BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25879_g2_i1 len=2008 path=[3796:0-167 6842:168-182 5890:183-207
4003:208-423 6991:424-426 638:427-476 353:477-501 @378@!:502-869
4652:870-874 85:875-911 4692:912-924 4705:925-1079 7221:1080-1085
191:1086-1104 7233:1105-1121 4894:1122-1134 4907:1135-1313
211:1314-1337 5106:1338-1338 1724:1339-1371 269:1372-1439
5203:1440-1459 683:1460-1625 7490:1626-1633 7498:1634-1670
5429:1671-1697 1287:1698-1740 5498:1741-1758 5516:1759-1825
5581:1826-1837 979:1838-2007]

Length=2008
                                                                      Score     E

ref|XP_006488042.1|  PREDICTED: high affinity nitrate transporter...    917   0.0      
ref|XP_006424510.1|  hypothetical protein CICLE_v10029836mg             917   0.0      
ref|XP_006424511.1|  hypothetical protein CICLE_v10030358mg             915   0.0      
emb|CDP07064.1|  unnamed protein product                                914   0.0      
ref|XP_011089944.1|  PREDICTED: high affinity nitrate transporter...    909   0.0      
ref|XP_006340219.1|  PREDICTED: high-affinity nitrate transporter...    907   0.0      
ref|XP_011089248.1|  PREDICTED: high affinity nitrate transporter...    905   0.0      
gb|KDP43998.1|  hypothetical protein JCGZ_05465                         905   0.0      
ref|XP_011089247.1|  PREDICTED: high-affinity nitrate transporter...    902   0.0      
ref|XP_007150166.1|  hypothetical protein PHAVU_005G132200g             902   0.0      
ref|XP_007132303.1|  hypothetical protein PHAVU_011G083500g             901   0.0      
ref|XP_002523687.1|  nitrate transporter, putative                      901   0.0      Ricinus communis
gb|ABQ57241.1|  nitrate transporter                                     901   0.0      Citrus sinensis x Citrus trifoliata [Carrizo citrange]
ref|XP_003539195.1|  PREDICTED: high affinity nitrate transporter...    900   0.0      
ref|XP_009802270.1|  PREDICTED: high affinity nitrate transporter...    899   0.0      
ref|NP_001236444.1|  NRT2 protein                                       899   0.0      
ref|XP_007016829.1|  Nitrate transporter 2:1                            898   0.0      
ref|XP_009791005.1|  PREDICTED: high affinity nitrate transporter...    897   0.0      
emb|CAA69387.1|  nitrate transporter                                    897   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009595071.1|  PREDICTED: high affinity nitrate transporter...    897   0.0      
ref|XP_010111803.1|  High affinity nitrate transporter 2.4              896   0.0      
emb|CAD89799.1|  high affinity nitrate transporter protein              895   0.0      Nicotiana tabacum [American tobacco]
emb|CAD89798.1|  high affinity nitrate transporter protein              894   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006388598.1|  high-affinity nitrate transporter NRT2 famil...    893   0.0      
ref|XP_002277127.1|  PREDICTED: high affinity nitrate transporter...    893   0.0      Vitis vinifera
ref|XP_011011351.1|  PREDICTED: high-affinity nitrate transporter...    893   0.0      
ref|XP_010031946.1|  PREDICTED: high affinity nitrate transporter...    892   0.0      
ref|XP_002523688.1|  nitrate transporter, putative                      892   0.0      Ricinus communis
ref|XP_007208472.1|  hypothetical protein PRUPE_ppa004104mg             892   0.0      
ref|XP_009621125.1|  PREDICTED: high affinity nitrate transporter...    892   0.0      
ref|XP_003540194.1|  PREDICTED: high affinity nitrate transporter...    892   0.0      
ref|XP_003596775.1|  High-affinity nitrate transporter                  892   0.0      
ref|XP_008226212.1|  PREDICTED: high-affinity nitrate transporter...    891   0.0      
gb|KEH30005.1|  high affinity nitrate transporter 2.7                   890   0.0      
emb|CAG26716.1|  nitrate transporter                                    890   0.0      Populus tremula x Populus tremuloides
ref|XP_006347193.1|  PREDICTED: high-affinity nitrate transporter...    890   0.0      
ref|XP_008226225.1|  PREDICTED: high-affinity nitrate transporter...    889   0.0      
ref|NP_001234134.1|  NRT2;1 protein                                     889   0.0      
gb|EYU36162.1|  hypothetical protein MIMGU_mgv1a025664mg                889   0.0      
ref|XP_002313528.2|  high-affinity nitrate transporter NRT2 famil...    887   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004303678.1|  PREDICTED: high-affinity nitrate transporter...    886   0.0      
ref|XP_004302082.1|  PREDICTED: high-affinity nitrate transporter...    885   0.0      
ref|XP_007207632.1|  hypothetical protein PRUPE_ppa021664mg             885   0.0      
ref|NP_001266263.1|  high-affinity nitrate transporter 2.1-like         885   0.0      
ref|XP_009356900.1|  PREDICTED: high affinity nitrate transporter...    883   0.0      
ref|XP_008349944.1|  PREDICTED: high affinity nitrate transporter...    882   0.0      
gb|ACN22072.1|  Rehd high-affinity nitrate transporter NRT2.1           879   0.0      Malus hupehensis
ref|NP_001234127.1|  NRT2;3 protein                                     879   0.0      
ref|NP_001269063.1|  high affinity nitrate transporter 2.4-like         879   0.0      
ref|NP_001274401.1|  high affinity nitrate transporter 2.4-like         878   0.0      
ref|XP_010111801.1|  High affinity nitrate transporter 2.4              878   0.0      
gb|KHN21500.1|  High affinity nitrate transporter 2.4                   878   0.0      
emb|CAN77058.1|  hypothetical protein VITISV_002248                     873   0.0      Vitis vinifera
ref|XP_004506049.1|  PREDICTED: high-affinity nitrate transporter...    871   0.0      
gb|EYU40082.1|  hypothetical protein MIMGU_mgv1a004568mg                868   0.0      
emb|CAC35729.1|  membrane transporter                                   867   0.0      Lotus japonicus
ref|XP_011011350.1|  PREDICTED: high-affinity nitrate transporter...    866   0.0      
ref|XP_009356899.1|  PREDICTED: high affinity nitrate transporter...    865   0.0      
gb|EYU21096.1|  hypothetical protein MIMGU_mgv1a027122mg                865   0.0      
ref|XP_002276817.1|  PREDICTED: high affinity nitrate transporter...    864   0.0      Vitis vinifera
gb|EYU21100.1|  hypothetical protein MIMGU_mgv1a025562mg                862   0.0      
ref|XP_010907042.1|  PREDICTED: high affinity nitrate transporter...    857   0.0      
gb|AEV89747.1|  nitrate transporter 2.1                                 856   0.0      
ref|XP_008776882.1|  PREDICTED: high affinity nitrate transporter...    855   0.0      
ref|XP_009110907.1|  PREDICTED: high-affinity nitrate transporter...    852   0.0      
gb|AEZ68614.1|  high-affinity nitrate transporter                       850   0.0      
dbj|BAP74415.1|  nitrate transporter                                    845   0.0      
ref|XP_009413146.1|  PREDICTED: high-affinity nitrate transporter...    844   0.0      
gb|AFK74855.1|  high-affinity nitrate transporter                       839   0.0      
ref|XP_010542581.1|  PREDICTED: high-affinity nitrate transporter...    839   0.0      
gb|AFK65609.1|  high-affinity nitrate transporter                       839   0.0      
ref|XP_009118394.1|  PREDICTED: high-affinity nitrate transporter...    837   0.0      
ref|XP_006307224.1|  hypothetical protein CARUB_v10008824mg             837   0.0      
ref|XP_002519504.1|  nitrate transporter, putative                      836   0.0      Ricinus communis
ref|XP_009382134.1|  PREDICTED: high affinity nitrate transporter...    836   0.0      
ref|XP_002864702.1|  predicted protein                                  835   0.0      
emb|CBI17171.3|  unnamed protein product                                835   0.0      
ref|XP_009595617.1|  PREDICTED: high-affinity nitrate transporter...    834   0.0      
gb|EYU36161.1|  hypothetical protein MIMGU_mgv1a004332mg                834   0.0      
ref|XP_011094630.1|  PREDICTED: high affinity nitrate transporter...    833   0.0      
ref|XP_002889679.1|  ATNRT2:1                                           833   0.0      
ref|XP_009781713.1|  PREDICTED: high-affinity nitrate transporter...    830   0.0      
ref|XP_006305882.1|  hypothetical protein CARUB_v10011028mg             830   0.0      
ref|NP_200885.1|  nitrate transporter 2.4                               830   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541316.1|  PREDICTED: high affinity nitrate transporter...    830   0.0      
ref|XP_006417730.1|  hypothetical protein EUTSA_v10007338mg             830   0.0      
ref|XP_006417729.1|  hypothetical protein EUTSA_v10007342mg             828   0.0      
ref|NP_172288.1|  nitrate transporter 2:1                               828   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148068.1|  PREDICTED: LOW QUALITY PROTEIN: high-affinit...    828   0.0      
ref|XP_010475601.1|  PREDICTED: high-affinity nitrate transporter...    827   0.0      
emb|CAC05338.1|  high-affinity nitrate transporter                      827   0.0      Brassica napus [oilseed rape]
ref|XP_009120612.1|  PREDICTED: high affinity nitrate transporter...    826   0.0      
ref|XP_010488345.1|  PREDICTED: high-affinity nitrate transporter...    825   0.0      
ref|XP_006282092.1|  hypothetical protein CARUB_v10028339mg             825   0.0      
ref|XP_010456740.1|  PREDICTED: high affinity nitrate transporter...    825   0.0      
ref|XP_006428719.1|  hypothetical protein CICLE_v10013718mg             825   0.0      
ref|XP_010475600.1|  PREDICTED: high-affinity nitrate transporter...    825   0.0      
gb|KFK43126.1|  hypothetical protein AALP_AA1G083700                    825   0.0      
ref|XP_010458033.1|  PREDICTED: high-affinity nitrate transporter...    825   0.0      
ref|XP_010443883.1|  PREDICTED: high affinity nitrate transporter...    824   0.0      
gb|KFK27602.1|  hypothetical protein AALP_AA8G404900                    823   0.0      
ref|XP_006339303.1|  PREDICTED: high affinity nitrate transporter...    823   0.0      
gb|KDO42638.1|  hypothetical protein CISIN_1g037413mg                   823   0.0      
ref|XP_010458035.1|  PREDICTED: high-affinity nitrate transporter...    822   0.0      
ref|XP_006400814.1|  hypothetical protein EUTSA_v10013237mg             822   0.0      
ref|XP_010483731.1|  PREDICTED: high affinity nitrate transporter...    822   0.0      
ref|XP_010521737.1|  PREDICTED: LOW QUALITY PROTEIN: high-affinit...    821   0.0      
ref|XP_010488337.1|  PREDICTED: high-affinity nitrate transporter...    821   0.0      
ref|XP_006843132.1|  hypothetical protein AMTR_s00140p00110570          821   0.0      
ref|XP_007027410.1|  Nitrate transporter 2.4                            820   0.0      
ref|XP_010535619.1|  PREDICTED: LOW QUALITY PROTEIN: high affinit...    817   0.0      
gb|KFK43120.1|  hypothetical protein AALP_AA1G082600                    816   0.0      
ref|XP_006493046.1|  PREDICTED: high affinity nitrate transporter...    815   0.0      
ref|XP_010483730.1|  PREDICTED: high affinity nitrate transporter...    813   0.0      
ref|XP_006424509.1|  hypothetical protein CICLE_v10028173mg             811   0.0      
ref|XP_006488041.1|  PREDICTED: high affinity nitrate transporter...    810   0.0      
ref|XP_007016831.1|  High affinity nitrate transporter 2.6              806   0.0      
gb|ADA83726.1|  NRT2                                                    797   0.0      Manihot esculenta [manioc]
gb|EAY84173.1|  hypothetical protein OsI_05552                          795   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001045658.1|  Os02g0112100                                       795   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952141.1|  PREDICTED: high-affinity nitrate transporter...    793   0.0      
ref|XP_002453159.1|  hypothetical protein SORBIDRAFT_04g001000          793   0.0      Sorghum bicolor [broomcorn]
ref|XP_002451375.1|  hypothetical protein SORBIDRAFT_04g000990          793   0.0      Sorghum bicolor [broomcorn]
ref|XP_010685329.1|  PREDICTED: high-affinity nitrate transporter...    793   0.0      
ref|XP_004952143.1|  PREDICTED: high-affinity nitrate transporter...    792   0.0      
ref|XP_002892435.1|  ATNRT2:1                                           791   0.0      
ref|XP_004952140.1|  PREDICTED: high-affinity nitrate transporter...    791   0.0      
gb|KHN06867.1|  High affinity nitrate transporter 2.4                   788   0.0      
ref|XP_010683900.1|  PREDICTED: high affinity nitrate transporter...    785   0.0      
ref|XP_002313529.2|  hypothetical protein POPTR_0009s01410g             782   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006646777.1|  PREDICTED: high affinity nitrate transporter...    785   0.0      
gb|KDP29155.1|  hypothetical protein JCGZ_16544                         783   0.0      
ref|NP_001266351.1|  high affinity nitrate transporter                  783   0.0      
ref|NP_001105780.1|  putative high affinity nitrate transporter         781   0.0      Zea mays [maize]
gb|AAV73917.1|  putative high affinity nitrate transporter              779   0.0      Zea mays [maize]
ref|XP_010683898.1|  PREDICTED: high affinity nitrate transporter...    778   0.0      
ref|XP_002523689.1|  nitrate transporter, putative                      778   0.0      Ricinus communis
ref|XP_010683899.1|  PREDICTED: high affinity nitrate transporter...    778   0.0      
ref|XP_010254451.1|  PREDICTED: LOW QUALITY PROTEIN: high affinit...    781   0.0      
gb|KDO60198.1|  hypothetical protein CISIN_1g040770mg                   775   0.0      
ref|NP_001105195.1|  nitrate transport2                                 774   0.0      Zea mays [maize]
ref|XP_006292196.1|  hypothetical protein CARUB_v10018402mg             772   0.0      
ref|XP_010430993.1|  PREDICTED: high affinity nitrate transporter...    771   0.0      
ref|XP_010507194.1|  PREDICTED: high affinity nitrate transporter...    771   0.0      
ref|XP_010685328.1|  PREDICTED: high-affinity nitrate transporter...    770   0.0      
ref|NP_172289.1|  nitrate transporter 2.2                               769   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CBI32763.3|  unnamed protein product                                768   0.0      
emb|CDP07062.1|  unnamed protein product                                769   0.0      
ref|XP_010514846.1|  PREDICTED: high affinity nitrate transporter...    768   0.0      
gb|AAC35884.1|  high-affinity nitrate transporter ACH2                  767   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU21099.1|  hypothetical protein MIMGU_mgv1a022931mg                766   0.0      
emb|CDY06299.1|  BnaA09g49040D                                          766   0.0      
ref|XP_002877380.1|  ATNRT2.3                                           766   0.0      
dbj|BAC76606.1|  putative high affinity nitrate transporter             765   0.0      Phragmites australis
ref|XP_006419072.1|  hypothetical protein EUTSA_v10002793mg             765   0.0      
ref|XP_009118513.1|  PREDICTED: high-affinity nitrate transporter...    763   0.0      
ref|XP_010541315.1|  PREDICTED: high affinity nitrate transporter...    763   0.0      
ref|XP_006648223.1|  PREDICTED: high affinity nitrate transporter...    759   0.0      
gb|KFK27603.1|  hypothetical protein AALP_AA8G405000                    759   0.0      
gb|KFK22683.1|  hypothetical protein AALP_AAs42556U000400               758   0.0      
ref|XP_009796419.1|  PREDICTED: high affinity nitrate transporter...    757   0.0      
ref|XP_008467040.1|  PREDICTED: high affinity nitrate transporter...    753   0.0      
ref|XP_009149905.1|  PREDICTED: high affinity nitrate transporter...    757   0.0      
gb|EMS65310.1|  High-affinity nitrate transporter 2.1                   755   0.0      
ref|XP_006400813.1|  hypothetical protein EUTSA_v10013201mg             754   0.0      
gb|EMS65311.1|  High-affinity nitrate transporter 2.1                   753   0.0      
ref|XP_009120613.1|  PREDICTED: high affinity nitrate transporter...    753   0.0      
ref|XP_006419073.1|  hypothetical protein EUTSA_v10002919mg             753   0.0      
gb|AAK19519.1|AF332214_1  high affinity nitrate transporter             750   0.0      Triticum aestivum [Canadian hard winter wheat]
gb|AAG01172.1|  high affinity nitrate transporter TaNRT2                750   0.0      Triticum aestivum [Canadian hard winter wheat]
gb|AAC49531.1|  BCH1                                                    750   0.0      Hordeum vulgare [barley]
ref|XP_009620497.1|  PREDICTED: high affinity nitrate transporter...    750   0.0      
ref|XP_010456747.1|  PREDICTED: high affinity nitrate transporter...    751   0.0      
gb|EMT10645.1|  Nitrate transporter                                     749   0.0      
gb|AAL11016.1|  high-affinity nitrate transporter                       749   0.0      Triticum aestivum [Canadian hard winter wheat]
gb|EMT10646.1|  Nitrate transporter                                     749   0.0      
gb|ABG20829.1|  high affinity nitrate transporter NRT2.6                749   0.0      Hordeum vulgare subsp. vulgare [barley]
gb|AAL99362.1|  high-affinity nitrate transporter                       749   0.0      Daucus carota [carrots]
gb|EMT10648.1|  Nitrate transporter                                     748   0.0      
ref|XP_010503158.1|  PREDICTED: high affinity nitrate transporter...    749   0.0      
gb|KFK33916.1|  hypothetical protein AALP_AA5G077200                    749   0.0      
ref|XP_010443885.1|  PREDICTED: high affinity nitrate transporter...    749   0.0      
ref|NP_200886.1|  nitrate transporter 2.3                               748   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514842.1|  PREDICTED: high affinity nitrate transporter...    748   0.0      
ref|XP_002864703.1|  ATNRT2.3                                           748   0.0      
ref|NP_190092.1|  high affinity nitrate transporter 2.6                 746   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483732.1|  PREDICTED: high affinity nitrate transporter...    746   0.0      
ref|XP_009149884.1|  PREDICTED: high affinity nitrate transporter...    746   0.0      
gb|ABK28768.1|  unknown                                                 746   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006281631.1|  hypothetical protein CARUB_v10027761mg             745   0.0      
gb|AAD28363.1|AF091115_1  putative high affinity nitrate transporter    743   0.0      Hordeum vulgare [barley]
gb|AAD28364.1|AF091116_1  putative high affinity nitrate transporter    743   0.0      Hordeum vulgare [barley]
ref|XP_009621124.1|  PREDICTED: high affinity nitrate transporter...    743   0.0      
ref|XP_009791006.1|  PREDICTED: high affinity nitrate transporter...    742   0.0      
gb|EMS65307.1|  High-affinity nitrate transporter 2.1                   739   0.0      
gb|EMT10644.1|  Nitrate transporter                                     739   0.0      
ref|XP_009150094.1|  PREDICTED: high affinity nitrate transporter...    740   0.0      
gb|EMT10649.1|  Nitrate transporter                                     746   0.0      
gb|AAC49532.1|  BCH2                                                    736   0.0      Hordeum vulgare [barley]
ref|XP_006293136.1|  hypothetical protein CARUB_v10019442mg             738   0.0      
ref|XP_002877379.1|  ATNRT2.6                                           737   0.0      
ref|XP_003572454.1|  PREDICTED: high-affinity nitrate transporter...    736   0.0      
ref|XP_003572550.1|  PREDICTED: high-affinity nitrate transporter...    735   0.0      
ref|XP_009150093.1|  PREDICTED: high affinity nitrate transporter...    736   0.0      
ref|XP_011090039.1|  PREDICTED: high affinity nitrate transporter...    735   0.0      
emb|CDY22703.1|  BnaC08g43370D                                          728   0.0      
ref|XP_006340412.1|  PREDICTED: high affinity nitrate transporter...    728   0.0      
ref|XP_004251405.1|  PREDICTED: high affinity nitrate transporter...    724   0.0      
gb|EMT10647.1|  Nitrate transporter                                     725   0.0      
ref|XP_007016830.1|  Nitrate transporter 2:1                            716   0.0      
gb|EYU17587.1|  hypothetical protein MIMGU_mgv1a004788mg                712   0.0      
ref|XP_002451374.1|  hypothetical protein SORBIDRAFT_04g000970          707   0.0      Sorghum bicolor [broomcorn]
emb|CDY32821.1|  BnaC08g02430D                                          704   0.0      
ref|XP_009126582.1|  PREDICTED: LOW QUALITY PROTEIN: high affinit...    706   0.0      
ref|XP_006359576.1|  PREDICTED: high affinity nitrate transporter...    701   0.0      
emb|CDX93591.1|  BnaA06g04570D                                          697   0.0      
ref|XP_004952138.1|  PREDICTED: high-affinity nitrate transporter...    696   0.0      
ref|XP_004240585.1|  PREDICTED: high affinity nitrate transporter...    690   0.0      
emb|CDY22704.1|  BnaC08g43380D                                          688   0.0      
ref|XP_004954761.1|  PREDICTED: high-affinity nitrate transporter...    692   0.0      
ref|XP_002966266.1|  hypothetical protein SELMODRAFT_168278             690   0.0      
emb|CDX93592.1|  BnaA06g04560D                                          687   0.0      
ref|XP_002978307.1|  hypothetical protein SELMODRAFT_443813             686   0.0      
ref|XP_008645163.1|  PREDICTED: high affinity nitrate transporter...    683   0.0      
gb|EEC72338.1|  hypothetical protein OsI_05554                          680   0.0      Oryza sativa Indica Group [Indian rice]
emb|CDY06298.1|  BnaA09g49050D                                          672   0.0      
ref|XP_003572590.2|  PREDICTED: high-affinity nitrate transporter...    674   0.0      
gb|EMS46095.1|  High affinity nitrate transporter 2.4                   674   0.0      
gb|EMS46096.1|  High affinity nitrate transporter 2.4                   674   0.0      
gb|EMT29902.1|  Nitrate transporter                                     673   0.0      
gb|EMT29903.1|  Nitrate transporter                                     671   0.0      
ref|XP_003570801.1|  PREDICTED: high-affinity nitrate transporter...    671   0.0      
gb|EMT29898.1|  Nitrate transporter                                     668   0.0      
gb|EMT31431.1|  Nitrate transporter                                     668   0.0      
gb|EMT31430.1|  Nitrate transporter                                     667   0.0      
dbj|BAP28462.1|  putative high affinity nitrate transporter             664   0.0      
gb|EMS65038.1|  High-affinity nitrate transporter 2.1                   667   0.0      
gb|EMT29900.1|  Nitrate transporter                                     672   0.0      
gb|EMS46094.1|  High-affinity nitrate transporter 2.1                   666   0.0      
gb|EMT29897.1|  Nitrate transporter                                     668   0.0      
gb|EMS46098.1|  High affinity nitrate transporter 2.4                   665   0.0      
gb|EYU21097.1|  hypothetical protein MIMGU_mgv1a0054572mg               657   0.0      
gb|EMS46097.1|  High affinity nitrate transporter 2.4                   663   0.0      
gb|EPS65539.1|  high-affinity nitrate transporter                       639   0.0      
ref|XP_001785194.1|  predicted protein                                  643   0.0      
emb|CDY50324.1|  BnaA10g13570D                                          637   0.0      
ref|XP_001768210.1|  nitrate transporter                                638   0.0      
ref|XP_001768212.1|  nitrate transporter                                634   0.0      
emb|CDY69111.1|  BnaC09g54030D                                          630   0.0      
ref|XP_006841012.1|  hypothetical protein AMTR_s00085p00099220          630   0.0      
dbj|BAD00099.2|  nitrate transporter                                    631   0.0      Physcomitrella patens
gb|EMT06111.1|  Nitrate transporter                                     623   0.0      
ref|XP_001765331.1|  predicted protein                                  624   0.0      
gb|EMT29901.1|  Nitrate transporter                                     614   0.0      
dbj|BAF42658.1|  nitrate transporter                                    612   0.0      Physcomitrella patens
ref|XP_001754130.1|  predicted protein                                  611   0.0      
ref|XP_010044590.1|  PREDICTED: high affinity nitrate transporter...    603   0.0      
gb|KDP26630.1|  hypothetical protein JCGZ_17788                         602   0.0      
gb|EAZ21472.1|  hypothetical protein OsJ_05079                          614   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010044589.1|  PREDICTED: high affinity nitrate transporter...    602   0.0      
ref|XP_011071124.1|  PREDICTED: high affinity nitrate transporter...    601   0.0      
ref|XP_007044725.1|  Nitrate transporter2.5                             600   0.0      
ref|XP_001768801.1|  predicted protein                                  600   0.0      
ref|XP_002266184.1|  PREDICTED: high affinity nitrate transporter...    599   0.0      Vitis vinifera
dbj|BAF42657.1|  nitrate transporter                                    599   0.0      Physcomitrella patens
ref|XP_010462594.1|  PREDICTED: high-affinity nitrate transporter...    605   0.0      
ref|XP_002527899.1|  nitrate transporter, putative                      598   0.0      Ricinus communis
gb|EYU28428.1|  hypothetical protein MIMGU_mgv1a019058mg                597   0.0      
gb|EYU28431.1|  hypothetical protein MIMGU_mgv1a004977mg                597   0.0      
ref|XP_011046204.1|  PREDICTED: high affinity nitrate transporter...    597   0.0      
ref|XP_006483914.1|  PREDICTED: high affinity nitrate transporter...    596   0.0      
gb|KHG03895.1|  High affinity nitrate transporter 2.5 -like protein     596   0.0      
ref|XP_008221864.1|  PREDICTED: high affinity nitrate transporter...    595   0.0      
dbj|BAF42659.1|  nitrate transporter                                    595   0.0      Physcomitrella patens
gb|ACN22073.1|  Rehd high-affinity nitrate transporter NRT2.5           595   0.0      Malus hupehensis
ref|XP_007223271.1|  hypothetical protein PRUPE_ppa004530mg             595   0.0      
ref|XP_001779265.1|  predicted protein                                  595   0.0      
ref|XP_006438312.1|  hypothetical protein CICLE_v10031126mg             595   0.0      
ref|XP_002321624.2|  high-affinity nitrate transporter family pro...    593   0.0      Populus trichocarpa [western balsam poplar]
emb|CAG26717.1|  nitrate transporter                                    593   0.0      
ref|XP_010023493.1|  PREDICTED: high affinity nitrate transporter...    592   0.0      
ref|XP_002321622.2|  high-affinity nitrate transporter family pro...    591   0.0      
gb|AFI74368.1|  nitrate transporter                                     590   0.0      
ref|XP_001754049.1|  predicted protein                                  589   0.0      
ref|XP_007044726.1|  Nitrate transporter2.5 isoform 1                   587   0.0      
ref|XP_003531994.1|  PREDICTED: high affinity nitrate transporter...    587   0.0      
ref|XP_010922819.1|  PREDICTED: high-affinity nitrate transporter...    586   0.0      
ref|XP_010248571.1|  PREDICTED: high affinity nitrate transporter...    585   0.0      
ref|XP_002994226.1|  hypothetical protein SELMODRAFT_138351             584   0.0      
ref|XP_011040491.1|  PREDICTED: high affinity nitrate transporter...    583   0.0      
ref|XP_004298986.1|  PREDICTED: high affinity nitrate transporter...    582   0.0      
ref|XP_002993278.1|  hypothetical protein SELMODRAFT_136730             582   0.0      
ref|XP_008446183.1|  PREDICTED: high affinity nitrate transporter...    581   0.0      
ref|XP_010528104.1|  PREDICTED: high affinity nitrate transporter...    580   0.0      
ref|XP_003552034.1|  PREDICTED: high affinity nitrate transporter...    580   0.0      
gb|AGO64299.1|  high-affinity nitrate transporter NRT2.3                578   0.0      
ref|XP_004135483.1|  PREDICTED: high affinity nitrate transporter...    578   0.0      
ref|XP_010923116.1|  PREDICTED: high-affinity nitrate transporter...    578   0.0      
ref|XP_006367151.1|  PREDICTED: high affinity nitrate transporter...    577   0.0      
emb|CDY68730.1|  BnaAnng28170D                                          570   0.0      
emb|CDY26984.1|  BnaC09g35990D                                          572   0.0      
ref|XP_004300920.1|  PREDICTED: high affinity nitrate transporter...    576   0.0      
dbj|BAK51923.1|  putative high affinity nitrate transporter             573   0.0      
ref|XP_004509567.1|  PREDICTED: high affinity nitrate transporter...    573   0.0      
gb|KFK43563.1|  hypothetical protein AALP_AA1G142500                    572   0.0      
emb|CDY34599.1|  BnaC03g56990D                                          570   0.0      
emb|CDP13197.1|  unnamed protein product                                570   0.0      
ref|XP_008389700.1|  PREDICTED: high affinity nitrate transporter...    570   0.0      
ref|XP_008804633.1|  PREDICTED: high affinity nitrate transporter...    570   0.0      
ref|XP_006417172.1|  hypothetical protein EUTSA_v10007446mg             569   0.0      
ref|XP_009110611.1|  PREDICTED: high affinity nitrate transporter...    569   0.0      
ref|XP_008791248.1|  PREDICTED: high affinity nitrate transporter...    569   0.0      
ref|XP_009396316.1|  PREDICTED: high-affinity nitrate transporter...    568   0.0      
ref|XP_006307313.1|  hypothetical protein CARUB_v10008932mg             568   0.0      
ref|XP_009395534.1|  PREDICTED: high-affinity nitrate transporter...    567   0.0      
gb|KEH20200.1|  high affinity nitrate transporter 2.7                   566   0.0      
ref|XP_010695867.1|  PREDICTED: high affinity nitrate transporter...    564   0.0      
ref|XP_010695819.1|  PREDICTED: high affinity nitrate transporter...    564   0.0      
ref|XP_007153759.1|  hypothetical protein PHAVU_003G062800g             564   0.0      
ref|XP_009625676.1|  PREDICTED: high affinity nitrate transporter...    562   0.0      
ref|XP_010695818.1|  PREDICTED: high affinity nitrate transporter...    563   0.0      
ref|NP_172754.1|  nitrate transporter2.5                                563   0.0      
ref|XP_010458734.1|  PREDICTED: high affinity nitrate transporter...    558   0.0      
ref|XP_010476275.1|  PREDICTED: high affinity nitrate transporter...    558   0.0      
ref|XP_009796050.1|  PREDICTED: high affinity nitrate transporter...    557   0.0      
ref|XP_010695865.1|  PREDICTED: high affinity nitrate transporter...    557   0.0      
ref|XP_010695889.1|  PREDICTED: high affinity nitrate transporter...    557   0.0      
gb|ABG20828.1|  high affinity nitrate transporter NRT2.5                551   0.0      
ref|XP_010494796.1|  PREDICTED: high affinity nitrate transporter...    550   0.0      
gb|EMT31244.1|  Nitrate transporter                                     549   0.0      
emb|CDM83676.1|  unnamed protein product                                548   0.0      
gb|EMT17074.1|  Nitrate transporter                                     545   0.0      
ref|XP_002456219.1|  hypothetical protein SORBIDRAFT_03g032310          545   0.0      
gb|EYU22515.1|  hypothetical protein MIMGU_mgv1a023971mg                543   0.0      
ref|XP_004972125.1|  PREDICTED: high affinity nitrate transporter...    544   0.0      
emb|CDY72274.1|  BnaAnng40490D                                          538   0.0      
emb|CDY70994.1|  BnaAnng35750D                                          532   0.0      
sp|Q94JG1.1|NRT23_ORYSJ  RecName: Full=High-affinity nitrate tran...    538   0.0      
ref|XP_003569637.1|  PREDICTED: high-affinity nitrate transporter...    537   0.0      
ref|XP_008656795.1|  PREDICTED: high affinity nitrate transporter...    538   0.0      
gb|EMS50263.1|  High affinity nitrate transporter 2.5                   536   0.0      
ref|XP_006644579.1|  PREDICTED: high affinity nitrate transporter...    534   6e-180   
gb|ABL89187.3|  high affinity nitrate transporter                       532   2e-179   
ref|XP_010251148.1|  PREDICTED: high affinity nitrate transporter...    504   5e-169   
emb|CAC87729.2|  high affinity nitrate transporter                      495   2e-167   
ref|XP_009617767.1|  PREDICTED: high affinity nitrate transporter...    486   8e-165   
gb|EPS59095.1|  hypothetical protein M569_15715                         487   4e-163   
gb|EMS65308.1|  High-affinity nitrate transporter 2.1                   481   1e-160   
ref|XP_010660878.1|  PREDICTED: high affinity nitrate transporter...    480   8e-160   
ref|NP_001044003.1|  Os01g0704100                                       481   1e-159   
emb|CAN60427.1|  hypothetical protein VITISV_021075                     478   7e-159   
ref|XP_009620499.1|  PREDICTED: high affinity nitrate transporter...    468   5e-157   
gb|AAK02066.1|  nitrate transporter NTR                                 476   1e-155   
ref|XP_007044728.1|  Nitrate transporter2.5 isoform 3                   469   1e-155   
ref|XP_003057942.1|  major facilitator superfamily                      471   2e-155   
ref|XP_005844792.1|  nitrate transporter                                471   3e-155   
ref|XP_002318680.2|  hypothetical protein POPTR_0012s08950g             464   1e-154   
ref|XP_007044727.1|  Nitrate transporter2.5 isoform 2                   464   2e-154   
ref|XP_002507114.1|  major facilitator superfamily                      466   1e-153   
ref|XP_002300040.1|  hypothetical protein POPTR_0001s35030g             465   1e-153   
ref|XP_007215328.1|  hypothetical protein PRUPE_ppa005221mg             461   5e-152   
ref|XP_011047324.1|  PREDICTED: high affinity nitrate transporter...    459   2e-151   
ref|XP_009417123.1|  PREDICTED: high affinity nitrate transporter...    456   4e-150   
ref|XP_008230563.1|  PREDICTED: high affinity nitrate transporter...    455   1e-149   
ref|XP_006446558.1|  hypothetical protein CICLE_v10015129mg             454   1e-149   
ref|XP_006470276.1|  PREDICTED: high affinity nitrate transporter...    454   2e-149   
gb|EMT29899.1|  hypothetical protein F775_10446                         452   3e-149   
ref|XP_004306358.1|  PREDICTED: high affinity nitrate transporter...    453   5e-149   
emb|CEF99315.1|  Major facilitator superfamily domain, general su...    452   2e-148   
ref|XP_001419922.1|  MFS family transporter: nitrate                    451   1e-147   
ref|XP_006357155.1|  PREDICTED: high affinity nitrate transporter...    449   1e-147   
gb|KDP45319.1|  hypothetical protein JCGZ_09568                         449   2e-147   
ref|XP_002504463.1|  major facilitator superfamily                      450   2e-147   
ref|XP_004233327.2|  PREDICTED: high affinity nitrate transporter...    449   5e-147   
ref|XP_009377187.1|  PREDICTED: high affinity nitrate transporter...    446   2e-146   
ref|XP_009757883.1|  PREDICTED: high affinity nitrate transporter...    446   2e-146   
ref|XP_009786786.1|  PREDICTED: high affinity nitrate transporter...    443   3e-146   
ref|XP_009377186.1|  PREDICTED: high affinity nitrate transporter...    446   3e-146   
ref|XP_002524664.1|  nitrate transporter, putative                      444   9e-146   
ref|XP_002955217.1|  hypothetical protein VOLCADRAFT_109952             446   2e-145   
ref|XP_001696788.1|  high affinity nitrate transporter                  446   2e-145   
ref|XP_001696789.1|  hypothetical protein CHLREDRAFT_192090             446   2e-145   
emb|CAA80925.1|  nitrate transporter component                          446   4e-145   
gb|AEO62175.1|  high affinity nitrate transporter                       444   2e-144   
gb|AAU11814.1|  nitrite/nitrate transporter                             444   4e-144   
ref|XP_009614323.1|  PREDICTED: high affinity nitrate transporter...    440   6e-144   
gb|KDO55197.1|  hypothetical protein CISIN_1g014301mg                   438   7e-144   
ref|XP_001694496.1|  nitrate transporter                                443   6e-143   
ref|XP_002955218.1|  hypothetical protein VOLCADRAFT_83071              438   8e-143   
emb|CAD60538.1|  NRT2;3 protein                                         442   9e-143   
ref|XP_010100419.1|  High affinity nitrate transporter 2.5              438   9e-142   
emb|CAD89800.1|  high affinity nitrate transporter protein              424   5e-141   
gb|KHG13680.1|  High affinity nitrate transporter 2.7 -like protein     431   1e-140   
ref|XP_007515051.1|  nitrate transporter                                431   2e-140   
ref|XP_010033302.1|  PREDICTED: high affinity nitrate transporter...    432   3e-140   
ref|XP_008246236.1|  PREDICTED: high-affinity nitrate transporter...    420   2e-139   
ref|XP_009334111.1|  PREDICTED: high affinity nitrate transporter...    427   7e-139   
ref|XP_002955238.1|  nitrite transporter                                424   2e-137   
gb|AAU87579.1|  high affinity nitrate transporter                       426   2e-137   
gb|EYU26848.1|  hypothetical protein MIMGU_mgv1a006145mg                421   1e-136   
gb|EYU22672.1|  hypothetical protein MIMGU_mgv1a005911mg                421   1e-136   
gb|AAP20046.1|  high affinity nitrate transporter                       411   4e-136   
ref|XP_009125986.1|  PREDICTED: high affinity nitrate transporter...    419   9e-136   
gb|KHM98920.1|  High affinity nitrate transporter 2.4                   413   1e-135   
ref|XP_002873677.1|  ATNRT2.7                                           419   2e-135   
gb|AAY40799.1|  high affinity nitrate transporter                       412   3e-135   
ref|XP_010492265.1|  PREDICTED: high affinity nitrate transporter...    417   4e-135   
emb|CDX91044.1|  BnaC02g05530D                                          418   5e-135   
emb|CDX85593.1|  BnaA02g02200D                                          417   6e-135   
ref|XP_008357733.1|  PREDICTED: high affinity nitrate transporter...    414   8e-134   
ref|XP_010420099.1|  PREDICTED: high affinity nitrate transporter...    412   5e-133   
ref|XP_010453583.1|  PREDICTED: high affinity nitrate transporter...    412   5e-133   
ref|XP_010420098.1|  PREDICTED: high affinity nitrate transporter...    412   5e-133   
ref|XP_010651839.1|  PREDICTED: high-affinity nitrate transporter...    403   6e-133   
gb|EYU22674.1|  hypothetical protein MIMGU_mgv1a005636mg                411   9e-133   
gb|KFK25697.1|  hypothetical protein AALP_AA8G147300                    410   2e-132   
ref|NP_196961.1|  high affinity nitrate transporter 2.7                 411   2e-132   
ref|XP_009107824.1|  PREDICTED: high affinity nitrate transporter...    403   4e-132   
ref|XP_006286495.1|  hypothetical protein CARUB_v10000843mg             409   1e-131   
ref|XP_006399969.1|  hypothetical protein EUTSA_v10013421mg             408   2e-131   
ref|XP_006357156.1|  PREDICTED: high affinity nitrate transporter...    405   3e-131   
ref|XP_004233328.2|  PREDICTED: high affinity nitrate transporter...    405   8e-131   
gb|EMS65312.1|  High-affinity nitrate transporter 2.1                   396   2e-126   
ref|XP_009621127.1|  PREDICTED: high-affinity nitrate transporter...    383   4e-125   
gb|AGG68804.1|  putative nitrate transporter                            382   5e-125   
gb|AGG68803.1|  putative nitrate transporter                            379   6e-124   
gb|EYU31249.1|  hypothetical protein MIMGU_mgv1a022483mg                376   3e-121   
ref|XP_005844791.1|  hypothetical protein CHLNCDRAFT_138674             392   2e-120   
gb|EMT31432.1|  hypothetical protein F775_11588                         372   5e-119   
ref|XP_010927127.1|  PREDICTED: probable high-affinity nitrate tr...    373   4e-118   
ref|XP_005648292.1|  MFS general substrate transporter                  375   5e-118   
ref|XP_007031544.1|  High affinity nitrate transporter 2.7              369   1e-117   
ref|XP_011046249.1|  PREDICTED: high affinity nitrate transporter...    362   2e-114   
gb|EPS57149.1|  hypothetical protein M569_17672                         352   2e-110   
ref|XP_006368145.1|  PREDICTED: high affinity nitrate transporter...    340   5e-109   
gb|KCW52915.1|  hypothetical protein EUGRSUZ_J02230                     345   2e-108   
gb|EYU41175.1|  hypothetical protein MIMGU_mgv1a023375mg                331   2e-105   
ref|XP_003081529.1|  Ntr2, nitrate high-affinity transporter (IC)       333   7e-104   
gb|KDP43997.1|  hypothetical protein JCGZ_05464                         322   7e-102   
ref|XP_006359575.1|  PREDICTED: LOW QUALITY PROTEIN: high affinit...    320   3e-99    
gb|KGN51782.1|  hypothetical protein Csa_5G599860                       313   4e-97    
ref|XP_004251406.1|  PREDICTED: high affinity nitrate transporter...    303   3e-95    
ref|XP_003566766.1|  PREDICTED: probable high-affinity nitrate tr...    312   1e-94    
ref|XP_004968955.1|  PREDICTED: high affinity nitrate transporter...    304   2e-91    
ref|XP_009609306.1|  PREDICTED: high affinity nitrate transporter...    284   2e-87    
ref|XP_002455791.1|  hypothetical protein SORBIDRAFT_03g025300          291   2e-86    
ref|XP_005791440.1|  putative nitrate transporter                       285   8e-84    
gb|EYU30269.1|  hypothetical protein MIMGU_mgv1a0234022mg               274   1e-83    
ref|WP_016254692.1|  Nitrate/nitrite transporter                        280   7e-83    
ref|WP_020889349.1|  Nitrate/nitrite transporter                        276   2e-81    
ref|WP_006913192.1|  MFS transporter                                    274   2e-80    
gb|EAY74469.1|  hypothetical protein OsI_02359                          274   3e-80    
dbj|BAG70346.1|  nitrate transporter                                    272   2e-79    
sp|A2ZU80.2|NRT24_ORYSJ  RecName: Full=Probable high-affinity nit...    272   3e-79    
ref|WP_026352005.1|  MFS transporter                                    270   4e-79    
gb|KGN64791.1|  hypothetical protein Csa_1G097690                       265   5e-79    
ref|WP_030069905.1|  MFS transporter                                    270   7e-79    
ref|WP_038482032.1|  MFS transporter                                    270   9e-79    
ref|WP_016914702.1|  MULTISPECIES: MFS transporter                      269   1e-78    
gb|KGN64790.1|  hypothetical protein Csa_1G097685                       263   1e-78    
ref|WP_009722351.1|  MFS transporter                                    268   3e-78    
ref|WP_009095800.1|  MFS transporter                                    268   3e-78    
ref|WP_029013391.1|  MFS transporter                                    268   4e-78    
gb|EAY84174.1|  hypothetical protein OsI_05553                          257   2e-77    
ref|WP_014021746.1|  MFS transporter                                    266   2e-77    
ref|WP_018917834.1|  MFS transporter                                    265   3e-77    
dbj|BAP56080.1|  major facilitator superfamily transporter              265   6e-77    
ref|XP_005780570.1|  hypothetical protein EMIHUDRAFT_73160              264   6e-77    
gb|AAD38794.1|  high affinity nitrate transporter                       254   2e-76    
ref|WP_028978530.1|  MFS transporter                                    263   3e-76    
ref|WP_024952061.1|  MFS transporter                                    262   6e-76    
gb|KGA02273.1|  MFS transporter                                         259   5e-75    
ref|WP_035077579.1|  MFS transporter                                    258   7e-75    
ref|WP_011584706.1|  MFS transporter                                    259   7e-75    
ref|WP_035474117.1|  MFS transporter                                    259   9e-75    
gb|ERM80359.1|  MFS transporter                                         259   1e-74    
ref|WP_026235652.1|  MFS transporter                                    258   2e-74    
ref|WP_010629444.1|  MFS transporter                                    257   3e-74    
emb|CBJ31728.1|  Nitrate high affinity transporter                      257   4e-74    
dbj|GAL86206.1|  nitrate/nitrite transporter                            256   6e-74    
ref|WP_007091382.1|  MFS transporter                                    257   6e-74    
ref|WP_022813237.1|  MFS transporter                                    256   7e-74    
gb|AJD52686.1|  major facilitator superfamily transporter               256   9e-74    
ref|WP_019017471.1|  MFS transporter                                    256   9e-74    
gb|AHF16326.1|  MFS transporter                                         255   1e-73    
ref|WP_011506433.1|  MULTISPECIES: MFS transporter                      256   1e-73    
ref|WP_037989699.1|  MFS transporter                                    256   2e-73    
emb|CBJ31724.1|  Nitrate high affinity transporter                      256   2e-73    
ref|WP_028791421.1|  MFS transporter                                    255   2e-73    
emb|CBJ31725.1|  Nitrate high affinity transporter                      255   3e-73    
emb|CBJ31727.1|  Nitrate high affinity transporter                      254   4e-73    
gb|AEN83410.1|  AT5G60780-like protein                                  244   7e-73    
ref|WP_020174491.1|  hypothetical protein                               253   1e-72    
ref|XP_005716155.1|  Nitrate transporter                                254   1e-72    
emb|CDQ33364.1|  Nitrate transporter                                    252   3e-72    
ref|WP_015265729.1|  nitrite extrusion protein, nitrite facilitator     252   3e-72    
ref|WP_031382767.1|  MFS transporter                                    252   3e-72    
ref|WP_034257329.1|  MFS transporter                                    251   4e-72    
gb|AAL85928.1|  putative nitrate transporter                            253   5e-72    
ref|WP_033405720.1|  MFS transporter                                    251   5e-72    



