YK+KY S+VQV+LQDT+I T E+HP+HLHGY F+VVG G GNFN   DT+ FNL
Sbjct  354   TRGTKAYKLKYKSKVQVILQDTSIVTIENHPMHLHGYEFYVVGTGIGNFNANKDTSSFNL  413

Query  654   VDPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVE  475
             +DPP RNTI  P GGW  IRF ADNPGVWLMHCHID+H+ WGLAM F+VENG+G  Q+V+
Sbjct  414   IDPPRRNTIGTPPGGWIAIRFVADNPGVWLMHCHIDAHIFWGLAMVFLVENGEGHLQSVQ  473

Query  474   PPPLDLPRC  448
              PPLDLP+C
Sbjct  474   SPPLDLPQC  482



>gb|EMS57222.1| Laccase-23 [Triticum urartu]
Length=567

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/548 (63%), Positives = 410/548 (75%), Gaps = 9/548 (2%)
 Frame = -3

Query  2079  ANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTI  1900
             A A     EFV+QE  +TRLC T++I+T NGQFPGP + V  GD +VV VVN A YNVTI
Sbjct  25    AIAKEQRHEFVIQEAAVTRLCNTRSIVTANGQFPGPAVEVNEGDSLVVTVVNNATYNVTI  84

Query  1899  HWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAF  1720
             HWHG+RQMRT W+DGPE+VTQCPI PGG+Y YRF +  QEGTLWWHAHS WLRATVYGA 
Sbjct  85    HWHGVRQMRTGWSDGPEFVTQCPIRPGGSYMYRFTVAGQEGTLWWHAHSSWLRATVYGAL  144

Query  1719  IIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDL  1540
             I+ P+    +PF    +  PI+LGEWW+ + I + R    TGAAPN+S+A T+NGQPGDL
Sbjct  145   IVRPRDPVPYPFDFHGELAPIMLGEWWDMNPIDVIRTATRTGAAPNVSDAITVNGQPGDL  204

Query  1539  YRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIM  1360
             Y CSSQDT  F V  GET LLR INAALN +LF S+A H + VVGADA+Y KP+   VI+
Sbjct  205   YNCSSQDTAVFPVKSGETNLLRFINAALNTELFVSLAGHTMTVVGADASYLKPYNATVIV  264

Query  1359  VGPGQTTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRPLMP  1180
             +GPGQTT+VL+T DQPP RYY+AARAYA+AQ  PFDN TTTA+ +Y     G  + P MP
Sbjct  265   LGPGQTTDVLVTFDQPPGRYYLAARAYASAQGVPFDNPTTTAIFDYG---AGGTASPAMP  321

Query  1179  QLPFFNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTR  1000
              LP +NDTAT T FTT LR++ S    + +  DE LFFTVG+GL NC+ G  C GPNNTR
Sbjct  322   PLPAYNDTATVTTFTTSLRNLHSVG--LPSAVDEDLFFTVGVGLFNCSSGQNCGGPNNTR  379

Query  999   FAASMNNVSFVLPRRTSLLQAYYNN---IPGIYTLDFPPVPPVQFDYTG-NVSRALWQPP  832
             FAAS+NN SFVLP   S+LQA+Y       G++T DFP  PPVQFDYT  NVSRALWQP 
Sbjct  380   FAASINNASFVLPSTVSILQAHYQGDAAATGVFTTDFPANPPVQFDYTAQNVSRALWQPV  439

Query  831   SGTKLYKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLV  652
              GTK+YK+KYGS VQ+VLQ T IF  E+HPIH HGY F+++ +GFGNF+  TDTAKFNL 
Sbjct  440   PGTKVYKLKYGSVVQIVLQGTNIFAGENHPIHTHGYDFFILAEGFGNFDAATDTAKFNLD  499

Query  651   DPPVRNTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEP  472
             DPP+RNT+ VPV GWAVIRF ADNPGVWLMHCH+  H+ WGLAMAF+VE+G GE Q++  
Sbjct  500   DPPMRNTVGVPVNGWAVIRFVADNPGVWLMHCHLGVHITWGLAMAFLVEDGVGELQSLGA  559

Query  471   PPLDLPRC  448
             PP DLP C
Sbjct  560   PPPDLPIC  567



>sp|Q2RBK2.1|LAC17_ORYSJ RecName: Full=Putative laccase-17; AltName: Full=Benzenediol:oxygen 
oxidoreductase 17; AltName: Full=Diphenol oxidase 17; 
AltName: Full=Urishiol oxidase 17; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|ABA91124.1| laccase, putative [Oryza sativa Japonica Group]
 gb|EAZ17158.1| hypothetical protein OsJ_32663 [Oryza sativa Japonica Group]
Length=567