>ref|XP_006488042.1| PREDICTED: high affinity nitrate transporter 2.4-like [Citrus 
sinensis]
Length=530

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/515 (88%), Positives = 489/515 (95%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGREP  +F+VASP VPTDTTAKFALPVDSEHKAKVFKLFSLANP
Sbjct  1     MADIEGSPGSSMHGVTGREPAFAFSVASPAVPTDTTAKFALPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSF++   GY+AVRFMIGFSLATFVSCQ+WMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFIAGPSGYIAVRFMIGFSLATFVSCQFWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQLLMP++YDIIR+ GATPF+AWRIAFF+PGW+HV+MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLLMPLVYDIIRRCGATPFTAWRIAFFVPGWMHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKGN+ KDKFSKV WYA+TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLGALQKKGNVAKDKFSKVLWYAITNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             V+AEYF+DRF+LKLHTAGIIAATFGMANLVARPFGG+ASD AA++FGMRGRLW LWILQT
Sbjct  301   VVAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGYASDTAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             MGG FC  LGRAN+LP+AV  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   MGGAFCIWLGRANSLPIAVLAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFST+KFSTA GLS+MG+MI+ACTLPVTLVHFPQWGGMFFP SKD V+ TE
Sbjct  421   FGSGLTQLIFFSTTKFSTAQGLSWMGVMIVACTLPVTLVHFPQWGGMFFPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNEEEKQKG+HQ SL+FAENSRSERG+R
Sbjct  481   EYYYASEWNEEEKQKGLHQGSLRFAENSRSERGRR  515



>ref|XP_006424510.1| hypothetical protein CICLE_v10029836mg [Citrus clementina]
 gb|ESR37750.1| hypothetical protein CICLE_v10029836mg [Citrus clementina]
Length=530

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/515 (88%), Positives = 489/515 (95%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGREP  +F+VASP VPTDTTAKFALPVDSEHKAKVFKLFSLANP
Sbjct  1     MADIEGSPGSSMHGVTGREPAFAFSVASPAVPTDTTAKFALPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSF++   GY+AVRFMIGFSLATFVSCQ+WMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFIAGPSGYIAVRFMIGFSLATFVSCQFWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQLLMP++YDIIR+ GATPF+AWRIAFF+PGW+HV+MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLLMPLVYDIIRRCGATPFTAWRIAFFVPGWMHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKGN+ KDKFSKV WYA+TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLGALQKKGNVAKDKFSKVLWYAITNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             V+AEYF+DRF+LKLHTAGIIAATFGMANLVARPFGG+ASD AA++FGMRGRLW LWILQT
Sbjct  301   VVAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGYASDMAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             MGG FC  LGRAN+LP+AV  MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   MGGAFCIWLGRANSLPIAVLAMILFSVGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFST+KFSTA GLS+MG+MI+ACTLPVTLVHFPQWGGMFFP SKD V+ TE
Sbjct  421   FGSGLTQLIFFSTTKFSTAQGLSWMGVMIVACTLPVTLVHFPQWGGMFFPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNEEEKQKG+HQ SL+FAENSRSERG+R
Sbjct  481   EYYYASEWNEEEKQKGLHQGSLRFAENSRSERGRR  515



>ref|XP_006424511.1| hypothetical protein CICLE_v10030358mg [Citrus clementina]
 gb|ESR37751.1| hypothetical protein CICLE_v10030358mg [Citrus clementina]
Length=530

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/515 (88%), Positives = 488/515 (95%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGREP  +F+VASP VPTDTTAKFALPVDSEHKAKVFKLFSLANP
Sbjct  1     MADIEGSPGSSMHGVTGREPAFAFSVASPAVPTDTTAKFALPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSF++   GY+ VRFMIGFSLATFVSCQ+WMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFIAGPSGYITVRFMIGFSLATFVSCQFWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQLLMP++YDIIR+ GATPF+AWRIAFF+PGW+HV+MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLLMPLVYDIIRRCGATPFTAWRIAFFVPGWMHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKGN+ KDKFSKV WYA+TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLGALQKKGNVAKDKFSKVLWYAITNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             V+AEYF+DRF+LKLHTAGIIAATFGMANLVARPFGG+ASD AA++FGMRGRLW LWILQT
Sbjct  301   VVAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGYASDMAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             MGG FC  LGRAN+LP+AV  MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   MGGAFCIWLGRANSLPIAVLAMILFSVGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFST+KFSTA GLS+MG+MI+ACTLPVTLVHFPQWGGMFFP SKD V+ TE
Sbjct  421   FGSGLTQLIFFSTTKFSTAQGLSWMGVMIVACTLPVTLVHFPQWGGMFFPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNEEEKQKG+HQ SL+FAENSRSERG+R
Sbjct  481   EYYYASEWNEEEKQKGLHQGSLRFAENSRSERGRR  515



>emb|CDP07064.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/515 (87%), Positives = 487/515 (95%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTGREPVL+F+VASP+ PTDTTAKF LPVDSEHKAKVFKL S ANP
Sbjct  1     MGDIEGSPGSSMHGVTGREPVLAFSVASPMAPTDTTAKFDLPVDSEHKAKVFKLLSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSILSRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGVASVSGSILSRLCMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CDLLGPRYGCAFLIML+APTVFCMSFVS AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDLLGPRYGCAFLIMLSAPTVFCMSFVSDAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQL+MP+LYD+IRK G+TPF+AWRIAFFIPGW HV+MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLIMPLLYDVIRKTGSTPFTAWRIAFFIPGWCHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLGSLQKKG + KDKF++V WYAVTNYRTWIFALLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLGSLQKKGEVRKDKFARVMWYAVTNYRTWIFALLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             V+AEYF+DRFDLKLHTAG+IAATFG+AN+VARPFGGF+SD+AA+ FGMRGRLW LWILQT
Sbjct  301   VVAEYFYDRFDLKLHTAGVIAATFGLANIVARPFGGFSSDFAARKFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC LLGRAN+LP+AVT MI+FS+GAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCILLGRANSLPIAVTMMILFSVGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFF+TSK++T+ GLSYMGIMI+ CTLPVTLVHFPQWG MF P SKD V+G+E
Sbjct  421   FGSGLTQLIFFTTSKYTTSQGLSYMGIMIVCCTLPVTLVHFPQWGSMFLPPSKDVVKGSE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SE+ EEEKQKGMHQ SLKFAENSRSERG+R
Sbjct  481   EHYYSSEYTEEEKQKGMHQGSLKFAENSRSERGRR  515



>ref|XP_011089944.1| PREDICTED: high affinity nitrate transporter 2.4-like [Sesamum 
indicum]
Length=530

 Score =   909 bits (2348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/515 (87%), Positives = 485/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGREPVL+F+VAS  VPTDTTAKF LPVDSEHKAK FKLFSLANP
Sbjct  1     MADIEGSPGSSMHGVTGREPVLAFSVASSTVPTDTTAKFDLPVDSEHKAKKFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIM++APTVFCMSFVSSAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMMSAPTVFCMSFVSSAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             +KIIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+ G+TPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   TKIIGLVNGTAAGWGNMGGGATQLIMPLLYDIIRRTGSTPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LV+TLGQDLPDGNL +LQKKG + KDKF KV  YAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVMTLGQDLPDGNLSALQKKGEVAKDKFGKVLLYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAG IAATFGMAN+VARPFGGFASDY+A+ FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGTIAATFGMANIVARPFGGFASDYSARKFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC LLGRAN+LPLAVT+MIIFS+GAQAACGATFGI PFISRRSLG+ISG+TGAGGN
Sbjct  361   LGGTFCLLLGRANSLPLAVTFMIIFSVGAQAACGATFGIIPFISRRSLGVISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+STA+GLSYMGIMI+ACTLPVTLVHFPQWG MF P +KDA + +E
Sbjct  421   FGSGLTQLLFFTSSKYSTATGLSYMGIMIIACTLPVTLVHFPQWGSMFLPPTKDADKASE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SE+ EEEK+KGMH NSLKFAE SRSERG R
Sbjct  481   EHYYSSEYTEEEKKKGMHHNSLKFAETSRSERGSR  515



>ref|XP_006340219.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Solanum 
tuberosum]
Length=530

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/515 (86%), Positives = 488/515 (95%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTGREPVL+F+VASPIVPTDT+A F +PVDSEHKAKVFK +S + P
Sbjct  1     MGDIEGSPGSSMHGVTGREPVLAFSVASPIVPTDTSANFKVPVDSEHKAKVFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTF AAPLVPIIRDNLNL K D+GNAGVASVSGSILSRL MGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFGAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CD+LGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDMLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPLLYDIIRRAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGNL SLQKKGN++KDKFSK+ WYA TNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   LVLNLGQDLPDGNLASLQKKGNVSKDKFSKILWYAATNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKLHTAGIIAATFGMANL+ARPFGG++SD+AAK FGMRGRLWTLWILQT
Sbjct  301   VIAEYFFDRFDLKLHTAGIIAATFGMANLLARPFGGWSSDFAAKRFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FCFLLGRANTLPLA+TWMIIFSIGAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCFLLGRANTLPLAITWMIIFSIGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF+++K+STA+G++YMG+MI+ACTLPV+LVHFPQWG MF P SKD ++GTE
Sbjct  421   FGSGLTQLLFFTSTKYSTATGITYMGMMIIACTLPVSLVHFPQWGSMFLPPSKDPIKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHY+ SE+ E+EKQKGMHQNS+KFAENSRSERGKR
Sbjct  481   EHYFTSEYTEDEKQKGMHQNSIKFAENSRSERGKR  515



>ref|XP_011089248.1| PREDICTED: high affinity nitrate transporter 2.4-like [Sesamum 
indicum]
Length=527

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/515 (88%), Positives = 482/515 (94%), Gaps = 3/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGREPVL+F+VASP+VP+D TA F LPVDSEHKAK FKL S ANP
Sbjct  1     MADIEGSPGSSMHGVTGREPVLAFSVASPMVPSDPTANFDLPVDSEHKAKKFKLLSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLKKIDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MPVLY+II+K G+TPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPVLYEIIKKTGSTPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++ KDKFSKV WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLSTLQKKGDVAKDKFSKVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAGIIAATFGMAN+VARPFGGFASDYAA+ FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGIIAATFGMANIVARPFGGFASDYAARLFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             MGG+FC LLGRA+TLP+AVT MIIFS+GAQAACGATFGI PF+SRRSLG+ISG+TGAGGN
Sbjct  361   MGGIFCVLLGRADTLPVAVTHMIIFSVGAQAACGATFGIIPFVSRRSLGVISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+ST  GL+YMGIMI+ CTLPV LVHFPQWG MF P SK  V   E
Sbjct  421   FGSGLTQLLFFTSSKYSTDQGLTYMGIMIVGCTLPVALVHFPQWGSMFLPPSKSVV---E  477

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SE+ EEEKQKGMHQNSLKFAENSRSERGKR
Sbjct  478   EHYYGSEYTEEEKQKGMHQNSLKFAENSRSERGKR  512



>gb|KDP43998.1| hypothetical protein JCGZ_05465 [Jatropha curcas]
Length=530

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/515 (87%), Positives = 486/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTG+E   +F+VASPIVPTDTTAKF LPVDSEHKAKVFK+FS ANP
Sbjct  1     MGDIEGSPGSSMHGVTGKEQTFAFSVASPIVPTDTTAKFDLPVDSEHKAKVFKIFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKNDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVFCMSFVS AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFCMSFVSDAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP++YD+I+KAGATPF+AWRIAFF+PG LHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPLVYDLIQKAGATPFTAWRIAFFVPGMLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLT+GQDLPDGNLG+LQKKG++ KDKFSKVFWYA+TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTMGQDLPDGNLGALQKKGDVAKDKFSKVFWYAITNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKL TAGIIAATFGMANL+ARPFGG+ASD AA++FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFNLKLRTAGIIAATFGMANLLARPFGGYASDVAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRAN+LP+AV  MI+FSIGAQAACGATFGI PF+SRRSLGIISGLTGAGGN
Sbjct  361   LGGAFCVWLGRANSLPIAVLAMILFSIGAQAACGATFGIIPFVSRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTSKFSTA+GLS MG+MIM CTLPVTLV+FPQWGGMFFPASKD V+ TE
Sbjct  421   FGSGLTQLIFFSTSKFSTATGLSLMGLMIMGCTLPVTLVYFPQWGGMFFPASKDIVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEWNEEEKQKG+HQ SLKFAENSRSERGKR
Sbjct  481   EFYYGSEWNEEEKQKGLHQQSLKFAENSRSERGKR  515



>ref|XP_011089247.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Sesamum 
indicum]
Length=527

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/515 (88%), Positives = 481/515 (93%), Gaps = 3/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGREPVL+F+VASP+VP+D TAKF LPVDSEHKAK FKLFS ANP
Sbjct  1     MADIEGSPGSSMHGVTGREPVLAFSVASPMVPSDPTAKFDLPVDSEHKAKKFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLKKIDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MPVLY+II+K G+TPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPVLYEIIKKTGSTPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++ KDKFSKV WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLSALQKKGDVAKDKFSKVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAGIIAATFGMAN+VARPFGGFASDYAA+ FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGIIAATFGMANIVARPFGGFASDYAARLFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             MGG+FC LLGRA+T   AVT MIIFS+GAQAACGATFG+ PFISRRSLGIISG+TGAGGN
Sbjct  361   MGGIFCVLLGRADTRCRAVTHMIIFSVGAQAACGATFGVIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+ST  GL+YMGIMI+ CTLPV LVHFPQWG MF P SK  V   E
Sbjct  421   FGSGLTQLLFFTSSKYSTDQGLTYMGIMIVGCTLPVALVHFPQWGSMFLPPSKSVV---E  477

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SE+ EEEKQKGMHQNSLKFAENSRSERGKR
Sbjct  478   EHYYGSEYTEEEKQKGMHQNSLKFAENSRSERGKR  512



>ref|XP_007150166.1| hypothetical protein PHAVU_005G132200g [Phaseolus vulgaris]
 gb|ESW22160.1| hypothetical protein PHAVU_005G132200g [Phaseolus vulgaris]
Length=530

 Score =   902 bits (2330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/515 (87%), Positives = 484/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+IEGSPGSSMHGVTGRE     +V SP+VPTDTTAKFALPVDSEHKAKVFKLFSLANP
Sbjct  1     MAEIEGSPGSSMHGVTGREQTFVASVGSPMVPTDTTAKFALPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVS A GY+AVRF+IGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSDASGYIAVRFLIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQL+MP++Y+IIR+AGATPF+AWRIAFFIPGW+HV+MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLIMPLMYEIIRRAGATPFTAWRIAFFIPGWMHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQK+GN+ KDKFSKV WYA+TNYRTWIFALLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLGALQKQGNVAKDKFSKVLWYAITNYRTWIFALLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAA+FGMANLVARPFGG+ASD AA+ FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAASFGMANLVARPFGGYASDVAARVFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRAN+LP+AV  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGAFCIWLGRANSLPIAVLAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTSKFST++GLS MG MI+ACTLPVTLVHFPQWG MF P +KD  + TE
Sbjct  421   FGSGLTQLIFFSTSKFSTSTGLSLMGAMIVACTLPVTLVHFPQWGSMFLPPTKDVNKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEWNEEEK+KG+HQ+SLKFAENSRSERGKR
Sbjct  481   EFYYTSEWNEEEKKKGLHQSSLKFAENSRSERGKR  515



>ref|XP_007132303.1| hypothetical protein PHAVU_011G083500g [Phaseolus vulgaris]
 gb|ESW04297.1| hypothetical protein PHAVU_011G083500g [Phaseolus vulgaris]
Length=530

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/515 (86%), Positives = 481/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D+EGSPGSSMHGVTGRE     +VASP+VPTDTTA FALPVDSEHKAKVFKLFSLANP
Sbjct  1     MGDVEGSPGSSMHGVTGREQTFIASVASPMVPTDTTANFALPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLTMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV  A GY+ VRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVDDAAGYIVVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MPV+Y++IR+AGATPF+AWRIAFF+PGWLHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPVVYELIRRAGATPFTAWRIAFFVPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKGN+ KDKFSKV WYA+TNYRTWIFALLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLGALQKKGNVAKDKFSKVLWYAITNYRTWIFALLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAA+FGMANL+ARPFGG+ SD AA+ FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAASFGMANLLARPFGGYTSDVAARLFGMRGRLWNLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAVLAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTSKFST++GLS MG+MI+ CTLPVTLVHFPQWGGMF P SKD  + TE
Sbjct  421   FGSGLTQLIFFSTSKFSTSTGLSLMGVMIVCCTLPVTLVHFPQWGGMFVPPSKDINKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNEEEKQKG+HQ+SLKFAENSRSERGKR
Sbjct  481   EYYYTSEWNEEEKQKGLHQSSLKFAENSRSERGKR  515



>ref|XP_002523687.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF38627.1| nitrate transporter, putative [Ricinus communis]
Length=530

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/515 (87%), Positives = 483/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTGRE   +F+VASPIVPTDTTAKF LPVDSEHKAKVFKLFS ANP
Sbjct  1     MGDIEGSPGSSMHGVTGREQTFAFSVASPIVPTDTTAKFDLPVDSEHKAKVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFCTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CDLLGPRYGCAFLIML+APTVFCMSFVSSAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDLLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGGATQL+MP++YD+I++ GATPF+AWRIAFF+PG LHV+MGI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGATQLIMPLVYDLIQRVGATPFTAWRIAFFVPGLLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKG++ KDKFSKV WYA+TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLGALQKKGDVAKDKFSKVMWYAITNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKL TAGIIAATFGMANLVARPFGGFASDYAA++FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFNLKLQTAGIIAATFGMANLVARPFGGFASDYAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRAN+LP+AV  MI+FS+GAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGAFCIWLGRANSLPIAVLAMILFSVGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFST++FST +GLS MG+MI+ACTLPVTLV+FPQWGGMF P SKDA++ TE
Sbjct  421   FGSGLTQLIFFSTTRFSTETGLSLMGVMIVACTLPVTLVYFPQWGGMFLPPSKDAMKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEWNEEEKQKG+HQ SLKFAENSRSERG R
Sbjct  481   EFYYASEWNEEEKQKGLHQQSLKFAENSRSERGNR  515



>gb|ABQ57241.1| nitrate transporter [Citrus sinensis x Citrus trifoliata]
Length=530

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/515 (86%), Positives = 482/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGREP  +F+VASP VPTDTTAKFALPVDSEHKAKVFKLFSLANP
Sbjct  1     MADIEGSPGSSMHGVTGREPAFAFSVASPAVPTDTTAKFALPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFH SWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHFSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCD LGPRYGCAFLIM +APTVFCMSF++   GY+ VRFMIGFSLATFVSCQ+WMS+MFN
Sbjct  121   VCDFLGPRYGCAFLIMQSAPTVFCMSFMAGPSGYITVRFMIGFSLATFVSCQFWMSSMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQLLMP++YDIIR+ GATPF+AWRIAFF+PGW+HV MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLLMPLVYDIIRRCGATPFTAWRIAFFVPGWMHVSMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKGN+ KDKFSKV WYA+TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLDALQKKGNVAKDKFSKVLWYAITNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             V+AEYF+DRF+LKLHTAGIIAATFGMANLVARPFGG+ASD AA++FGMRGRLW LWILQT
Sbjct  301   VVAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGYASDMAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             MGG FC  LGRAN+LP+AV  MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   MGGAFCIWLGRANSLPIAVLAMILFSVGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFS +KFSTA GLS+MG+MI+ACTLPVTLVHFPQWGGMFFP SKD V+ TE
Sbjct  421   FGSGLTQLIFFSKTKFSTAQGLSWMGVMIVACTLPVTLVHFPQWGGMFFPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNEEEKQKG+HQ SL+FAENSRSERG+R
Sbjct  481   EYYYASEWNEEEKQKGLHQGSLRFAENSRSERGRR  515



>ref|XP_003539195.1| PREDICTED: high affinity nitrate transporter 2.4 [Glycine max]
 gb|KHN38727.1| High affinity nitrate transporter 2.4 [Glycine soja]
Length=530

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/515 (86%), Positives = 482/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGRE     +VASP+VPTDTTA FALPVDSEHKAK+FKLFSLANP
Sbjct  1     MADIEGSPGSSMHGVTGREQTFIASVASPMVPTDTTANFALPVDSEHKAKIFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDIGNAGVASVSGSIFSRLTMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV+ A GY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVNDAAGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP++Y++IR+AGATPF+AWRIAFF+PGW+HVVMGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPMVYELIRRAGATPFTAWRIAFFVPGWMHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKGN+ KDKFSKV WYA+TNYRTW+FALLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLGALQKKGNVAKDKFSKVLWYAITNYRTWVFALLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAA+FGMANL+ARPFGG+ SD AA+ FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAASFGMANLLARPFGGYTSDVAARLFGMRGRLWNLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAVLAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+FST++GLS MG+MI+ CTLPVTLVHFPQWG MF P SKD  + TE
Sbjct  421   FGSGLTQLIFFSTSRFSTSTGLSLMGVMIVCCTLPVTLVHFPQWGSMFLPPSKDVNKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY +EWNEEEKQKG+HQNSLKFAENSRSERGKR
Sbjct  481   EYYYTAEWNEEEKQKGLHQNSLKFAENSRSERGKR  515



>ref|XP_009802270.1| PREDICTED: high affinity nitrate transporter 2.4-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009802272.1| PREDICTED: high affinity nitrate transporter 2.4-like isoform 
X2 [Nicotiana sylvestris]
Length=530

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/515 (86%), Positives = 485/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEG PGSSMHGVTGREPVL+F+VASP+VPTDTTAKF++PVD+EHKAKVFK +S + P
Sbjct  1     MADIEGEPGSSMHGVTGREPVLAFSVASPMVPTDTTAKFSVPVDTEHKAKVFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRLVMGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCD+LGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDMLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGATPF+AWRIAFFIPGWLHVVMGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPILYDIIRRAGATPFTAWRIAFFIPGWLHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN G LQKKG+++KDKFS + WYA TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRGDLQKKGDVSKDKFSNILWYAATNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKLHTAGIIAATFGMANL+ARPFGGF+SDYAAK FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLHTAGIIAATFGMANLLARPFGGFSSDYAAKRFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC LLGR+N+LP+AVT+MI+FSIGAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCVLLGRSNSLPIAVTFMILFSIGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+STA+GL+YMG+MI+ CTLPVT  HFPQWG MFFP +KD V+G+E
Sbjct  421   FGSGLTQLLFFTSSKYSTATGLTYMGLMIIGCTLPVTFCHFPQWGSMFFPPTKDPVKGSE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY +E+ E E+QKGMHQNSLKFAEN RSERGKR
Sbjct  481   EHYYAAEYTEAERQKGMHQNSLKFAENCRSERGKR  515



>ref|NP_001236444.1| NRT2 protein [Glycine max]
 gb|AAC09320.1| putative high affinity nitrate transporter [Glycine max]
Length=530

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/515 (86%), Positives = 485/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+IEGSPGSSMHGVTGRE     +VASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP
Sbjct  1     MAEIEGSPGSSMHGVTGREQTFVASVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCD+LGPRYGCAFLIML+APTVFCMSFV  A GY+AVRF+IGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDMLGPRYGCAFLIMLSAPTVFCMSFVKDAAGYIAVRFLIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQL+MP++Y++IR+AGATPF+AWRIAFF+PG++HV+MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLIMPLVYELIRRAGATPFTAWRIAFFVPGFMHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+L+KKG++ KDKFSKV WYA+TNYRTWIFALLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLGALRKKGDVAKDKFSKVLWYAITNYRTWIFALLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAA+FGMANLVARPFGG+ASD AA+ FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAASFGMANLVARPFGGYASDVAARLFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAVLAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTSKFSTA+GLS MG+MI+ACTLPV++VHFPQWG MF P SKD  + TE
Sbjct  421   FGSGLTQLVFFSTSKFSTATGLSLMGVMIVACTLPVSVVHFPQWGSMFLPPSKDVSKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEWNEEEKQKG+HQ SLKFAENSRSERGKR
Sbjct  481   EFYYTSEWNEEEKQKGLHQQSLKFAENSRSERGKR  515



>ref|XP_007016829.1| Nitrate transporter 2:1 [Theobroma cacao]
 gb|EOY34448.1| Nitrate transporter 2:1 [Theobroma cacao]
Length=530

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/515 (87%), Positives = 480/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M+DIEGSPGSSMHGVTGREP  + +VASP+VPTDTTA F LPVDSEHKAKVFKLFS ANP
Sbjct  1     MSDIEGSPGSSMHGVTGREPAFALSVASPMVPTDTTANFDLPVDSEHKAKVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV+ AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVADAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMP++YDIIR+AG+TPF+AWRIAFFIPG LHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPLVYDIIRRAGSTPFTAWRIAFFIPGSLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNL +LQKKG++ KDKF KV WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   MVLTLGQDLPDGNLSTLQKKGDVAKDKFGKVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAATFGMANLVARPFGGFASD AA+ FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGFASDRAARLFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRANTLP+A+  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANTLPIAILAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+FSTA+GLS+MG+MI+ACTLPVTLVHFPQWG MF P SKD    TE
Sbjct  421   FGSGLTQLIFFSTSRFSTAAGLSWMGVMIVACTLPVTLVHFPQWGSMFLPPSKDVTTSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SE+NE+EK+KGMH  SLKFAENSRSERG+R
Sbjct  481   EHYYSSEYNEDEKKKGMHSASLKFAENSRSERGRR  515



>ref|XP_009791005.1| PREDICTED: high affinity nitrate transporter 2.4-like [Nicotiana 
sylvestris]
Length=530

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/515 (85%), Positives = 484/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTGREPVL+F+VASP+VPTDTTA F +PVDSEHKAKVFK +S + P
Sbjct  1     MGDIEGSPGSSMHGVTGREPVLAFSVASPMVPTDTTAHFKVPVDSEHKAKVFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRL MGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CD+LGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDMLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPILYDIIRRAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL SLQKKG+++KDKFSK+ WYA TNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLASLQKKGDVSKDKFSKILWYAATNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKLHTAGIIAATFGMANL+ARPFGG++SD+AAK FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLHTAGIIAATFGMANLLARPFGGWSSDFAAKRFGMRGRLWNLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FCFLLG+ANTLP+A+ WMIIFS+GAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCFLLGKANTLPMAIAWMIIFSLGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF+T+K+ST +GLSYMGIMI+ACTLPV+LVHFPQWG MF P +KD V+ TE
Sbjct  421   FGSGLTQLLFFTTTKWSTETGLSYMGIMIIACTLPVSLVHFPQWGSMFLPPTKDPVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHY+ SE+ E EKQKGMHQNS+KFAEN RSERGKR
Sbjct  481   EHYFTSEYTEAEKQKGMHQNSIKFAENCRSERGKR  515



>emb|CAA69387.1| nitrate transporter [Nicotiana plumbaginifolia]
Length=530

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/515 (85%), Positives = 485/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEG PGSSMHGVTGREPVL+F+VASP+VPTDTTAKF++PVD+EHKAKVFK +S + P
Sbjct  1     MADIEGEPGSSMHGVTGREPVLAFSVASPMVPTDTTAKFSVPVDTEHKAKVFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVP+IRDNLNL K D+GNAGVASVSGSILSRLVMGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPLIRDNLNLTKMDVGNAGVASVSGSILSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCD+LGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDMLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LYDIIRKAGATPF+AWRIAFFIPGWLHVVMGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPILYDIIRKAGATPFTAWRIAFFIPGWLHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN G LQKKG ++KDKF+ + WYA TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRGDLQKKGGVSKDKFTNILWYAATNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKLHTAGIIAATFGMANL+ARPFGGF+SD+AAK FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLHTAGIIAATFGMANLLARPFGGFSSDFAAKRFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC LLGR+N+LP+AVT+MI+FS+GAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCVLLGRSNSLPIAVTFMILFSVGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+STA+GL+YMG+MI+ CTLPVTL HFPQWG MFFP +KD V+G+E
Sbjct  421   FGSGLTQLLFFTSSKYSTATGLTYMGMMIIGCTLPVTLCHFPQWGSMFFPPTKDPVKGSE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY +E+ E E+QKGMHQNSLKFAEN RSERGKR
Sbjct  481   EHYYAAEYTEAERQKGMHQNSLKFAENCRSERGKR  515



>ref|XP_009595071.1| PREDICTED: high affinity nitrate transporter 2.4-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/515 (85%), Positives = 483/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEG PGSSMHGVTGREPVL+F+VASP+VPTDTTAKF++PVD+EHKAKVFK +S + P
Sbjct  1     MGDIEGEPGSSMHGVTGREPVLAFSVASPMVPTDTTAKFSVPVDTEHKAKVFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRLVMGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCD+LGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDMLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGATPF+AWRIAFFIPGWLHVVMGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPILYDIIRRAGATPFTAWRIAFFIPGWLHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN G LQKKG ++KDKFS + WYA TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRGDLQKKGGVSKDKFSNILWYAATNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKLHTAGIIAATFGMANL+ARPFGGF+SDYAAK FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLHTAGIIAATFGMANLLARPFGGFSSDYAAKRFGMRGRLWALWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC LLGR+N+LP+AVT+MI+FSIGAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCVLLGRSNSLPIAVTFMILFSIGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+STA+GL+YMG+MI+ CTLPVT  HFPQWG MFFP +KD V+G+E
Sbjct  421   FGSGLTQLLFFTSSKYSTATGLTYMGLMIIGCTLPVTFCHFPQWGSMFFPPTKDPVKGSE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY +E+ E E+QKGMHQNSLKFAEN RSERGKR
Sbjct  481   EHYYAAEYTEAERQKGMHQNSLKFAENCRSERGKR  515



>ref|XP_010111803.1| High affinity nitrate transporter 2.4 [Morus notabilis]
 gb|EXC31768.1| High affinity nitrate transporter 2.4 [Morus notabilis]
Length=532

 Score =   896 bits (2315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/517 (87%), Positives = 478/517 (92%), Gaps = 2/517 (0%)
 Frame = +2

Query  89    MADIEG--SPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  262
             M DIEG   PGSSMHGVTGRE   +F+VASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA
Sbjct  1     MGDIEGLGEPGSSMHGVTGREQTFAFSVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  60

Query  263   NPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVM  442
             NPHMRTFHLSW+SFFTCF+STFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVM
Sbjct  61    NPHMRTFHLSWVSFFTCFISTFAAAPLVPIIRDNLNLKKVDIGNAGVASVSGSIFSRLVM  120

Query  443   GAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTM  622
             GAVCDLLGPRYGCAFLIML+APTVFCMSFVS AGGY+AVRFMIGFSLATFVSCQYWMSTM
Sbjct  121   GAVCDLLGPRYGCAFLIMLSAPTVFCMSFVSDAGGYLAVRFMIGFSLATFVSCQYWMSTM  180

Query  623   FNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVM  802
             FNSKIIGLANGTAAGWGNMGGGATQLLMP++YDIIRKAGATPFSAWR+AFFIPGW H++M
Sbjct  181   FNSKIIGLANGTAAGWGNMGGGATQLLMPLVYDIIRKAGATPFSAWRMAFFIPGWFHIIM  240

Query  803   GILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELST  982
             GILVLTLGQDLPDGNLG+LQKKG++ KDKFSKV WYAVTNYRTWIF LLYGYSMGVELST
Sbjct  241   GILVLTLGQDLPDGNLGALQKKGDVAKDKFSKVLWYAVTNYRTWIFVLLYGYSMGVELST  300

Query  983   DNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWIL  1162
             DNVIAEYF+DRFDL LHTAGIIAA+FGMANLVARPFGG+ASD A + FGMRGRLWTLWIL
Sbjct  301   DNVIAEYFYDRFDLNLHTAGIIAASFGMANLVARPFGGYASDVAGRHFGMRGRLWTLWIL  360

Query  1163  QTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAG  1342
             QT GG FC  LGRAN+LP+AV  MI+FSIGAQAACGATFGI PFISRRSLGIISG+TGAG
Sbjct  361   QTAGGAFCIWLGRANSLPIAVFAMILFSIGAQAACGATFGIIPFISRRSLGIISGMTGAG  420

Query  1343  GNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRG  1522
             GNFGSGLTQL+FFSTSKFST +GLS MG MI+ACTLPVTLVHFPQWG MF P SKD  + 
Sbjct  421   GNFGSGLTQLVFFSTSKFSTETGLSLMGAMIVACTLPVTLVHFPQWGSMFLPPSKDVAKS  480

Query  1523  TEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             TEE YY SEW EEEKQKG+H NS+KFAENSRSERG+R
Sbjct  481   TEESYYGSEWTEEEKQKGLHHNSIKFAENSRSERGRR  517



>emb|CAD89799.1| high affinity nitrate transporter protein [Nicotiana tabacum]
Length=530

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/515 (85%), Positives = 482/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTGREPVL+F+VASP+V TDTTA F +PVDSEHKAKVFK +S + P
Sbjct  1     MVDIEGSPGSSMHGVTGREPVLAFSVASPMVQTDTTAHFKVPVDSEHKAKVFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRL MGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CD+LGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDMLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPILYDIIRRAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL SLQKKG+++KDKFSK+ WYA TNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLASLQKKGDVSKDKFSKILWYAATNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKLHTAGIIAATFGMANL+ARPFGG++SD AAK FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLHTAGIIAATFGMANLLARPFGGWSSDIAAKHFGMRGRLWNLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FCFLLG+ANTLP+A+ WMIIFS+GAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCFLLGKANTLPMAIAWMIIFSLGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF+T+K+ST +GLSYMGIMI+ACTLPV+LVHFPQWG MF P +KD V+ TE
Sbjct  421   FGSGLTQLLFFTTTKWSTETGLSYMGIMIIACTLPVSLVHFPQWGSMFLPPTKDPVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHY+ SE+ E EKQKGMHQNS+KFAEN RSERGKR
Sbjct  481   EHYFTSEYTEAEKQKGMHQNSIKFAENCRSERGKR  515



>emb|CAD89798.1| high affinity nitrate transporter protein [Nicotiana tabacum]
Length=530

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/515 (85%), Positives = 483/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEG PGSSMHGVTGREPVL+F+VASP+VPTDTTAKF++PVD+EHKAK+FK +S + P
Sbjct  1     MGDIEGEPGSSMHGVTGREPVLAFSVASPMVPTDTTAKFSVPVDTEHKAKIFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRLVMGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCD+LGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDMLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP++YDIIR+AGATPF+AWRIAFFIPGWLH+VMGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPIVYDIIRRAGATPFTAWRIAFFIPGWLHIVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN G LQKKG+++KDKFS + WYA TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRGDLQKKGDVSKDKFSNILWYAATNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKLHTAGIIAATFGMANL+ARPFGGF+SDYAAK FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLHTAGIIAATFGMANLLARPFGGFSSDYAAKRFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC LLGR+N LP+AVT+MI+FSIGAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCVLLGRSNPLPIAVTFMILFSIGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+STA+GL+YMG+MI+ CTLPVT  HFPQWG MFFP +KD V+G+E
Sbjct  421   FGSGLTQLLFFTSSKYSTATGLTYMGLMIIGCTLPVTFCHFPQWGSMFFPPTKDPVKGSE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY +E+ E E+QKGMHQNSLKFAEN RSERGKR
Sbjct  481   EHYYAAEYTEAERQKGMHQNSLKFAENCRSERGKR  515



>ref|XP_006388598.1| high-affinity nitrate transporter NRT2 family protein [Populus 
trichocarpa]
 gb|ERP47512.1| high-affinity nitrate transporter NRT2 family protein [Populus 
trichocarpa]
Length=530

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/515 (86%), Positives = 486/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD+EGSPGSSMHGVTGRE   +F+VASP VPTDTTAKFALPVDSEHKAKVFK+FS+ANP
Sbjct  1     MADVEGSPGSSMHGVTGREQTFAFSVASPTVPTDTTAKFALPVDSEHKAKVFKIFSMANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV+SAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVNSAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP++Y++I++AG+T FSAWRIAFF PGWLHV+ GI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLVMPLVYELIKRAGSTSFSAWRIAFFFPGWLHVITGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+L+KKG++ KDKFSKV WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   MVLTLGQDLPDGNLGALKKKGDVAKDKFSKVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAG+IAATFGMANLVARPFGG++SD AA++FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGVIAATFGMANLVARPFGGYSSDVAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LPLAVT MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   VGGVFCIWLGRANSLPLAVTAMILFSLGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S  STA+GLS+MG+MI  CTLPV LV+FPQWGGMFFPASKD V+ TE
Sbjct  421   FGSGLTQLVFFSSSSLSTAAGLSWMGVMICGCTLPVALVYFPQWGGMFFPASKDIVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW+E+EKQKGMHQ S+KFAENSRSERGKR
Sbjct  481   ESYYASEWDEDEKQKGMHQQSIKFAENSRSERGKR  515



>ref|XP_002277127.1| PREDICTED: high affinity nitrate transporter 2.4 [Vitis vinifera]
Length=530

 Score =   893 bits (2308),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/515 (85%), Positives = 482/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M++IEGSPGSSMHGVTGRE   +F+VASPIVPTDT+A FALPVDSEHKAKVFK+ S ANP
Sbjct  1     MSNIEGSPGSSMHGVTGREQTFAFSVASPIVPTDTSANFALPVDSEHKAKVFKILSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVFCMSFVSSAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFCMSFVSSAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGGATQL+MP+LY++I + G+TPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGATQLIMPILYEVICRVGSTPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++++DKFS+VFWYA+TNYRTWIF LLYGYSMGVELS DN
Sbjct  241   LVLTLGQDLPDGNLSTLQKKGDVSRDKFSRVFWYAITNYRTWIFVLLYGYSMGVELSIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAATFGMANLVARPFGG++SD A + FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGYSSDLAGRRFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+L +AV  M++FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLSIAVLAMMLFSVGAQAACGATFGIVPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+SKFSTA+GLS MG MI+ACTLPVTLVHFPQWG MF P SKD V+GTE
Sbjct  421   FGSGLTQLVFFSSSKFSTATGLSLMGAMIVACTLPVTLVHFPQWGSMFLPPSKDVVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNEEEKQKGMHQ SLKFAENSRSERG+R
Sbjct  481   EHYYESEWNEEEKQKGMHQGSLKFAENSRSERGQR  515



>ref|XP_011011351.1| PREDICTED: high-affinity nitrate transporter 2.1 [Populus euphratica]
Length=530

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/515 (87%), Positives = 485/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTGRE   +F+VASPIVPTDTTAKFALPVDSEHKAKVFK+FS ANP
Sbjct  1     MGDIEGSPGSSMHGVTGREQTFAFSVASPIVPTDTTAKFALPVDSEHKAKVFKIFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV+SAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVNSAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP++Y++I++AG+T FSAWRIAFF PGWLHV+ GI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLVMPLVYELIKRAGSTSFSAWRIAFFFPGWLHVITGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+L+KKG++ KDKF KV WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLGALKKKGDVAKDKFFKVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAG+IAATFGMANLVARPFGG++SD AA++FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGVIAATFGMANLVARPFGGYSSDVAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LPLAVT MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPLAVTAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S  STA+GLS+MG+MI  CTLPVTLV+FPQWGGMFFP SKDAV+ TE
Sbjct  421   FGSGLTQLVFFSSSSLSTAAGLSWMGVMICGCTLPVTLVYFPQWGGMFFPPSKDAVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW+E+EKQKGMHQ SLKFAENSRSERGKR
Sbjct  481   ESYYASEWDEDEKQKGMHQQSLKFAENSRSERGKR  515



>ref|XP_010031946.1| PREDICTED: high affinity nitrate transporter 2.4-like [Eucalyptus 
grandis]
 gb|KCW51347.1| hypothetical protein EUGRSUZ_J00898 [Eucalyptus grandis]
Length=530

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/515 (85%), Positives = 483/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M +IEGSPGSSMHGVTGRE   +F+VASP VPTD TAKFALPVDSEHKAK FK+FS ANP
Sbjct  1     MGEIEGSPGSSMHGVTGREQTFAFSVASPTVPTDHTAKFALPVDSEHKAKDFKIFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSILSRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSILSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVFCMSFVS+AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLMMLSAPTVFCMSFVSNAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MPV+Y++IR+ G+TPFSAWRIAFFIPGWL+V+ GI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPVVYELIRRTGSTPFSAWRIAFFIPGWLNVITGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++ KDKFSKV WYAVTNYRTW+F LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLSTLQKKGDVTKDKFSKVLWYAVTNYRTWVFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAGIIAA+FGMANLVARPFGG+ASDY+A++FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGIIAASFGMANLVARPFGGYASDYSARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAVLAMILFSVGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFF++S +STA+GLS MG+MI+ CTLPVTLVHFPQWGGMFFP SKD V+ TE
Sbjct  421   FGSGLTQLIFFASSSYSTATGLSLMGVMIVCCTLPVTLVHFPQWGGMFFPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEWNEEEK++GMHQ SLKFAENSRSERG++
Sbjct  481   EFYYESEWNEEEKREGMHQGSLKFAENSRSERGRK  515



>ref|XP_002523688.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF38628.1| nitrate transporter, putative [Ricinus communis]
Length=530

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/515 (86%), Positives = 481/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+IEGSPGSSMHGVTGRE   + +VASP+VPTDTTA F LPVDSEHKAKVFKLFS+ANP
Sbjct  1     MANIEGSPGSSMHGVTGREQTFALSVASPMVPTDTTAHFDLPVDSEHKAKVFKLFSIANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCF+STFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFCTCFISTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMS VSSAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSLVSSAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGGATQL+MP++YD+I++ GATPF+AWRIAFF+PG LHV+MGI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGATQLIMPLVYDLIQRVGATPFTAWRIAFFVPGILHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKG++ +DKFSKV WYA+TNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLGALQKKGDVARDKFSKVMWYAITNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF+LKLHTAGIIAATFGMANLVARPFGG+ASD AA+ FGMRGRLW LW LQT
Sbjct  301   VIAEYFFDRFNLKLHTAGIIAATFGMANLVARPFGGYASDVAARHFGMRGRLWVLWTLQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRAN+LPLA+  MI FSIGAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGAFCIWLGRANSLPLAIFTMIAFSIGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFST+KFST +GLS MG+MI+ACTLPVTL++FPQWGGMFFPASKD  R TE
Sbjct  421   FGSGLTQLIFFSTTKFSTQAGLSLMGVMIVACTLPVTLIYFPQWGGMFFPASKDVTRSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY +EWNEEEKQKGMHQ SLKFAENSRSERG++
Sbjct  481   EHYYEAEWNEEEKQKGMHQGSLKFAENSRSERGRK  515



>ref|XP_007208472.1| hypothetical protein PRUPE_ppa004104mg [Prunus persica]
 dbj|BAD02939.1| high-affinity nitrate transporter [Prunus persica]
 dbj|BAD22821.1| nitrate transporter [Prunus persica]
 gb|EMJ09671.1| hypothetical protein PRUPE_ppa004104mg [Prunus persica]
Length=530

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/515 (86%), Positives = 481/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA++EG PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKAKVFK+FSLANP
Sbjct  1     MAEVEGEPGSSMHGVTGREQTFAFSVASPIVPTDPTAKFDLPVDSEHKAKVFKIFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVS AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSDAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMP+++DII + GATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPLVFDIIGRVGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNL +LQKKG++ KD+FSKV W+AVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   MVLTLGQDLPDGNLAALQKKGDVAKDQFSKVLWHAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAATFGMANLVARPFGGFASD AA++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGFASDRAARYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  MI+FS+GAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAVFAMILFSVGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S FSTA+GLS MG+MI+ CTLPVTLVHFPQWG MF P SKD V+ TE
Sbjct  421   FGSGLTQLVFFSSSAFSTATGLSLMGVMIVCCTLPVTLVHFPQWGSMFLPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY +EWNEEEKQKG+HQ SL+FAENSRSERG+R
Sbjct  481   EFYYGAEWNEEEKQKGLHQQSLRFAENSRSERGRR  515



>ref|XP_009621125.1| PREDICTED: high affinity nitrate transporter 2.4-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/515 (85%), Positives = 482/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTGREPVL+F+VASP+V TDTTA F +PVDSEHKAKVFK +S + P
Sbjct  1     MVDIEGSPGSSMHGVTGREPVLAFSVASPMVQTDTTAHFKVPVDSEHKAKVFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRL MGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CD+LGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDMLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPILYDIIRRAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL SLQKKG+++KDKFSK+ WYA TNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLASLQKKGDVSKDKFSKILWYAATNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKLHTAGIIAATFGMANL+ARPFGG++SD AAK FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLHTAGIIAATFGMANLLARPFGGWSSDIAAKHFGMRGRLWNLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FCFLLG+A+TLP+A+ WMIIFS+GAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCFLLGKASTLPMAIAWMIIFSLGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF+T+K+ST +GLSYMGIMI+ACTLPV+LVHFPQWG MF P +KD V+ TE
Sbjct  421   FGSGLTQLLFFTTTKWSTETGLSYMGIMIIACTLPVSLVHFPQWGSMFLPPTKDPVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHY+ SE+ E EKQKGMHQNS+KFAEN RSERGKR
Sbjct  481   EHYFTSEYTEAEKQKGMHQNSIKFAENCRSERGKR  515



>ref|XP_003540194.1| PREDICTED: high affinity nitrate transporter 2.4-like [Glycine 
max]
Length=530

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/515 (85%), Positives = 483/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+IEGSPGSSMHGVTGRE     ++ASPIVPTDTTAKFALPVDSEHKAK+FKLFS+ANP
Sbjct  1     MAEIEGSPGSSMHGVTGREQTFVASIASPIVPTDTTAKFALPVDSEHKAKIFKLFSMANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV  A GY+ VRF+IGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVKDAAGYIMVRFLIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQL+MP++Y++IR+AGATPF+AWRIAFF+PG++HV+MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLIMPLVYELIRRAGATPFTAWRIAFFVPGFMHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++ KDKFSKV WYA+TNYRTWIFALLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLAALQKKGDVAKDKFSKVLWYAITNYRTWIFALLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAA+FGMANLVARPFGG+ASD AA+ FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAASFGMANLVARPFGGYASDVAARLFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+A+  MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAILAMILFSLGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTSKFSTA+GLS MG+MI+ACTLPV++VHFPQWG MF P SKD  + TE
Sbjct  421   FGSGLTQLVFFSTSKFSTATGLSLMGVMIVACTLPVSVVHFPQWGSMFLPPSKDVNKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEWNEEE+QKG+HQ SLKFAENSRSERGKR
Sbjct  481   EFYYTSEWNEEERQKGLHQQSLKFAENSRSERGKR  515



>ref|XP_003596775.1| High-affinity nitrate transporter [Medicago truncatula]
 ref|XP_003637531.1| High-affinity nitrate transporter [Medicago truncatula]
 gb|KEH30007.1| high affinity nitrate transporter 2.7 [Medicago truncatula]
Length=526

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/515 (86%), Positives = 482/515 (94%), Gaps = 3/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGRE     +VASP+VPTDTTAKFALPVDSEHK+KVFKLFS+ANP
Sbjct  1     MADIEGSPGSSMHGVTGREQTFMSSVASPMVPTDTTAKFALPVDSEHKSKVFKLFSMANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSD+GNAGVASVSGSI SRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDVGNAGVASVSGSIFSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CDLLGPRYGCAFLIMLTAPTVFCMSFV +A GY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDLLGPRYGCAFLIMLTAPTVFCMSFVENAAGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQL+MP++Y++IR+AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLIMPLVYELIRRAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+LQKKGN+ KDKF+KV WYA+TNYRTWIFALLYGYSMGVEL+TDN
Sbjct  241   MVLTLGQDLPDGNLGALQKKGNVAKDKFTKVLWYAITNYRTWIFALLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAA+FGMAN+VARPFGG+ASD AA+ FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAASFGMANIVARPFGGYASDVAARLFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRANTLP+AV  MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANTLPIAVLSMILFSVGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFS+SKFSTASGLS+MG MI+ CTLPV  VHFPQWG MF PASK+     E
Sbjct  421   FGSGLTQLIFFSSSKFSTASGLSWMGAMIVGCTLPVAFVHFPQWGSMFLPASKEI---NE  477

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+E QKG+HQ SL+FAENSRSERGKR
Sbjct  478   EHYYTSEWNEDEVQKGLHQPSLRFAENSRSERGKR  512



>ref|XP_008226212.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Prunus 
mume]
Length=530

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/515 (85%), Positives = 481/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA++EG PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKAKVFK+FSLANP
Sbjct  1     MAEVEGEPGSSMHGVTGREQTFAFSVASPIVPTDPTAKFDLPVDSEHKAKVFKIFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVS AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSDAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMP+++DII + GATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPLVFDIIGRLGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNL +LQKKG++ KD+FSKV W+A+TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   MVLTLGQDLPDGNLAALQKKGDVAKDQFSKVLWHAITNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAATFGMANLVARPFGGFASD AA++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGFASDRAARYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  MI+FS+GAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAVFAMILFSVGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S FSTA+GLS MG+MI+ CTLPVTLVHFPQWG MF P SKD V+ TE
Sbjct  421   FGSGLTQLVFFSSSAFSTATGLSLMGVMIVCCTLPVTLVHFPQWGSMFLPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY +EWNEEEKQKG+HQ SL+FAENSRSERG+R
Sbjct  481   EFYYGAEWNEEEKQKGLHQQSLRFAENSRSERGRR  515



>gb|KEH30005.1| high affinity nitrate transporter 2.7 [Medicago truncatula]
Length=526

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/515 (86%), Positives = 482/515 (94%), Gaps = 3/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGRE     +VASP+VPTDTTAKFALPVDSEHK+KVFKLFS+ANP
Sbjct  1     MADIEGSPGSSMHGVTGREQTFMSSVASPMVPTDTTAKFALPVDSEHKSKVFKLFSMANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSD+GNAGVASVSGSI SRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDVGNAGVASVSGSIFSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CDLLGPRYGCAFLIMLTAPTVFCMSFV +A GY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDLLGPRYGCAFLIMLTAPTVFCMSFVENAAGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQL+MP++Y++IR+AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLIMPLVYELIRRAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+LQKKGN+ KDKF+KV WYA+TNYRTWIFALLYGYSMGVEL+TDN
Sbjct  241   MVLTLGQDLPDGNLGALQKKGNVAKDKFTKVLWYAITNYRTWIFALLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAA+FGMAN+VARPFGG+ASD AA+ FGMRGR+WTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAASFGMANIVARPFGGYASDVAARLFGMRGRIWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRANTLP+AV  MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANTLPIAVLSMILFSVGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFS+SKFSTASGLS+MG MI+ CTLPV  VHFPQWG MF PASK+     E
Sbjct  421   FGSGLTQLIFFSSSKFSTASGLSWMGAMIVGCTLPVAFVHFPQWGSMFLPASKEI---NE  477

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+E QKG+HQ SL+FAENSRSERGKR
Sbjct  478   EHYYTSEWNEDEVQKGLHQPSLRFAENSRSERGKR  512



>emb|CAG26716.1| nitrate transporter [Populus tremula x Populus tremuloides]
Length=530

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/515 (86%), Positives = 484/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD+EGSPGSSMHGVTGRE   +F+VASP VPTDTTAKFALPVDSEHKAKVFK+FS ANP
Sbjct  1     MADVEGSPGSSMHGVTGREQSFAFSVASPTVPTDTTAKFALPVDSEHKAKVFKIFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV SAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVDSAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP++Y++I++AG+T FSAWRIAFF+PGWLHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLVMPLVYELIKRAGSTSFSAWRIAFFVPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGNLG+L+KKG++ KDKFSKV WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLNLGQDLPDGNLGALKKKGDVAKDKFSKVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF++RFDLKLHTAG+IAATFGMANLVARPFGG+ SD AA++FGMRGRLW LWILQT
Sbjct  301   VIAEYFYNRFDLKLHTAGVIAATFGMANLVARPFGGYFSDVAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LPLAVT MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCTWLGRANSLPLAVTAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S  STA+GLS+MG+MI  CTLPVTLV+FPQWGGMFFP SKD V+ TE
Sbjct  421   FGSGLTQLVFFSSSSLSTAAGLSWMGVMICGCTLPVTLVYFPQWGGMFFPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW+E+EKQ+GMHQ SLKFAENSRSERGKR
Sbjct  481   ESYYASEWDEDEKQRGMHQKSLKFAENSRSERGKR  515



>ref|XP_006347193.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Solanum 
tuberosum]
 ref|XP_006347194.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Solanum 
tuberosum]
Length=530

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/515 (85%), Positives = 480/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD+EGSPGSSMHGVTGREPVL+F+VASP+VPTDTTAKF++PVD+EHKAK FK +S + P
Sbjct  1     MADVEGSPGSSMHGVTGREPVLAFSVASPMVPTDTTAKFSVPVDTEHKAKQFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRL MGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGATPF+AWRIAFFIPGWLHVVMGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPLLYDIIRRAGATPFTAWRIAFFIPGWLHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN G LQK G ++KDKF  + WYA TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRGDLQKTGTVSKDKFGNILWYAATNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKL TAGIIAATFGMANL+ARPFGGF+SDYAA+ FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLQTAGIIAATFGMANLLARPFGGFSSDYAAEKFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC LLGR+N+LPLAVT+MI+FSIGAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCVLLGRSNSLPLAVTFMILFSIGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+STA+GL+YMG+MI+ CTLPVT  HFPQWG MFFP +KD ++G+E
Sbjct  421   FGSGLTQLLFFTSSKYSTATGLTYMGLMIIGCTLPVTFCHFPQWGSMFFPPTKDPIKGSE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SE+ E E+QKGMHQN+LKFAEN RSERGKR
Sbjct  481   EHYYTSEYTEAERQKGMHQNALKFAENCRSERGKR  515



>ref|XP_008226225.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Prunus 
mume]
Length=530

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/515 (85%), Positives = 481/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA++EG PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKAKVFK+FSLANP
Sbjct  1     MAEVEGEPGSSMHGVTGREQTFAFSVASPIVPTDPTAKFDLPVDSEHKAKVFKIFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVS AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSDAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMP+++DII + GATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPLVFDIIGRLGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNL +LQKKG++ KD+FSKV W+A+TNYRTWIF LLYGYS+GVELSTDN
Sbjct  241   MVLTLGQDLPDGNLAALQKKGDVAKDQFSKVLWHAITNYRTWIFILLYGYSLGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAATFGMANLVARPFGGFASD AA++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGFASDRAARYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  MI+FS+GAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAVFAMILFSVGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S FSTA+GLS MG+MI+ CTLPVTLVHFPQWG MF P SKD V+ TE
Sbjct  421   FGSGLTQLVFFSSSAFSTATGLSLMGVMIVCCTLPVTLVHFPQWGSMFLPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY +EWNEEEKQKG+HQ SL+FAENSRSERG+R
Sbjct  481   EFYYGAEWNEEEKQKGLHQQSLRFAENSRSERGRR  515



>ref|NP_001234134.1| NRT2;1 protein [Solanum lycopersicum]
 gb|AAF00053.1|AF092655_1 putative high-affinity nitrate transporter [Solanum lycopersicum]
Length=530

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/515 (85%), Positives = 478/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD+EGSPGSSMHGVTGREPVL+F+VASP+VPTDT+AKF++PVD+EHKAK FK +S + P
Sbjct  1     MADVEGSPGSSMHGVTGREPVLAFSVASPMVPTDTSAKFSVPVDTEHKAKQFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRL MGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLTMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGATPF+AWRIAFFIPGWLHVVMGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPLLYDIIRRAGATPFTAWRIAFFIPGWLHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN G+LQK G + KDKF  + WYA TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRGTLQKTGTVAKDKFGNILWYAATNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKL TAGIIAATFGMANL+ARPFGGF+SDYAAK FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLSTAGIIAATFGMANLLARPFGGFSSDYAAKKFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC LLGR+N+LPLAVT+MI+FSIGAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCVLLGRSNSLPLAVTFMILFSIGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+STA+GL+YMG MI+ CTLPVT  HFPQWG MF P +KD V+GTE
Sbjct  421   FGSGLTQLLFFTSSKYSTATGLTYMGFMIIGCTLPVTFCHFPQWGSMFLPPTKDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SE+ E E+QKGMHQNSLKFAEN RSERGKR
Sbjct  481   EHYYTSEYTEAERQKGMHQNSLKFAENCRSERGKR  515



>gb|EYU36162.1| hypothetical protein MIMGU_mgv1a025664mg [Erythranthe guttata]
Length=528

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/511 (86%), Positives = 479/511 (94%), Gaps = 3/511 (1%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRT  280
             EGSPG+SMHGVTGREPVL+F+VASP+V TDTTAKF LPVDSEHKAK FKLFS   PHMRT
Sbjct  6     EGSPGTSMHGVTGREPVLAFSVASPMVATDTTAKFDLPVDSEHKAKKFKLFSFGKPHMRT  65

Query  281   FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDL  460
             FHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRLVMGAVCDL
Sbjct  66    FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLVMGAVCDL  125

Query  461   LGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKII  640
             LGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN KII
Sbjct  126   LGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNGKII  185

Query  641   GLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLT  820
             GL NGTAAGWGNMGGGATQL+MPVLY+II+KAG+TPF+AWRIAFFIPGWLHV+M ILV+T
Sbjct  186   GLVNGTAAGWGNMGGGATQLIMPVLYEIIKKAGSTPFTAWRIAFFIPGWLHVIMVILVMT  245

Query  821   LGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAE  1000
             LGQDLPDGNLG+LQKKG + KDKF KV WYAVTNYRT+IF LLYGYSMGVELSTDNVIAE
Sbjct  246   LGQDLPDGNLGALQKKGTVAKDKFGKVLWYAVTNYRTYIFVLLYGYSMGVELSTDNVIAE  305

Query  1001  YFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGL  1180
             YF+DRFDLKLHTAG IAATFGMANLVARPFGGFASDYAA+ FGMRGRLWTLWILQT+GG 
Sbjct  306   YFYDRFDLKLHTAGTIAATFGMANLVARPFGGFASDYAARKFGMRGRLWTLWILQTLGGA  365

Query  1181  FCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSG  1360
             FC LLG+A+TLPLAVT+MIIFS+GAQAACGATFGI PFISRRSLG+ISG+TGAGGNFGSG
Sbjct  366   FCLLLGKADTLPLAVTFMIIFSVGAQAACGATFGIIPFISRRSLGVISGMTGAGGNFGSG  425

Query  1361  LTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYY  1540
             LTQL+FF++S++STA+GL+YMGIMIM CTLPVT+VHFPQWG MF P SK A    EEHYY
Sbjct  426   LTQLLFFTSSRYSTATGLTYMGIMIMCCTLPVTVVHFPQWGSMFLPPSKHA---EEEHYY  482

Query  1541  CSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +E++E+E++KGMHQNSLKFAENSRSERG R
Sbjct  483   SAEYDEDERKKGMHQNSLKFAENSRSERGNR  513



>ref|XP_002313528.2| high-affinity nitrate transporter NRT2 family protein [Populus 
trichocarpa]
 gb|EEE87483.2| high-affinity nitrate transporter NRT2 family protein [Populus 
trichocarpa]
Length=530

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/515 (86%), Positives = 482/515 (94%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTG+E   +F+VASP VPTDTTA FALPVDSEHKAKVFK+FS ANP
Sbjct  1     MGDIEGSPGSSMHGVTGKEQTFAFSVASPTVPTDTTANFALPVDSEHKAKVFKIFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV+SAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVNSAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP++Y++I++AG+T FSAWRIAFF PGWLHV+ GI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLVMPLVYELIKRAGSTSFSAWRIAFFFPGWLHVITGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+L+KKG++ KDKFSKV WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   MVLTLGQDLPDGNLGALKKKGDVAKDKFSKVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAG+IAATFGMANLVARPFGG++SD AA++FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGVIAATFGMANLVARPFGGYSSDVAARYFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LPLAVT MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPLAVTAMILFSLGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S  STA+GLS+MG+MI  CTLPVTLV+FPQWGGMFFP SKD V+ TE
Sbjct  421   FGSGLTQLVFFSSSSLSTAAGLSWMGVMICGCTLPVTLVYFPQWGGMFFPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW+E+EKQKGMHQ SLKFAENSRSERG R
Sbjct  481   ESYYASEWDEDEKQKGMHQQSLKFAENSRSERGNR  515



>ref|XP_004303678.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Fragaria 
vesca subsp. vesca]
Length=530

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/515 (84%), Positives = 477/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA++EG PGSSMHGVTG+E   + +VASPIVPTD TAKF LPVDSEHKAKVFKLFSLANP
Sbjct  1     MAELEGEPGSSMHGVTGKEQTFALSVASPIVPTDRTAKFDLPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIMLTAPTVFCMSFV+ AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLTAPTVFCMSFVADAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMP+++DII +AGATPF+AWRIAFFIPGWLH++MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPIVFDIIGRAGATPFTAWRIAFFIPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+LQKKG + KD+F KV WYA+TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   MVLTLGQDLPDGNLGALQKKGEVAKDEFKKVLWYAITNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAG+IAATFGMAN +ARPFGGF SD AA++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGLIAATFGMANFLARPFGGFVSDRAARYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRANTLP+A+T MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANTLPVAITAMILFSVGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S FST +GLS+MG+MI+ CTLPVTLVHFPQWG MF PAS+   + TE
Sbjct  421   FGSGLTQLVFFSSSAFSTGTGLSFMGVMIVCCTLPVTLVHFPQWGSMFLPASQHVEKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW EEEKQKG+HQ S+KFAENSRSERG+R
Sbjct  481   EFYYGSEWTEEEKQKGLHQQSIKFAENSRSERGRR  515



>ref|XP_004302082.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Fragaria 
vesca subsp. vesca]
Length=530

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/515 (84%), Positives = 477/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA++EG PGSSMHGVTG+E   + +VASPIVPTD TAKF LPVDSEHKAKVFKLFSLANP
Sbjct  1     MAEVEGEPGSSMHGVTGKEQTFALSVASPIVPTDRTAKFDLPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIMLTAPTVFCMSFV+ AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLTAPTVFCMSFVADAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMP+++DII +AGATPF+AWRIAFFIPGWLH++MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPIVFDIIGRAGATPFTAWRIAFFIPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+LQKKG + KD+F KV WYA+TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   MVLTLGQDLPDGNLGALQKKGEVAKDEFKKVLWYAITNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAG+IAATFGMAN +ARPFGGF SD AA++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGLIAATFGMANFLARPFGGFISDRAARYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRANTLP+A+T MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANTLPVAITAMILFSVGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S FST +GLS+MG+MI+ CTLPVTLVHFPQWG MF PAS+   + TE
Sbjct  421   FGSGLTQLVFFSSSAFSTGTGLSFMGVMIVCCTLPVTLVHFPQWGSMFLPASQHVEKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW EEEKQKG+HQ S+KFAENSRSERG+R
Sbjct  481   EFYYGSEWTEEEKQKGLHQQSIKFAENSRSERGRR  515



>ref|XP_007207632.1| hypothetical protein PRUPE_ppa021664mg [Prunus persica]
 dbj|BAD04063.1| high-affinity nitrate transporter [Prunus persica]
 dbj|BAD22822.1| nitrate transporter [Prunus persica]
 gb|EMJ08831.1| hypothetical protein PRUPE_ppa021664mg [Prunus persica]
Length=530

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/515 (85%), Positives = 479/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA++EG PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKAKVFK+FSLANP
Sbjct  1     MAEVEGEPGSSMHGVTGREQTFAFSVASPIVPTDPTAKFDLPVDSEHKAKVFKIFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVS AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSDAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMP+++DII + GATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPLVFDIIGRVGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNL +LQKKG++ KD+FSKV W+A+TNYRTWIF LLYGYSMGVELS DN
Sbjct  241   MVLTLGQDLPDGNLAALQKKGDVAKDQFSKVLWHAITNYRTWIFVLLYGYSMGVELSIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAA FGMAN+VARPFGGFASD AA++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAAAFGMANIVARPFGGFASDRAARYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  MI+FS+GAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAVFAMILFSVGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS++ FSTA+GLS MG+MI+ CTLPVTLVHFPQWG MF P SKD V+ TE
Sbjct  421   FGSGLTQLVFFSSAAFSTATGLSLMGVMIVCCTLPVTLVHFPQWGSMFLPPSKDVVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY +EWNEEEKQKG+HQ SL+FAENSRSERG+R
Sbjct  481   EFYYGAEWNEEEKQKGLHQQSLRFAENSRSERGRR  515



>ref|NP_001266263.1| high-affinity nitrate transporter 2.1-like [Solanum lycopersicum]
 gb|AAF00054.1|AF092654_1 putative high-affinity nitrate transporter [Solanum lycopersicum]
Length=530

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/515 (85%), Positives = 476/515 (92%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D+EGSPGSSMHGVTGREPVL+F+VASP+VPTDT+AKF++PVD+EHKAK FK +S + P
Sbjct  1     MTDVEGSPGSSMHGVTGREPVLAFSVASPMVPTDTSAKFSVPVDTEHKAKQFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRL MGA
Sbjct  61    HGLTFQLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLTMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGA PF+AWRIAFFIPGWLHVVMGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPLLYDIIRRAGAIPFTAWRIAFFIPGWLHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN G+LQK G + KDKF  + WYA TNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRGTLQKTGTVAKDKFGNILWYAATNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKL TAGIIAATFGMANL+ARPFGGF+SDYAAK FGMRGRLW LWILQT
Sbjct  301   VIAEYFFDRFDLKLSTAGIIAATFGMANLLARPFGGFSSDYAAKKFGMRGRLWVLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC LLGR+N+LPLAVT+MI+FSIGAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCVLLGRSNSLPLAVTFMILFSIGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+STA+GL+YMG MI+ CTLPVT  HFPQWG MF P +KD V+GTE
Sbjct  421   FGSGLTQLLFFTSSKYSTATGLTYMGFMIIGCTLPVTFCHFPQWGSMFLPPTKDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SE+ E E+QKGMHQNSLKFAEN RSERGKR
Sbjct  481   EHYYTSEYTEAERQKGMHQNSLKFAENCRSERGKR  515



>ref|XP_009356900.1| PREDICTED: high affinity nitrate transporter 2.4-like [Pyrus 
x bretschneideri]
Length=530

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/515 (85%), Positives = 475/515 (92%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD EG PGSSMHGVTGRE  LSF+VASPIVPTDTTAKF LPVDSEHKAKVFKLFSLANP
Sbjct  1     MADSEGEPGSSMHGVTGREQTLSFSVASPIVPTDTTAKFDLPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCF+STFAAAPLVPIIRDN+NL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFISTFAAAPLVPIIRDNINLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDL+GPRYGCAFLIML+APTVFCMSFV+ AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLIGPRYGCAFLIMLSAPTVFCMSFVADAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMP+++DII + GATPF+AWRIAFFIPGW H++ GI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPLVFDIIGRCGATPFTAWRIAFFIPGWFHIITGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+LQKKG + KD+FSKV WYAVTNYRTWIF LLYGYSMGVELS DN
Sbjct  241   MVLTLGQDLPDGNLGALQKKGEVAKDQFSKVLWYAVTNYRTWIFVLLYGYSMGVELSIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFD KLH AGIIAA+FGMAN  ARPFGG+ASD A ++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFDPKLHLAGIIAASFGMANFAARPFGGWASDVAGRYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LPLAV  MI+FSIGAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCICLGRANSLPLAVLAMILFSIGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS FSTASGLS+MG+MI+ CTLPVTLVHFPQWGGMF PASKD  + TE
Sbjct  421   FGSGLTQLVFFSTSAFSTASGLSWMGVMIVCCTLPVTLVHFPQWGGMFLPASKDVEKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY +EW+E EKQKG+HQ SLKFA+NSRSERG+R
Sbjct  481   EFYYAAEWSEAEKQKGLHQGSLKFADNSRSERGRR  515



>ref|XP_008349944.1| PREDICTED: high affinity nitrate transporter 2.4-like [Malus 
domestica]
Length=530

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/515 (85%), Positives = 474/515 (92%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD EG PGSSMHGVTGRE   +F+VASPIVPTDTTAKF LPVDSEHKAKVFKLFSLANP
Sbjct  1     MADSEGEPGSSMHGVTGREQTFAFSVASPIVPTDTTAKFDLPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCF+STFAAAPLVPIIRDN+NL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFISTFAAAPLVPIIRDNINLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDL+GPRYGCAFLIML+APTVFCMSFV+ AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLIGPRYGCAFLIMLSAPTVFCMSFVADAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGGATQLLMP+++DII + GATPF+AWRIAFFIPGW H++ GI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGATQLLMPLMFDIIGRCGATPFTAWRIAFFIPGWFHIITGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+LQKKG + KD+FSKV WYAVTNYRTWIF LLYGYSMGVELS DN
Sbjct  241   MVLTLGQDLPDGNLGALQKKGEVAKDQFSKVLWYAVTNYRTWIFVLLYGYSMGVELSIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLH AGIIAA+FGMAN  ARPFGG+ASD A ++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFDLKLHLAGIIAASFGMANFAARPFGGWASDVAGRYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LPLAV  MI+FSIGAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCICLGRANSLPLAVLAMILFSIGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS FSTASGLS+MG+MI+ CTLPVTLVHFPQWGGMF PASKD  + TE
Sbjct  421   FGSGLTQLVFFSTSAFSTASGLSWMGVMIVCCTLPVTLVHFPQWGGMFLPASKDVEKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY +EW+E EKQKG+HQ SLKFAENSRSERG+R
Sbjct  481   EFYYAAEWSEAEKQKGLHQGSLKFAENSRSERGRR  515



>gb|ACN22072.1| Rehd high-affinity nitrate transporter NRT2.1 [Malus hupehensis]
Length=530

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/515 (85%), Positives = 472/515 (92%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD EG PGSSMHGVTGRE   +F+VASPIVPTDTTAKF LPVDSEHKAKVFKLFSLANP
Sbjct  1     MADSEGEPGSSMHGVTGREQAFAFSVASPIVPTDTTAKFDLPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCF+STFAAAPLVPIIRDN+NL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFISTFAAAPLVPIIRDNINLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDL+GPRYGCAFLIML+APTVFCMSFV  AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLIGPRYGCAFLIMLSAPTVFCMSFVGDAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKII L NGTAAGWGNMGGGATQLLMP+++DII + GATPF+AWRIAFFIPGW H++ GI
Sbjct  181   SKIIRLVNGTAAGWGNMGGGATQLLMPLMFDIIGRCGATPFTAWRIAFFIPGWFHIITGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+LQKKG + KD+FSKV WYAVTNYRTWIF LLYGYSMGVELS DN
Sbjct  241   MVLTLGQDLPDGNLGALQKKGEVAKDQFSKVLWYAVTNYRTWIFVLLYGYSMGVELSIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLH AGIIAA+FGMAN  ARPFGG+ASD A ++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFDLKLHLAGIIAASFGMANFAARPFGGWASDVAGRYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LPLAV  MI+FSIGAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCICLGRANSLPLAVLAMILFSIGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS FSTASGLS MG+MI+ CTLPVTLVHFPQWGGMF PASKD  + TE
Sbjct  421   FGSGLTQLVFFSTSAFSTASGLSLMGVMIVCCTLPVTLVHFPQWGGMFLPASKDVDKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY +EW+E EKQKG+HQ SLKFAENSRSERG+R
Sbjct  481   EFYYAAEWSEAEKQKGLHQGSLKFAENSRSERGRR  515



>ref|NP_001234127.1| NRT2;3 protein [Solanum lycopersicum]
 gb|AAK72402.1| putative high-affinity nitrate transporter [Solanum lycopersicum]
Length=531

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/515 (84%), Positives = 477/515 (93%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTGREPVL+F+VAS IVPTDT+A F +PVDSEHKAKVFK +S + P
Sbjct  1     MGDIEGSPGSSMHGVTGREPVLAFSVASLIVPTDTSANFKVPVDSEHKAKVFKFYSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H  TF LSWISF TCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSILSRL MGA
Sbjct  61    HGLTFQLSWISFCTCFVSTFAAAPLVPIIRDNLNLTKMDVGNAGVASVSGSILSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CD+LGPRYGCAFLIML+APTV CMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDMLGPRYGCAFLIMLSAPTVLCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LYDIIR+AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPLLYDIIRRAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL SLQKKG+++KDKFSK+ WYA TNYRTWI  LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLASLQKKGDVSKDKFSKILWYAATNYRTWILVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDLKLHTAGIIAATFGMANL+ARPFGG++SD AAK FGMRGRLW  WILQT
Sbjct  301   VIAEYFFDRFDLKLHTAGIIAATFGMANLLARPFGGWSSDVAAKHFGMRGRLWNSWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC LLGRA TLPLA+TWMIIFSIGAQAACG TFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGVFCLLLGRATTLPLAITWMIIFSIGAQAACGVTFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF+++K+ST +GL+YMG+MI+ACTLPV LV FPQWG MF P SKD ++GTE
Sbjct  421   FGSGLTQLLFFTSTKYSTGTGLTYMGMMIIACTLPVMLVRFPQWGSMFLPPSKDPIKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHY+ SE+ E+EKQKGMHQNS+KFAENSR+ERGK+
Sbjct  481   EHYFGSEYTEDEKQKGMHQNSIKFAENSRTERGKK  515



>ref|NP_001269063.1| high affinity nitrate transporter 2.4-like [Cucumis sativus]
 gb|AGO64298.1| high-affinity nitrate transporter NRT2.2 [Cucumis sativus]
Length=530

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/515 (84%), Positives = 475/515 (92%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D+EGSPGSSMHGVTGRE   +F+VASPIVPTDTTAKFALPVDSEHKAKVF+++SLANP
Sbjct  1     MGDVEGSPGSSMHGVTGREQTFAFSVASPIVPTDTTAKFALPVDSEHKAKVFRIWSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSW+SFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGV SVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWVSFFTCFVSTFAAAPLVPIIRDNLNLTKVDIGNAGVTSVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVS A GY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSDAAGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LY++I++AGATPF+AWRIAFFIPG+LHV+MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPLLYEVIQRAGATPFTAWRIAFFIPGFLHVLMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL SLQKKGN+ KDKFS V WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLASLQKKGNVAKDKFSNVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAGIIAATFGMANLVARPFGG+ASD AA++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGIIAATFGMANLVARPFGGYASDVAARYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GG+FC  LG+A  LP+A+  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   FGGVFCMWLGKATKLPIAIAAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFST+K+ST +GL  MGIMI+ CTLPVTLVHFPQWG MF P +K   + TE
Sbjct  421   FGSGLTQLVFFSTTKYSTDTGLFLMGIMIVCCTLPVTLVHFPQWGSMFLPPTKHVEKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW E+EK+KG+HQ S+KFAENSRSERG+R
Sbjct  481   EFYYGSEWTEDEKKKGLHQQSIKFAENSRSERGRR  515



>ref|NP_001274401.1| high affinity nitrate transporter 2.4-like [Cucumis sativus]
 gb|AAS93686.3| high-affinity nitrate transporter [Cucumis sativus]
Length=530

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/515 (84%), Positives = 476/515 (92%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D+EGSPGSSMHGVTGRE   +F+VASPIVPTDTTAKFALPVDSEHKAKVF+++SLANP
Sbjct  1     MGDVEGSPGSSMHGVTGREQTFAFSVASPIVPTDTTAKFALPVDSEHKAKVFRIWSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGV SVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKVDIGNAGVTSVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVS+A GY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSNAAGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQL+MP+LY++I++AGATPF+AWRIAFFIPG+LHV+MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLIMPLLYEVIQRAGATPFTAWRIAFFIPGFLHVLMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL SLQKKGN+ KDKFS V WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLASLQKKGNVAKDKFSNVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAGIIAATFGMANLVARPFGG+ASD AA++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGIIAATFGMANLVARPFGGYASDVAARYFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GG+FC  LG+A  LP+A+  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   FGGVFCMWLGKATKLPIAIAAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFST+K+ST +GL  MGIMI+ CTLPVTLVHFPQWG MF P +K   + TE
Sbjct  421   FGSGLTQLVFFSTTKYSTDTGLFLMGIMIVCCTLPVTLVHFPQWGSMFLPPTKHVEKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW E+EK+KG+HQ S+KFAENSRSERG+R
Sbjct  481   EFYYGSEWTEDEKKKGLHQQSIKFAENSRSERGRR  515



>ref|XP_010111801.1| High affinity nitrate transporter 2.4 [Morus notabilis]
 gb|EXC31766.1| High affinity nitrate transporter 2.4 [Morus notabilis]
Length=556

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/541 (83%), Positives = 478/541 (88%), Gaps = 26/541 (5%)
 Frame = +2

Query  89    MADIEG--SPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  262
             M D EG   PGSSMHGVTGRE   +F+VASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA
Sbjct  1     MGDNEGLGEPGSSMHGVTGREQTFAFSVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  60

Query  263   NPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVM  442
             NPHMRTFHLSWISFFTCF+STFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVM
Sbjct  61    NPHMRTFHLSWISFFTCFISTFAAAPLVPIIRDNLNLKKVDIGNAGVASVSGSIFSRLVM  120

Query  443   GAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTM  622
             GAVCDLLGPRYGCAFLIML+APTVFCMSFVS AGGY+AVRFMIGFSLATFVSCQYWMSTM
Sbjct  121   GAVCDLLGPRYGCAFLIMLSAPTVFCMSFVSDAGGYLAVRFMIGFSLATFVSCQYWMSTM  180

Query  623   FNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVM  802
             FNSKIIGLANGTAAGWGNMGGGATQLLMP++YDIIRKAGATPFSAWR+AFFIPGW H++M
Sbjct  181   FNSKIIGLANGTAAGWGNMGGGATQLLMPLVYDIIRKAGATPFSAWRMAFFIPGWFHIIM  240

Query  803   GILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELST  982
             GILVLTLGQDLPDGNL +LQKKG++ KDKFSKV WYAVTNYRTWIF LLYGYSMGVELST
Sbjct  241   GILVLTLGQDLPDGNLRALQKKGDVAKDKFSKVMWYAVTNYRTWIFVLLYGYSMGVELST  300

Query  983   DNVIAEYFFD------------------------RFDLKLHTAGIIAATFGMANLVARPF  1090
             DNVIAEYF+D                        RF+L LHTAGIIAA+FGMANLVARPF
Sbjct  301   DNVIAEYFYDSLIRNGEPGGPSFRRLRLRRGSDDRFNLNLHTAGIIAASFGMANLVARPF  360

Query  1091  GGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACG  1270
             GG+ASD A + FGMRGRLWTLWILQT GG FC  LGRAN+LP+AV  MI+FSIGAQAACG
Sbjct  361   GGYASDVAGRHFGMRGRLWTLWILQTAGGAFCIWLGRANSLPIAVFAMILFSIGAQAACG  420

Query  1271  ATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTL  1450
             ATFGI PFISRRSLGIISG+TGAGGNFGSGLTQL+FFSTSKFSTA+GLS MG+MIMACTL
Sbjct  421   ATFGIIPFISRRSLGIISGMTGAGGNFGSGLTQLVFFSTSKFSTATGLSLMGVMIMACTL  480