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/543 (62%), Positives = 420/543 (77%), Gaps = 8/543 (1%)
 Frame = -3

Query  2058  QEFVVQETKITRLCKTKTIITVNGQFPGPTIAvrngddvvvkvvnrarynVTIHWHGLRQ  1879
              EFV++ET + RLCK+  I+TVNGQFPGPT+ +  GD +++ ++NR RYN+T+HWHG+RQ
Sbjct  27    HEFVIRETTVKRLCKSHNIMTVNGQFPGPTLEINEGDSLIINLINRGRYNMTLHWHGVRQ  86

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT W+DGPEYVTQCP+ PG +Y YRF +  QEGTLWWHAHS WLRATVYGA +I P+ G
Sbjct  87    MRTGWSDGPEYVTQCPVRPGQSYRYRFTVAAQEGTLWWHAHSSWLRATVYGALLIRPRDG  146

Query  1698  SHFPFS-QPKKDI-PILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSS  1525
             + +PF  QP +++ PILLGEWW+ + + + R    TGAAPNIS+A T+N QPGDLY CSS
Sbjct  147   TSYPFDVQPTRELAPILLGEWWDMNPVDVVRAATRTGAAPNISDALTVNAQPGDLYSCSS  206

Query  1524  QDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQ  1345
              DT  F V+ GET LLR INAALN +LF S+A H + VV ADA+Y KP+TT+++++ PGQ
Sbjct  207   HDTAVFPVTSGETNLLRFINAALNTELFVSLAGHNMTVVAADASYTKPYTTSLLLLAPGQ  266

Query  1344  TTNVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNLRPGANSRPLMPQLPFF  1165
             TT+VL+T DQPP RYY+AARAYA+AQ  PFDNTTTTA+ +Y      +++   MP LP +
Sbjct  267   TTDVLVTFDQPPGRYYLAARAYASAQGVPFDNTTTTAIFDYGAANNASSAAIAMPTLPAY  326

Query  1164  NDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCT--PGPRCQGPNNTRFAA  991
             NDT  ATAFTT LR +      + ++ DESLFFTVG+GL NCT     +C GPN TRFAA
Sbjct  327   NDTTAATAFTTNLRGL--RKAELPSRVDESLFFTVGVGLFNCTNATAQQCGGPNGTRFAA  384

Query  990   SMNNVSFVLPRRTSLLQAYYNNIPG-IYTLDFPPVPPVQFDYTG-NVSRALWQPPSGTKL  817
             S+NNVSFVLP  TS+LQA+++  PG ++T DFP  PPVQFDYT  NVSRALWQP +GTK+
Sbjct  385   SINNVSFVLPSSTSILQAHHHGAPGGVFTADFPANPPVQFDYTAQNVSRALWQPVAGTKV  444

Query  816   YKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVR  637
             YK+KYGS VQVVLQ T IF  E+HPIHLHGY F+++ +G GNF+   DT KFN+ DPP+R
Sbjct  445   YKLKYGSAVQVVLQGTNIFAGENHPIHLHGYDFYILAEGLGNFDAGADTGKFNVEDPPMR  504

Query  636   NTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDL  457
             NT+ VPV GWAVIRF ADNPGVWLMHCH+D H+ WGLAMAF+V++G GE Q++E PP DL
Sbjct  505   NTVGVPVNGWAVIRFVADNPGVWLMHCHLDVHITWGLAMAFLVDDGVGELQSLEAPPPDL  564

Query  456   PRC  448
             P C
Sbjct  565   PLC  567



>gb|KHN48594.1| Laccase-5 [Glycine soja]
Length=481

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/483 (66%), Positives = 383/483 (79%), Gaps = 8/483 (2%)
 Frame = -3

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVYGA II+P+ G
Sbjct  1     MRTGWADGPEFVTQCPIRPGESYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPREG  60

Query  1698  SHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQD  1519
               +PF++PK++ PILLGEWW+ + I + RQ   TGAAPNIS+AYTINGQPGDLY+CSSQ 
Sbjct  61    EAYPFTKPKRETPILLGEWWDANPIDVVRQATQTGAAPNISDAYTINGQPGDLYKCSSQG  120

Query  1518  TVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTT  1339
             T    +  GET LLRVINAALNQ LFF+VANHKL VVGADA+Y KPFTTNVIM+GPGQTT
Sbjct  121   TTIVPIDSGETNLLRVINAALNQPLFFTVANHKLTVVGADASYLKPFTTNVIMLGPGQTT  180

Query  1338  NVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL---RPGANSRPLMPQLPF  1168
             +VL+  DQPP RYYMAARAY +AQNAPFDNTTTTA+LEY +      G++ +P+MP LP 
Sbjct  181   DVLIQGDQPPTRYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKGSSIKPVMPSLPA  240

Query  1167  FNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRCQGPNNTRF  997
             +NDT T TAF+   RS       V  + D++LFFT+GLGL NC       +CQGPN TRF
Sbjct  241   YNDTNTVTAFSKSFRS--PRKVEVPAEIDDNLFFTIGLGLNNCPKNFNANQCQGPNGTRF  298

Query  996   AASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKL  817
              ASMNNVSFVLP   S+LQA++  + G++T DFP  PPV+FDYTGNVSR+LWQP  GTK+
Sbjct  299   TASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPPVKFDYTGNVSRSLWQPVQGTKV  358

Query  816   YKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVR  637
              K+K+GSRVQ+VLQDT+I T E+HPIHLHGY F++V +GFGNF+P  DT+KFNLVDPP+R
Sbjct  359   TKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPNKDTSKFNLVDPPMR  418

Query  636   NTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDL  457
             NT+ VPV GWAVIRF ADNPG W+MHCH+D H+ WGLA   +V+NG G  Q++EPPP DL
Sbjct  419   NTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLATVLLVDNGVGLLQSIEPPPEDL  478

Query  456   PRC  448
             P C
Sbjct  479   PLC  481



>gb|KHN38548.1| Laccase-5 [Glycine soja]
Length=481

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/483 (66%), Positives = 382/483 (79%), Gaps = 8/483 (2%)
 Frame = -3

Query  1878  MRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEGTLWWHAHSRWLRATVYGAFIIYPKSG  1699
             MRT WADGPE+VTQCPI PG +YTYRF I+ QEGTLWWHAHS WLRATVYGA II+P+ G
Sbjct  1     MRTGWADGPEFVTQCPIRPGESYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPREG  60

Query  1698  SHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFTGAAPNISNAYTINGQPGDLYRCSSQD  1519
               +PF++PK++ PILLGEWW+ + I + RQ   TGAAPNIS+AYTINGQPGDLY+CSSQ 
Sbjct  61    EAYPFTKPKRETPILLGEWWDANPIDVVRQATQTGAAPNISDAYTINGQPGDLYKCSSQG  120

Query  1518  TVKFSVSPGETVLLRVINAALNQQLFFSVANHKLQVVGADAAYNKPFTTNVIMVGPGQTT  1339
             +    +  GET LLRVINAALNQ LFF VANHKL VVGADA+Y KPFTTNVIM+GPGQTT
Sbjct  121   STIVPIDSGETNLLRVINAALNQPLFFKVANHKLTVVGADASYLKPFTTNVIMLGPGQTT  180

Query  1338  NVLLTADQpparyymaarayataqnaPFDNTTTTAVLEYTNL---RPGANSRPLMPQLPF  1168
             +VL+  DQPP RYYMAARAY +AQNAPFDNTTTTA+LEY +      G++ +P+MP LP 
Sbjct  181   DVLIQGDQPPTRYYMAARAYQSAQNAPFDNTTTTAILEYKSAPCPAKGSSIKPVMPSLPA  240

Query  1167  FNDtatataftTQLRSVPSNNPTVFNQPDESLFFTVGLGLVNCTP---GPRCQGPNNTRF  997
             +NDT T TAF+   RS       V  + DE+LFFT+GLGL NC       +CQGPN TRF
Sbjct  241   YNDTNTVTAFSKSFRS--PRKVEVPAEIDENLFFTIGLGLNNCPKNFNANQCQGPNGTRF  298

Query  996   AASMNNVSFVLPRRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTGNVSRALWQPPSGTKL  817
              ASMNNVSFVLP   S+LQA++  + G++T DFP  PPV+FDYTGNVSR+LWQP  GTK+
Sbjct  299   TASMNNVSFVLPNNVSILQAHHLGVQGVFTTDFPTQPPVKFDYTGNVSRSLWQPVPGTKV  358

Query  816   YKIKYGSRVQVVLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVR  637
              K+K+GSRVQ+VLQDT+I T E+HPIHLHGY F++V +GFGNF+P  DT+KFNLVDPP+R
Sbjct  359   TKLKFGSRVQIVLQDTSIVTPENHPIHLHGYDFYIVAEGFGNFDPNKDTSKFNLVDPPMR  418

Query  636   NTIDVPVGGWAVIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDL  457
             NT+ VPV GWAVIRF ADNPG W+MHCH+D H+ WGLA   +V+NG G  Q++EPPP DL
Sbjct  419   NTVAVPVNGWAVIRFVADNPGAWIMHCHLDVHIGWGLATVLLVDNGVGLLQSIEPPPEDL  478