Query  1451  PVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGK  1630
             PVTLVHFPQWG MF P SKD  + TEE YY SEW EEEKQKG+H NS+KFAENSRSERG+
Sbjct  481   PVTLVHFPQWGSMFLPPSKDVAKSTEESYYGSEWTEEEKQKGLHHNSIKFAENSRSERGR  540

Query  1631  R  1633
             R
Sbjct  541   R  541



>gb|KHN21500.1| High affinity nitrate transporter 2.4 [Glycine soja]
Length=519

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/504 (86%), Positives = 474/504 (94%), Gaps = 0/504 (0%)
 Frame = +2

Query  122   MHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWIS  301
             MHGVTGRE     +VASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWIS
Sbjct  1     MHGVTGREQTFVASVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWIS  60

Query  302   FFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGC  481
             FFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRL MGAVCD+LGPRYGC
Sbjct  61    FFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLAMGAVCDMLGPRYGC  120

Query  482   AFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangta  661
             AFLIML+APTVFCMSFV  A GY+AVRF+IGFSLATFVSCQYWMSTMFNSKIIGLANGTA
Sbjct  121   AFLIMLSAPTVFCMSFVKDAAGYIAVRFLIGFSLATFVSCQYWMSTMFNSKIIGLANGTA  180

Query  662   agwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPD  841
             AGWGNMGGGATQL+MP++Y++IR+AGATPF+AWRIAFF+PG++HV+MGILVLTLGQDLPD
Sbjct  181   AGWGNMGGGATQLIMPLVYELIRRAGATPFTAWRIAFFVPGFMHVIMGILVLTLGQDLPD  240

Query  842   GNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFD  1021
             GNLG+L+KKG++ KDKFSKV WYA+TNYRTWIFALLYGYSMGVEL+TDNVIAEYF+DRF+
Sbjct  241   GNLGALRKKGDVAKDKFSKVLWYAITNYRTWIFALLYGYSMGVELTTDNVIAEYFYDRFN  300

Query  1022  LKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGR  1201
             LKLHTAGIIAA+FGMANLVARPFGG+ASD AA+ FGMRGRLWTLWILQT+GG+FC  LGR
Sbjct  301   LKLHTAGIIAASFGMANLVARPFGGYASDVAARLFGMRGRLWTLWILQTLGGVFCIWLGR  360

Query  1202  ANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFF  1381
             AN+LP+AV  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGNFGSGLTQL+FF
Sbjct  361   ANSLPIAVLAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGNFGSGLTQLVFF  420

Query  1382  STSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEE  1561
             STSKFSTA+GLS MG+MI+ACTLPV++VHFPQWG MF P SKD  + TEE YY SEWNEE
Sbjct  421   STSKFSTATGLSLMGVMIVACTLPVSVVHFPQWGSMFLPPSKDVSKSTEEFYYTSEWNEE  480

Query  1562  EKQKGMHQNSLKFAENSRSERGKR  1633
             EKQKG+HQ SLKFAENSRSERGKR
Sbjct  481   EKQKGLHQQSLKFAENSRSERGKR  504



>emb|CAN77058.1| hypothetical protein VITISV_002248 [Vitis vinifera]
Length=523

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/515 (84%), Positives = 473/515 (92%), Gaps = 7/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M++IEGSPGSSMHGVTGRE   +F+VASPIVPTDT+A FALPVDSEHKAKVFK+ S ANP
Sbjct  1     MSNIEGSPGSSMHGVTGREQTFAFSVASPIVPTDTSANFALPVDSEHKAKVFKILSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVFCMSFVSSAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFCMSFVSSAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGGATQL+MP+LY++I + G+TPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGATQLIMPILYEVICRVGSTPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +L +KG         VFWYA+TNYRTWIF LLYGYSMGVELS DN
Sbjct  241   LVLTLGQDLPDGNLSTLAEKGRC-------VFWYAITNYRTWIFVLLYGYSMGVELSIDN  293

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAATFGMANLVARPFGG++SD A + FGMRGRLWTLWILQT
Sbjct  294   VIAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGYSSDLAGRRFGMRGRLWTLWILQT  353

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  M++FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  354   LGGVFCIWLGRANSLPIAVLAMMLFSVGAQAACGATFGIVPFISRRSLGIISGLTGAGGN  413

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+SKFSTA+GLS MG MI+ACTLPVTLVHFPQWG MF P SKD ++GTE
Sbjct  414   FGSGLTQLVFFSSSKFSTATGLSLMGAMIVACTLPVTLVHFPQWGSMFLPPSKDVIKGTE  473

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNEEEKQKGMHQ SLKFAENSRSERGKR
Sbjct  474   EHYYESEWNEEEKQKGMHQGSLKFAENSRSERGKR  508



>ref|XP_004506049.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Cicer 
arietinum]
Length=527

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/515 (85%), Positives = 483/515 (94%), Gaps = 3/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGRE     +V SP VPTDTTAKFALPVDSEHK+KVFKLFSLANP
Sbjct  1     MADIEGSPGSSMHGVTGREQTFISSVTSPTVPTDTTAKFALPVDSEHKSKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+D+GNAGVASVSGSI SRL+MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADVGNAGVASVSGSIFSRLIMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV+ A GY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVNDAAGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP++Y++IR+AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPLVYELIRRAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKGN+ KDKF+KV WYA+TNYRTW+FALLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLAALQKKGNVAKDKFTKVLWYAITNYRTWVFALLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAG+IAA+FGMANLVARPFGG+ASD AA+ FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGVIAASFGMANLVARPFGGYASDAAARLFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRANTLP+AV  MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANTLPIAVVSMILFSVGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSG+TQL+FFS+SKFST++GLS+MG MI+ACTLPVTLVHFPQWG MF P SK+    +E
Sbjct  421   FGSGVTQLVFFSSSKFSTSTGLSWMGAMIVACTLPVTLVHFPQWGSMFCPPSKEV---SE  477

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNEEE QKG+HQ+SLKFAENSRSERGKR
Sbjct  478   EHYYTSEWNEEEVQKGLHQSSLKFAENSRSERGKR  512



>gb|EYU40082.1| hypothetical protein MIMGU_mgv1a004568mg [Erythranthe guttata]
Length=520

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/510 (84%), Positives = 469/510 (92%), Gaps = 3/510 (1%)
 Frame = +2

Query  98    IEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMR  277
             +EGSPG+SMHGVTGREPVL+F+VASP+VPTD TA F LPVDSEHKAK FKLFSLANPHMR
Sbjct  1     MEGSPGTSMHGVTGREPVLAFSVASPMVPTDKTAHFDLPVDSEHKAKKFKLFSLANPHMR  60

Query  278   TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCD  457
             TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGAVCD
Sbjct  61    TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDIGNAGVASVSGSIFSRLVMGAVCD  120

Query  458   LLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKI  637
             LLGPRYGCAFL+M+TAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS+I
Sbjct  121   LLGPRYGCAFLVMMTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSQI  180

Query  638   IGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVL  817
             IGL NGTAAGWGNMGGGATQLLMP+L++II+ AGATPF+AWRIAFFIPGWLH++MG+LVL
Sbjct  181   IGLVNGTAAGWGNMGGGATQLLMPLLFEIIKSAGATPFTAWRIAFFIPGWLHIIMGLLVL  240

Query  818   TLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIA  997
             TLGQDLPDGNL +LQKKG + KDKF KV WYAVTNYRTWIF LLYGYSMGVELSTDNVIA
Sbjct  241   TLGQDLPDGNLSTLQKKGEVAKDKFGKVLWYAVTNYRTWIFVLLYGYSMGVELSTDNVIA  300

Query  998   EYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGG  1177
             EYF+DRFDLKLHTAG+IAATFGMANL+ARPFGGFASDY A+ FGMRGRLWTLW LQTMGG
Sbjct  301   EYFYDRFDLKLHTAGVIAATFGMANLLARPFGGFASDYMARHFGMRGRLWTLWTLQTMGG  360

Query  1178  LFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGS  1357
             +FC LLGRA +LP+A+  MIIFSIGAQAACGATFG+ PFISRRSLGIISGLTGAGGNFGS
Sbjct  361   VFCILLGRATSLPVAIAHMIIFSIGAQAACGATFGVVPFISRRSLGIISGLTGAGGNFGS  420

Query  1358  GLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHY  1537
             GLTQL+FF+ +K ST +GLSYMGIMI+ACTLPV  +HFPQWG MFFP SK  V   EEHY
Sbjct  421   GLTQLLFFTNAKHSTGTGLSYMGIMIVACTLPVAAIHFPQWGSMFFPPSKGVV---EEHY  477

Query  1538  YCSEWNEEEKQKGMHQNSLKFAENSRSERG  1627
             Y  E+ E+E++K MH  ++KFAENSRSERG
Sbjct  478   YIKEYTEDEREKNMHLGNIKFAENSRSERG  507



>emb|CAC35729.1| membrane transporter [Lotus japonicus]
Length=530

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/515 (82%), Positives = 474/515 (92%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M +IEGSPG+SMHGVTGRE     +V+SP+VPTDTTAKF LPVDS+HKAKVFKLFSLANP
Sbjct  1     MVEIEGSPGTSMHGVTGREQTFISSVSSPMVPTDTTAKFDLPVDSQHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HM TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRL MG 
Sbjct  61    HMTTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLTMGV  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CDLLGPRYGCAFLIML+APTVFCMSFV+ A GY+ VRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   ICDLLGPRYGCAFLIMLSAPTVFCMSFVNDAAGYIVVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP++Y++IR+AG+T F+AWRIAFFIPG++HV MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLIMPIVYELIRRAGSTGFTAWRIAFFIPGFMHVFMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++ KDKFSKV WYA+TNYRTWIFALLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLSALQKKGDVAKDKFSKVLWYAITNYRTWIFALLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHT GIIAA+FGMANLVARPFGG+ SD AA+ FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTVGIIAASFGMANLVARPFGGYVSDVAARLFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+AV  MI+FS+GAQAACGATFGI PFIS+RSLGIISGLTGAGGN
Sbjct  361   LGGVFCIWLGRANSLPIAVLAMILFSVGAQAACGATFGIIPFISKRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS+FST +GLS+MG+MI+ CTLPVTLVHFPQWG MF P SKD  + +E
Sbjct  421   FGSGLTQLVFFSTSRFSTGAGLSWMGVMIVGCTLPVTLVHFPQWGSMFLPPSKDINKSSE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY +EW+EEE++KG+H  SLKFAENSRSERGKR
Sbjct  481   EHYYTAEWDEEERKKGLHSQSLKFAENSRSERGKR  515



>ref|XP_011011350.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Populus 
euphratica]
Length=524

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/515 (85%), Positives = 476/515 (92%), Gaps = 6/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA++EGS GSSMHGVTGRE   +F+VASP VPTDTTA FALPVDSEHKAKVFK+FS ANP
Sbjct  1     MANVEGSLGSSMHGVTGREQTFAFSVASPTVPTDTTANFALPVDSEHKAKVFKIFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFV+SAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVNSAGGYLAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQL+MP++Y++I++AG+T FSAWRIAFF PGWLHV+ GI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLVMPLVYELIKRAGSTSFSAWRIAFFFPGWLHVITGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+L+K G++ KDKF KV WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNLGALKKTGDVAKDKFFKVLWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAG+I      ANLVARPFGG++SD AA++FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGVI------ANLVARPFGGYSSDVAARYFGMRGRLWVLWILQT  354

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LPLAVT MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  355   LGGVFCIWLGRANSLPLAVTAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  414

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS+S  STA+GLS+MG+MI  CTLPVTLV+FPQWGGMFFP SKDAV+ TE
Sbjct  415   FGSGLTQLVFFSSSSLSTAAGLSWMGVMICGCTLPVTLVYFPQWGGMFFPPSKDAVKSTE  474

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW+E+EKQKGMHQ SLKFAENSRSERGKR
Sbjct  475   ESYYASEWDEDEKQKGMHQQSLKFAENSRSERGKR  509



>ref|XP_009356899.1| PREDICTED: high affinity nitrate transporter 2.4-like [Pyrus 
x bretschneideri]
Length=527

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/515 (84%), Positives = 470/515 (91%), Gaps = 3/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD EG PGSSMHGVTGRE  LSF+VASPIVPTDTTAKF LPVDSEHKAKVFKLFSLANP
Sbjct  1     MADSEGEPGSSMHGVTGREQTLSFSVASPIVPTDTTAKFDLPVDSEHKAKVFKLFSLANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCF+STFAAAPLVPIIRDN+NL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFISTFAAAPLVPIIRDNINLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDL+GPRYGCAFLIML+APTVFCMSFV+ AGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLIGPRYGCAFLIMLSAPTVFCMSFVADAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMP+++DII + GATPF+AWRIAFFIPGW H++ GI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPLVFDIIGRCGATPFTAWRIAFFIPGWFHIITGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VLTLGQDLPDGNLG+LQKKG + KD+FSKV WYAVTNYRTWIF LLYGYSMGVELS DN
Sbjct  241   MVLTLGQDLPDGNLGALQKKGEVAKDQFSKVLWYAVTNYRTWIFVLLYGYSMGVELSIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DR    L+   +IAA+FGMAN  ARPFGG+ASD A ++FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRLVFLLY---LIAASFGMANFAARPFGGWASDVAGRYFGMRGRLWTLWILQT  357

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LPLAV  MI+FSIGAQAACGATFG+ PFISRRSLGIISGLTGAGGN
Sbjct  358   LGGVFCICLGRANSLPLAVLAMILFSIGAQAACGATFGVIPFISRRSLGIISGLTGAGGN  417

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS FSTASGLS+MG+MI+ CTLPVTLVHFPQWGGMF PASKD  + TE
Sbjct  418   FGSGLTQLVFFSTSAFSTASGLSWMGVMIVCCTLPVTLVHFPQWGGMFLPASKDVEKSTE  477

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY +EW+E EKQKG+HQ SLKFAENSRSERG+R
Sbjct  478   EFYYAAEWSEAEKQKGLHQGSLKFAENSRSERGRR  512



>gb|EYU21096.1| hypothetical protein MIMGU_mgv1a027122mg [Erythranthe guttata]
Length=523

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/513 (83%), Positives = 468/513 (91%), Gaps = 3/513 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHM  274
             +IEGSPG+SMHGVTGREPVL+F+VASP+VPTD TA F LPVDSEHKAK FKLFS ANPHM
Sbjct  4     EIEGSPGTSMHGVTGREPVLAFSVASPMVPTDKTAHFDLPVDSEHKAKKFKLFSFANPHM  63

Query  275   RTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVC  454
             RTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGAVC
Sbjct  64    RTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDIGNAGVASVSGSIFSRLVMGAVC  123

Query  455   DLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSK  634
             DLLGPRYGCAFL+M+TAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS+
Sbjct  124   DLLGPRYGCAFLVMMTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSQ  183

Query  635   IIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILV  814
             IIGL NGTAAGWGNMGGGATQLLMP+L++II+ AGATPF+AWRIAFFIPGWLH++MG+LV
Sbjct  184   IIGLVNGTAAGWGNMGGGATQLLMPLLFEIIKSAGATPFTAWRIAFFIPGWLHIIMGLLV  243

Query  815   LTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVI  994
             LTLGQDLPDGNL +LQKKG + KD+F KV WYAVTNYRTWIF LLYGYSMGVELSTDNVI
Sbjct  244   LTLGQDLPDGNLSTLQKKGEVAKDQFGKVLWYAVTNYRTWIFVLLYGYSMGVELSTDNVI  303

Query  995   AEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMG  1174
             AEYF+DRFDLKLHTAG+IAATFGMANL+ARPFGGFASDY A+ FGMRGRLWTLW LQTMG
Sbjct  304   AEYFYDRFDLKLHTAGVIAATFGMANLLARPFGGFASDYMARHFGMRGRLWTLWTLQTMG  363

Query  1175  GLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFG  1354
             G+FC LLGRA +LP+A+  MIIFSIGAQAACGATFG+ PFISRRSLGIISGLTGAGGNFG
Sbjct  364   GVFCILLGRATSLPVAIAHMIIFSIGAQAACGATFGVVPFISRRSLGIISGLTGAGGNFG  423

Query  1355  SGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEH  1534
             SGLTQL+FF+ +K ST +GLSYMGIMI+ACTLPV  VHFPQWG MF P SK  V   EE 
Sbjct  424   SGLTQLLFFTNAKHSTGTGLSYMGIMIVACTLPVAFVHFPQWGSMFLPPSKGVV---EEQ  480

Query  1535  YYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             YY  E++E+E++K MH  ++KFAEN RSERG R
Sbjct  481   YYIKEYSEDEREKNMHLGNIKFAENCRSERGNR  513



>ref|XP_002276817.1| PREDICTED: high affinity nitrate transporter 2.4 [Vitis vinifera]
Length=531

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/515 (82%), Positives = 473/515 (92%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADI+GSPGSSMHGVTGRE   +F+VASP +PTDTTAKFALPVDSEHKAKVFK+FS A P
Sbjct  1     MADIQGSPGSSMHGVTGREQTFAFSVASPAIPTDTTAKFALPVDSEHKAKVFKVFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSW+SFFTCFVSTFAAAPLVP+IRDNLNL KSDIGNAG+ASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWVSFFTCFVSTFAAAPLVPVIRDNLNLRKSDIGNAGIASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+AP VFCMSFVSSA GY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLMMLSAPAVFCMSFVSSAEGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQLLMPV+++II + G TPF AWR+AFFIPG LHV+MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLLMPVIFEIICRVGVTPFMAWRVAFFIPGCLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL+LGQDLPDGNLG+LQKKG+++KDKFSKV WYA+TNYRTWIF LLYG+S+GVEL+ DN
Sbjct  241   LVLSLGQDLPDGNLGTLQKKGDVSKDKFSKVLWYAITNYRTWIFVLLYGFSLGVELTADN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAG IAATFGMAN+VARP GG  SD AA+ FGMRGRLW LWILQT
Sbjct  301   VIAEYFYDRFDLKLHTAGTIAATFGMANIVARPMGGLMSDLAARRFGMRGRLWNLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP++++ MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGVFCICLGRANSLPISISSMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQ +FF++SK+STA+G+S MGIMI+ACTLPV LVHFPQWG M  P SKDAVR  E
Sbjct  421   FGSGLTQWLFFTSSKYSTATGISLMGIMIVACTLPVALVHFPQWGSMLLPPSKDAVRSCE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNE EKQKG+HQ SLKFAENS+SERG+R
Sbjct  481   EYYYGSEWNEAEKQKGLHQGSLKFAENSKSERGRR  515



>gb|EYU21100.1| hypothetical protein MIMGU_mgv1a025562mg [Erythranthe guttata]
Length=520

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/510 (84%), Positives = 467/510 (92%), Gaps = 3/510 (1%)
 Frame = +2

Query  98    IEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMR  277
             +EGSPG+SMHGVTGREPVL+F+VASP+VPTD TA F LPVDSEHKAK FKLFS ANPHMR
Sbjct  1     MEGSPGTSMHGVTGREPVLAFSVASPMVPTDNTAHFDLPVDSEHKAKKFKLFSFANPHMR  60

Query  278   TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCD  457
             TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGAVCD
Sbjct  61    TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDIGNAGVASVSGSIFSRLVMGAVCD  120

Query  458   LLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKI  637
             LLGPRYGCAFL+M+TAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS+I
Sbjct  121   LLGPRYGCAFLVMMTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSQI  180

Query  638   IGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVL  817
             IGL NGTAAGWGNMGGGATQLLMP+L++II+ AGATPF+AWRIAFFIPGWLH++MG+LVL
Sbjct  181   IGLVNGTAAGWGNMGGGATQLLMPLLFEIIKSAGATPFTAWRIAFFIPGWLHIIMGLLVL  240

Query  818   TLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIA  997
             TLGQDLPDGNL +LQKKG + KD+F KV WYAVTNYRTWIF LLYGYSMGVELSTDNVIA
Sbjct  241   TLGQDLPDGNLSTLQKKGEVAKDQFGKVLWYAVTNYRTWIFVLLYGYSMGVELSTDNVIA  300

Query  998   EYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGG  1177
             EYF+DRFDLKLHTAG+IAATFGMANL+ARPFGGFASDY A+ FGMRGRLWTLW LQTMGG
Sbjct  301   EYFYDRFDLKLHTAGVIAATFGMANLLARPFGGFASDYMARHFGMRGRLWTLWTLQTMGG  360

Query  1178  LFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGS  1357
             +FC LLGRA +LP+A+  MIIFSIGAQAACGATFG+ PFISRRSLGIISGLTGAGGNFGS
Sbjct  361   VFCILLGRATSLPVAIAHMIIFSIGAQAACGATFGVVPFISRRSLGIISGLTGAGGNFGS  420

Query  1358  GLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHY  1537
             GLTQL+FF+ +K ST +GLSYMGIMI+ACTLPV  +HFPQWG MFFP SK  V   EEHY
Sbjct  421   GLTQLLFFTNAKHSTGTGLSYMGIMIVACTLPVAAIHFPQWGSMFFPPSKGVV---EEHY  477

Query  1538  YCSEWNEEEKQKGMHQNSLKFAENSRSERG  1627
             Y  E+ E+E++K MH  ++KFAEN RSERG
Sbjct  478   YIKEYTEDEREKNMHLGNIKFAENCRSERG  507



>ref|XP_010907042.1| PREDICTED: high affinity nitrate transporter 2.4-like [Elaeis 
guineensis]
Length=603

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/515 (83%), Positives = 466/515 (90%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+  G+PGSSMHGVTGREP L+F+V SP VPTDT AKF LPVDSEHKAK FKL S A P
Sbjct  1     MAEGIGAPGSSMHGVTGREPTLAFSVTSPSVPTDTGAKFDLPVDSEHKAKAFKLLSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCF+STFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFISTFAAAPLVPIIRDNLNLTKGDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMS VSSAGGY+ +RF+IGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSLVSSAGGYIIIRFLIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQLLMP++YD+IRKAGATPF+AWRIAFFIPG +HVVMGI
Sbjct  181   SKIIGLANGTAAGWGNMGGGATQLLMPLVYDVIRKAGATPFTAWRIAFFIPGLMHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKG++NKDKFS+V  YA+TNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLGALQKKGDVNKDKFSQVLRYAITNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRFDL L TAGIIAA FGMAN  ARPFGG+ SD  A+ FGMR RLW LWILQT
Sbjct  301   VIAEYFFDRFDLNLRTAGIIAACFGMANFAARPFGGYMSDLGARRFGMRARLWNLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LG A +LP++V  MI+FSI AQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGAFCLWLGLAQSLPISVFAMILFSICAQAACGATFGIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++S++ST++GL  MG+MIMACTLPVTLVHFPQWG MF P S DA++ TE
Sbjct  421   FGSGLTQLLFFTSSRYSTSTGLVLMGVMIMACTLPVTLVHFPQWGSMFLPPSTDAMKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNEEEKQKGMHQ SL+FAENSRSERG+R
Sbjct  481   EYYYASEWNEEEKQKGMHQASLRFAENSRSERGRR  515



>gb|AEV89747.1| nitrate transporter 2.1 [Chrysanthemum x morifolium]
Length=530

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/515 (83%), Positives = 463/515 (90%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M DIEGSPGSSMHGVTGREPVL+F+V SP+V TD TAKF LPVDSEHKA VFKLFS ANP
Sbjct  1     MPDIEGSPGSSMHGVTGREPVLAFSVQSPVVHTDRTAKFDLPVDSEHKATVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFT F+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTTFISTFAAAPLVPIIRDNLDLTKADIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML APTVFCMSFVS A GY+ VRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLAAPTVFCMSFVSDASGYIIVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMPV+++II+KAGA+PF AWRIAFFIPGW +V+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPVMFEIIQKAGASPFVAWRIAFFIPGWFNVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQK G++ KDKFSKV WYAVTNYRTWIF LLYGYSMGVEL+ DN
Sbjct  241   LVLTLGQDLPDGNLGALQKNGDVAKDKFSKVLWYAVTNYRTWIFVLLYGYSMGVELTIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLH AGIIAA FGMANL+ARPFGGF SDY AK FGMRGRLW LW+LQT
Sbjct  301   VIAEYFYDRFDLKLHLAGIIAACFGMANLLARPFGGFTSDYMAKRFGMRGRLWNLWLLQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GG+ C  LGR N+L LA+T+M++FSIGAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   AGGVCCVFLGRVNSLTLAITFMMLFSIGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFF+ +  ST  GL+YMGIMI+  TLPVTLVHFPQWG MFFP S   V+GTE
Sbjct  421   FGSGLTQLIFFANASLSTPDGLTYMGIMIICATLPVTLVHFPQWGSMFFPPSTHIVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY +EW EEEK KGMHQ S+KFAENSRSERG +
Sbjct  481   EHYYEAEWTEEEKNKGMHQASIKFAENSRSERGGK  515



>ref|XP_008776882.1| PREDICTED: high affinity nitrate transporter 2.4-like [Phoenix 
dactylifera]
Length=531

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/515 (83%), Positives = 465/515 (90%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+  G+PGSSMHGVTGREP L+F+V SP VPTDT AKF LPVDSEHKAK FKLFS ANP
Sbjct  1     MAEGIGAPGSSMHGVTGREPTLAFSVTSPSVPTDTGAKFDLPVDSEHKAKAFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGC FLIML+APTVF MS VSSAGGY+ +RF+IGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCVFLIMLSAPTVFGMSMVSSAGGYITIRFLIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKI+GLANGTAAGWGNMGGGATQLLMP++YD+IRK GATPF+AWRIAFFIPG +HVVMGI
Sbjct  181   SKIVGLANGTAAGWGNMGGGATQLLMPLVYDVIRKIGATPFTAWRIAFFIPGLMHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKG+INKDKFSKV WYA+TNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLGTLQKKGDINKDKFSKVLWYAITNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEY+FDRFDL L TAGIIAA FGMAN  ARPFGG+ SD  A+ FGMR RLW LWILQT
Sbjct  301   VIAEYYFDRFDLDLRTAGIIAACFGMANFAARPFGGYTSDLGARRFGMRARLWNLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LG A +LP+++  MI+FSI AQAACGATFGI PF+SRRSLGIISGL+GAGGN
Sbjct  361   LGGAFCLWLGLAESLPISILAMILFSICAQAACGATFGIIPFVSRRSLGIISGLSGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
              GSGLTQL+FF++S++ST++GL  MG+MIMACTLPVTLVHFPQWG MF P S DA++ TE
Sbjct  421   LGSGLTQLLFFTSSRYSTSTGLVLMGVMIMACTLPVTLVHFPQWGSMFLPPSSDAMKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNEEEKQKGMHQ SLKFAENSRSERG+R
Sbjct  481   EHYYGSEWNEEEKQKGMHQASLKFAENSRSERGRR  515



>ref|XP_009110907.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Brassica 
rapa]
Length=530

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/515 (81%), Positives = 460/515 (89%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTDTTAKF LPVD+EHKAKVFKLFS ANP
Sbjct  1     MGDPSGEPGSSMHGVTGREQSFAFSVASPIVPTDTTAKFDLPVDTEHKAKVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVADAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAG GNMGGG TQLLMPV+Y+IIR+ GAT F+AWR+AFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGGGNMGGGITQLLMPVVYEIIRRCGATAFTAWRLAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AA +FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDIAATYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  A+  MI+FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAIVAMILFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPVTL+HFPQWG MF P SKD V+GTE
Sbjct  421   FGSGLTQLIFFSTSQFTTEQGLTWMGVMIVACTLPVTLIHFPQWGSMFLPPSKDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EKQK MHQ SL+FAENS+SE G+R
Sbjct  481   EHYYASEWNEQEKQKNMHQGSLRFAENSKSEGGRR  515



>gb|AEZ68614.1| high-affinity nitrate transporter [Brassica juncea]
Length=530

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/515 (81%), Positives = 461/515 (90%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTDTTAKF LPVD+EHKAKVFKLFS ANP
Sbjct  1     MGDPSGEPGSSMHGVTGREQSFAFSVASPIVPTDTTAKFDLPVDTEHKAKVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVADAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+ GAT F+AWR+AFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRCGATAFTAWRLAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AA +FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDIAATYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  A+  MI+FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAIVAMILFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPVTL+HFPQWG MF P SKD V+GTE
Sbjct  421   FGSGLTQLIFFSTSQFTTEQGLTWMGVMIVACTLPVTLIHFPQWGSMFLPPSKDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EKQK MHQ SL+FAENS+SE G+R
Sbjct  481   EHYYASEWNEQEKQKNMHQGSLRFAENSKSEGGRR  515



>dbj|BAP74415.1| nitrate transporter [Chrysanthemum sp. CSG-2014]
Length=530

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/515 (82%), Positives = 461/515 (90%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M ++EGSPGSSMHGVTGREPVL+F+V SP+V TD  AKF LPVDSEHKA VFKLFS ANP
Sbjct  1     MPEVEGSPGSSMHGVTGREPVLTFSVQSPMVQTDHNAKFDLPVDSEHKATVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFT F+STFAAAPLVPIIRDN +L K+DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTTFISTFAAAPLVPIIRDNHDLTKADIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML APTVFCMSF S A GY+ VRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLAAPTVFCMSFASDATGYIIVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGGATQLLMPVL++II+KAGA+PF AWRIAFFIPGWL+V+MGI
Sbjct  181   SKIIGLVNGTAAGWGNMGGGATQLLMPVLFEIIKKAGASPFVAWRIAFFIPGWLNVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKG++ KDKF KV WYAVTNYRTWIF LLYGYSMGVEL+ DN
Sbjct  241   LVLTLGQDLPDGNLGALQKKGDVAKDKFGKVLWYAVTNYRTWIFVLLYGYSMGVELTIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLH AGI+AA FGMANL+ARPFGGF SDY AK FGMRGRLW LW+LQT
Sbjct  301   VIAEYFYDRFELKLHLAGIVAACFGMANLLARPFGGFTSDYMAKRFGMRGRLWNLWLLQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GG+ C  LG  N+LPLA+T+M++FSIGAQAACGATFGI PFISRRSLGIISG+TGAGGN
Sbjct  361   AGGVCCVFLGIVNSLPLAITFMMLFSIGAQAACGATFGIIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFF+ +  ST  GL+YMGIMI+  TLPV LVHFPQWG MFFP S   V+GTE
Sbjct  421   FGSGLTQLIFFANASLSTPDGLTYMGIMIICATLPVALVHFPQWGSMFFPPSTHIVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEW EEE++KGMHQ S+KFAENSR+ERG +
Sbjct  481   EHYYVSEWTEEEREKGMHQASVKFAENSRTERGGK  515



>ref|XP_009413146.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Musa acuminata 
subsp. malaccensis]
Length=530

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/515 (82%), Positives = 463/515 (90%), Gaps = 1/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+  G PGSSMHGVTGREP L+F   SP VPTD TAKFALPVDSEHKAK FKLFS ANP
Sbjct  1     MAEGVGEPGSSMHGVTGREPTLAFET-SPSVPTDATAKFALPVDSEHKAKAFKLFSFANP  59

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSG+I SRL+MGA
Sbjct  60    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLKKGDIGNAGVASVSGAIFSRLMMGA  119

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMS VSSAGGY+ +RF+IGFSLATFVSCQYWMSTMFN
Sbjct  120   VCDLLGPRYGCAFLIMLSAPTVFCMSLVSSAGGYITMRFLIGFSLATFVSCQYWMSTMFN  179

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGLANGTAAGWGNMGGGATQL+MP++YDIIRKAGATPF AWRIAFFIPG +HV+MGI
Sbjct  180   SQIIGLANGTAAGWGNMGGGATQLIMPLVYDIIRKAGATPFLAWRIAFFIPGLMHVIMGI  239

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGNL +LQKKGN+ KDKFSKV WYAVTNYRTWIF LLYGYSMGVEL+TDN
Sbjct  240   LVLVLGQDLPDGNLSTLQKKGNVAKDKFSKVLWYAVTNYRTWIFVLLYGYSMGVELTTDN  299

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDL L TAGIIAA FGMAN+VARPFGGF SD+ A+ +GMR RLW LWILQT
Sbjct  300   VIAEYFYDRFDLNLRTAGIIAACFGMANIVARPFGGFVSDFGARRYGMRARLWNLWILQT  359

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRAN+LP+++  M+ FSI AQAACGATFGI PFISRRSLGIISG++GAGGN
Sbjct  360   LGGAFCLWLGRANSLPISIFAMVCFSICAQAACGATFGIIPFISRRSLGIISGMSGAGGN  419

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF+++K+STA+GLS MG+MIMACTLP   VHFPQWG MF P S DA + TE
Sbjct  420   FGSGLTQLLFFTSTKYSTATGLSLMGVMIMACTLPTAFVHFPQWGSMFLPPSNDAAKSTE  479

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEW++ E++KGMHQ SLKFAENSRSERGKR
Sbjct  480   ENYYVSEWSKAEREKGMHQASLKFAENSRSERGKR  514



>gb|AFK74855.1| high-affinity nitrate transporter [Brassica rapa subsp. oleifera]
 gb|AHL44962.1| NRT2.2 [Brassica rapa subsp. chinensis]
Length=530

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/515 (80%), Positives = 456/515 (89%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQTFAFSVASPIVPTDKTAKFDLPVDSEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV  AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVHDAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ GAT F+AWRIAFF+PGWLH++MG+
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRCGATAFTAWRIAFFVPGWLHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLNLGQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDLAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  MI+FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMILFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPVTL+HFPQWG MF P S D V+GTE
Sbjct  421   FGSGLTQLIFFSTSRFTTEQGLTWMGVMIVACTLPVTLIHFPQWGSMFLPPSTDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EK+K MHQ SL+FA+N++SE G+R
Sbjct  481   EHYYASEWNEQEKEKNMHQGSLRFAKNAKSEGGRR  515



>ref|XP_010542581.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Tarenaya 
hassleriana]
Length=530

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/515 (81%), Positives = 455/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D    PGSSMHGVTG+E   +F+VASP VPTDTTAKF LPVDSEHKAKVFKLFS ANP
Sbjct  1     MGDSVDEPGSSMHGVTGKEQSFAFSVASPAVPTDTTAKFDLPVDSEHKAKVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMPV+Y+II+  G+TPF+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGVTQLLMPVVYEIIKSCGSTPFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGN   L+KKGN+ KDKFSK+ WYAVTNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   LVLALGQDLPDGNRSVLEKKGNVTKDKFSKIMWYAVTNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAATFGMAN  ARP GG+ SD AA++FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAATFGMANFFARPLGGYFSDIAARYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRAN L  A+  MI FS+GAQAACGATF I PFISRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANKLVPAIVSMIFFSLGAQAACGATFAIVPFISRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS+FST  GL++MG++I+ACTLPV LVHFPQWG MF PAS D V+GTE
Sbjct  421   FGSGLTQLVFFSTSRFSTEEGLTWMGVLIVACTLPVALVHFPQWGSMFLPASSDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY +EW E+EK+K MHQ SL+FAEN RSERG R
Sbjct  481   EYYYVAEWTEKEKEKNMHQGSLRFAENCRSERGPR  515



>gb|AFK65609.1| high-affinity nitrate transporter [Brassica rapa subsp. chinensis]
Length=530

 Score =   839 bits (2167),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/515 (80%), Positives = 456/515 (89%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQTFAFSVASPIVPTDKTAKFDLPVDSEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ GAT F+AWR+AFF+PGWLH++MG+
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRCGATAFTAWRLAFFVPGWLHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLNLGQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAACFGMANFFARPAGGYASDLAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPVTL+HFPQWG MF P S D V+GTE
Sbjct  421   FGSGLTQLIFFSTSRFTTEQGLTWMGVMIVACTLPVTLIHFPQWGSMFLPPSTDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EK+K MHQ SL+FA+N++SE G+R
Sbjct  481   EHYYASEWNEQEKEKNMHQGSLRFAKNAKSEGGRR  515



>ref|XP_009118394.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Brassica 
rapa]
Length=529

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/515 (80%), Positives = 454/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQTFAFSVASPIVPTDKTAKFDLPVDSEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ GAT F+AWR+AFF+PGWLH++MG+
Sbjct  181   SQIIGLVNGTAAGWGNMGGGVTQLLMPIVYEIIRRCGATAFTAWRLAFFVPGWLHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLNLGQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAACFGMANFFARPAGGYASDLAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPVTL HFPQWG MF P S D V+GTE
Sbjct  421   FGSGLTQLIFFSTSRFTTEQGLTWMGVMIVACTLPVTLCHFPQWGSMFLPPSTDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EKQK +HQ SL+FAEN++SE G R
Sbjct  481   EHYYASEWNEQEKQKNLHQGSLRFAENAKSEGGPR  515



>ref|XP_006307224.1| hypothetical protein CARUB_v10008824mg [Capsella rubella]
 gb|EOA40122.1| hypothetical protein CARUB_v10008824mg [Capsella rubella]
Length=530

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/515 (80%), Positives = 456/515 (89%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIV TD TAKF LPVDSEHKA VFKLFS + P
Sbjct  1     MGDTTGEPGSSMHGVTGREQSFAFSVASPIVHTDKTAKFDLPVDSEHKATVFKLFSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR++G+T F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRSGSTAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAALEKAGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD+AAK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGYASDFAAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI+ CTLPVTL+HFPQWG MF P SKD V+GTE
Sbjct  421   FGSGLTQLIFFSTSTFTTEQGLTWMGVMIVGCTLPVTLIHFPQWGSMFLPPSKDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EKQK MHQ SL+FAEN++SE G+R
Sbjct  481   EHYYASEWNEQEKQKNMHQGSLRFAENAKSEGGRR  515



>ref|XP_002519504.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF42918.1| nitrate transporter, putative [Ricinus communis]
Length=532

 Score =   836 bits (2160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/512 (80%), Positives = 466/512 (91%), Gaps = 1/512 (0%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFAVAS-PIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMR  277
             E SPGSSMHGV+G+E   +F+V + P +PTDTTAKF+LPVDSEHKAKVF L SLANPHM 
Sbjct  6     EMSPGSSMHGVSGKEQTFAFSVTNDPEIPTDTTAKFSLPVDSEHKAKVFNLLSLANPHMT  65

Query  278   TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCD  457
             TFHLSW+SFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAG+ASVSGSI SRLVMGA CD
Sbjct  66    TFHLSWLSFFTCFVSTFAAAPLVPIIRDNLNLTKKDIGNAGIASVSGSIFSRLVMGAACD  125

Query  458   LLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKI  637
             LLGPRY CAFLIML+APTVFCM+FVSSAGGYVAVRFMIGFSLATFVSCQ+WMSTMFN KI
Sbjct  126   LLGPRYACAFLIMLSAPTVFCMTFVSSAGGYVAVRFMIGFSLATFVSCQFWMSTMFNGKI  185

Query  638   IGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVL  817
             IG+ NGTAAGWGNMGGGATQLLMP+LY++I++AGATPF+AWRIAFFIPGWLHV+MGILVL
Sbjct  186   IGVVNGTAAGWGNMGGGATQLLMPLLYELIKRAGATPFTAWRIAFFIPGWLHVIMGILVL  245

Query  818   TLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIA  997
             +LGQDLPDGNL +LQKKG++ KDKFSKV WYA+TNYRTW+F LLYG S+GVEL+TDNVIA
Sbjct  246   SLGQDLPDGNLSTLQKKGDVPKDKFSKVLWYAITNYRTWVFFLLYGMSLGVELTTDNVIA  305

Query  998   EYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGG  1177
             EYFFDRFDLKL TAG IAA FGMAN+ ARP GG  SD AA+ FGMRGRLW L+ILQT+GG
Sbjct  306   EYFFDRFDLKLRTAGTIAAIFGMANIFARPMGGLMSDIAARRFGMRGRLWNLYILQTLGG  365

Query  1178  LFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGS  1357
             +FC  LGR ++LPL+V +MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGNFGS
Sbjct  366   IFCICLGRVSSLPLSVLFMILFSLGAQAACGATFGIIPFISRRSLGIISGLTGAGGNFGS  425

Query  1358  GLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHY  1537
             GLTQL+FF++S ++TA+GLS MGIMI+ACTLPVTLVHFPQWG MF PA+K+  + +EE+Y
Sbjct  426   GLTQLLFFTSSTYTTATGLSLMGIMIVACTLPVTLVHFPQWGSMFLPATKNVEKCSEEYY  485

Query  1538  YCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             Y SEWN+EEK+KG+HQ SLKFAENSRSERG+R
Sbjct  486   YASEWNQEEKEKGLHQGSLKFAENSRSERGRR  517



>ref|XP_009382134.1| PREDICTED: high affinity nitrate transporter 2.4-like [Musa acuminata 
subsp. malaccensis]
Length=531

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/515 (80%), Positives = 461/515 (90%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+  G PGSSMHGVTGREP L+F V SP VPTDTTAKFALPVDSEHKAK FKLFS A P
Sbjct  1     MAEGVGEPGSSMHGVTGREPTLAFEVTSPSVPTDTTAKFALPVDSEHKAKAFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSW+SFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSG+I SRL+MGA
Sbjct  61    HMRTFHLSWVSFFTCFVSTFAAAPLVPIIRDNLNLKKGDIGNAGVASVSGAIFSRLLMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVF M+ VSSAGG++ +RF+IGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFGMALVSSAGGFITMRFLIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGLANGTAAGWGNMGGGATQLLMP++YD+IRKAGATPF+AWRI+FF+PG +HVVMGI
Sbjct  181   SQIIGLANGTAAGWGNMGGGATQLLMPLVYDLIRKAGATPFTAWRISFFVPGLMHVVMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGNL +LQKKG++ KDKFSKV WYA+TNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   LVLVLGQDLPDGNLSTLQKKGDVAKDKFSKVLWYAITNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDL L TAGIIAA FGMAN++ARP GGF SD+ A+ +GMR RLW LWILQT
Sbjct  301   VIAEYFYDRFDLDLRTAGIIAACFGMANILARPIGGFTSDFGARRYGMRARLWNLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRA +LP+++  M+ FSI AQAACGATFG+ PFISRRSLGIISG+TGAGGN
Sbjct  361   LGGAFCLWLGRAESLPVSIFAMVCFSICAQAACGATFGVIPFISRRSLGIISGMTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF+++K+ST +GLS MG+MIMACTLP T VHFPQWG MF P S D V  TE
Sbjct  421   FGSGLTQLLFFTSTKYSTGTGLSLMGVMIMACTLPTTFVHFPQWGSMFLPPSSDVVTSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEW++ E+++GMHQ SLKFAENSRSERGKR
Sbjct  481   EHYYASEWSKAERERGMHQASLKFAENSRSERGKR  515



>ref|XP_002864702.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40961.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=530

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/515 (79%), Positives = 460/515 (89%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD  G PGSSMHGVTGRE   +F+V SP+VP+DT+AKF+LPVD+EHKAKVFKL S   P
Sbjct  1     MADGFGEPGSSMHGVTGREQSYAFSVESPVVPSDTSAKFSLPVDTEHKAKVFKLLSFEAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV++AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVANAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGW+H++MGI
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPMVYEIIRRLGSTSFTAWRMAFFVPGWMHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKFSKV WYA+TNYRTW+F LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNRSTLEKKGAVTKDKFSKVLWYAITNYRTWVFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AA+ FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPIGGWASDIAARRFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRA TLP AV +MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGFFCLWLGRATTLPTAVVFMILFSLGAQAACGATFAIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS FST  GL++MG+MIMACTLPVTLVHFPQWG MF P+++D V+ TE
Sbjct  421   FGSGLTQLVFFSTSTFSTEQGLTWMGVMIMACTLPVTLVHFPQWGSMFLPSTEDEVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY  EW E EKQKGMH+ SLKFA NSRSERG+R
Sbjct  481   EYYYMKEWTEPEKQKGMHEGSLKFAVNSRSERGRR  515



>emb|CBI17171.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/515 (81%), Positives = 457/515 (89%), Gaps = 25/515 (5%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M++IEGSPGSSMHGVTGRE   +F+VASPIVPTDT+A FALPVDSEHKAKVFK+ S ANP
Sbjct  1     MSNIEGSPGSSMHGVTGREQTFAFSVASPIVPTDTSANFALPVDSEHKAKVFKILSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVFCMSFVSSAGGY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFCMSFVSSAGGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGGATQL+MP+LY++I + G+TPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGATQLIMPILYEVICRVGSTPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++++DKFS+VFWYA+TNYRTWIF LLYGYSMGVELS DN
Sbjct  241   LVLTLGQDLPDGNLSTLQKKGDVSRDKFSRVFWYAITNYRTWIFVLLYGYSMGVELSIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAATFGMANLVARPFGG++SD A + FGMRGRLWTLWILQT
Sbjct  301   VIAEYFYDRFNLKLHTAGIIAATFGMANLVARPFGGYSSDLAGRRFGMRGRLWTLWILQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+L +AV  M++FS+GAQAACGATFGI PFISRRSLGIISGLT     
Sbjct  361   LGGVFCIWLGRANSLSIAVLAMMLFSVGAQAACGATFGIVPFISRRSLGIISGLT-----  415

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
                                 GLS MG MI+ACTLPVTLVHFPQWG MF P SKD V+GTE
Sbjct  416   --------------------GLSLMGAMIVACTLPVTLVHFPQWGSMFLPPSKDVVKGTE  455

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNEEEKQKGMHQ SLKFAENSRSERG+R
Sbjct  456   EHYYESEWNEEEKQKGMHQGSLKFAENSRSERGQR  490



>ref|XP_009595617.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Nicotiana 
tomentosiformis]
Length=533

 Score =   834 bits (2155),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/518 (81%), Positives = 464/518 (90%), Gaps = 3/518 (1%)
 Frame = +2

Query  89    MADIE--GSPGSSMHGVTGREPVLSFAVAS-PIVPTDTTAKFALPVDSEHKAKVFKLFSL  259
             MAD    GSPGSSMHGVTG+E   +F+V S P +PTDTTAKFALPVDSEHKAKVFK+FS 
Sbjct  1     MADQNSTGSPGSSMHGVTGKEQTFAFSVKSDPKIPTDTTAKFALPVDSEHKAKVFKIFSF  60

Query  260   ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLV  439
             A PHM TFHLSW SFFTCF+STFAAAPLVPIIRDNLNL KSDIGNAG+ASVSGSI SRLV
Sbjct  61    AKPHMTTFHLSWTSFFTCFISTFAAAPLVPIIRDNLNLKKSDIGNAGIASVSGSIFSRLV  120

Query  440   MGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMST  619
             MGAVCDLLGPRYGCAFL+MLTAPTVFCMSFVSSAGGYV VRFMIGFSLATFVSCQYWMST
Sbjct  121   MGAVCDLLGPRYGCAFLMMLTAPTVFCMSFVSSAGGYVVVRFMIGFSLATFVSCQYWMST  180

Query  620   MFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVV  799
             MFNSKIIGL NGTAAGWGNMGGG TQLLMP+LY++IR+AGATPF+AWRIAFF+PGWL V+
Sbjct  181   MFNSKIIGLVNGTAAGWGNMGGGVTQLLMPLLYELIRRAGATPFTAWRIAFFVPGWLQVI  240

Query  800   MGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             MG+LVL LGQDLPDGNLG+LQKKG++ KDKFSKV WYAVTNYRTWIF LLYG S+GVEL+
Sbjct  241   MGLLVLGLGQDLPDGNLGTLQKKGDVPKDKFSKVLWYAVTNYRTWIFVLLYGMSLGVELT  300

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
             TDNVIAEYFFDRF+LKL TAG IAATFGMANLVARP GG  SD AAK FGMRGRLW LWI
Sbjct  301   TDNVIAEYFFDRFNLKLRTAGTIAATFGMANLVARPLGGLMSDIAAKRFGMRGRLWNLWI  360

Query  1160  LQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGA  1339
             LQT GG+FC LLG++N L +++  MI+FSIGAQAA GATFGI PFISRRSLGIISGLTGA
Sbjct  361   LQTFGGVFCILLGKSNKLSISILSMILFSIGAQAAAGATFGIIPFISRRSLGIISGLTGA  420

Query  1340  GGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVR  1519
             GGNFGSGLTQL+FF+ + +ST++GLS+MG+MI+ CTLPVTLVHFPQWG MF P SK+  +
Sbjct  421   GGNFGSGLTQLLFFTRANYSTSTGLSFMGVMIVVCTLPVTLVHFPQWGSMFLPPSKNVGK  480

Query  1520  GTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +EE+YY  EWNEEEK KG+H+ SLKFA+NSRSERG+R
Sbjct  481   FSEEYYYGLEWNEEEKLKGLHEGSLKFAKNSRSERGRR  518



>gb|EYU36161.1| hypothetical protein MIMGU_mgv1a004332mg [Erythranthe guttata]
Length=532

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/511 (83%), Positives = 467/511 (91%), Gaps = 0/511 (0%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRT  280
             +GSPGSSMHGV+G+E   +F+V+   VPT+ TAKF LPVDSEHKA VFKLFS A PHMRT
Sbjct  6     QGSPGSSMHGVSGKEQTYAFSVSQSTVPTEKTAKFNLPVDSEHKATVFKLFSFAKPHMRT  65

Query  281   FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDL  460
             FHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRL MG VCDL
Sbjct  66    FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLAMGVVCDL  125

Query  461   LGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKII  640
             LGPRYGCAFLI+L+APTVFCM+FVSSAGGY+AVRFMIGFSLATFVSCQYWMSTMFNSKII
Sbjct  126   LGPRYGCAFLILLSAPTVFCMTFVSSAGGYLAVRFMIGFSLATFVSCQYWMSTMFNSKII  185

Query  641   GLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLT  820
             GL NGTAAGWGNMGGGATQL+MP+LY++IRKAG+TPF+AWRIAFFIPGWLHV+MGILV+T
Sbjct  186   GLVNGTAAGWGNMGGGATQLIMPLLYEMIRKAGSTPFTAWRIAFFIPGWLHVIMGILVMT  245

Query  821   LGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAE  1000
             LGQDLPDGNLG+L+KKG +  DKFSKVFW A+TNYRTWIF LLYGYSMGVEL+TDNV+AE
Sbjct  246   LGQDLPDGNLGTLKKKGTVATDKFSKVFWNAITNYRTWIFVLLYGYSMGVELTTDNVVAE  305

Query  1001  YFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGL  1180
             YF+DRFDL LHTAG IAATFGMAN+VARPFGGFASDYAA+ FGMRGRLW LW LQT+GG+
Sbjct  306   YFYDRFDLNLHTAGTIAATFGMANIVARPFGGFASDYAARRFGMRGRLWVLWTLQTLGGV  365

Query  1181  FCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSG  1360
             FC +LGRAN LP A+  MI+FS+GAQAACGATFGI PFISRRSLGIISG+TGAGGNFGSG
Sbjct  366   FCIMLGRANVLPFAIAMMILFSVGAQAACGATFGIIPFISRRSLGIISGMTGAGGNFGSG  425

Query  1361  LTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYY  1540
             LTQL+FF+ S+FSTA+GLSYMGIMI+ CT PVT V+FPQWGGMF   SKD V+GTEE YY
Sbjct  426   LTQLVFFAGSQFSTATGLSYMGIMIVCCTFPVTAVYFPQWGGMFCGPSKDGVKGTEEDYY  485

Query  1541  CSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EWNEEEK+KGMH +SLKFAENSRSERG+R
Sbjct  486   GKEWNEEEKKKGMHASSLKFAENSRSERGRR  516



>ref|XP_011094630.1| PREDICTED: high affinity nitrate transporter 2.4-like [Sesamum 
indicum]
Length=529

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/511 (81%), Positives = 462/511 (90%), Gaps = 4/511 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVA-SPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRT  280
             GSPGSSMHGVTG+E   +F+ A    VPTD+TA+FALPVDSEHKA VFK++S ANPHMR 
Sbjct  7     GSPGSSMHGVTGKEQSFAFSAARDQTVPTDSTAQFALPVDSEHKATVFKIYSFANPHMRA  66

Query  281   FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDL  460
             FHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAG+ASVSGSI SRLVMGA CDL
Sbjct  67    FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKRDIGNAGIASVSGSIFSRLVMGAACDL  126

Query  461   LGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKII  640
             LGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQ+WMSTMFN KII
Sbjct  127   LGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQFWMSTMFNGKII  186

Query  641   GLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLT  820
             GL NGTAAGWGNMGGGATQLLMP+LY+ I++AGATPF+AWRIAFF+PGW+HV+MG LVL 
Sbjct  187   GLVNGTAAGWGNMGGGATQLLMPLLYEGIKRAGATPFTAWRIAFFVPGWMHVIMGFLVLG  246

Query  821   LGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAE  1000
             LGQDLPDGNLG+LQK+G++ KDKFSKV WYA+TNYRTWIF LLYG S+GVEL+TDNVIAE
Sbjct  247   LGQDLPDGNLGTLQKQGDVPKDKFSKVLWYAITNYRTWIFVLLYGMSLGVELTTDNVIAE  306

Query  1001  YFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGL  1180
             YFFDRFDL LHTAG IAATFGMAN+V+RP GG  SD AA+ FGMRGRLW LWILQT+GG+
Sbjct  307   YFFDRFDLNLHTAGTIAATFGMANIVSRPAGGLMSDMAARRFGMRGRLWNLWILQTLGGV  366

Query  1181  FCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSG  1360
             FC  LGRANTLPLAVT MI+FSIGAQAACGATFGI PFISRRSLG+ISGLTGAGGNFG+G
Sbjct  367   FCICLGRANTLPLAVTSMILFSIGAQAACGATFGIIPFISRRSLGVISGLTGAGGNFGAG  426

Query  1361  LTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYY  1540
             LTQL+FF++SK+STA+GLS MGIMI+ACT PV LVHFPQWG MF P S+   R +EE+YY
Sbjct  427   LTQLLFFTSSKYSTATGLSLMGIMIVACTTPVALVHFPQWGSMFLPPSE---RWSEEYYY  483

Query  1541  CSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EWN+EEK++G+HQ SLKFAENSRSERG+R
Sbjct  484   GKEWNKEEKERGLHQGSLKFAENSRSERGRR  514



>ref|XP_002889679.1| ATNRT2:1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65938.1| ATNRT2:1 [Arabidopsis lyrata subsp. lyrata]
Length=530

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/515 (80%), Positives = 455/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+V SPIV TD TAKF LPVD+EHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQSFAFSVQSPIVHTDKTAKFDLPVDTEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWRIAFFIPGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRCGSTAFTAWRIAFFIPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAALEKSGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD+AAK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGYASDFAAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI+ACTLPVTL+HFPQWG MF P SKD V+GTE
Sbjct  421   FGSGLTQLIFFSTSHFTTEQGLTWMGVMIVACTLPVTLIHFPQWGSMFLPPSKDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EK++ MHQ SL+FAEN++SE G+R
Sbjct  481   EHYYGSEWNEQEKERNMHQGSLRFAENAKSEGGRR  515



>ref|XP_009781713.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Nicotiana 
sylvestris]
Length=533

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/518 (81%), Positives = 461/518 (89%), Gaps = 3/518 (1%)
 Frame = +2

Query  89    MADIE--GSPGSSMHGVTGREPVLSFAVAS-PIVPTDTTAKFALPVDSEHKAKVFKLFSL  259
             MAD    GSPGSSMHGVTG+E   +F+V S P +P DTTAKFALPVDSEHKAKVFK+FS 
Sbjct  1     MADQNSTGSPGSSMHGVTGKEQTFAFSVKSDPKIPIDTTAKFALPVDSEHKAKVFKIFSF  60

Query  260   ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLV  439
             A PHM TFHLSW SFFTCF+STFAAAPLVPIIRDNLNL KSDIGNAG+ASVSGSI SRLV
Sbjct  61    AKPHMTTFHLSWTSFFTCFISTFAAAPLVPIIRDNLNLKKSDIGNAGIASVSGSIFSRLV  120

Query  440   MGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMST  619
             MGAVCDLLGPRYGCAFL+MLTAPTVFCMSFVSSAGGYV VRFMIGFSLATFVSCQ+WMST
Sbjct  121   MGAVCDLLGPRYGCAFLMMLTAPTVFCMSFVSSAGGYVVVRFMIGFSLATFVSCQFWMST  180

Query  620   MFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVV  799
             MFNSKIIGL NGTAAGWGNMGGG TQLLMP+LY++IR+AGATPF+AWRIAFF+PGWL V+
Sbjct  181   MFNSKIIGLVNGTAAGWGNMGGGVTQLLMPLLYELIRRAGATPFTAWRIAFFVPGWLQVI  240

Query  800   MGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             MG+LVL LGQDLPDGNLG LQKKG++ KDKFSKV WYAVTNYRTWIF LLYG S+GVEL+
Sbjct  241   MGLLVLGLGQDLPDGNLGILQKKGDVPKDKFSKVLWYAVTNYRTWIFVLLYGMSLGVELT  300

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
             TDNVIAEYFFDRF+LKL TAG IAATFGMANLVARP GG  SD AAK FGMRGRLW LWI
Sbjct  301   TDNVIAEYFFDRFNLKLRTAGTIAATFGMANLVARPLGGLMSDIAAKRFGMRGRLWNLWI  360

Query  1160  LQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGA  1339
             LQT GG FC LLG++N L +++  MI+FSIGAQAA GATFGI PFISRRSLGIISGLTGA
Sbjct  361   LQTFGGTFCILLGKSNKLSISILSMILFSIGAQAAAGATFGIIPFISRRSLGIISGLTGA  420

Query  1340  GGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVR  1519
             GGNFGSGLTQL+FF+ + +STA+GLS+MG+MI+ CTLPVTLVHFPQWG MF P SK+  +
Sbjct  421   GGNFGSGLTQLLFFTHANYSTATGLSFMGVMIVVCTLPVTLVHFPQWGSMFLPPSKNVGK  480

Query  1520  GTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +EE+YY  EWNEEEK KG+H+ SLKFAENSRSERG+R
Sbjct  481   FSEEYYYGLEWNEEEKLKGLHEGSLKFAENSRSERGRR  518



>ref|XP_006305882.1| hypothetical protein CARUB_v10011028mg [Capsella rubella]
 gb|EOA38780.1| hypothetical protein CARUB_v10011028mg [Capsella rubella]
Length=526

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/515 (79%), Positives = 454/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIV TD TA F LPVDSEHKA VFKLFS + P
Sbjct  1     MGDTTGEPGSSMHGVTGREQSFAFSVASPIVHTDKTATFDLPVDSEHKATVFKLFSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR++G+T F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRSGSTAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRDTLEKAGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD+AAK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGYASDFAAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI+ CTLPV L+HFPQWG MF P SKD V+GTE
Sbjct  421   FGSGLTQLIFFSTSTFTTEQGLTWMGVMIVGCTLPVALIHFPQWGSMFLPPSKDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EK+K MHQ SL+FA+N++SE G+R
Sbjct  481   EHYYASEWNEQEKEKNMHQGSLRFAKNAKSEGGRR  515



>ref|NP_200885.1| nitrate transporter 2.4 [Arabidopsis thaliana]
 sp|Q9FJH8.1|NRT24_ARATH RecName: Full=High affinity nitrate transporter 2.4; Short=AtNRT2:4 
[Arabidopsis thaliana]
 dbj|BAB10098.1| high affinity nitrate transporter [Arabidopsis thaliana]
 gb|AAY78876.1| putative high-affinity nitrate transporter [Arabidopsis thaliana]
 gb|AED97375.1| nitrate transporter 2.4 [Arabidopsis thaliana]
Length=527

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/515 (79%), Positives = 457/515 (89%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD  G PGSSMHGVTGRE   +F+V SP VP+D++AKF+LPVD+EHKAKVFKL S   P
Sbjct  1     MADGFGEPGSSMHGVTGREQSYAFSVESPAVPSDSSAKFSLPVDTEHKAKVFKLLSFEAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV  AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVGGAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGW+H++MGI
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPMVYEIIRRLGSTSFTAWRMAFFVPGWMHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKFSKV WYA+TNYRTW+F LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNRSTLEKKGAVTKDKFSKVLWYAITNYRTWVFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AA+ FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPIGGWASDIAARRFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRA TLP AV +MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGFFCLWLGRATTLPTAVVFMILFSLGAQAACGATFAIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS FST  GL++MG+MIMACTLPVTLVHFPQWG MF P+++D V+ TE
Sbjct  421   FGSGLTQLVFFSTSTFSTEQGLTWMGVMIMACTLPVTLVHFPQWGSMFLPSTEDEVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY  EW E EK+KGMH+ SLKFA NSRSERG+R
Sbjct  481   EYYYMKEWTETEKRKGMHEGSLKFAVNSRSERGRR  515



>ref|XP_010541316.1| PREDICTED: high affinity nitrate transporter 2.4-like [Tarenaya 
hassleriana]
Length=532

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/521 (78%), Positives = 461/521 (88%), Gaps = 4/521 (1%)
 Frame = +2

Query  71    DNSKTLMADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKL  250
             DN++    D+ G PGSSMHGVTGRE   +F+VASP+VPTDTTAKF+LPVDSEHKAKVFK+
Sbjct  3     DNNE----DVVGEPGSSMHGVTGREQSFAFSVASPMVPTDTTAKFSLPVDSEHKAKVFKI  58

Query  251   FSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILS  430
              S ANPHMRTFHLSWISFFTC+VSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI S
Sbjct  59    LSFANPHMRTFHLSWISFFTCYVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFS  118

Query  431   RLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYW  610
             RLVMGAVCDLLGPRYGCAF++ML+APTV+ MSFVS AGGY+ VRFMIGF LATFVSCQYW
Sbjct  119   RLVMGAVCDLLGPRYGCAFVVMLSAPTVYSMSFVSDAGGYITVRFMIGFCLATFVSCQYW  178

Query  611   MSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWL  790
             MSTMFNS+IIGL NGTAAGWGNMGGGATQLLMP++Y+II +AG+T F+AWRIAFF+PGW+
Sbjct  179   MSTMFNSQIIGLVNGTAAGWGNMGGGATQLLMPLVYEIIHRAGSTSFTAWRIAFFVPGWM  238

Query  791   HVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGV  970
             H VMGILVLT+GQDLPDGN  +LQK+G + KDKFS+V WYAV+NYRTWIF LLYGYSMGV
Sbjct  239   HTVMGILVLTMGQDLPDGNRSTLQKRGEVTKDKFSRVLWYAVSNYRTWIFVLLYGYSMGV  298

Query  971   ELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWT  1150
             EL+TDNVIAEYFFDRF LKLH AGIIAA+FGMAN  ARP GG+ SD AA+++GMRGRLWT
Sbjct  299   ELTTDNVIAEYFFDRFHLKLHVAGIIAASFGMANFFARPLGGYVSDVAARYYGMRGRLWT  358

Query  1151  LWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGL  1330
             LWI+QT+GG+FC LLGRAN L  AV  M++FS+GAQAACGATF I PFISRRSLGIISGL
Sbjct  359   LWIIQTLGGVFCILLGRANQLTFAVVSMVLFSLGAQAACGATFAIIPFISRRSLGIISGL  418

Query  1331  TGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKD  1510
             TGAGGNFGSGLTQ +FFSTS+F T  GL +MG+M +ACTLPV  VHFPQWG MFFP S+ 
Sbjct  419   TGAGGNFGSGLTQFVFFSTSRFGTNEGLMWMGVMTVACTLPVAFVHFPQWGSMFFPPSRH  478

Query  1511  AVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              ++ TEE+YY SEWN++E ++GMH  S+KFAEN+RSERGKR
Sbjct  479   PLKSTEEYYYTSEWNDDEIKRGMHSGSVKFAENARSERGKR  519



>ref|XP_006417730.1| hypothetical protein EUTSA_v10007338mg [Eutrema salsugineum]
 gb|ESQ36083.1| hypothetical protein EUTSA_v10007338mg [Eutrema salsugineum]
Length=530

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/515 (79%), Positives = 450/515 (87%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIV TD TAKF LPVD+EHKA VFKLFS ANP
Sbjct  1     MGDSTGEPGSSMHGVTGREQSFAFSVASPIVSTDKTAKFDLPVDTEHKATVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSW+SF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWVSFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRY CAFL+ML+APTVF MSFV  A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYACAFLVMLSAPTVFSMSFVDGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+ G+T F+AWRIAFF+PGWLH++MG 
Sbjct  181   SKIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRCGSTAFTAWRIAFFVPGWLHIIMGF  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
              VLTLGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   FVLTLGQDLPDGNRSALEKKGEVAKDKFGKILWYAVTNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF +KLHTAGIIAA+FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHMKLHTAGIIAASFGMANFFARPAGGYASDIAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  A+  MI+FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAIVAMILFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI ACTLPV  +HFPQWG MF P SKD ++GTE
Sbjct  421   FGSGLTQLIFFSTSTFTTEEGLTWMGVMIAACTLPVAFIHFPQWGSMFLPPSKDPIKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EKQK MHQ SL+FAEN++SE G+R
Sbjct  481   EHYYASEWNEQEKQKNMHQGSLRFAENAKSEGGRR  515



>ref|XP_006417729.1| hypothetical protein EUTSA_v10007342mg [Eutrema salsugineum]
 gb|ESQ36082.1| hypothetical protein EUTSA_v10007342mg [Eutrema salsugineum]
Length=530

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/515 (79%), Positives = 450/515 (87%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIV TD TAKF LPVD+EHKA VFKLFS ANP
Sbjct  1     MGDSTGEPGSSMHGVTGREQSFAFSVASPIVSTDKTAKFDLPVDTEHKATVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSW+SF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWVSFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRY CAFL+ML+APTVF MSFV  A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYACAFLVMLSAPTVFSMSFVDGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+ G+T F+AWRIAFF+PGWLH++MG 
Sbjct  181   SKIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRCGSTAFTAWRIAFFVPGWLHIIMGF  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
              VLTLGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVEL+TDN
Sbjct  241   FVLTLGQDLPDGNRSALEKKGEVAKDKFGKILWYAVTNYRTWIFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF +KLHTAGIIAA+FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHMKLHTAGIIAASFGMANFFARPAGGYASDIAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  A+  MI+FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAIVAMILFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI ACTLPV  +HFPQWG MF P SKD ++GTE
Sbjct  421   FGSGLTQLIFFSTSTFTTEEGLTWMGVMIAACTLPVAFIHFPQWGSMFLPPSKDPIKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EKQK MHQ SL+FAEN++SE G+R
Sbjct  481   EHYYASEWNEQEKQKNMHQGSLRFAENAKSEGGRR  515



>ref|NP_172288.1| nitrate transporter 2:1 [Arabidopsis thaliana]
 sp|O82811.1|NRT21_ARATH RecName: Full=High-affinity nitrate transporter 2.1; Short=AtNRT2:1; 
AltName: Full=Protein ACH1; AltName: Full=Protein LATERAL 
ROOT INITIATION 1 [Arabidopsis thaliana]
 gb|AAF79826.1|AC026875_6 T6D22.17 [Arabidopsis thaliana]
 emb|CAB09794.1| NRT2;1p [Arabidopsis thaliana]
 gb|AAC35883.1| high-affinity nitrate transporter ACH1 [Arabidopsis thaliana]
 gb|AAC64170.1| trans-membrane nitrate transporter protein AtNRT2:1 [Arabidopsis 
thaliana]
 gb|AEE28241.1| nitrate transporter 2:1 [Arabidopsis thaliana]
Length=530

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/515 (79%), Positives = 452/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+V SPIV TD TAKF LPVD+EHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQSFAFSVQSPIVHTDKTAKFDLPVDTEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSDAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRCGSTAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLNLGQDLPDGNRATLEKAGEVAKDKFGKILWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD+AAK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGYASDFAAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSMGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS F+T  GL++MG+MI+ACTLPVTLVHFPQWG MF P S D V+GTE
Sbjct  421   FGSGLTQLLFFSTSHFTTEQGLTWMGVMIVACTLPVTLVHFPQWGSMFLPPSTDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              HYY SEWNE+EKQK MHQ SL+FAEN++SE G+R
Sbjct  481   AHYYGSEWNEQEKQKNMHQGSLRFAENAKSEGGRR  515



>ref|XP_009148068.1| PREDICTED: LOW QUALITY PROTEIN: high-affinity nitrate transporter 
2.1-like [Brassica rapa]
Length=528

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/515 (79%), Positives = 453/515 (88%), Gaps = 2/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQTFAFSVASPIVPTDKTAKFDLPVDSEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV  AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVHDAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ GAT F+AWRIAFF+PGWLH++MG+
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRCGATAFTAWRIAFFVPGWLHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLNLGQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDLAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  MI+FS+GAQAACGATF I   +SRR+LGIISG TGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMILFSLGAQAACGATFAIV--VSRRALGIISGXTGAGGN  418

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPVTL+HFPQWG MF P S D V+GTE
Sbjct  419   FGSGLTQLIFFSTSRFTTEQGLTWMGVMIVACTLPVTLIHFPQWGSMFLPPSTDPVKGTE  478

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EK+K MHQ SL+FA+N++SE G+R
Sbjct  479   EHYYASEWNEQEKEKNMHQGSLRFAKNAKSEGGRR  513



>ref|XP_010475601.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Camelina 
sativa]
Length=530

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/515 (79%), Positives = 454/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIV TD TAKF LPVD+EHKA VFKLFS + P
Sbjct  1     MGDSTGEPGSSMHGVTGREQSFAFSVASPIVHTDKTAKFDLPVDTEHKATVFKLFSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+AGA+ F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRAGASAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAALEKAGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD++AK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGWASDFSAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFST++F+T  GL++MG+MI+ CTLPV  +HFPQWG MF P SKD V+GTE
Sbjct  421   FGSGLTQLLFFSTNQFTTEEGLTWMGVMIVGCTLPVAFIHFPQWGSMFLPPSKDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEW E+EKQK MHQ SL+FAEN++SE G+R
Sbjct  481   EHYYASEWTEQEKQKNMHQGSLRFAENAKSEGGRR  515



>emb|CAC05338.1| high-affinity nitrate transporter [Brassica napus]
Length=530

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/515 (79%), Positives = 453/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQTFAFSVASPIVPTDKTAKFDLPVDSEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQY MSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYGMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+ GAT F+AWR+AFF+PGWLH++MG+
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRCGATAFTAWRLAFFVPGWLHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLNLGQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAACFGMANFFARPAGGYASDLAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GG+FC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGVFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPVTL+HFPQWG MF P S D V+G +
Sbjct  421   FGSGLTQLIFFSTSRFTTEQGLTWMGVMIVACTLPVTLIHFPQWGSMFLPPSTDPVKGPK  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EK+K MHQ SL+FA+N++SE G+R
Sbjct  481   EHYYASEWNEQEKEKNMHQGSLRFAKNAKSEGGRR  515



>ref|XP_009120612.1| PREDICTED: high affinity nitrate transporter 2.4 [Brassica rapa]
Length=527

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/514 (78%), Positives = 457/514 (89%), Gaps = 0/514 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+  G PGSSMHGVTGRE   +F+V SP+VP+DT+A F+LPVD+EHKAKVFKL S A P
Sbjct  1     MANGLGEPGSSMHGVTGREQSYAFSVQSPVVPSDTSAMFSLPVDTEHKAKVFKLLSFAAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVADAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGW+H++MGI
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPLVYEIIRRLGSTSFTAWRMAFFVPGWMHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKFSKV WYA+TNYRTW+F LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNRSTLEKKGAVTKDKFSKVLWYAITNYRTWVFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD +A++FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPIGGWASDISARYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC LLGRA TLP AV  MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGCFCVLLGRATTLPTAVFSMILFSLGAQAACGATFAIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS F+T  GL++MG+MIMACTLPVTLVHFPQWG MF  ++ D V+ TE
Sbjct  421   FGSGLTQLVFFSTSTFTTEQGLTWMGVMIMACTLPVTLVHFPQWGSMFLSSTGDEVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGK  1630
             E+YY  EW E EKQKGMH+ SLKFA NSRSERG+
Sbjct  481   EYYYLKEWTETEKQKGMHEGSLKFAVNSRSERGR  514



>ref|XP_010488345.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Camelina 
sativa]
Length=525

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/513 (80%), Positives = 453/513 (88%), Gaps = 0/513 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIV TD TAKF LPVD+EHKA VFKLFS + P
Sbjct  1     MGDPTGEPGSSMHGVTGREQSYAFSVASPIVHTDKTAKFDLPVDTEHKATVFKLFSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+AGA+ F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRAGASAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAALEKAGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD++AK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGWASDFSAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI+ACTLPVTLVHFPQWG MF P SKD V+G+ 
Sbjct  421   FGSGLTQLIFFSTSHFTTEEGLTWMGVMIVACTLPVTLVHFPQWGSMFLPPSKDPVKGSV  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERG  1627
             EHYY SEW E+EKQK MHQ SL+FAEN++SE G
Sbjct  481   EHYYVSEWTEQEKQKNMHQGSLRFAENAKSEGG  513



>ref|XP_006282092.1| hypothetical protein CARUB_v10028339mg [Capsella rubella]
 gb|EOA14990.1| hypothetical protein CARUB_v10028339mg [Capsella rubella]
Length=530

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/515 (79%), Positives = 455/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F V SP VP+DT+AKF+LPVD+EHKAKVFKL S   P
Sbjct  1     MVDGFGEPGSSMHGVTGREQSYAFFVESPAVPSDTSAKFSLPVDTEHKAKVFKLLSFEAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVADAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGW+H++MGI
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPMVYEIIRRLGSTSFTAWRMAFFVPGWMHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKFSKV WYA+TNYRTW+F LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNRSTLEKKGAVTKDKFSKVLWYAITNYRTWVFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AA+ FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPIGGWASDIAARHFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRA TLP AV  MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGGFCVWLGRATTLPTAVFSMILFSLGAQAACGATFAIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS F+T  GL++MG+MIMACTLPVTLVHFPQWG MF  +++DAV+ TE
Sbjct  421   FGSGLTQLVFFSTSTFTTEQGLTWMGVMIMACTLPVTLVHFPQWGSMFLASTEDAVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY  EW E EKQKGMH+ SLKFA NSRSERG+R
Sbjct  481   EYYYLKEWTETEKQKGMHEGSLKFAVNSRSERGRR  515



>ref|XP_010456740.1| PREDICTED: high affinity nitrate transporter 2.4 [Camelina sativa]
Length=530

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/515 (78%), Positives = 456/515 (89%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD  G PGSSMHGVTGRE   +F V SP VP+DT+AKF+LPVD+EHKAKVFKL S   P
Sbjct  1     MADGFGEPGSSMHGVTGREQSYAFFVESPAVPSDTSAKFSLPVDTEHKAKVFKLLSFEAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVADAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGW+H++MG+
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPMVYEIIRRMGSTSFTAWRMAFFVPGWMHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKFSKV WYA+TNYRTW+F LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNRSTLEKKGAVTKDKFSKVLWYAITNYRTWVFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD +A+ FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPIGGWASDVSARHFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRA TLP AV  MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGCFCVWLGRATTLPTAVFSMILFSLGAQAACGATFAIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS F+T  GL++MG+MIMACTLPVTLVHFPQWG MF  +++DAV+ TE
Sbjct  421   FGSGLTQLVFFSTSTFTTEQGLTWMGVMIMACTLPVTLVHFPQWGSMFMASTEDAVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY  EW E EKQKGMH+ SLKFA NSRSERG+R
Sbjct  481   EYYYLKEWTETEKQKGMHEGSLKFAVNSRSERGRR  515



>ref|XP_006428719.1| hypothetical protein CICLE_v10013718mg [Citrus clementina]
 gb|ESR41959.1| hypothetical protein CICLE_v10013718mg [Citrus clementina]
Length=530

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/514 (79%), Positives = 459/514 (89%), Gaps = 0/514 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD E +PG+SMHGV+ +E   +F+VASPI+PTD TAKF L VDSEHKAKVFK+FSLA+P
Sbjct  1     MADTENTPGNSMHGVSAKEKAFAFSVASPIMPTDPTAKFKLLVDSEHKAKVFKIFSLASP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HM TFHLSW+SFFTCFVSTFAAAPLVPIIRDNLNL+K+DIGNAG+ASVSGSI SRL MGA
Sbjct  61    HMTTFHLSWLSFFTCFVSTFAAAPLVPIIRDNLNLIKTDIGNAGIASVSGSIFSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVF M FVSSAGGY+A RFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFSMVFVSSAGGYIAARFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGG TQLLMP +Y++IR+AGATPF+AWRIAFF PG LHV+MGI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGITQLLMPFIYELIRRAGATPFTAWRIAFFAPGCLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++ KDKF KV WYA+TNYRTWIF LLYG S+G+EL+ DN
Sbjct  241   LVLTLGQDLPDGNLNTLQKKGDVPKDKFPKVLWYAITNYRTWIFVLLYGMSLGIELTIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF+LKLHTAG+IAATFGMAN+ ARP GG  SD AA+ FGMRGRLW L+I+QT
Sbjct  301   VIAEYFFDRFNLKLHTAGVIAATFGMANIFARPLGGLMSDMAARPFGMRGRLWNLYIVQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRA+TLPL++  MI+FSI  QAACGATFGI PFISRRSLG+ISGLTGAGGN
Sbjct  361   LGGIFCICLGRASTLPLSILSMILFSITTQAACGATFGIIPFISRRSLGVISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++S+ STA+G+S MGIMI+ CT PV LVHFPQWG MF PA+KD+ +  E
Sbjct  421   FGSGLTQLLFFTSSRHSTATGISLMGIMIVCCTFPVALVHFPQWGSMFLPATKDSEKSKE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGK  1630
             E+YY +EWNEEEKQ+G+H  SLKFAENSRSERGK
Sbjct  481   EYYYGAEWNEEEKQRGLHHRSLKFAENSRSERGK  514



>ref|XP_010475600.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Camelina 
sativa]
Length=530

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/515 (79%), Positives = 453/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIV TD TAKF LPVD+EHKA VFKLFS + P
Sbjct  1     MGDPTGEPGSSMHGVTGREQSFAFSVASPIVHTDKTAKFDLPVDTEHKATVFKLFSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+AGA+ F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRAGASAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAALEKAGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD++AK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGWASDFSAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFST++F+T  GL++MG+MI+ CTLPV  +HFPQWG MF P SKD V+ TE
Sbjct  421   FGSGLTQLLFFSTNQFTTEEGLTWMGVMIVGCTLPVAFIHFPQWGSMFLPPSKDPVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEW E+EKQK MHQ SL+FAEN++SE G+R
Sbjct  481   EHYYASEWTEQEKQKNMHQGSLRFAENAKSEGGRR  515



>gb|KFK43126.1| hypothetical protein AALP_AA1G083700 [Arabis alpina]
Length=530

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/515 (79%), Positives = 452/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F VASP+V TD TA F LPVD+EHKA  FKLFS ANP
Sbjct  1     MGDPSGEPGSSMHGVTGREQSFAFEVASPMVTTDKTAHFDLPVDTEHKATKFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPL+PIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLIPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVNGAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRCGSTAFTAWRLAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAACFGMANFFARPAGGYASDIAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI+ACTLPV L+HFPQWG MF P S D V+GTE
Sbjct  421   FGSGLTQLIFFSTSTFTTEQGLTWMGVMIVACTLPVMLIHFPQWGSMFLPPSTDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEW+E+EKQK MHQ SL+FAEN++SE G+R
Sbjct  481   EHYYGSEWDEQEKQKNMHQGSLRFAENAKSEGGRR  515



>ref|XP_010458033.1| PREDICTED: high-affinity nitrate transporter 2.1 [Camelina sativa]
Length=530

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/515 (79%), Positives = 454/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIV TD TAKF LPVD+EHKA VFKLFS + P
Sbjct  1     MGDPTGEPGSSMHGVTGREQSFAFSVASPIVHTDKTAKFDLPVDTEHKATVFKLFSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+AGA+ F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRAGASAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAALEKSGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD++AK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGWASDFSAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI+ACT PVTL+HFPQWG MF P SKD V+ TE
Sbjct  421   FGSGLTQLIFFSTSHFTTEEGLTWMGVMIVACTFPVTLIHFPQWGSMFLPPSKDPVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEW E+EK+K MHQ SL+FA+N++SE G+R
Sbjct  481   EHYYGSEWTEQEKEKNMHQGSLRFAKNAKSEGGRR  515



>ref|XP_010443883.1| PREDICTED: high affinity nitrate transporter 2.4-like [Camelina 
sativa]
Length=530

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/515 (78%), Positives = 455/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F V SP VP+DT+AKF+LPVD+EHKAKVFKL S   P
Sbjct  1     MTDGFGEPGSSMHGVTGREQSYAFFVESPAVPSDTSAKFSLPVDTEHKAKVFKLLSFEAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVADAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGW+H++MGI
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPMVYEIIRRLGSTSFTAWRMAFFVPGWMHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKFSKV WYA+TNYRTW+F LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNRSTLEKKGAVTKDKFSKVLWYAITNYRTWVFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD +A+ FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPIGGWASDVSARHFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRA TLP AV  MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGCFCVWLGRATTLPTAVFSMILFSLGAQAACGATFAIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS F+T  GL++MG+MIMACTLPVTLVHFPQWG MF  +++DAV+ TE
Sbjct  421   FGSGLTQLVFFSTSTFTTEQGLTWMGVMIMACTLPVTLVHFPQWGSMFMASTEDAVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY  EW E EKQKGMH+ SLKFA NSRSERG+R
Sbjct  481   EYYYLKEWTETEKQKGMHEGSLKFAVNSRSERGRR  515



>gb|KFK27602.1| hypothetical protein AALP_AA8G404900 [Arabis alpina]
Length=527

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/515 (78%), Positives = 456/515 (89%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+  G PGSSMHGVTGRE   +F+V SP V +DT+AKF+LPVD+EHKAKVFKLFS A P
Sbjct  1     MANGFGEPGSSMHGVTGREQSYAFSVESPAVASDTSAKFSLPVDTEHKAKVFKLFSFAAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRL MGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVADAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFFIPGW+H++MGI
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPLVYEIIRRLGSTSFTAWRMAFFIPGWMHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKFSKV WYA+TNYRTW+F LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNRSTLEKKGAVTKDKFSKVLWYAITNYRTWVFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKL TAGIIAA+FGMAN  ARP GG+ASD AA+ FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLQTAGIIAASFGMANFFARPIGGWASDMAARHFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRA TLP AV  MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGCFCVWLGRATTLPTAVFSMILFSLGAQAACGATFAIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS F+T  GL++MG+MI+ACTLPVTLVHFPQWG MF P+++D V+ TE
Sbjct  421   FGSGLTQLVFFSTSAFTTEQGLTWMGVMIVACTLPVTLVHFPQWGSMFLPSTEDEVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY  EW E EKQKGMH+ SLKFA NSRSERG+R
Sbjct  481   EYYYMKEWTEPEKQKGMHEGSLKFAINSRSERGRR  515



>ref|XP_006339303.1| PREDICTED: high affinity nitrate transporter 2.4-like [Solanum 
tuberosum]
Length=534

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/511 (80%), Positives = 457/511 (89%), Gaps = 1/511 (0%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVAS-PIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRT  280
             GSPG+SMHGVTG+E   +F+V S P +PTDT AKFALPVDSEHK+KVFK+FS A PHM T
Sbjct  9     GSPGTSMHGVTGKEQTFAFSVTSDPNIPTDTMAKFALPVDSEHKSKVFKIFSFAKPHMTT  68