Query  456   PRC  448
             P C
Sbjct  479   PLC  481



>gb|EMT01053.1| Laccase-3 [Aegilops tauschii]
Length=591

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/592 (58%), Positives = 411/592 (69%), Gaps = 34/592 (6%)
 Frame = -3

Query  2136  FCNGFLAKLFVMLTVLASLANADVYNQEFVVQETKITRLCKTKTIITVNGQFPGPTIAvr  1957
              C      L +   +  +LA    Y  EFVVQET + RLC+T  IITVNGQFPGPTI V 
Sbjct  3     LCCCLSGVLLLSFLLPGALAEERFY--EFVVQETVVKRLCQTNRIITVNGQFPGPTIEVH  60

Query  1956  ngddvvvkvvnrarynVTIHWHGLRQMRTPWADGPEYVTQCPIMPGGTYTYRFKIENQEG  1777
             NGD + ++ VN A+YNVT+HWHGLRQ+R  WADGPE+VTQCPI PG +YTYR+ I+ QEG
Sbjct  61    NGDTLAIRAVNMAQYNVTLHWHGLRQLRNGWADGPEFVTQCPIRPGSSYTYRYTIQEQEG  120

Query  1776  TLWWHAHSRWLRATVYGAFIIYPKSGSHFPFSQPKKDIPILLGEWWNRDIIALQRQTQFT  1597
             TLWWHAHS WLRATV+GA II PK G  +PF +P K+ P++L EWW RD IA+ RQ+  T
Sbjct  121   TLWWHAHSSWLRATVHGALIILPKRGMPYPFPKPDKEFPVVLAEWWRRDPIAVLRQSMVT  180

Query  1596  GAAPNISNAYTINGQPGDLYRCSSQDTVKFSVSPGETVLLRVINAALNQQLFFSVANHKL  1417
             GA PN+S+   INGQPGD   CSSQ+T    V  GET L+R+INAA+N +LF S+A HK+
Sbjct  181   GAPPNVSDTILINGQPGDFLPCSSQETSIIPVVAGETNLVRIINAAMNSELFVSLAGHKM  240

Query  1416  QVVGADAAYNKPFTTNVIMVGPGQTTNVLLTADQpp-aryymaarayataqnaPFDNTTT  1240
              VV ADA Y KPF T V+++GPGQTT+VL+TA      RYY+ AR YA+AQN PFDNTT 
Sbjct  241   TVVAADAVYTKPFETTVVLLGPGQTTDVLVTAHAAAPGRYYLGARVYASAQNVPFDNTTA  300

Query  1239  TAVLEYTNL-------------------------RPG-ANSRPLMPQLPFFNDtatataf  1138
             TA+ +Y N                           PG A   P+ P LP  NDT TAT F
Sbjct  301   TAIFQYKNAAGCPPTGAGAGVGGHTGLGRPRSSGNPGRAGPAPMFPMLPANNDTNTATGF  360

Query  1137  tTQLRS-VPSNNPTVFNQPDESLFFTVGLGLVNCTPGPRCQGPNNTRFAASMNNVSFVLP  961
             +  +RS  P   P    Q    +F T+G GL NC PGP CQGPNNTRF ASMNNVSF LP
Sbjct  361   SNLIRSPGPVKVPGPVTQ---EVFTTIGFGLFNCQPGPFCQGPNNTRFGASMNNVSFQLP  417

Query  960   RRTSLLQAYYNNIPGIYTLDFPPVPPVQFDYTG-NVSRALWQPPSGTKLYKIKYGSRVQV  784
                SLLQA+Y+ IPG++T DFP  PPV FDYT  NV RALWQP  GT+LY++KYG+ VQ+
Sbjct  418   NTVSLLQAHYHRIPGVFTEDFPARPPVVFDYTSQNVPRALWQPVKGTRLYRVKYGAVVQM  477

Query  783   VLQDTAIFTTEDHPIHLHGYHFWVVGQGFGNFNPQTDTAKFNLVDPPVRNTIDVPVGGWA  604
             V QDT IF  E+HP+H+HGYHF+V+  GFGN+NP+ D AK N+V P  RNTI VPVGGWA
Sbjct  478   VFQDTGIFAAEEHPMHIHGYHFYVLATGFGNYNPRRDEAKVNMVGPASRNTIGVPVGGWA  537

Query  603   VIRFFADNPGVWLMHCHIDSHLAWGLAMAFIVENGQGEKQTVEPPPLDLPRC  448
             V+RF ADNPG WL+HCHID+HL  GLAMA +VE+G+ E QT  PPPLDLP C
Sbjct  538   VVRFLADNPGGWLVHCHIDAHLTGGLAMALVVEDGKTELQTTMPPPLDLPLC  589



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6691343371916