Query  281   FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDL  460
             FHLSW SFFTCF+STFAAAPLVPIIRDNLNL KSDIGNAG+ASVSGSI SRLVMGAVCDL
Sbjct  69    FHLSWTSFFTCFISTFAAAPLVPIIRDNLNLTKSDIGNAGIASVSGSIFSRLVMGAVCDL  128

Query  461   LGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKII  640
             LGPRYGCAFL+MLTAPTVFCMSFVSSAGGY+AVRFMIGFSLATFVSCQYWMSTMFNSKII
Sbjct  129   LGPRYGCAFLMMLTAPTVFCMSFVSSAGGYIAVRFMIGFSLATFVSCQYWMSTMFNSKII  188

Query  641   GLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLT  820
             G+ NGTAAGWGNMGGGATQLLMP+LY++IR+AGATPF+AWRIAFF+PGWLHVVMG+LVL 
Sbjct  189   GVVNGTAAGWGNMGGGATQLLMPLLYELIRQAGATPFTAWRIAFFVPGWLHVVMGLLVLG  248

Query  821   LGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAE  1000
             LGQDLPDGNLG+LQKKG++ KDKFSKV WY VTNYRTWIF LLYG S+GVEL+TDNVIAE
Sbjct  249   LGQDLPDGNLGTLQKKGDVAKDKFSKVLWYGVTNYRTWIFVLLYGMSLGVELTTDNVIAE  308

Query  1001  YFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGL  1180
             YFFDRF+LKL TAG IAATFGMAN++ARP GG  SD  A  FGMRGRLW LWILQT GG+
Sbjct  309   YFFDRFNLKLRTAGTIAATFGMANILARPLGGLTSDVLANRFGMRGRLWNLWILQTFGGI  368

Query  1181  FCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSG  1360
             FC LLG++  LP+++  MI+FSIGAQAA GATFGI PFISRRSLG+ISGLTGAGGNFGSG
Sbjct  369   FCILLGKSEKLPISILSMILFSIGAQAAAGATFGIIPFISRRSLGVISGLTGAGGNFGSG  428

Query  1361  LTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYY  1540
             LTQL+FF+ + +ST++GL YMG+MI+ CTLPVTLVHFPQWG MF P SK+  +  EE+YY
Sbjct  429   LTQLLFFTNANYSTSTGLLYMGVMIVVCTLPVTLVHFPQWGSMFLPPSKNIAKFNEEYYY  488

Query  1541  CSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EWN+EEK KG+ + SLKFAENSRSERG+R
Sbjct  489   GLEWNDEEKLKGLDEGSLKFAENSRSERGRR  519



>gb|KDO42638.1| hypothetical protein CISIN_1g037413mg [Citrus sinensis]
Length=530

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/515 (78%), Positives = 458/515 (89%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD E +PG+SMHGV+ +E   +F+VASPI+PTD  AKF LPVDSEHKAKVFK+FSLA+P
Sbjct  1     MADTENTPGNSMHGVSAKEKAFAFSVASPIMPTDPIAKFKLPVDSEHKAKVFKIFSLASP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HM TFHLSW+SFFTCFVSTFAAAPLVPIIRDNLNL+K+DIGNAG+ASVSGSI SRLVMGA
Sbjct  61    HMTTFHLSWLSFFTCFVSTFAAAPLVPIIRDNLNLIKTDIGNAGIASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVF M FVSSA GY+A RFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFSMVFVSSARGYIAARFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGG TQLL P +Y++IR+AGATPF+AWRIAFF PG LHV+MGI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGITQLLTPFIYELIRRAGATPFTAWRIAFFAPGCLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++  DKF KV WYA+TNYRTWIF LLYG S+G+EL+ DN
Sbjct  241   LVLTLGQDLPDGNLNTLQKKGDVPTDKFPKVLWYAITNYRTWIFVLLYGMSLGIELTIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF+LKLHTAG+IAATFGMAN+ ARP GG  SD AA+ FGMRGRLW L+I+QT
Sbjct  301   VIAEYFFDRFNLKLHTAGVIAATFGMANIFARPLGGLMSDMAARPFGMRGRLWNLYIVQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRA+TLPL++  MI+FSI  QAACGATFGI PFISRRSLG+ISGLTGAGGN
Sbjct  361   LGGIFCICLGRASTLPLSILSMILFSITTQAACGATFGIIPFISRRSLGVISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++S+ STA+G+S MGIMI+ CT PV LVHFPQWG MF PA+KD+ +  E
Sbjct  421   FGSGLTQLLFFTSSRHSTATGISLMGIMIVCCTFPVALVHFPQWGSMFLPATKDSEKSKE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY +EWNEEEKQ+G+H  SLKFAENSRSERGKR
Sbjct  481   EYYYGAEWNEEEKQRGLHHGSLKFAENSRSERGKR  515



>ref|XP_010458035.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Camelina 
sativa]
Length=525

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/513 (79%), Positives = 453/513 (88%), Gaps = 0/513 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIV TD TAKF LPVD+EHKA VFKLFS + P
Sbjct  1     MGDPTGEPGSSMHGVTGREQSFAFSVASPIVHTDKTAKFDLPVDTEHKATVFKLFSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+AGA+ F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRAGASAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAALEKSGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD++AK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGWASDFSAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI+ACT+PVTLVHFPQWG MF P SKD V+G+ 
Sbjct  421   FGSGLTQLIFFSTSHFTTEEGLTWMGVMIVACTMPVTLVHFPQWGSMFLPPSKDPVKGSV  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERG  1627
             E+YY SEW E+EKQK MHQ SL+FAEN++SE G
Sbjct  481   ENYYVSEWTEQEKQKNMHQGSLRFAENAKSEGG  513



>ref|XP_006400814.1| hypothetical protein EUTSA_v10013237mg [Eutrema salsugineum]
 gb|ESQ42267.1| hypothetical protein EUTSA_v10013237mg [Eutrema salsugineum]
Length=527

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/515 (78%), Positives = 455/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD  G PGSSMHGVTGRE   +F+V SP+VP+DT+AKF+LPVD+EHKAKVFKLFS   P
Sbjct  1     MADGFGEPGSSMHGVTGREQSYAFSVQSPVVPSDTSAKFSLPVDTEHKAKVFKLFSFEAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCFVSTFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFVSTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV  AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVVDAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGW+H++MGI
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPLVYEIIRRLGSTSFTAWRMAFFVPGWMHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K+G + KDKFSKV WYA+TNYRTW+F LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNRSTLEKQGAVTKDKFSKVLWYAITNYRTWVFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD +A++FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPIGGWASDISARYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRA TLP A+  MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGCFCVWLGRATTLPTAIFSMILFSLGAQAACGATFAIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS F+T  GL++MG+MI+ACTLPVTLVHFPQWG MF  ++ D  + TE
Sbjct  421   FGSGLTQLVFFSTSTFTTEQGLTWMGVMIVACTLPVTLVHFPQWGSMFLASTGDEKKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY  EW E EKQKGMH+ SLKFA NSRSERG R
Sbjct  481   EYYYLKEWTETEKQKGMHEGSLKFAVNSRSERGPR  515



>ref|XP_010483731.1| PREDICTED: high affinity nitrate transporter 2.4-like isoform 
X2 [Camelina sativa]
Length=530

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/515 (78%), Positives = 455/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD  G PGSSMHGVTGRE   +F V SP VP+DT+AKF+LPVD+EHKAKVFKL S   P
Sbjct  1     MADGFGEPGSSMHGVTGREQSYAFFVESPAVPSDTSAKFSLPVDTEHKAKVFKLLSFEAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVADAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGW+H++MG+
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPMVYEIIRRMGSTSFTAWRMAFFVPGWMHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+KKG + KDKF +V WYA+TNYRTW+F LLYGYSMGVEL+TDN
Sbjct  241   LVLTLGQDLPDGNRSTLEKKGAVTKDKFYQVLWYAITNYRTWVFVLLYGYSMGVELTTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD +A+ FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPIGGWASDVSARHFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG FC  LGRA TLP AV  MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGN
Sbjct  361   LGGCFCVWLGRATTLPTAVFSMILFSLGAQAACGATFAIIPFISRRSLGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS F+T  GL++MG+MIMACTLPVTLVHFPQWG MF  +++DAV+ TE
Sbjct  421   FGSGLTQLVFFSTSTFTTEQGLTWMGVMIMACTLPVTLVHFPQWGSMFMASTEDAVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY  EW E EKQKGMH+ SLKFA NSRSERG+R
Sbjct  481   EYYYLKEWTETEKQKGMHEGSLKFAVNSRSERGRR  515



>ref|XP_010521737.1| PREDICTED: LOW QUALITY PROTEIN: high-affinity nitrate transporter 
2.1-like [Tarenaya hassleriana]
Length=525

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/515 (79%), Positives = 453/515 (88%), Gaps = 5/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTG+E   +F+VASP+VPTDTTAKF LPVDSEHKAKVFKLFS A P
Sbjct  1     MGDSAGEPGSSMHGVTGKEQSFAFSVASPMVPTDTTAKFDLPVDSEHKAKVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFCTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV++AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVANAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR  G+TPF+AWRIAFFIPGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGVTQLLMPVVYEIIRSIGSTPFTAWRIAFFIPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN   L+KKG++ KDKFSK+ WYA+TNYRTW+F LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRSVLEKKGDVAKDKFSKILWYAITNYRTWVFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG +         + R  GG+ASD AA++FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGSLXI---FIPRIGR--GGYASDIAARYFGMRGRLWTLWIIQT  355

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  A+  MI+FS GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  356   AGGLFCVWLGRANTLVTAIVAMILFSFGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  415

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPVTLVHFPQWG MF PAS D V+GTE
Sbjct  416   FGSGLTQLIFFSTSRFTTEEGLTWMGVMIVACTLPVTLVHFPQWGSMFLPASSDPVKGTE  475

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEW ++EKQK MHQ SL+FAENSRSERG+R
Sbjct  476   EHYYVSEWTDKEKQKNMHQGSLRFAENSRSERGRR  510



>ref|XP_010488337.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Camelina 
sativa]
Length=530

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/515 (78%), Positives = 453/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASP+V TD TAKF LPVD+EHKA VFKLFS + P
Sbjct  1     MGDPTGEPGSSMHGVTGREQSFAFSVASPVVHTDKTAKFDLPVDTEHKATVFKLFSFSKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+AGA+ F+AWRIAFF+PGWLH++MG+
Sbjct  181   CQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRAGASAFTAWRIAFFVPGWLHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +L+K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAALEKAGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAG+IAA FGMAN  ARP GG+ASD++AK+FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGLIAACFGMANFFARPAGGWASDFSAKYFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS F+T  GL++MG+MI+ACT PVTL+HFPQWG MF P SKD V+ TE
Sbjct  421   FGSGLTQLIFFSTSHFTTEEGLTWMGVMIVACTFPVTLIHFPQWGSMFLPPSKDPVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEW E+EK+K MHQ SL+FA+N++SE G+R
Sbjct  481   EHYYGSEWTEQEKEKNMHQGSLRFAKNAKSEGGRR  515



>ref|XP_006843132.1| hypothetical protein AMTR_s00140p00110570 [Amborella trichopoda]
 gb|ERN04807.1| hypothetical protein AMTR_s00140p00110570 [Amborella trichopoda]
Length=534

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/513 (81%), Positives = 464/513 (90%), Gaps = 3/513 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHM  274
             D+E SPG+SMHGVTGREPVL+ +VASP+V TD TAKFALPVDSEHKAKVFKLFSLANPHM
Sbjct  8     DVESSPGTSMHGVTGREPVLAMSVASPMVATDHTAKFALPVDSEHKAKVFKLFSLANPHM  67

Query  275   RTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVC  454
             RTFHLSW+SFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAG+ASVSGSI SRL MGAVC
Sbjct  68    RTFHLSWVSFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGIASVSGSIFSRLAMGAVC  127

Query  455   DLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSK  634
             DLLGPRYGCAFL+ML+APTVFCMS +SSA GYV VRFMIGFSLATFVSCQ+WMS+MFNSK
Sbjct  128   DLLGPRYGCAFLLMLSAPTVFCMSLISSAEGYVVVRFMIGFSLATFVSCQFWMSSMFNSK  187

Query  635   IIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILV  814
             I+GLANGTAAGWGNMGGGATQL+MP+LYD+IRK GATPF AWRIAFF+PG +HVVMG++V
Sbjct  188   IVGLANGTAAGWGNMGGGATQLIMPLLYDVIRKVGATPFIAWRIAFFVPGMMHVVMGVMV  247

Query  815   LTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVI  994
             LTLGQDLPDGN  +LQK+G  + DKFSKV WYAVTNYRTWIFAL+YGYSMGVEL+TDNVI
Sbjct  248   LTLGQDLPDGNYAALQKQGTKSMDKFSKVLWYAVTNYRTWIFALIYGYSMGVELTTDNVI  307

Query  995   AEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMG  1174
             AEYF+DRFDL+L TAG+IAA+FGMAN +ARP GGF SD+ A+ +GMR RLW LWILQTMG
Sbjct  308   AEYFYDRFDLQLRTAGLIAASFGMANFIARPVGGFLSDFGARRWGMRARLWNLWILQTMG  367

Query  1175  GLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFG  1354
             GLFC  LGR+N+L ++V  MI FS+ AQAACGA FGI PF+SRRSLGIISGLTGAGGNFG
Sbjct  368   GLFCLWLGRSNSLSMSVVAMIAFSVCAQAACGAIFGIIPFVSRRSLGIISGLTGAGGNFG  427

Query  1355  SGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEH  1534
             SGLTQL+FF++SK+STA+GLS+MGIMIMACTLPVTLVHFPQWG MF P SK A   TEEH
Sbjct  428   SGLTQLLFFTSSKYSTATGLSFMGIMIMACTLPVTLVHFPQWGSMFRPPSKKA---TEEH  484

Query  1535  YYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             YYCSEWNEEE+ +G H  SLKFAENSRSERG R
Sbjct  485   YYCSEWNEEERAEGWHAGSLKFAENSRSERGSR  517



>ref|XP_007027410.1| Nitrate transporter 2.4 [Theobroma cacao]
 gb|EOY07912.1| Nitrate transporter 2.4 [Theobroma cacao]
Length=522

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/515 (80%), Positives = 457/515 (89%), Gaps = 8/515 (2%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M + E  PG SMHGV+ +E   +F+V SP +PTD TAKFALPVDSEHKAKVF L S A P
Sbjct  1     MTETENEPGRSMHGVSAKEQAFAFSVTSPTIPTDPTAKFALPVDSEHKAKVFNLLSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HM TFHLSW+SFFTCF+STFAAAPLVPIIRDNLNL KSDI NAG+ASVSGSI SRLVMGA
Sbjct  61    HMVTFHLSWLSFFTCFISTFAAAPLVPIIRDNLNLTKSDISNAGIASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCMSFVSSAGGYVAVRFMIGFSLATFV CQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVFCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGGATQLLMP+++++I++AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGATQLLMPLIFELIKQAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKG+        V WYA+TNYRTWIF LLYG S+GVEL+TDN
Sbjct  241   LVLTLGQDLPDGNLGTLQKKGD--------VIWYAITNYRTWIFVLLYGMSLGVELTTDN  292

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF+LKLHTAG IAATFGMAN+ ARP GGF SD AA+ FGMRGRLW L+ILQT
Sbjct  293   VIAEYFFDRFNLKLHTAGTIAATFGMANIFARPMGGFLSDIAARRFGMRGRLWNLYILQT  352

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN L L++  MI+FSIGAQAACGATFGI PFIS RSLG+ISGLTGAGGN
Sbjct  353   LGGIFCICLGRANYLSLSIFSMILFSIGAQAACGATFGIIPFISCRSLGVISGLTGAGGN  412

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++SK+STA+G+ +MGIMI+ACTLPVTLVHFPQWG MFFPASK   + +E
Sbjct  413   FGSGLTQLLFFTSSKYSTATGIFHMGIMIVACTLPVTLVHFPQWGSMFFPASKHGEKCSE  472

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNEEEK+KG+H  SLKFAENSRSERG+R
Sbjct  473   EHYYGSEWNEEEKEKGLHHGSLKFAENSRSERGRR  507



>ref|XP_010535619.1| PREDICTED: LOW QUALITY PROTEIN: high affinity nitrate transporter 
2.4 [Tarenaya hassleriana]
Length=519

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/512 (79%), Positives = 456/512 (89%), Gaps = 5/512 (1%)
 Frame = +2

Query  98    IEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMR  277
             + G PGSSMHGVTGRE   +F+VASP+VPTDT+AKF++PVDSEHKAKVFK+ S+A+PHMR
Sbjct  1     MAGEPGSSMHGVTGREQSFAFSVASPVVPTDTSAKFSVPVDSEHKAKVFKILSVASPHMR  60

Query  278   TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCD  457
             TFHL+WISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGAVCD
Sbjct  61    TFHLAWISFFTCFVSTFAAAPLVPIIRDNLNLTKQDIGNAGVASVSGSIFSRLVMGAVCD  120

Query  458   LLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKI  637
             LLGPRYGCAFL+ML+APTVF MSFV+ A GY+ VRFMIGF LATFVSCQYWMSTMFNSKI
Sbjct  121   LLGPRYGCAFLVMLSAPTVFSMSFVTDASGYITVRFMIGFCLATFVSCQYWMSTMFNSKI  180

Query  638   IGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVL  817
             IGL NGTAAGWGNMGGGATQL+MP++Y+ IR++G+T F+AWRIAFF+PGW+H+VMGILVL
Sbjct  181   IGLVNGTAAGWGNMGGGATQLIMPLVYEAIRRSGSTSFTAWRIAFFVPGWMHIVMGILVL  240

Query  818   TLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIA  997
             TLGQDLPDGN  +L+KKG + KD FSK+FWYA+TNYRTWIF +LYGYSMGVELSTDNVIA
Sbjct  241   TLGQDLPDGNRSTLEKKGEVAKDHFSKIFWYAITNYRTWIFVVLYGYSMGVELSTDNVIA  300

Query  998   EYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGG  1177
             EYFFDRF LKL TAG IAA FGMAN  ARPFGG+ASD AA++ GMRGRLWTLWI+QT+GG
Sbjct  301   EYFFDRFHLKLQTAGTIAAAFGMANFFARPFGGWASDMAARYLGMRGRLWTLWIIQTLGG  360

Query  1178  LFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGS  1357
              F      A+TL  AVT MI+FS+GAQAACGATF I PFISRRSLGIISGLTGAGGNFGS
Sbjct  361   CF-----XADTLSTAVTAMILFSVGAQAACGATFAIIPFISRRSLGIISGLTGAGGNFGS  415

Query  1358  GLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHY  1537
             GLTQL+FFSTS+F+T  GL++MG+MI+ACTLPVTLVHFPQWG MF P + D V+ TEE+Y
Sbjct  416   GLTQLVFFSTSRFTTGEGLTWMGVMIVACTLPVTLVHFPQWGSMFLPPTSDEVKCTEEYY  475

Query  1538  YCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             Y  EW+E EK+KGMH+ SLKFA NSRSERG+R
Sbjct  476   YMREWSEREKEKGMHEGSLKFAVNSRSERGRR  507



>gb|KFK43120.1| hypothetical protein AALP_AA1G082600 [Arabis alpina]
Length=525

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/515 (78%), Positives = 448/515 (87%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F VASPIV +D TA F LPVD+EHKA  FKLFS A P
Sbjct  1     MGDTSGEPGSSMHGVTGREQSFAFEVASPIVTSDKTAHFDLPVDAEHKAMKFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+ G+T F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRCGSTAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGN  +++KKG + KDKF K+ WYAV+NYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPDGNRAAMEKKGEVVKDKFGKILWYAVSNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDVAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  A+  MI+FS+GAQAACGATFGI PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAIVAMILFSLGAQAACGATFGIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFST+ F+T  GL++MG+MI+ACT+PV  VHFPQWG MFFP SKD V+GTE
Sbjct  421   FGSGLTQLIFFSTNTFTTEQGLTWMGVMIVACTMPVMFVHFPQWGSMFFPPSKDPVKGTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              HYY SEWN+EEK K MHQ S  FA+N+ SE G +
Sbjct  481   LHYYESEWNDEEKAKNMHQGSKLFAQNATSEGGPK  515



>ref|XP_006493046.1| PREDICTED: high affinity nitrate transporter 2.4-like [Citrus 
sinensis]
Length=530

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/514 (78%), Positives = 455/514 (89%), Gaps = 0/514 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD E +PG+SMHGV+ +E   +F+VASPI+PTD TAKF L VDSEHKAKVFK+FSLA+P
Sbjct  1     MADTENTPGNSMHGVSAKEKAFAFSVASPIMPTDPTAKFKLLVDSEHKAKVFKIFSLASP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HM TFHLSW+SFFTCFVSTFAAAPLV IIRDNLNL+K+DIGNAG+ASVSGSI SRL MGA
Sbjct  61    HMTTFHLSWLSFFTCFVSTFAAAPLVSIIRDNLNLIKTDIGNAGIASVSGSIFSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVF M FVSSAGGY+A RFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLIMLSAPTVFSMVFVSSAGGYIAARFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAAGWGNMGGG TQLL P +Y++IR+AGATPF+AWRIAFF PG LHV+MGI
Sbjct  181   GKIIGLVNGTAAGWGNMGGGITQLLTPFIYELIRRAGATPFTAWRIAFFAPGCLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++  DKF KV WYA+TNYRTWIF LLYG S+G+EL+ DN
Sbjct  241   LVLTLGQDLPDGNLNTLQKKGDVPTDKFPKVLWYAITNYRTWIFVLLYGMSLGIELTIDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF+LKLHTAG+IAATFGMAN+ ARP GG  SD AA+ FGMRGRLW L+I+QT
Sbjct  301   VIAEYFFDRFNLKLHTAGVIAATFGMANIFARPLGGLMSDMAARPFGMRGRLWNLYIVQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRA+TLPL++  MI+FSI  QAACGATFGI PFISRRSLG+ISGLTGAGGN
Sbjct  361   LGGIFCICLGRASTLPLSILSMILFSITTQAACGATFGIIPFISRRSLGVISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FF++S+ STA+G+S MGIMI+ CT PV LVHFPQWG MF PA+KD+ +  E
Sbjct  421   FGSGLTQLLFFTSSRHSTATGISLMGIMIVCCTFPVALVHFPQWGSMFLPATKDSEKSKE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGK  1630
             E+YY +EWNEEEK +G+H  SLKFAENSRSERGK
Sbjct  481   EYYYGAEWNEEEKHRGLHHRSLKFAENSRSERGK  514



>ref|XP_010483730.1| PREDICTED: high affinity nitrate transporter 2.4-like isoform 
X1 [Camelina sativa]
Length=536

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/521 (77%), Positives = 454/521 (87%), Gaps = 6/521 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD  G PGSSMHGVTGRE   +F V SP VP+DT+AKF+LPVD+EHKAKVFKL S   P
Sbjct  1     MADGFGEPGSSMHGVTGREQSYAFFVESPAVPSDTSAKFSLPVDTEHKAKVFKLLSFEAP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNLNL + D+GNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTRQDVGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV+ AGGY+ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVADAGGYITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWR+AFF+PGW+H++MG+
Sbjct  181   GQIIGLVNGTAAGWGNMGGGVTQLLMPMVYEIIRRMGSTSFTAWRMAFFVPGWMHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKF------SKVFWYAVTNYRTWIFALLYGYSMGV  970
             LVLTLGQDLPDGN  +L+KKG + KD F       +V WYA+TNYRTW+F LLYGYSMGV
Sbjct  241   LVLTLGQDLPDGNRSTLEKKGAVTKDNFLVDNFNYQVLWYAITNYRTWVFVLLYGYSMGV  300

Query  971   ELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWT  1150
             EL+TDNVIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD +A+ FGMRGRLWT
Sbjct  301   ELTTDNVIAEYFFDRFHLKLHTAGIIAASFGMANFFARPIGGWASDVSARHFGMRGRLWT  360

Query  1151  LWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGL  1330
             LWI+QT+GG FC  LGRA TLP AV  MI+FS+GAQAACGATF I PFISRRSLGIISGL
Sbjct  361   LWIIQTLGGCFCVWLGRATTLPTAVFSMILFSLGAQAACGATFAIIPFISRRSLGIISGL  420

Query  1331  TGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKD  1510
             TGAGGNFGSGLTQL+FFSTS F+T  GL++MG+MIMACTLPVTLVHFPQWG MF  +++D
Sbjct  421   TGAGGNFGSGLTQLVFFSTSTFTTEQGLTWMGVMIMACTLPVTLVHFPQWGSMFMASTED  480

Query  1511  AVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             AV+ TEE+YY  EW E EKQKGMH+ SLKFA NSRSERG+R
Sbjct  481   AVKSTEEYYYLKEWTETEKQKGMHEGSLKFAVNSRSERGRR  521



>ref|XP_006424509.1| hypothetical protein CICLE_v10028173mg [Citrus clementina]
 gb|ESR37749.1| hypothetical protein CICLE_v10028173mg [Citrus clementina]
Length=535

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/515 (75%), Positives = 448/515 (87%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA  EGS GSSMHGV GRE   +  V SP VPTDTT KF LPVDSEH+AK FK+FS A P
Sbjct  1     MAQNEGSLGSSMHGVIGREQTFALEVVSPSVPTDTTVKFDLPVDSEHRAKAFKVFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+W+SFFTCF+STFAAAPLVPIIRDNLNL K+D+GNAGVASVSGSI SRL+MGA
Sbjct  61    HMRTFHLAWVSFFTCFISTFAAAPLVPIIRDNLNLTKTDVGNAGVASVSGSIFSRLIMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDL+GPRYG +FL++L+AP VFCMSFVS A GY+A RFMIGF LATFVSCQYW + MFN
Sbjct  121   VCDLIGPRYGTSFLLLLSAPAVFCMSFVSDAQGYIAARFMIGFCLATFVSCQYWTTIMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KI+GL NG A GWG+MGGG TQLLMP+++++I+ AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   GKILGLVNGCAGGWGDMGGGVTQLLMPLVFEVIKLAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKGN+NKDKFSKVFWY + NYRTW+F +LYG+SMG+EL+T+N
Sbjct  241   LVLTLGQDLPDGNLGALQKKGNVNKDKFSKVFWYGIKNYRTWVFFVLYGFSMGIELTTNN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             +I+E+ +DRF+LKLHTAG IAATFGMAN+ ARPFGG+ASD A + FGMRGRLWTLWI QT
Sbjct  301   IISEFMYDRFNLKLHTAGTIAATFGMANIFARPFGGYASDVAGRLFGMRGRLWTLWIFQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRA +LP+AV  M++FS+G QAACGATFGI PF+SRRSLG++SGLTGAGGN
Sbjct  361   LGGVFCVWLGRAESLPIAVVAMVLFSMGTQAACGATFGIVPFVSRRSLGVLSGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL FFS SKFSTA+G+S MG + +ACTLPV L+HFPQWG M  P SKD  R  E
Sbjct  421   FGSGLTQLAFFSNSKFSTATGISLMGALTVACTLPVALIHFPQWGSMLLPPSKDPQRSNE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEW EEEK +GMH+ SLKFAENS+SERGKR
Sbjct  481   EYYYSSEWTEEEKLRGMHEGSLKFAENSKSERGKR  515



>ref|XP_006488041.1| PREDICTED: high affinity nitrate transporter 2.6-like [Citrus 
sinensis]
Length=535

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/515 (75%), Positives = 447/515 (87%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA  EGS GSSMHGV  RE   +  V SP VPTDTT KF LPVDSEH+AK FK+FS A P
Sbjct  1     MAQNEGSLGSSMHGVIAREQTFALEVVSPSVPTDTTVKFDLPVDSEHRAKAFKVFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+W+SFFTCF+STFAAAPLVPIIRDNLNL K+D+GNAGVASVSGSI SRL+MGA
Sbjct  61    HMRTFHLAWVSFFTCFISTFAAAPLVPIIRDNLNLTKTDVGNAGVASVSGSIFSRLIMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDL+GPRYG +FL++L+AP VFCMSFVS A GY+A RFMIGF LATFVSCQYW + MFN
Sbjct  121   VCDLIGPRYGTSFLLLLSAPAVFCMSFVSDAQGYIAARFMIGFCLATFVSCQYWTTIMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KI+GL NG A GWG+MGGG TQLLMP+++++I+ AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   GKILGLVNGCAGGWGDMGGGVTQLLMPLVFEVIKLAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKGN+NKDKFSKVFWY + NYRTW+F +LYG+SMG+EL+T+N
Sbjct  241   LVLTLGQDLPDGNLGALQKKGNVNKDKFSKVFWYGIKNYRTWVFFVLYGFSMGIELTTNN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             +I+E+ +DRF+LKLHTAG IAATFGMAN+ ARPFGG+ASD A + FGMRGRLWTLWI QT
Sbjct  301   IISEFMYDRFNLKLHTAGTIAATFGMANIFARPFGGYASDVAGRLFGMRGRLWTLWIFQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRA +LP+AV  M++FS+G QAACGATFGI PF+SRRSLGI+SGLTGAGGN
Sbjct  361   LGGVFCVWLGRAESLPIAVVAMVLFSMGTQAACGATFGIVPFVSRRSLGILSGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL FFS SKFSTA+G+S MG + +ACTLPV L+HFPQWG M  P SKD  R  E
Sbjct  421   FGSGLTQLAFFSNSKFSTATGISLMGALTVACTLPVALIHFPQWGSMLLPPSKDPQRSNE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEW EEEK +GMH+ SLKFAENS+SERGKR
Sbjct  481   EYYYSSEWTEEEKLRGMHEGSLKFAENSKSERGKR  515



>ref|XP_007016831.1| High affinity nitrate transporter 2.6 [Theobroma cacao]
 gb|EOY34450.1| High affinity nitrate transporter 2.6 [Theobroma cacao]
Length=534

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/515 (76%), Positives = 451/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MAD EGS G+SMHGVTGRE   + + AS  +PTDTTAKFALPVDSEH+A+VFK+FS A P
Sbjct  1     MADNEGSFGTSMHGVTGREQTFALSAASADIPTDTTAKFALPVDSEHRAQVFKVFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+WISFFTCF+STFAAAPLVPIIRDNL+L ++DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLAWISFFTCFISTFAAAPLVPIIRDNLDLKQADIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDL+GPRYG AFL+ML+APTVFCMSFVS A GY+AVRFMIGF LATFVSCQYW + MFN
Sbjct  121   VCDLIGPRYGTAFLLMLSAPTVFCMSFVSDAQGYLAVRFMIGFCLATFVSCQYWTTIMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NG A GWG+MGGG TQLLMP+ Y +IR AGATPF+AWRIAFFIPGW HV+MGI
Sbjct  181   GKIIGLVNGCAGGWGDMGGGVTQLLMPLAYHLIRLAGATPFTAWRIAFFIPGWFHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG + KDKFSKVF YAVTNYRTWIF LLYG+SMG+EL+ +N
Sbjct  241   LVLTLGQDLPDGNLRTLQKKGEVAKDKFSKVFRYAVTNYRTWIFFLLYGFSMGIELTINN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VI+ YF+DRF+LKLHTAG IAA+FGMAN  ARPFGG+ASD AA+  GMRGRLW LW+ QT
Sbjct  301   VISGYFYDRFNLKLHTAGTIAASFGMANFFARPFGGYASDVAARLLGMRGRLWILWLFQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LG A++LP+AV  MI+FS+G QAACGATFG+ PF+SRRSLG+ISGLTGAGGN
Sbjct  361   LGGVFCIWLGLADSLPIAVLAMILFSLGTQAACGATFGVVPFVSRRSLGLISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFS S+FSTA+GLS MG   + CT+PV L+HFPQWG MFFP SKD V+ TE
Sbjct  421   FGSGLTQLVFFSGSRFSTATGLSLMGATAVVCTIPVALLHFPQWGSMFFPPSKDPVKSTE  480

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEW E+EKQ+G+H+ S+KFAENSRSERGKR
Sbjct  481   EYYYMSEWTEDEKQQGLHEGSVKFAENSRSERGKR  515



>gb|ADA83726.1| NRT2 [Manihot esculenta]
Length=524

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/510 (78%), Positives = 443/510 (87%), Gaps = 4/510 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G+PGSS+HGVTGREP  +F+       ++   KF LPVDSEHKAK  +LFS+ANPHMRTF
Sbjct  5     GAPGSSLHGVTGREPAFAFSTEHEEAASNG-GKFDLPVDSEHKAKSVRLFSVANPHMRTF  63

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRL MGA+CDLL
Sbjct  64    HLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKVDIGNAGVASVSGSIFSRLAMGAICDLL  123

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAFLIMLTAPTVFCMSFVSSAGGY+AVRFMIGFSLATFVSCQYWMSTMFNSKIIG
Sbjct  124   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYIAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  183

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTL  823
             L NGTAAGWGNMGGGATQL+MP++YD+I++AGATPF+AWRIAFF+PG LHV+MGILVLTL
Sbjct  184   LVNGTAAGWGNMGGGATQLIMPLVYDVIQRAGATPFTAWRIAFFVPGCLHVIMGILVLTL  243

Query  824   GQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEY  1003
             GQDLPDGNLG+LQKKG++ +DKFSKV WYA+TNYRTWIF LLYG SMGVELSTDNVIAEY
Sbjct  244   GQDLPDGNLGALQKKGDVARDKFSKVLWYAITNYRTWIFVLLYGISMGVELSTDNVIAEY  303

Query  1004  FFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLF  1183
              +DRFDL L  AG IAA FGMAN+VARP GG  SD  A+++GMR RLW +WILQT GG F
Sbjct  304   MYDRFDLDLRVAGTIAACFGMANIVARPMGGIMSDMGARYWGMRARLWNIWILQTAGGAF  363

Query  1184  CFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGL  1363
             C  LGRA+TLP++V  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGNFG+GL
Sbjct  364   CLWLGRASTLPVSVVAMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGNFGAGL  423

Query  1364  TQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYC  1543
             TQL+FF++S +ST  GL YMGIMIMACTLPV  VHFPQWG MFFP S  A    EE YY 
Sbjct  424   TQLLFFTSSTYSTGRGLEYMGIMIMACTLPVVFVHFPQWGSMFFPPSATA---DEEGYYA  480

Query  1544  SEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             SEWN++EK KG+H  SLKFAENSRSERGKR
Sbjct  481   SEWNDDEKSKGLHSASLKFAENSRSERGKR  510



>gb|EAY84173.1| hypothetical protein OsI_05552 [Oryza sativa Indica Group]
Length=533

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/510 (76%), Positives = 441/510 (86%), Gaps = 3/510 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G+PGSS+HGVTGREP  +F+           +KF LPVDSEHKAK  +L S ANPHMRTF
Sbjct  7     GAPGSSLHGVTGREPAFAFSTEVGGDDAAAASKFDLPVDSEHKAKTIRLLSFANPHMRTF  66

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSWISFF+CFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGAVCD+L
Sbjct  67    HLSWISFFSCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLAMGAVCDML  126

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAFLIML APTVFCMS + SA GY+AVRF+IGFSLATFVSCQYWMSTMFNSKIIG
Sbjct  127   GPRYGCAFLIMLAAPTVFCMSLIDSAAGYIAVRFLIGFSLATFVSCQYWMSTMFNSKIIG  186

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTL  823
             L NG AAGWGNMGGGATQL+MP++YD+IRK GATPF+AWR+A+F+PG LHVVMG+LVLTL
Sbjct  187   LVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRLAYFVPGTLHVVMGVLVLTL  246

Query  824   GQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEY  1003
             GQDLPDGNL SLQKKG++N+D FS+V WYAVTNYRTWIF LLYGYSMGVEL+TDNVIAEY
Sbjct  247   GQDLPDGNLRSLQKKGDVNRDSFSRVLWYAVTNYRTWIFVLLYGYSMGVELTTDNVIAEY  306

Query  1004  FFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLF  1183
             F+DRFDL L  AGIIAA+FGMAN+VARP GG  SD  A++FGMR RLW +WILQT GG F
Sbjct  307   FYDRFDLDLRVAGIIAASFGMANIVARPTGGLLSDLGARYFGMRARLWNIWILQTAGGAF  366

Query  1184  CFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGL  1363
             C LLGRA+TLP +V  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGNFG+GL
Sbjct  367   CLLLGRASTLPTSVVCMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGNFGAGL  426

Query  1364  TQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYC  1543
             TQL+FF++S++ST +GL YMGIMIMACTLPV LVHFPQWG MF P +  A    EEHYY 
Sbjct  427   TQLLFFTSSRYSTGTGLEYMGIMIMACTLPVVLVHFPQWGSMFLPPNAGA---EEEHYYG  483

Query  1544  SEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             SEW+E+EK KG+H  SLKFAENSRSERG+R
Sbjct  484   SEWSEQEKSKGLHGASLKFAENSRSERGRR  513



>ref|NP_001045658.1| Os02g0112100 [Oryza sativa Japonica Group]
 ref|NP_001045659.1| Os02g0112600 [Oryza sativa Japonica Group]
 sp|P0DKG9.1|NRT21_ORYSJ RecName: Full=High-affinity nitrate transporter 2.1; Short=OsNRT2.1 
[Oryza sativa Japonica Group]
 sp|P0DKH0.1|NRT22_ORYSJ RecName: Full=High-affinity nitrate transporter 2.2; Short=OsNRT2.2 
[Oryza sativa Japonica Group]
 dbj|BAA33382.1| high affinity nitrate transporter [Oryza sativa]
 dbj|BAD07627.1| high affinity nitrate transporter [Oryza sativa Japonica Group]
 dbj|BAD07629.1| high affinity nitrate transporter [Oryza sativa Japonica Group]
 dbj|BAD07851.1| high affinity nitrate transporter [Oryza sativa Japonica Group]
 dbj|BAD07853.1| high affinity nitrate transporter [Oryza sativa Japonica Group]
 dbj|BAF07572.1| Os02g0112100 [Oryza sativa Japonica Group]
 dbj|BAF07573.1| Os02g0112600 [Oryza sativa Japonica Group]
 gb|EAZ21473.1| hypothetical protein OsJ_05080 [Oryza sativa Japonica Group]
 dbj|BAG98877.1| unnamed protein product [Oryza sativa Japonica Group]
Length=533

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/510 (76%), Positives = 441/510 (86%), Gaps = 3/510 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G+PGSS+HGVTGREP  +F+           +KF LPVDSEHKAK  +L S ANPHMRTF
Sbjct  7     GAPGSSLHGVTGREPAFAFSTEVGGEDAAAASKFDLPVDSEHKAKTIRLLSFANPHMRTF  66

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSWISFF+CFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGA+CD+L
Sbjct  67    HLSWISFFSCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLAMGAICDML  126

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAFLIML APTVFCMS + SA GY+AVRF+IGFSLATFVSCQYWMSTMFNSKIIG
Sbjct  127   GPRYGCAFLIMLAAPTVFCMSLIDSAAGYIAVRFLIGFSLATFVSCQYWMSTMFNSKIIG  186

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTL  823
             L NG AAGWGNMGGGATQL+MP++YD+IRK GATPF+AWR+A+F+PG LHVVMG+LVLTL
Sbjct  187   LVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRLAYFVPGTLHVVMGVLVLTL  246

Query  824   GQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEY  1003
             GQDLPDGNL SLQKKG++N+D FS+V WYAVTNYRTWIF LLYGYSMGVEL+TDNVIAEY
Sbjct  247   GQDLPDGNLRSLQKKGDVNRDSFSRVLWYAVTNYRTWIFVLLYGYSMGVELTTDNVIAEY  306

Query  1004  FFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLF  1183
             F+DRFDL L  AGIIAA+FGMAN+VARP GG  SD  A++FGMR RLW +WILQT GG F
Sbjct  307   FYDRFDLDLRVAGIIAASFGMANIVARPTGGLLSDLGARYFGMRARLWNIWILQTAGGAF  366

Query  1184  CFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGL  1363
             C LLGRA+TLP +V  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGNFG+GL
Sbjct  367   CLLLGRASTLPTSVVCMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGNFGAGL  426

Query  1364  TQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYC  1543
             TQL+FF++S++ST +GL YMGIMIMACTLPV LVHFPQWG MF P +  A    EEHYY 
Sbjct  427   TQLLFFTSSRYSTGTGLEYMGIMIMACTLPVVLVHFPQWGSMFLPPNAGA---EEEHYYG  483

Query  1544  SEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             SEW+E+EK KG+H  SLKFAENSRSERG+R
Sbjct  484   SEWSEQEKSKGLHGASLKFAENSRSERGRR  513



>ref|XP_004952141.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Setaria 
italica]
Length=527

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/518 (77%), Positives = 441/518 (85%), Gaps = 12/518 (2%)
 Frame = +2

Query  89    MADIE-GSPGSSMHGVTGREPVLSFAVASPIVPTDTTA--KFALPVDSEHKAKVFKLFSL  259
             MAD E G+PGSS+HG+TGREP  +F+        D TA  KF LPVDSEHKAK  +LFS 
Sbjct  1     MADGERGAPGSSLHGMTGREPTFAFST------EDATAASKFDLPVDSEHKAKTIRLFSF  54

Query  260   ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLV  439
             ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL 
Sbjct  55    ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLA  114

Query  440   MGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMST  619
             MGAVCDLLGPRYGCAFLIML APTVFCM+ +  A GY+ VRF+IGFSLATFVSCQYWMST
Sbjct  115   MGAVCDLLGPRYGCAFLIMLAAPTVFCMAIIDDAAGYIVVRFLIGFSLATFVSCQYWMST  174

Query  620   MFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVV  799
             MFNSKIIG  NG AAGWGNMGGGATQL+MP++YDIIRK GATPF+AWR+A+F+PG LH+V
Sbjct  175   MFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVYDIIRKCGATPFTAWRLAYFVPGSLHIV  234

Query  800   MGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             MGILVLT+GQDLPDGNL SLQKKG+ NKDKFSKV WYA+TNYRTWIF LLYGY MGVEL+
Sbjct  235   MGILVLTMGQDLPDGNLRSLQKKGDANKDKFSKVMWYAITNYRTWIFVLLYGYCMGVELT  294

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
             TDNVIAEY+FD F+L L  AGIIAA FGMAN+VARP GG  SD  A+++GMR RLW +WI
Sbjct  295   TDNVIAEYYFDHFNLDLRVAGIIAACFGMANIVARPLGGILSDVGARYWGMRARLWNIWI  354

Query  1160  LQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGA  1339
             LQT GG FC  LGRA TLP ++T M++FS  AQAACGA FG+TPFISRRSLGIISG+TGA
Sbjct  355   LQTAGGAFCLWLGRATTLPASITAMVLFSFCAQAACGAIFGVTPFISRRSLGIISGMTGA  414

Query  1340  GGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVR  1519
             GGNFG+GLTQL+FF++SK+ST  GL YMGIMIMACTLPV  VHFPQWG M FPA+  AV 
Sbjct  415   GGNFGAGLTQLLFFTSSKYSTGMGLEYMGIMIMACTLPVVFVHFPQWGSMLFPANAGAV-  473

Query  1520  GTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EEHYY SEWNEEEK KG+H  SLKFAEN RSERGKR
Sbjct  474   --EEHYYSSEWNEEEKSKGLHSASLKFAENCRSERGKR  509



>ref|XP_002453159.1| hypothetical protein SORBIDRAFT_04g001000 [Sorghum bicolor]
 gb|EES06135.1| hypothetical protein SORBIDRAFT_04g001000 [Sorghum bicolor]
Length=527

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/515 (76%), Positives = 441/515 (86%), Gaps = 5/515 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTA--KFALPVDSEHKAKVFKLFSLANP  268
             +  G+PGSS+HG+TGREP  +F+ A+P    D  A  KF LPVDSEHKAK  +LFS ANP
Sbjct  2     EAAGAPGSSLHGMTGREPAFAFSTAAPEHDGDDAAASKFDLPVDSEHKAKSIRLFSFANP  61

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGA
Sbjct  62    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLTMGA  121

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFLIML+APTVFCM+ +  A GY+ VRF+IGFSLATFVSCQYWMSTMFN
Sbjct  122   VCDLLGPRYGCAFLIMLSAPTVFCMALIDDAAGYIVVRFLIGFSLATFVSCQYWMSTMFN  181

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIG  NG AAGWGNMGGGATQL+MP++YD+IRK GATPF+AWR+A+F+PG +HVVMG+
Sbjct  182   SKIIGTVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRVAYFVPGLMHVVMGV  241

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKGN+NKDKFSKV WYA+ NYRTWIF LLYGYSMGVEL+TDN
Sbjct  242   LVLTLGQDLPDGNLRTLQKKGNVNKDKFSKVMWYALINYRTWIFVLLYGYSMGVELTTDN  301

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEY +DRFDL L  AG IAA FGMANLVARP GG  SD  A+++GMR RLW +WILQT
Sbjct  302   VIAEYMYDRFDLDLRVAGTIAACFGMANLVARPMGGVLSDVGARYWGMRARLWNIWILQT  361

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GG FC  LGRA+TLP+++  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGN
Sbjct  362   AGGAFCLWLGRASTLPVSIVAMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGN  421

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FG+GLTQL+FF++S +STA GL YMGIMIMACTLPV  VHFPQWG MFFPAS  A    E
Sbjct  422   FGAGLTQLLFFTSSTYSTARGLEYMGIMIMACTLPVVFVHFPQWGSMFFPASATA---DE  478

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEWN++EK KG+H  SLKFAENSRSERGKR
Sbjct  479   ETYYASEWNDDEKSKGLHSASLKFAENSRSERGKR  513



>ref|XP_002451375.1| hypothetical protein SORBIDRAFT_04g000990 [Sorghum bicolor]
 gb|EES04351.1| hypothetical protein SORBIDRAFT_04g000990 [Sorghum bicolor]
Length=527

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/512 (76%), Positives = 440/512 (86%), Gaps = 5/512 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTA--KFALPVDSEHKAKVFKLFSLANPHMR  277
             G+PGSS+HG+TGREP  +F+ A+P    D  A  KF LPVDSEHKAK  +LFS ANPHMR
Sbjct  5     GAPGSSLHGMTGREPAFAFSTAAPEHDGDDAAASKFDLPVDSEHKAKSIRLFSFANPHMR  64

Query  278   TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCD  457
             TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGAVCD
Sbjct  65    TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLTMGAVCD  124

Query  458   LLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKI  637
             LLGPRYGCAFLIML+APTVFCM+ +  A GY+ VRF+IGFSLATFVSCQYWMSTMFNSKI
Sbjct  125   LLGPRYGCAFLIMLSAPTVFCMALIDDAAGYIVVRFLIGFSLATFVSCQYWMSTMFNSKI  184

Query  638   IGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVL  817
             IG  NG AAGWGNMGGGATQL+MP++YD+IRK GATPF+AWR+A+F+PG +HVVMG+LVL
Sbjct  185   IGTVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRVAYFVPGLMHVVMGVLVL  244

Query  818   TLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIA  997
             TLGQDLPDGNL +LQKKGN+NKDKFSKV WYA+ NYRTWIF LLYGYSMGVEL+TDNVIA
Sbjct  245   TLGQDLPDGNLRTLQKKGNVNKDKFSKVMWYALINYRTWIFVLLYGYSMGVELTTDNVIA  304

Query  998   EYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGG  1177
             EY +DRFDL L  AG IAA FGMANLVARP GG  SD  A+++GMR RLW +WILQT GG
Sbjct  305   EYMYDRFDLDLRVAGTIAACFGMANLVARPMGGVLSDVGARYWGMRARLWNIWILQTAGG  364

Query  1178  LFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGS  1357
              FC  LGRA+TLP+++  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGNFG+
Sbjct  365   AFCLWLGRASTLPVSIVAMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGNFGA  424

Query  1358  GLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHY  1537
             GLTQL+FF++S +STA GL YMGIMIMACTLPV  VHFPQWG MFFPAS  A    EE Y
Sbjct  425   GLTQLLFFTSSTYSTARGLEYMGIMIMACTLPVVFVHFPQWGSMFFPASATA---DEEGY  481

Query  1538  YCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             Y SEWN++EK KG+H  SLKFAENSRSERGKR
Sbjct  482   YASEWNDDEKSKGLHAASLKFAENSRSERGKR  513



>ref|XP_010685329.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Beta vulgaris 
subsp. vulgaris]
Length=527

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/512 (75%), Positives = 446/512 (87%), Gaps = 3/512 (1%)
 Frame = +2

Query  98    IEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMR  277
             + G PGSSMHGVTGRE   +F+V+   VP D TAKFALPVD+EHKA   K+FSLA PHM 
Sbjct  1     MAGEPGSSMHGVTGREQTFAFSVSPSTVPVDPTAKFALPVDAEHKATRLKIFSLAKPHMT  60

Query  278   TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCD  457
             TFHLSWISF TC++STFAAAPLVPIIRDNL+L + DIGNA VASVSGS+ SRL+MG +CD
Sbjct  61    TFHLSWISFCTCYISTFAAAPLVPIIRDNLDLTRRDIGNASVASVSGSVFSRLIMGTLCD  120

Query  458   LLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKI  637
             L+GPRY CAFL+MLTAPTVFCMS +  A GYVAVRFMIGF LATFVSCQYWMSTMFN +I
Sbjct  121   LMGPRYACAFLVMLTAPTVFCMSLIEDASGYVAVRFMIGFCLATFVSCQYWMSTMFNGRI  180

Query  638   IGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVL  817
             IGL NGTAAGWGN+GGGATQLLMP++Y++IR+ G++PF+AWRI+FFIPG LH++MGILVL
Sbjct  181   IGLVNGTAAGWGNVGGGATQLLMPLIYEVIRRTGSSPFTAWRISFFIPGILHIIMGILVL  240

Query  818   TLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIA  997
             TLGQDLPDGNLG+LQKKG ++KDKF+KV WYA++NYRTW+F LLYGYS+GVEL+TDNVIA
Sbjct  241   TLGQDLPDGNLGALQKKGEVSKDKFTKVLWYAISNYRTWVFVLLYGYSLGVELTTDNVIA  300

Query  998   EYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGG  1177
             EYFFDRF+LKLHTAGIIAA+FGMANL +RP GG ASD++A++FGMRGRLWTLWI QT GG
Sbjct  301   EYFFDRFNLKLHTAGIIAASFGMANLFSRPLGGLASDWSARYFGMRGRLWTLWIFQTAGG  360

Query  1178  LFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGS  1357
             LFC  LG A TLP AV  +I+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN GS
Sbjct  361   LFCVWLGLAKTLPTAVVALILFSLGAQAACGATFGIVPFISRRSLGIISGLTGAGGNIGS  420

Query  1358  GLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHY  1537
             GLTQ IFF+T  FST  GL+YMGIM +ACTLPV LVHFPQWG MF P SK A    EE Y
Sbjct  421   GLTQFIFFTTDTFSTHEGLTYMGIMTIACTLPVALVHFPQWGSMFLPPSKSA---NEEAY  477

Query  1538  YCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             Y SE+N++EK+KGMH+ S+KFAE+SRSERG++
Sbjct  478   YVSEYNDDEKRKGMHEGSVKFAESSRSERGRK  509



>ref|XP_004952143.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Setaria 
italica]
Length=527

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/518 (76%), Positives = 441/518 (85%), Gaps = 12/518 (2%)
 Frame = +2

Query  89    MADIE-GSPGSSMHGVTGREPVLSFAVASPIVPTDTTA--KFALPVDSEHKAKVFKLFSL  259
             MAD E G+PGSS+HG+TGREP  +F+        D TA  KF LPVDSEHKAK  +LFS 
Sbjct  1     MADRERGAPGSSLHGMTGREPTFAFST------EDATAASKFDLPVDSEHKAKTIRLFSF  54

Query  260   ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLV  439
             ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL 
Sbjct  55    ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLA  114

Query  440   MGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMST  619
             MGAVCDLLGPRYGCAFLIML APTVFCM+ +  A GY+ VRF+IGFSLATFVSCQYWMST
Sbjct  115   MGAVCDLLGPRYGCAFLIMLAAPTVFCMAIIDDAAGYIVVRFLIGFSLATFVSCQYWMST  174

Query  620   MFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVV  799
             MFNSKIIG  NG AAGWGNMGGGATQL+MP++YDIIRK GATPF+AWR+A+F+PG LH+V
Sbjct  175   MFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVYDIIRKCGATPFTAWRLAYFVPGSLHIV  234

Query  800   MGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             MGILVLT+GQDLPDGNL SLQKKG+ NKDKFSKV WYA+TNYRTW+F LLYGY MGVEL+
Sbjct  235   MGILVLTMGQDLPDGNLRSLQKKGDANKDKFSKVMWYAITNYRTWVFVLLYGYCMGVELT  294

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
             TDNVIAEY+FD F+L L  AGIIAA FGMAN+VARP GG  SD  A+++GMR RLW +WI
Sbjct  295   TDNVIAEYYFDHFNLDLRVAGIIAACFGMANIVARPLGGILSDVGARYWGMRARLWNIWI  354

Query  1160  LQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGA  1339
             LQT GG FC  LGRA TLP ++T M++FS  AQAACGA FG+TPFISRRSLGIISG+TGA
Sbjct  355   LQTAGGAFCLWLGRATTLPASITAMVLFSFCAQAACGAIFGVTPFISRRSLGIISGMTGA  414

Query  1340  GGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVR  1519
             GGNFG+GLTQL+FF++SK+ST  GL YMGIMIMACTLPV  VHFPQWG M FPA+  AV 
Sbjct  415   GGNFGAGLTQLLFFTSSKYSTGMGLEYMGIMIMACTLPVVFVHFPQWGSMLFPANAGAV-  473

Query  1520  GTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EEHYY SEWNEEEK KG+H  SLKFAEN RSERG+R
Sbjct  474   --EEHYYSSEWNEEEKSKGLHSASLKFAENCRSERGRR  509



>ref|XP_002892435.1| ATNRT2:1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68694.1| ATNRT2:1 [Arabidopsis lyrata subsp. lyrata]
Length=524

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/513 (76%), Positives = 443/513 (86%), Gaps = 1/513 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+V +P VPT+T  K+ LPVD+E KA VFKLFS A P
Sbjct  1     MGDSNGEPGSSMHGVTGREQSYAFSVDTPTVPTNTKKKYNLPVDAEDKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPL+PIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLIPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMF 
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFT  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWRIAFF+PGWLH++MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRCGSTAFTAWRIAFFVPGWLHIIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLP GN  +++K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLTLGQDLPGGNRAAMEKSGEVAKDKFGKILWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AA+ FGMRGRLWTLWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAACFGMANFFARPAGGWASDIAARRFGMRGRLWTLWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  361   AGGLFCVWLGRANTLVTAVVSMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTS+F+T  GL++MG+MI+ACTLPVTL+HFPQWG MF P S D++  T 
Sbjct  421   FGSGLTQLVFFSTSRFTTEEGLTWMGVMIVACTLPVTLIHFPQWGSMFLPPSNDSIDAT-  479

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERG  1627
             EHYY SE+N++E+Q GMH  S+KFAE +R+E G
Sbjct  480   EHYYVSEYNKQEQQDGMHLKSIKFAEGARTEGG  512



>ref|XP_004952140.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Setaria 
italica]
Length=526

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/516 (77%), Positives = 440/516 (85%), Gaps = 12/516 (2%)
 Frame = +2

Query  95    DIE-GSPGSSMHGVTGREPVLSFAVASPIVPTDTTA--KFALPVDSEHKAKVFKLFSLAN  265
             D+E G+PGSS+HG+TGREP  +F+        D TA  KF LPVDSEHKAK  +LFS AN
Sbjct  2     DMERGAPGSSLHGMTGREPTFAFST------EDATAASKFDLPVDSEHKAKTIRLFSFAN  55

Query  266   PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMG  445
             PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MG
Sbjct  56    PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLAMG  115

Query  446   AVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF  625
             AVCDLLGPRYGCAFLIML APTVFCM+ +  A GY+ VRF+IGFSLATFVSCQYWMSTMF
Sbjct  116   AVCDLLGPRYGCAFLIMLAAPTVFCMAIIDDAAGYIVVRFLIGFSLATFVSCQYWMSTMF  175

Query  626   NSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMG  805
             NSKIIG  NG AAGWGNMGGGATQL+MP++YDIIRK GATPF+AWR+A+F+PG LH+VMG
Sbjct  176   NSKIIGTVNGLAAGWGNMGGGATQLIMPLVYDIIRKCGATPFTAWRLAYFVPGSLHIVMG  235

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             ILVLT+GQDLPDGNL SLQKKG+ NKDKFSKV WYA+TNYRTWIF LLYGY MGVEL+TD
Sbjct  236   ILVLTMGQDLPDGNLRSLQKKGDANKDKFSKVMWYAITNYRTWIFVLLYGYCMGVELTTD  295

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             NVIAEY+FD F+L L  AGIIAA FGMAN+VARP GG  SD  A+++GMR RLW +WILQ
Sbjct  296   NVIAEYYFDHFNLDLRVAGIIAACFGMANIVARPLGGILSDVGARYWGMRARLWNIWILQ  355

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T GG FC  LGRA TLP ++T M++FS  AQAACGA FG+TPFISRRSLGIISG+TGAGG
Sbjct  356   TAGGAFCLWLGRATTLPASITAMVLFSFCAQAACGAIFGVTPFISRRSLGIISGMTGAGG  415

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             NFG+GLTQL+FF++SK+ST  GL YMGIMIMACTLPV  VHFPQWG M FPA+  AV   
Sbjct  416   NFGAGLTQLLFFTSSKYSTGMGLEYMGIMIMACTLPVVFVHFPQWGSMLFPANAGAV---  472

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EEHYY SEWNEEEK KG+H  SLKFAEN RSERGKR
Sbjct  473   EEHYYSSEWNEEEKSKGLHSASLKFAENCRSERGKR  508



>gb|KHN06867.1| High affinity nitrate transporter 2.4 [Glycine soja]
Length=484

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/515 (77%), Positives = 441/515 (86%), Gaps = 46/515 (9%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+IEGSPGSSMHGVTGRE     ++ASPIVPTDTTAKFALPVDSEHKAK+FKLFS+ANP
Sbjct  1     MAEIEGSPGSSMHGVTGREQTFVASIASPIVPTDTTAKFALPVDSEHKAKIFKLFSMANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRL MGA
Sbjct  61    HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLAMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLG                                              YWMSTMFN
Sbjct  121   VCDLLG----------------------------------------------YWMSTMFN  134

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGLANGTAAGWGNMGGGATQL+MP++Y++IR+AGATPF+AWRIAFF+PG++HV+MGI
Sbjct  135   SKIIGLANGTAAGWGNMGGGATQLIMPLVYELIRRAGATPFTAWRIAFFVPGFMHVIMGI  194

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNL +LQKKG++ KDKFSKV WYA+TNYRTWIFALLYGYSMGVEL+TDN
Sbjct  195   LVLTLGQDLPDGNLAALQKKGDVAKDKFSKVLWYAITNYRTWIFALLYGYSMGVELTTDN  254

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRF+LKLHTAGIIAA+FGMANLVARPFGG+ASD AA+ FGMRGRLWTLWILQT
Sbjct  255   VIAEYFYDRFNLKLHTAGIIAASFGMANLVARPFGGYASDVAARLFGMRGRLWTLWILQT  314

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRAN+LP+A+  MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  315   LGGVFCIWLGRANSLPIAILAMILFSLGAQAACGATFGIIPFISRRSLGIISGLTGAGGN  374

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL+FFSTSKFSTA+GLS MG+MI+ACTLPV++VHFPQWG MF P SKD  + TE
Sbjct  375   FGSGLTQLVFFSTSKFSTATGLSLMGVMIVACTLPVSVVHFPQWGSMFLPPSKDVNKSTE  434

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEWNEEE+QKG+HQ SLKFAENSRSERGKR
Sbjct  435   EFYYTSEWNEEERQKGLHQQSLKFAENSRSERGKR  469



>ref|XP_010683900.1| PREDICTED: high affinity nitrate transporter 2.4-like [Beta vulgaris 
subsp. vulgaris]
Length=529

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/511 (75%), Positives = 441/511 (86%), Gaps = 1/511 (0%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G  GSSMHGVTG+E   +F+VASP VPTDTTAKFALPVDSEHKAKVFK+FSLA PHMR F
Sbjct  2     GELGSSMHGVTGKERTQAFSVASPEVPTDTTAKFALPVDSEHKAKVFKIFSLAKPHMRAF  61

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HL+W SFFTC VSTFAAAPL+PIIRDNLNL + DIGNAGVASVSGSI SRL MGAVCDL+
Sbjct  62    HLAWFSFFTCVVSTFAAAPLLPIIRDNLNLTQIDIGNAGVASVSGSIFSRLAMGAVCDLI  121

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAF++MLTAP VF MS V SA GY  VRF+IGFSLATFVSCQYW+STMFNS+IIG
Sbjct  122   GPRYGCAFILMLTAPAVFGMSMVESAIGYTTVRFLIGFSLATFVSCQYWVSTMFNSQIIG  181

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGAT-PFSAWRIAFFIPGWLHVVMGILVLT  820
               +G  +GWG+MGGGATQLLMPV+++II++AG T PF AWRIAFFIPG L ++MGIL+LT
Sbjct  182   SVSGITSGWGDMGGGATQLLMPVMFEIIQRAGGTTPFMAWRIAFFIPGCLQLIMGILILT  241

Query  821   LGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAE  1000
              GQDLPDGNL  LQ KG+++KDKFSKV WYA+TNYRTWIF ++YGYSMGV+L+T+N+IA+
Sbjct  242   FGQDLPDGNLSELQNKGDVSKDKFSKVCWYAITNYRTWIFVMVYGYSMGVQLTTNNIIAQ  301

Query  1001  YFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGL  1180
             YFFDRF+LKLHTAG IA  FGMANLV+RPFGGFASD +A+ FGMRGRLW LW+ QT+GG+
Sbjct  302   YFFDRFNLKLHTAGFIATGFGMANLVSRPFGGFASDLSARLFGMRGRLWILWLFQTLGGV  361

Query  1181  FCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSG  1360
             FC  LG ANT+P+AV  M+ FS GAQAACGAT+GI PFISRRSLGIISGLTGAGGN GS 
Sbjct  362   FCVWLGLANTVPVAVVAMVFFSFGAQAACGATYGIVPFISRRSLGIISGLTGAGGNLGSM  421

Query  1361  LTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYY  1540
             +TQLIFFSTS+++T  GL YMG+M +ACTLPV LV FPQWGGMF P S D ++  EEHYY
Sbjct  422   ITQLIFFSTSRYTTEQGLVYMGVMAIACTLPVALVQFPQWGGMFLPPSSDPMKSNEEHYY  481

Query  1541  CSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              SEW+E E QKGMH NS+ FAENSRSERGKR
Sbjct  482   SSEWSEAEIQKGMHSNSIMFAENSRSERGKR  512



>ref|XP_002313529.2| hypothetical protein POPTR_0009s01410g [Populus trichocarpa]
 gb|EEE87484.2| hypothetical protein POPTR_0009s01410g [Populus trichocarpa]
Length=469

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/454 (86%), Positives = 429/454 (94%), Gaps = 0/454 (0%)
 Frame = +2

Query  272   MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAV  451
             MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI SRLVMGAV
Sbjct  1     MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIFSRLVMGAV  60

Query  452   CDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS  631
             CDLLGPRYGCAFLIML+APTVFCMSFV+SAGGY+AVRFMIGFSLATFVSCQYWMSTMFNS
Sbjct  61    CDLLGPRYGCAFLIMLSAPTVFCMSFVNSAGGYLAVRFMIGFSLATFVSCQYWMSTMFNS  120

Query  632   KIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGIL  811
             KIIGL NGTAAGWGNMGGGATQL+MP++Y++I++AG+T FSAWRIAFF PGWLH++MGIL
Sbjct  121   KIIGLVNGTAAGWGNMGGGATQLVMPLVYELIKRAGSTSFSAWRIAFFFPGWLHIIMGIL  180

Query  812   VLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNV  991
             VL LGQDLPDGNLG+L+KKG++ KDKFSKV WYAVTNYRTWIF LLYGYSMGVELSTDNV
Sbjct  181   VLNLGQDLPDGNLGALKKKGDVAKDKFSKVLWYAVTNYRTWIFVLLYGYSMGVELSTDNV  240

Query  992   IAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTM  1171
             IAEYF+DRFDLKLHTAG+IAATFGMANLVARPFGG++SD AA++FGMRGRLW LWILQT+
Sbjct  241   IAEYFYDRFDLKLHTAGVIAATFGMANLVARPFGGYSSDVAARYFGMRGRLWVLWILQTL  300

Query  1172  GGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNF  1351
             GG+FC  LGRAN+LPLAVT MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGNF
Sbjct  301   GGVFCIWLGRANSLPLAVTAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGNF  360

Query  1352  GSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEE  1531
             GSGLTQL+FFS+S  STA+GLS+MG+MI  CTLPVTLV+FPQWGGMFFP SKD V+ TEE
Sbjct  361   GSGLTQLVFFSSSSLSTAAGLSWMGVMICGCTLPVTLVYFPQWGGMFFPPSKDVVKSTEE  420

Query  1532  HYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              YY SEW+E+EKQ+GMHQ SLKFAENSRSERGKR
Sbjct  421   SYYASEWDEDEKQRGMHQKSLKFAENSRSERGKR  454



>ref|XP_006646777.1| PREDICTED: high affinity nitrate transporter 2.4-like [Oryza 
brachyantha]
Length=530

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/510 (76%), Positives = 439/510 (86%), Gaps = 4/510 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G+PGSS+HGVTGREP  +F+  +        +KF+LPVDSEHKAK  +L S A PHMRTF
Sbjct  7     GAPGSSLHGVTGREPAFAFSTEAGGG-GGEESKFSLPVDSEHKAKTIRLLSFARPHMRTF  65

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSWISFF+CFVSTFAAAPLVPIIRDNL+L K+DIGNAGVASVSGSI SRL MGAVCD+L
Sbjct  66    HLSWISFFSCFVSTFAAAPLVPIIRDNLSLTKADIGNAGVASVSGSIFSRLAMGAVCDML  125

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAFLIML APTVFCMS + SA GY+ VRF+IGFSLATFVSCQYWMSTMFNSKIIG
Sbjct  126   GPRYGCAFLIMLAAPTVFCMSLIESAAGYIVVRFLIGFSLATFVSCQYWMSTMFNSKIIG  185

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTL  823
             L NG AAGWGNMGGGATQL+MP++YD+IRK GATPF+AWR+A+F+PG LHVVMGILVLTL
Sbjct  186   LVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRLAYFVPGTLHVVMGILVLTL  245

Query  824   GQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEY  1003
             GQDLPDGNL SLQKKG++NKD FSKV  YAVTNYRTWIF LLYGYSMGVEL+TDNVIAEY
Sbjct  246   GQDLPDGNLRSLQKKGDVNKDSFSKVLRYAVTNYRTWIFVLLYGYSMGVELTTDNVIAEY  305

Query  1004  FFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLF  1183
             F+DRFDL L  AGIIAA+FGMAN+VARP GG  SD  A++FGMR RLW +W+LQT GG F
Sbjct  306   FYDRFDLDLRVAGIIAASFGMANIVARPTGGLLSDLGARYFGMRARLWNIWLLQTAGGAF  365

Query  1184  CFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGL  1363
             C LLGRA+TLP +V  M++FS  AQAACGA FG+ PFISRRSLGIISG+TGAGGNFG+GL
Sbjct  366   CLLLGRASTLPTSVVCMVLFSFCAQAACGAIFGVIPFISRRSLGIISGMTGAGGNFGAGL  425

Query  1364  TQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYC  1543
             TQL+FF++S++ST +GL YMGIMIMACTLPV LVHFPQWG M  P +  A    EEHYY 
Sbjct  426   TQLLFFTSSRYSTGTGLEYMGIMIMACTLPVVLVHFPQWGSMLLPPNAGA---EEEHYYG  482

Query  1544  SEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             SEW++EEK KG+H  SLKFAEN+RSERG+R
Sbjct  483   SEWSDEEKSKGLHGASLKFAENARSERGRR  512



>gb|KDP29155.1| hypothetical protein JCGZ_16544 [Jatropha curcas]
Length=498

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/504 (78%), Positives = 440/504 (87%), Gaps = 21/504 (4%)
 Frame = +2

Query  122   MHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWIS  301
             MHGV+ +E   +F+V +P +PTDTTAKF+LPVDSEHKAK+F LFSLANPHM TFHLSW+S
Sbjct  1     MHGVSAKEQTFAFSVTNPEIPTDTTAKFSLPVDSEHKAKIFNLFSLANPHMTTFHLSWLS  60

Query  302   FFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGC  481
             FFTCF+STFAAAPLVPIIRDNLNL K DIGNAG++SVSGSI SRLVMGA CDLLGPRY C
Sbjct  61    FFTCFISTFAAAPLVPIIRDNLNLTKKDIGNAGISSVSGSIFSRLVMGAACDLLGPRYAC  120

Query  482   AFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangta  661
             AFLIML+APTVFCM+FVSSAGGYVAVRFMIGFSLATFVSCQ+WMS MFN KIIGL NGTA
Sbjct  121   AFLIMLSAPTVFCMAFVSSAGGYVAVRFMIGFSLATFVSCQFWMSCMFNGKIIGLVNGTA  180

Query  662   agwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPD  841
             AGWGNMGGG TQLLMP+LY++IR+ GATPF+AWRIAFFIPGWLHV+MGILVL+LGQDLPD
Sbjct  181   AGWGNMGGGVTQLLMPMLYELIRRCGATPFTAWRIAFFIPGWLHVIMGILVLSLGQDLPD  240

Query  842   GNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFD  1021
             GNL                     VTNYRTWIF LLYG S+GVEL+TDNVIAEYFFDRF+
Sbjct  241   GNL---------------------VTNYRTWIFFLLYGMSLGVELTTDNVIAEYFFDRFN  279

Query  1022  LKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGR  1201
             LKL TAGIIAATFGMAN+ ARP GG  SD AA+ FGMRGRLW L+ILQT+GG+FC  LGR
Sbjct  280   LKLRTAGIIAATFGMANIFARPMGGLMSDMAARRFGMRGRLWNLYILQTLGGIFCISLGR  339

Query  1202  ANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFF  1381
             AN+L L+V +MI+FS+GAQAACGATFGI PFISRRSLGIISGLTGAGGNFGSGLTQL+FF
Sbjct  340   ANSLSLSVLFMILFSLGAQAACGATFGIIPFISRRSLGIISGLTGAGGNFGSGLTQLLFF  399

Query  1382  STSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEE  1561
             +TS FSTA+GLS MGIMI+ACTLPV LVHFPQWG MF PA+K+  +G+EE+YY  EWNEE
Sbjct  400   TTSSFSTATGLSLMGIMIVACTLPVALVHFPQWGSMFLPATKNVEKGSEEYYYGLEWNEE  459

Query  1562  EKQKGMHQNSLKFAENSRSERGKR  1633
             EK+KG+H+ SLKFAENSRSERG+R
Sbjct  460   EKEKGLHRGSLKFAENSRSERGRR  483



>ref|NP_001266351.1| high affinity nitrate transporter [Zea mays]
 gb|ACF85202.1| unknown [Zea mays]
 gb|AFW66807.1| high affinity nitrate transporter [Zea mays]
Length=524

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/510 (76%), Positives = 435/510 (85%), Gaps = 4/510 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G+PGSS+HGVTGREP  +F+       ++   KF LPVDSEHKAK  +LFS+ANPHMRTF
Sbjct  5     GAPGSSLHGVTGREPAFAFSTEHEEAASNG-GKFDLPVDSEHKAKSVRLFSVANPHMRTF  63

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGAVCDLL
Sbjct  64    HLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLTMGAVCDLL  123

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAFLIML+APTVFCMS +  A GY+AVRF+IGFSLATFVSCQYWMSTMF+SKIIG
Sbjct  124   GPRYGCAFLIMLSAPTVFCMSLIDDAAGYIAVRFLIGFSLATFVSCQYWMSTMFSSKIIG  183

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTL  823
               NG AAGWGNMGGGATQL+MP++YD+IRK GATPF+AWR+A+F+PG +HVVMG+LVLTL
Sbjct  184   TVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRLAYFVPGLMHVVMGVLVLTL  243

Query  824   GQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEY  1003
             GQDLPDGNL SLQKKGN+NKD FSKV WYAV NYRTWIF LLYGY MGVEL+TDNVIAEY
Sbjct  244   GQDLPDGNLRSLQKKGNVNKDSFSKVMWYAVINYRTWIFVLLYGYCMGVELTTDNVIAEY  303

Query  1004  FFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLF  1183
              +DRFDL L  AG IAA FGMAN+VARP GG  SD  A+++GMR RLW +WILQT GG F
Sbjct  304   MYDRFDLDLRVAGTIAACFGMANIVARPMGGIMSDMGARYWGMRARLWNIWILQTAGGAF  363

Query  1184  CFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGL  1363
             C  LGRA+TLP++V  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGNFG+GL
Sbjct  364   CLWLGRASTLPVSVVAMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGNFGAGL  423

Query  1364  TQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYC  1543
             TQL+FF++S +ST  GL YMGIMIMACTLPV  VHFPQWG MFFP S  A    EE YY 
Sbjct  424   TQLLFFTSSTYSTGRGLEYMGIMIMACTLPVVFVHFPQWGSMFFPPSATA---DEEGYYA  480

Query  1544  SEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             SEWN++EK KG+H  SLKFAENSRSERGKR
Sbjct  481   SEWNDDEKSKGLHSASLKFAENSRSERGKR  510



>ref|NP_001105780.1| putative high affinity nitrate transporter [Zea mays]
 gb|AAT66252.1| putative high affinity nitrate transporter [Zea mays]
 gb|AFW66805.1| high affinity nitrate transporter [Zea mays]
Length=524

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/510 (76%), Positives = 434/510 (85%), Gaps = 4/510 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G+PGSS+HGVTGREP  +F+       ++   KF LPVDSEHKAK  +LFS+ANPHMRTF
Sbjct  5     GAPGSSLHGVTGREPAFAFSTEHEEAASNG-GKFDLPVDSEHKAKSVRLFSVANPHMRTF  63

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGAVCDLL
Sbjct  64    HLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLTMGAVCDLL  123

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAFLIML+APTVFCMS +  A GY+ VRF+IGFSLATFVSCQYWMSTMF+SKIIG
Sbjct  124   GPRYGCAFLIMLSAPTVFCMSLIDDAAGYITVRFLIGFSLATFVSCQYWMSTMFSSKIIG  183

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTL  823
               NG AAGWGNMGGGATQL+MP++YD+IRK GATPF+AWR+A+F+PG +HVVMG+LVLTL
Sbjct  184   TVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRLAYFVPGLMHVVMGVLVLTL  243

Query  824   GQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEY  1003
             GQDLPDGNL SLQKKGN+NKD FSKV WYAV NYRTWIF LLYGY MGVEL+TDNVIAEY
Sbjct  244   GQDLPDGNLRSLQKKGNVNKDSFSKVMWYAVINYRTWIFVLLYGYCMGVELTTDNVIAEY  303

Query  1004  FFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLF  1183
              +DRFDL L  AG IAA FGMAN+VARP GG  SD  A+++GMR RLW +WILQT GG F
Sbjct  304   MYDRFDLDLRVAGTIAACFGMANIVARPMGGIMSDMGARYWGMRARLWNIWILQTAGGAF  363

Query  1184  CFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGL  1363
             C  LGRA+TLP++V  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGNFG+GL
Sbjct  364   CLWLGRASTLPVSVVAMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGNFGAGL  423

Query  1364  TQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYC  1543
             TQL+FF++S +ST  GL YMGIMIMACTLPV  VHFPQWG MFFP S  A    EE YY 
Sbjct  424   TQLLFFTSSTYSTGRGLEYMGIMIMACTLPVVFVHFPQWGSMFFPPSATA---DEEGYYA  480

Query  1544  SEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             SEWN++EK KG+H  SLKFAENSRSERGKR
Sbjct  481   SEWNDDEKSKGLHSASLKFAENSRSERGKR  510



>gb|AAV73917.1| putative high affinity nitrate transporter [Zea mays]
Length=524

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/510 (75%), Positives = 433/510 (85%), Gaps = 4/510 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G+PGSS+HGVTGREP  +F+       ++   KF LPVDSEHKAK  +LFS+ANPHMRTF
Sbjct  5     GAPGSSLHGVTGREPAFAFSTEHEEAASNG-GKFDLPVDSEHKAKSVRLFSVANPHMRTF  63

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGAVCDLL
Sbjct  64    HLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLTMGAVCDLL  123

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAFLIML+APTVFCMS +  A GY+ VRF+IGFSLATFVSCQYWMSTMF+SKIIG
Sbjct  124   GPRYGCAFLIMLSAPTVFCMSLIDDAAGYITVRFLIGFSLATFVSCQYWMSTMFSSKIIG  183

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTL  823
               NG AAGWGNMGGGATQL+MP++YD+IRK GATPF+AWR+A+F+PG +HVVMG+LVLTL
Sbjct  184   TVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRLAYFVPGLMHVVMGVLVLTL  243

Query  824   GQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEY  1003
             GQDLPDGNL SLQKKGN+NKD FSKV WYAV NYRTWIF LLYGY MGVEL+ DNVIAEY
Sbjct  244   GQDLPDGNLRSLQKKGNVNKDSFSKVMWYAVINYRTWIFVLLYGYCMGVELTIDNVIAEY  303

Query  1004  FFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLF  1183
              +DRFDL L  AG IAA FGMAN+VARP GG  SD  A+++GMR RLW +WILQT GG F
Sbjct  304   MYDRFDLDLRVAGTIAACFGMANIVARPMGGIMSDMGARYWGMRARLWNIWILQTAGGAF  363

Query  1184  CFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGL  1363
             C  LGRA+TLP++V  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGNFG+GL
Sbjct  364   CLWLGRASTLPVSVVAMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGNFGAGL  423

Query  1364  TQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYC  1543
             TQL+FF++S +ST  GL YMGIMIMACTLPV  VHFPQWG MFFP S  A    EE YY 
Sbjct  424   TQLLFFTSSTYSTGRGLEYMGIMIMACTLPVVFVHFPQWGSMFFPPSATA---DEEGYYA  480

Query  1544  SEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             SEWN++EK KG+H  SLKFAENSRSERGKR
Sbjct  481   SEWNDDEKSKGLHSASLKFAENSRSERGKR  510



>ref|XP_010683898.1| PREDICTED: high affinity nitrate transporter 2.4-like [Beta vulgaris 
subsp. vulgaris]
Length=529

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/511 (74%), Positives = 439/511 (86%), Gaps = 1/511 (0%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G  G+SMHGVTGRE   +F+VASP VPTDTTAKFALPVDSEHKAKVF +FSLA PHMR F
Sbjct  2     GELGTSMHGVTGRERTHAFSVASPEVPTDTTAKFALPVDSEHKAKVFNIFSLAKPHMRAF  61

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HL+W SFFTC VSTFAAAPL+PIIRDNL+L + DIGNAGVASVSGSI SRL MGAVCDL+
Sbjct  62    HLAWFSFFTCVVSTFAAAPLLPIIRDNLDLTQIDIGNAGVASVSGSIFSRLAMGAVCDLI  121

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAF++MLTAP VF MS V SA GY  VRF+IGFSLATFVSCQYW+STMFNS+IIG
Sbjct  122   GPRYGCAFILMLTAPAVFAMSMVESAIGYTTVRFLIGFSLATFVSCQYWVSTMFNSRIIG  181

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRK-AGATPFSAWRIAFFIPGWLHVVMGILVLT  820
               +G  +GWG+MGGGATQLLMPV+++II++  G TPF AWR+AFFIPG L ++MGIL+LT
Sbjct  182   SVSGITSGWGDMGGGATQLLMPVMFEIIQRVGGTTPFMAWRLAFFIPGCLQLIMGILILT  241

Query  821   LGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAE  1000
              GQDLPDGNL  LQ KG+++KDKFSKV WYA+TNYRTWIF ++YGYSMGV+L+T+N+IA+
Sbjct  242   FGQDLPDGNLSELQNKGDVSKDKFSKVCWYAITNYRTWIFVMVYGYSMGVQLTTNNIIAQ  301

Query  1001  YFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGL  1180
             YFFDRF+LKLHTAG IA  FGMANL +RPFGGFASD++A+ FGMRGRLW LW  QT+GG+
Sbjct  302   YFFDRFNLKLHTAGFIATGFGMANLASRPFGGFASDWSARLFGMRGRLWILWFFQTLGGV  361

Query  1181  FCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSG  1360
             FC  LG ANT+P+AV  M++FSIGAQAACGAT+GI PFISRRSLGIISGLTGAGGN GS 
Sbjct  362   FCVWLGLANTVPVAVVAMVLFSIGAQAACGATYGIVPFISRRSLGIISGLTGAGGNLGSM  421

Query  1361  LTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYY  1540
             +TQLIFFSTS+++T  GL YMG+M +ACTLPV LV FPQWGGMF P S D ++  EEHYY
Sbjct  422   ITQLIFFSTSRYTTEQGLVYMGVMAIACTLPVALVQFPQWGGMFLPPSSDPMKSNEEHYY  481

Query  1541  CSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              SEW+E E  KGMH NS+ FAENSRSERGKR
Sbjct  482   SSEWSEAEMHKGMHSNSIMFAENSRSERGKR  512



>ref|XP_002523689.1| nitrate transporter, putative [Ricinus communis]
 gb|EEF38629.1| nitrate transporter, putative [Ricinus communis]
Length=530

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/511 (74%), Positives = 442/511 (86%), Gaps = 2/511 (0%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRT  280
             +G+ G+SMHGVTGRE   +F+V S     DTT KF LPVDSEH+AKVFK FSLANPHMR 
Sbjct  4     DGALGTSMHGVTGREQTFAFSVQS--TENDTTHKFELPVDSEHRAKVFKPFSLANPHMRA  61

Query  281   FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDL  460
             FHL+W SFFT F+STFAAAPLVPIIRDNLNL KSD+GNAGVASVSGSILSRLVMGAVCDL
Sbjct  62    FHLAWTSFFTSFISTFAAAPLVPIIRDNLNLTKSDVGNAGVASVSGSILSRLVMGAVCDL  121

Query  461   LGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKII  640
             +GPRYG AFL+ML+APTVFCMSFVS A GY+ VRFMIGF LATFVSCQYW + MFN KII
Sbjct  122   IGPRYGTAFLLMLSAPTVFCMSFVSDAQGYLIVRFMIGFCLATFVSCQYWTTMMFNGKII  181

Query  641   GLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLT  820
             GL NG A GWG+MGGG TQLLMP+++ II+ AGATPF+AWRIAFF+PG  HV++GILVLT
Sbjct  182   GLVNGCAGGWGDMGGGVTQLLMPLVFHIIKLAGATPFTAWRIAFFVPGCFHVIIGILVLT  241

Query  821   LGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAE  1000
             LGQDLPDGNL +LQKKG++ KDKFSKV  YA+TNYRTWIF LLYG+SMG++L+T+N+I E
Sbjct  242   LGQDLPDGNLSTLQKKGDVAKDKFSKVLKYAITNYRTWIFFLLYGFSMGIQLTTNNIITE  301

Query  1001  YFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGL  1180
             YF+DRF+LKLHTAG+IAA+FGM N+ ARPFGG+ASD  A+ FG RGRLWTLWILQT+G +
Sbjct  302   YFYDRFNLKLHTAGVIAASFGMTNIFARPFGGYASDLTARRFGTRGRLWTLWILQTLGAV  361

Query  1181  FCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSG  1360
             FC  LGRAN+LP+A+  MI+ S+G QAACGAT+GI PF+SRRSLGI+SGLTGAGGNFGSG
Sbjct  362   FCIWLGRANSLPIAILAMILSSMGIQAACGATYGIVPFVSRRSLGILSGLTGAGGNFGSG  421

Query  1361  LTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYY  1540
             L QL+FFS+S+FSTA+GLS MGI+ + CTL V L+HFPQWG MF P SKD  + +EE+YY
Sbjct  422   LNQLVFFSSSRFSTATGLSLMGILALVCTLSVALIHFPQWGSMFLPPSKDPAKCSEEYYY  481

Query  1541  CSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +EW EEE QKGMH+ S+KFAENSRSERG+R
Sbjct  482   TAEWTEEEMQKGMHEGSVKFAENSRSERGRR  512



>ref|XP_010683899.1| PREDICTED: high affinity nitrate transporter 2.4-like [Beta vulgaris 
subsp. vulgaris]
Length=536

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/508 (74%), Positives = 441/508 (87%), Gaps = 1/508 (0%)
 Frame = +2

Query  113   GSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLS  292
             GSSMHGVTGREP  +F+  +  VPTDT+ KFALPVDSEHKAKVFK+FSLA PHMR FHL+
Sbjct  6     GSSMHGVTGREPTHAFSGVTSGVPTDTSTKFALPVDSEHKAKVFKIFSLAQPHMRAFHLA  65

Query  293   WISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPR  472
             W SFFTC VSTFAAAPL+PIIRDNLNL    IG+AGVASVSGSI SRL MG +CDL+GPR
Sbjct  66    WFSFFTCVVSTFAAAPLLPIIRDNLNLTDIHIGDAGVASVSGSIFSRLAMGVICDLIGPR  125

Query  473   YGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLan  652
             YGCAF++MLTAP VF MS V SA GY+ VRF+IGFSLATFVSCQYW+STMFNS+IIG  +
Sbjct  126   YGCAFVLMLTAPAVFSMSMVESAVGYIIVRFLIGFSLATFVSCQYWVSTMFNSQIIGAVS  185

Query  653   gtaagwgnmgggatQLLMPVLYDIIRKAGA-TPFSAWRIAFFIPGWLHVVMGILVLTLGQ  829
             G  +GWG+MGGGATQLLMPV+++II++AG  T F AWR+AFFIPG L ++MGIL+LT GQ
Sbjct  186   GVTSGWGDMGGGATQLLMPVMFEIIQRAGGITAFKAWRLAFFIPGCLQLIMGILILTFGQ  245

Query  830   DLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFF  1009
             DLPDGNL  LQ KG+++KDKFSKV WYA+TNYRTWIF ++YGYSMGV+L+T+N+IA+YFF
Sbjct  246   DLPDGNLSELQNKGDVSKDKFSKVCWYAITNYRTWIFVMIYGYSMGVQLTTNNIIAQYFF  305

Query  1010  DRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCF  1189
             DRF+LKLHTAG+IA  FGMAN+ +RPFGGFASD++A+ FGMRGRLW LW  QTMGG+FC 
Sbjct  306   DRFNLKLHTAGLIATGFGMANIASRPFGGFASDWSARLFGMRGRLWMLWFFQTMGGVFCV  365

Query  1190  LLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQ  1369
              LG ANTLP+AV  M++FSIGAQAACGAT+G+ PFISRRSLGIISGLTGAGGN GS +TQ
Sbjct  366   WLGLANTLPVAVVAMVLFSIGAQAACGATYGVVPFISRRSLGIISGLTGAGGNLGSMITQ  425

Query  1370  LIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSE  1549
             LIFF++S+++T  GL YMG+M +ACTLPV LVHFPQWGGMFFPASKD  + +EEHYY SE
Sbjct  426   LIFFASSRYTTEQGLVYMGVMAIACTLPVALVHFPQWGGMFFPASKDPAKSSEEHYYSSE  485

Query  1550  WNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             W+E E+QKGMH NS+ FAENSRSERGKR
Sbjct  486   WSEVERQKGMHVNSVMFAENSRSERGKR  513



>ref|XP_010254451.1| PREDICTED: LOW QUALITY PROTEIN: high affinity nitrate transporter 
2.4 [Nelumbo nucifera]
Length=626

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/530 (76%), Positives = 446/530 (84%), Gaps = 18/530 (3%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHM  274
              ++G PGSSMHGVTGRE   +F+VA+PIVPTDTTA FALPVDSEHKAKVFK+FS ANPHM
Sbjct  82    KMQGEPGSSMHGVTGREQSFAFSVATPIVPTDTTAGFALPVDSEHKAKVFKIFSFANPHM  141

Query  275   RTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVC  454
             RTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K D+GNAG+ASVSGSI SRLVMGAVC
Sbjct  142   RTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDVGNAGIASVSGSIFSRLVMGAVC  201

Query  455   DLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSK  634
             DLLGPRYGCAFLIML AP VFCMS VSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF+ K
Sbjct  202   DLLGPRYGCAFLIMLAAPAVFCMSIVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFSGK  261

Query  635   IIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILV  814
             IIGL NGTAAGWGNMGGGATQLLM +LYD+IR+ G TPF+AWRIAFFIPG LH+VMGILV
Sbjct  262   IIGLVNGTAAGWGNMGGGATQLLMSLLYDVIRRTGTTPFTAWRIAFFIPGVLHIVMGILV  321

Query  815   LTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVT--------------NYRTWIFALLY  952
             LTLGQDLPDGNLGSLQKKG ++ DKFSKV WYA+T              +   W+   L 
Sbjct  322   LTLGQDLPDGNLGSLQKKGEVSIDKFSKVLWYAMTGXFIIISQYPIHXYHIFLWMHDQLN  381

Query  953   GYSMGVELSTDNVIAEYFFDR---FDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKF  1123
              + +  E + DN   E    R   FDLKLHTAGIIAA FGMAN  ARPFGG+ SD AA+ 
Sbjct  382   RWRID-EFNIDNQFNETALIRCIRFDLKLHTAGIIAAAFGMANFAARPFGGYMSDVAARR  440

Query  1124  FGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISR  1303
             FGMRGRLW LWILQT+GG+FC   GRAN+LP+++  MI+FSIGAQ+ACGATFGI PFISR
Sbjct  441   FGMRGRLWNLWILQTLGGVFCIWPGRANSLPISIMAMILFSIGAQSACGATFGIIPFISR  500

Query  1304  RSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWG  1483
             RSLGIISGLTGAGGNFGSGLTQL+FF++S++STA+G+S MG+MI+ACTLPVTLVHFPQWG
Sbjct  501   RSLGIISGLTGAGGNFGSGLTQLLFFTSSRYSTATGISLMGVMIVACTLPVTLVHFPQWG  560

Query  1484  GMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              MF PAS DA +  EE+YY SEW EEEKQK +H+ S KFAENSRSERGKR
Sbjct  561   SMFLPASTDAEKSKEEYYYGSEWTEEEKQKCLHEGSFKFAENSRSERGKR  610



>gb|KDO60198.1| hypothetical protein CISIN_1g040770mg [Citrus sinensis]
Length=521

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/515 (73%), Positives = 434/515 (84%), Gaps = 14/515 (3%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA  EGS GSSMHGV  RE   +  V SP VPTDTT KF LPVDSEH+AK FK+FS A P
Sbjct  1     MAQNEGSLGSSMHGVIAREQTFALEVVSPSVPTDTTVKFDLPVDSEHRAKAFKVFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHL+W+SFFTCF+STFAAAPLVPIIRDNLNL K+D+GNAGVASVSGSI SRL+MGA
Sbjct  61    HMRTFHLAWVSFFTCFISTFAAAPLVPIIRDNLNLTKTDVGNAGVASVSGSIFSRLIMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDL+GPRYG +FL++L+AP VFCMSFVS A GY+A RFMIGF LATFVSCQYW + MFN
Sbjct  121   VCDLIGPRYGTSFLLLLSAPAVFCMSFVSDAQGYIAARFMIGFCLATFVSCQYWTTIMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KI+GL NG A GWG+MGGG TQLLMP+++++I+ AGATPF+AWRIAFFIPGWLHV+MGI
Sbjct  181   GKILGLVNGCAGGWGDMGGGVTQLLMPLVFEVIKLAGATPFTAWRIAFFIPGWLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLPDGNLG+LQKKGN+NKDKFSKVFWY + NYRTW+F +LYG+SMG+EL+T+N
Sbjct  241   LVLTLGQDLPDGNLGALQKKGNVNKDKFSKVFWYGIKNYRTWVFFVLYGFSMGIELTTNN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             +I+E+ +DRF+LKLHTAG IAATFGMAN+ ARPFGG+ASD A + FGMRGRLWTLWI QT
Sbjct  301   IISEFMYDRFNLKLHTAGTIAATFGMANIFARPFGGYASDVAGRLFGMRGRLWTLWIFQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRA +LP+AV  M++FS+G QAACGATFGI PF+SRRSLGI+SGLTGAGGN
Sbjct  361   LGGVFCVWLGRAESLPIAVVAMVLFSMGTQAACGATFGIVPFVSRRSLGILSGLTGAGGN  420

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQL FFS SKFSTA+G+S MG +               WG M  P SKD  R  E
Sbjct  421   FGSGLTQLAFFSNSKFSTATGISLMGAL--------------TWGSMLLPPSKDPQRSNE  466

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEW EEEK +GMH+ SLKFAENS+SERGKR
Sbjct  467   EYYYSSEWTEEEKLRGMHEGSLKFAENSKSERGKR  501



>ref|NP_001105195.1| nitrate transport2 [Zea mays]
 gb|AAN05088.1| putative high affinity nitrate transporter [Zea mays]
Length=524

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/510 (74%), Positives = 426/510 (84%), Gaps = 4/510 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G+PGSS+HGVTGREP  +F+       ++   KF LPVDSEHKAK  +LFS+ANPHMRTF
Sbjct  5     GAPGSSLHGVTGREPAFAFSTEHEEAASNG-GKFDLPVDSEHKAKSVRLFSVANPHMRTF  63

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGAVCDLL
Sbjct  64    HLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLTMGAVCDLL  123

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAFLIML+APTVFCMS +  A GY+ VRF+IGFSLATFVSCQYWMSTMF+SKIIG
Sbjct  124   GPRYGCAFLIMLSAPTVFCMSLIDDAAGYITVRFLIGFSLATFVSCQYWMSTMFSSKIIG  183

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTL  823
               NG AAGWG MG       MP++YD+IRK GATPF+AWR+A+F+PG +HVVMG+LVLTL
Sbjct  184   TVNGLAAGWGTMGRRRHAAHMPLVYDVIRKCGATPFTAWRLAYFVPGLMHVVMGVLVLTL  243

Query  824   GQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEY  1003
             GQDLPDGNL SLQKKGN+NKD FSKV WYAV NYRTWIF LLYGY MGVEL+TDNVIAEY
Sbjct  244   GQDLPDGNLRSLQKKGNVNKDSFSKVMWYAVINYRTWIFVLLYGYCMGVELTTDNVIAEY  303

Query  1004  FFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLF  1183
              +DRFDL L  AG IAA FGMAN+VARP GG  SD  A+++GMR RLW +WILQT GG F
Sbjct  304   MYDRFDLDLRVAGTIAACFGMANIVARPMGGIMSDMGARYWGMRARLWNIWILQTAGGAF  363

Query  1184  CFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGL  1363
             C  LGRA+TLP++V  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGNFG+GL
Sbjct  364   CLWLGRASTLPVSVVAMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGNFGAGL  423

Query  1364  TQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYC  1543
             TQL+FF++S +ST  GL YMGIMIMACTLPV  VHFPQWG MFFP S  A    EE YY 
Sbjct  424   TQLLFFTSSTYSTGRGLEYMGIMIMACTLPVVFVHFPQWGSMFFPPSATA---DEEGYYA  480

Query  1544  SEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             SEWN++EK KG+H  SLKFAENSRSERGKR
Sbjct  481   SEWNDDEKSKGLHSASLKFAENSRSERGKR  510



>ref|XP_006292196.1| hypothetical protein CARUB_v10018402mg [Capsella rubella]
 gb|EOA25094.1| hypothetical protein CARUB_v10018402mg [Capsella rubella]
Length=542

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/520 (73%), Positives = 440/520 (85%), Gaps = 7/520 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAVASPIVPT-------DTTAKFALPVDSEHKAKVFKLF  253
             + EGS G+SMHGVT RE V SF+V    VP+       D TAKFALPVDSEH+AKVFK F
Sbjct  6     EEEGSIGTSMHGVTAREQVFSFSVQGKDVPSSHTVQSNDQTAKFALPVDSEHRAKVFKPF  65

Query  254   SLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSR  433
             S A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SR
Sbjct  66    SFAKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKNDIGNAGVASVSGAIFSR  125

Query  434   LVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWM  613
             L MGAVCDLLG RYG AFL+ML+APTVF MSFVS AGGY+AVRFMIGF LATFVSCQYW 
Sbjct  126   LAMGAVCDLLGARYGTAFLLMLSAPTVFSMSFVSDAGGYLAVRFMIGFCLATFVSCQYWT  185

Query  614   STMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLH  793
             S MFN KIIGL NG A GWG+MGGG TQLLMP+++++I+ AGA+PF AWRIAFF+PG+L 
Sbjct  186   SVMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFNVIKLAGASPFMAWRIAFFVPGFLQ  245

Query  794   VVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVE  973
             V+MGILVLTLGQDLPDGNL +LQKKG+++KDKFSKVFWYAV NYRT++  LLYG+SMG+E
Sbjct  246   VIMGILVLTLGQDLPDGNLSTLQKKGDVSKDKFSKVFWYAVMNYRTYVLFLLYGFSMGIE  305

Query  974   LSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTL  1153
             ++ +NVI+EYF+DRF L+LHTAG+IAA+FGMAN  ARP GG+ASD +A++FGMRGRLWTL
Sbjct  306   MTINNVISEYFYDRFQLQLHTAGMIAASFGMANFFARPLGGYASDMSARYFGMRGRLWTL  365

Query  1154  WILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLT  1333
             WILQT GGLFC  LGRA +LP+A+  M++FS+G QAACGA FGI PF+SRRSLG+ISGLT
Sbjct  366   WILQTSGGLFCVWLGRATSLPIAILAMMLFSVGVQAACGAIFGIVPFVSRRSLGLISGLT  425

Query  1334  GAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDA  1513
             GAGGNFGSGLTQL+FFS+S+F TA GLS MGIM    TL V  +HFPQWG MFF  + D 
Sbjct  426   GAGGNFGSGLTQLVFFSSSRFHTADGLSLMGIMATIFTLLVAFIHFPQWGSMFFGPTSDE  485

Query  1514  VRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +  EEHYY +EW EEEK++G+H+ SLKFAENSRSERGKR
Sbjct  486   KKAKEEHYYAAEWTEEEKRQGLHEGSLKFAENSRSERGKR  525



>ref|XP_010430993.1| PREDICTED: high affinity nitrate transporter 2.6-like [Camelina 
sativa]
Length=542

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/520 (73%), Positives = 439/520 (84%), Gaps = 7/520 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAV-------ASPIVPTDTTAKFALPVDSEHKAKVFKLF  253
             D EGS G+SMHGVT RE V SF+V       + P+   D TAKFALPVDSEH+AKVFK F
Sbjct  6     DEEGSIGTSMHGVTAREQVFSFSVQGEDGPASHPVQSDDPTAKFALPVDSEHRAKVFKPF  65

Query  254   SLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSR  433
             S A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SR
Sbjct  66    SFAKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKNDIGNAGVASVSGAIFSR  125

Query  434   LVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWM  613
             L MGAVCDLLG RYG AFL+ML+APTVF MSFVS AGGY+AVRFMIGF LATFVSCQYW 
Sbjct  126   LAMGAVCDLLGARYGTAFLLMLSAPTVFSMSFVSDAGGYLAVRFMIGFCLATFVSCQYWT  185

Query  614   STMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLH  793
             S MFN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGA+PF AWRIAFF+PG+L 
Sbjct  186   SVMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGASPFVAWRIAFFVPGFLQ  245

Query  794   VVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVE  973
             V+MGILVLTLGQDLPDGNL +LQKKG ++KD+FSKVFWYAV NYRT++  LLYG+SMG+E
Sbjct  246   VIMGILVLTLGQDLPDGNLSTLQKKGEVSKDRFSKVFWYAVMNYRTYVLFLLYGFSMGIE  305

Query  974   LSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTL  1153
             ++ +NVI+EYFFDRF L+LHTAG+IAA+FGMAN  ARP GG+ASD +A+FFGMRGRLWTL
Sbjct  306   MTINNVISEYFFDRFQLQLHTAGMIAASFGMANFFARPLGGYASDMSARFFGMRGRLWTL  365

Query  1154  WILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLT  1333
             WILQT GGLFC  LGRA +LP+A+  M++FS+G QAACGA FGI PF+SRRSLG+ISGLT
Sbjct  366   WILQTSGGLFCVWLGRATSLPIAILAMMLFSVGVQAACGAIFGIVPFVSRRSLGLISGLT  425

Query  1334  GAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDA  1513
             GAGGNFGSGLTQLIFFS+SKF TA GLS MGIM M  TL V  +HFPQWG MFF  + D 
Sbjct  426   GAGGNFGSGLTQLIFFSSSKFLTADGLSLMGIMAMIFTLLVAFIHFPQWGSMFFGPTSDE  485

Query  1514  VRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +  EEHYY +EW EEEK++G+H+ SLKFAENSRSERG++
Sbjct  486   KKSKEEHYYAAEWTEEEKRQGLHEGSLKFAENSRSERGRK  525



>ref|XP_010507194.1| PREDICTED: high affinity nitrate transporter 2.6-like [Camelina 
sativa]
Length=542

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/520 (73%), Positives = 439/520 (84%), Gaps = 7/520 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAV-------ASPIVPTDTTAKFALPVDSEHKAKVFKLF  253
             D EGS G+SMHGVT RE V SF+V       + P+   D TAKFALPVDSEH+AKVFK F
Sbjct  6     DEEGSIGTSMHGVTAREQVFSFSVQGEDGPASHPVQSDDPTAKFALPVDSEHRAKVFKPF  65

Query  254   SLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSR  433
             S A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SR
Sbjct  66    SFAKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKNDIGNAGVASVSGAIFSR  125

Query  434   LVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWM  613
             L MGAVCDLLG RYG AFL+ML+APTVF MSFVS AGGY+AVRFMIGF LATFVSCQYW 
Sbjct  126   LAMGAVCDLLGARYGTAFLLMLSAPTVFSMSFVSDAGGYLAVRFMIGFCLATFVSCQYWT  185

Query  614   STMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLH  793
             S MFN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGA+PF AWRIAFF+PG+L 
Sbjct  186   SVMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGASPFVAWRIAFFVPGFLQ  245

Query  794   VVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVE  973
             V+MGILVLTLGQDLPDGNL +LQKKG ++KD+FSKVFWYAV NYRT++  LLYG+SMG+E
Sbjct  246   VIMGILVLTLGQDLPDGNLSTLQKKGEVSKDRFSKVFWYAVMNYRTYVLFLLYGFSMGIE  305

Query  974   LSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTL  1153
             ++ +NVI+EYFFDRF L+LHTAG+IAA+FGMAN  ARP GG+ASD +A+FFGMRGRLWTL
Sbjct  306   MTINNVISEYFFDRFQLQLHTAGMIAASFGMANFFARPLGGYASDMSARFFGMRGRLWTL  365

Query  1154  WILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLT  1333
             WILQT GGLFC  LGRA +LP+A+  M++FS+G QAACGA FGI PF+SRRSLG+ISGLT
Sbjct  366   WILQTSGGLFCVWLGRATSLPIAILAMMLFSVGVQAACGAIFGIVPFVSRRSLGLISGLT  425

Query  1334  GAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDA  1513
             GAGGNFGSGLTQL+FFS+SKF TA GLS MGIM M  TL V  +HFPQWG MFF  + D 
Sbjct  426   GAGGNFGSGLTQLVFFSSSKFHTADGLSLMGIMAMIFTLLVAFIHFPQWGSMFFGPTSDE  485

Query  1514  VRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +  EEHYY +EW EEEK++G+H+ SLKFAENSRSERG++
Sbjct  486   KKSNEEHYYAAEWTEEEKRQGLHEGSLKFAENSRSERGRK  525



>ref|XP_010685328.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Beta vulgaris 
subsp. vulgaris]
Length=525

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/512 (73%), Positives = 432/512 (84%), Gaps = 3/512 (1%)
 Frame = +2

Query  98    IEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMR  277
             + G PGSSMHGVTG+E   +F+V+   VP D+ AKFALPVD+EHKA  FK+ SLA PHM 
Sbjct  1     MAGEPGSSMHGVTGKEQSFAFSVSPSEVPVDSAAKFALPVDAEHKATKFKILSLAKPHMT  60

Query  278   TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCD  457
             TFHLSWISF TCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSGS+ SRLVMG +CD
Sbjct  61    TFHLSWISFCTCFISTFAAAPLVPIIRDNLSLTKADIGNAGVASVSGSVFSRLVMGTLCD  120

Query  458   LLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKI  637
             L+GPRY CAFL+ML AP VFCMS ++ A GYVAVRFMIGF LATFVSCQYWMSTMFN +I
Sbjct  121   LMGPRYACAFLVMLIAPAVFCMSLITDASGYVAVRFMIGFCLATFVSCQYWMSTMFNGRI  180

Query  638   IGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVL  817
             IGL NGTAAGWGN GGGATQLLMP++Y IIR+AGAT F AWRI+FFIPG LH+VMGILVL
Sbjct  181   IGLVNGTAAGWGNAGGGATQLLMPLVYAIIRRAGATSFVAWRISFFIPGLLHIVMGILVL  240

Query  818   TLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIA  997
             TLGQDLPDGNLG+LQKKG + KDK  KV WYAV+NYRTW+F LLYGYS+GVEL+TDN+IA
Sbjct  241   TLGQDLPDGNLGALQKKGQVAKDKLPKVLWYAVSNYRTWVFVLLYGYSLGVELTTDNIIA  300

Query  998   EYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGG  1177
             EYFFDRFDL LHTAGIIA +FG+AN  +RP GG ASDY+A++FGMRGRLWTLWILQT GG
Sbjct  301   EYFFDRFDLNLHTAGIIAGSFGLANFFSRPLGGLASDYSARYFGMRGRLWTLWILQTAGG  360

Query  1178  LFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGS  1357
             LFC  LG A  L  A+  +I+FS+GAQAACGATFG+ PF+SRRSLGIISGLTGAGGN G+
Sbjct  361   LFCIWLGLAKDLVTAIVALILFSLGAQAACGATFGVVPFVSRRSLGIISGLTGAGGNVGA  420

Query  1358  GLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHY  1537
              LTQ IFF+  +  T  GL+YMG+M +ACTLPV LVHFPQWG MFFP SK A   TEE Y
Sbjct  421   ALTQFIFFTGERLRTEEGLTYMGVMTIACTLPVALVHFPQWGSMFFPPSKSA---TEESY  477

Query  1538  YCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             Y SE+   E+ KGMH+ S+KFAE++RSERG++
Sbjct  478   YTSEYTNNEQSKGMHERSVKFAESARSERGRK  509



>ref|NP_172289.1| nitrate transporter 2.2 [Arabidopsis thaliana]
 sp|Q9LMZ9.1|NRT22_ARATH RecName: Full=High-affinity nitrate transporter 2.2; Short=AtNRT2:2 
[Arabidopsis thaliana]
 gb|AAF79836.1|AC026875_16 T6D22.18 [Arabidopsis thaliana]
 gb|AEE28242.1| nitrate transporter 2.2 [Arabidopsis thaliana]
Length=522

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/507 (76%), Positives = 436/507 (86%), Gaps = 2/507 (0%)
 Frame = +2

Query  107   SPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFH  286
              PGSSMHGVTGRE   +F+V     PT+T  K+ LPVD+E KA VFKLFS A PHMRTFH
Sbjct  6     EPGSSMHGVTGREQSYAFSVDGS-EPTNTKKKYNLPVDAEDKATVFKLFSFAKPHMRTFH  64

Query  287   LSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLG  466
             LSWISF TCFVSTFAAAPL+PIIR+NLNL K DIGNAGVASVSGSI SRLVMGAVCDLLG
Sbjct  65    LSWISFSTCFVSTFAAAPLIPIIRENLNLTKHDIGNAGVASVSGSIFSRLVMGAVCDLLG  124

Query  467   PRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGL  646
             PRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFNS+IIGL
Sbjct  125   PRYGCAFLVMLSAPTVFSMSFVSDAAGFITVRFMIGFCLATFVSCQYWMSTMFNSQIIGL  184

Query  647   angtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLG  826
              NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWRIAFF+PGWLH++MGILVLTLG
Sbjct  185   VNGTAAGWGNMGGGITQLLMPIVYEIIRRCGSTAFTAWRIAFFVPGWLHIIMGILVLTLG  244

Query  827   QDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYF  1006
             QDLP GN  +++K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDNVIAEYF
Sbjct  245   QDLPGGNRAAMEKAGEVAKDKFGKILWYAVTNYRTWIFVLLYGYSMGVELSTDNVIAEYF  304

Query  1007  FDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFC  1186
             FDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AAK FGMRGRLWTLWI+QT GGLFC
Sbjct  305   FDRFHLKLHTAGIIAACFGMANFFARPAGGWASDIAAKRFGMRGRLWTLWIIQTSGGLFC  364

Query  1187  FLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLT  1366
               LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGNFGSGLT
Sbjct  365   VWLGRANTLVTAVVSMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGNFGSGLT  424

Query  1367  QLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCS  1546
             QL+FFSTS+F+T  GL++MG+MI+ACTLPVTL+HFPQWG MFFP S D+V  T EHYY  
Sbjct  425   QLVFFSTSRFTTEEGLTWMGVMIVACTLPVTLIHFPQWGSMFFPPSNDSVDAT-EHYYVG  483

Query  1547  EWNEEEKQKGMHQNSLKFAENSRSERG  1627
             E+++EE+Q GMH  S  FA+ +++E G
Sbjct  484   EYSKEEQQIGMHLKSKLFADGAKTEGG  510



>emb|CBI32763.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/515 (76%), Positives = 431/515 (84%), Gaps = 46/515 (9%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADI+GSPGSSMHGVTGRE   +F+VASP +PTDTTAKFALPVDSEHKAKVFK+FS A P
Sbjct  1     MADIQGSPGSSMHGVTGREQTFAFSVASPAIPTDTTAKFALPVDSEHKAKVFKVFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSW+SFFTCFVSTFAAAPLVP+IRDNLNL KSDIGNAG+ASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWVSFFTCFVSTFAAAPLVPVIRDNLNLRKSDIGNAGIASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+AP VFCMSFVSSA GY+AVRFMIGFSLATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLMMLSAPAVFCMSFVSSAEGYIAVRFMIGFSLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGGATQLLMPV+++II + G TPF AWR+AFFIPG LHV+MGI
Sbjct  181   SQIIGLVNGTAAGWGNMGGGATQLLMPVIFEIICRVGVTPFMAWRVAFFIPGCLHVIMGI  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL+LGQDLPDGNLG+LQKKG+++KDKFSKV WYA+TNYRTWIF LLYG+S+GVEL+ DN
Sbjct  241   LVLSLGQDLPDGNLGTLQKKGDVSKDKFSKVLWYAITNYRTWIFVLLYGFSLGVELTADN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDLKLHTAG IAATFGMAN+VARP GG  SD AA+                
Sbjct  301   VIAEYFYDRFDLKLHTAGTIAATFGMANIVARPMGGLMSDLAAR----------------  344

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
                                            ACGATFGI PFISRRSLGIISGLTGAGGN
Sbjct  345   ------------------------------PACGATFGIIPFISRRSLGIISGLTGAGGN  374

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQ +FF++SK+STA+G+S MGIMI+ACTLPV LVHFPQWG M  P SKDAVR  E
Sbjct  375   FGSGLTQWLFFTSSKYSTATGISLMGIMIVACTLPVALVHFPQWGSMLLPPSKDAVRSCE  434

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNE EKQKG+HQ SLKFAENS+SERG+R
Sbjct  435   EYYYGSEWNEAEKQKGLHQGSLKFAENSKSERGRR  469



>emb|CDP07062.1| unnamed protein product [Coffea canephora]
Length=532

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/516 (77%), Positives = 459/516 (89%), Gaps = 2/516 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASP-IVPTDTTAKFALPVDSEHKAKVFKLFSLAN  265
             MADIE   GSSMHGVTGRE   +F+VA+P  VP +T+A FALPVDSEH+AK  K+FS A 
Sbjct  1     MADIEAPFGSSMHGVTGREQSFAFSVATPETVPAETSANFALPVDSEHRAKEIKIFSFAQ  60

Query  266   PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMG  445
             PHMR+FHL+WISFFTCF+STFAAAPLVPIIRDNL+L ++DIGNAGVASVSGSI SRLVMG
Sbjct  61    PHMRSFHLAWISFFTCFISTFAAAPLVPIIRDNLDLTRADIGNAGVASVSGSIFSRLVMG  120

Query  446   AVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF  625
              VCDL+GPRYGCAF+ +L AP VF ++FVSSA GY+AVRFMIGFSLATFVSCQYW S MF
Sbjct  121   VVCDLIGPRYGCAFVNLLVAPVVFSVAFVSSAEGYIAVRFMIGFSLATFVSCQYWTSIMF  180

Query  626   NSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMG  805
             NSKIIGL NG AAGWG+MGGG TQLLMP L+ +I+  GATPF+AWRIAFFIPGWLH++ G
Sbjct  181   NSKIIGLVNGVAAGWGDMGGGVTQLLMPFLFQLIKMLGATPFTAWRIAFFIPGWLHIITG  240

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             I+VLTLGQDLPDGNL +LQK+G+++KDKF+KVF +AVTNYRTWIF L+YG+SMGVEL  +
Sbjct  241   IMVLTLGQDLPDGNLSTLQKRGDVHKDKFAKVFRHAVTNYRTWIFFLIYGFSMGVELCIN  300

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             NVIAEYFFDRF+LKLHTAGIIAA+FGMAN  ARPFGGFASD+AA+ FGMRGRLW LWI+Q
Sbjct  301   NVIAEYFFDRFNLKLHTAGIIAASFGMANFAARPFGGFASDFAARKFGMRGRLWVLWIVQ  360

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T+GG+FC  LGRAN+LPLA+  MI+FSIGAQAACGA +GI PFISRRSLG+ISGLTGAGG
Sbjct  361   TLGGVFCIWLGRANSLPLAILAMILFSIGAQAACGAAYGIIPFISRRSLGLISGLTGAGG  420

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             NFG GLTQL+FFS+S FSTA+GL++MG+M +ACTLPV LVHFPQWG MFFPASKDA + +
Sbjct  421   NFGGGLTQLVFFSSSTFSTATGLTWMGVMAVACTLPVALVHFPQWGSMFFPASKDA-KYS  479

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EE+YY SEWNE+EKQ+G+H  SLKFAENSRSERGKR
Sbjct  480   EEYYYESEWNEDEKQRGLHHGSLKFAENSRSERGKR  515



>ref|XP_010514846.1| PREDICTED: high affinity nitrate transporter 2.6-like [Camelina 
sativa]
Length=542

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/520 (73%), Positives = 438/520 (84%), Gaps = 7/520 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAV-------ASPIVPTDTTAKFALPVDSEHKAKVFKLF  253
             D EGS G+SMHGVT RE V SF+V       + P+   D TA FALPVDSEH+AKVFK F
Sbjct  6     DEEGSIGTSMHGVTAREQVFSFSVQGEDAPASQPVQSDDPTANFALPVDSEHRAKVFKPF  65

Query  254   SLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSR  433
             S A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SR
Sbjct  66    SFAKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKNDIGNAGVASVSGAIFSR  125

Query  434   LVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWM  613
             L MGAVCDLLG RYG AFL+ML+APTVF MSFVS AGGY+AVRFMIGF LATFVSCQYW 
Sbjct  126   LAMGAVCDLLGARYGTAFLLMLSAPTVFSMSFVSDAGGYLAVRFMIGFCLATFVSCQYWT  185

Query  614   STMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLH  793
             S MFN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGA+PF AWRIAFF+PG+L 
Sbjct  186   SVMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGASPFVAWRIAFFVPGFLQ  245

Query  794   VVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVE  973
             V+MGILVLTLGQDLPDGNL +LQKKG ++KD+FSKVFWYAV NYRT++  LLYG+SMG+E
Sbjct  246   VIMGILVLTLGQDLPDGNLSTLQKKGEVSKDRFSKVFWYAVMNYRTYVLFLLYGFSMGIE  305

Query  974   LSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTL  1153
             ++ +NVI+EYFFDRF L+LHTAG+IAA+FGMAN  ARP GG+ASD +A++FGMRGRLWTL
Sbjct  306   MTINNVISEYFFDRFQLQLHTAGMIAASFGMANFFARPLGGYASDMSARYFGMRGRLWTL  365

Query  1154  WILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLT  1333
             WILQT GGLFC  LGRA +LP+A+  M++FS+G QAACGA FGI PF+SRRSLG+ISGLT
Sbjct  366   WILQTSGGLFCVWLGRATSLPIAILAMMLFSVGVQAACGAIFGIVPFVSRRSLGLISGLT  425

Query  1334  GAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDA  1513
             GAGGNFGSGLTQL+FFS+SKF TA GLS MGIM M  TL V  +HFPQWG MFF  + D 
Sbjct  426   GAGGNFGSGLTQLVFFSSSKFHTADGLSLMGIMAMIFTLLVAFIHFPQWGSMFFGPTSDE  485

Query  1514  VRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +  EEHYY +EW EEEK++G+H+ SLKFAENSRSERG++
Sbjct  486   KKSKEEHYYAAEWTEEEKRQGLHEGSLKFAENSRSERGRK  525



>gb|AAC35884.1| high-affinity nitrate transporter ACH2 [Arabidopsis thaliana]
Length=522

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/507 (76%), Positives = 435/507 (86%), Gaps = 2/507 (0%)
 Frame = +2

Query  107   SPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFH  286
              P SSMHGVTGRE   +F+V     PT+T  K+ LPVD+E KA VFKLFS A PHMRTFH
Sbjct  6     EPRSSMHGVTGREQSYAFSVDGS-EPTNTKKKYNLPVDAEDKATVFKLFSFAKPHMRTFH  64

Query  287   LSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLG  466
             LSWISF TCFVSTFAAAPL+PIIR+NLNL K DIGNAGVASVSGSI SRLVMGAVCDLLG
Sbjct  65    LSWISFSTCFVSTFAAAPLIPIIRENLNLTKHDIGNAGVASVSGSIFSRLVMGAVCDLLG  124

Query  467   PRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGL  646
             PRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFNS+IIGL
Sbjct  125   PRYGCAFLVMLSAPTVFSMSFVSDAAGFITVRFMIGFCLATFVSCQYWMSTMFNSQIIGL  184

Query  647   angtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLG  826
              NGTAAGWGNMGGG TQLLMP++Y+IIR+ G+T F+AWRIAFF+PGWLH++MGILVLTLG
Sbjct  185   VNGTAAGWGNMGGGITQLLMPIVYEIIRRCGSTAFTAWRIAFFVPGWLHIIMGILVLTLG  244

Query  827   QDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYF  1006
             QDLP GN  +++K G + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDNVIAEYF
Sbjct  245   QDLPGGNRAAMEKAGEVAKDKFGKILWYAVTNYRTWIFVLLYGYSMGVELSTDNVIAEYF  304

Query  1007  FDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFC  1186
             FDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AAK FGMRGRLWTLWI+QT GGLFC
Sbjct  305   FDRFHLKLHTAGIIAACFGMANFFARPAGGWASDIAAKRFGMRGRLWTLWIIQTSGGLFC  364

Query  1187  FLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLT  1366
               LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGNFGSGLT
Sbjct  365   VWLGRANTLVTAVVSMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGNFGSGLT  424

Query  1367  QLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCS  1546
             QL+FFSTS+F+T  GL++MG+MI+ACTLPVTL+HFPQWG MFFP S D+V  T EHYY  
Sbjct  425   QLVFFSTSRFTTEEGLTWMGVMIVACTLPVTLIHFPQWGSMFFPPSNDSVDAT-EHYYVG  483

Query  1547  EWNEEEKQKGMHQNSLKFAENSRSERG  1627
             E+++EE+Q GMH  S  FA+ +++E G
Sbjct  484   EYSKEEQQIGMHLKSKLFADGAKTEGG  510



>gb|EYU21099.1| hypothetical protein MIMGU_mgv1a022931mg [Erythranthe guttata]
Length=504

 Score =   766 bits (1978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/515 (76%), Positives = 435/515 (84%), Gaps = 24/515 (5%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPH  271
             ++  GSPG   HGVTGREP+L+F+VASP+   +   KF LPVDSEHKAK FKLFS ANPH
Sbjct  3     SEFGGSPG---HGVTGREPMLAFSVASPMRSNNKVVKFDLPVDSEHKAKKFKLFSFANPH  59

Query  272   MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAV  451
             MRTFHLSWISFFTCFVS FAAAPLVPIIRDNLNL KSDIGNAGVASVSGSI+SRLVMGAV
Sbjct  60    MRTFHLSWISFFTCFVSMFAAAPLVPIIRDNLNLTKSDIGNAGVASVSGSIVSRLVMGAV  119

Query  452   CDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS  631
             CDLLGPRYGCA LIMLTAP VFCMSFVSSAGGYV VRFMIGF+LATFVSCQYWMSTMFN 
Sbjct  120   CDLLGPRYGCAVLIMLTAPPVFCMSFVSSAGGYVVVRFMIGFALATFVSCQYWMSTMFNG  179

Query  632   KIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGIL  811
             +IIGL NGTAAGWGNMGGGATQLLMPVL+ II+ AG T F+AWRIAFF+PGWLHV+MGIL
Sbjct  180   QIIGLVNGTAAGWGNMGGGATQLLMPVLFAIIKSAGYTAFTAWRIAFFVPGWLHVIMGIL  239

Query  812   VLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVT-NYRTWIFALLYGYSMGVELSTDN  988
             VLTLGQDLPDGNLG                 WY    NYRTWIF LLYGYSMGVEL+TDN
Sbjct  240   VLTLGQDLPDGNLG-----------------WYGCCDNYRTWIFVLLYGYSMGVELTTDN  282

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYF+DRFDL+LHTAG+IAA+FGM NLV+R FGGFASDY A+ FGMRGRLW LWILQT
Sbjct  283   VIAEYFYDRFDLQLHTAGVIAASFGMVNLVSRSFGGFASDYMAQHFGMRGRLWNLWILQT  342

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             MGG+FC LLG A +L LA+T+MIIFSIGAQAACGATFG+ PF+SRRSLGIISGLTGAGGN
Sbjct  343   MGGVFCILLGNAASLSLAITFMIIFSIGAQAACGATFGVVPFVSRRSLGIISGLTGAGGN  402

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
              GSGLTQL+FF+ S+ ST +GL YMGI+ + CT+PV  +HFPQWG MF PASK  V   E
Sbjct  403   IGSGLTQLLFFTNSEHSTGTGLIYMGILTVVCTIPVAFIHFPQWGSMFLPASKGLV---E  459

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY  E+++EE++K MH  ++KFAEN RSERG R
Sbjct  460   EHYYIKEYSKEEREKNMHAGNMKFAENCRSERGNR  494



>emb|CDY06299.1| BnaA09g49040D [Brassica napus]
Length=506

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/515 (75%), Positives = 430/515 (83%), Gaps = 16/515 (3%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G  GSSMHGV+                TD T K+ LPVD E +A VFKLFS A P
Sbjct  1     MGDSTGDTGSSMHGVS----------------TDKTGKYDLPVDLEDRATVFKLFSFAKP  44

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K D+GNAGVASVSGSI SRLVMGA
Sbjct  45    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDVGNAGVASVSGSIFSRLVMGA  104

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMF 
Sbjct  105   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFT  164

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+ GAT F+AWRIAFF+PGWLH++MGI
Sbjct  165   SKIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRCGATAFTAWRIAFFVPGWLHIIMGI  224

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLP GN  +++KKG + +DK  K+ W AV+NYRTWIF LLYGYSMGVELSTDN
Sbjct  225   LVLTLGQDLPGGNRKAVEKKGKVVQDKLGKIMWCAVSNYRTWIFVLLYGYSMGVELSTDN  284

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  285   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDIAAKYFGMRGRLWALWIIQT  344

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LG ANTL  A+  MI+FS+GAQAACGATF I PF+SRRSLGIISGLTGAGGN
Sbjct  345   AGGLFCVWLGLANTLVTAIVAMILFSLGAQAACGATFAIVPFVSRRSLGIISGLTGAGGN  404

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPV L+HFPQWG MF P S D V+GT 
Sbjct  405   FGSGLTQLIFFSTSQFTTEQGLTWMGVMIVACTLPVMLIHFPQWGSMFRPPSTDPVKGTA  464

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNEEEKQK MHQ S+ FA N++SE G+ 
Sbjct  465   EYYYVSEWNEEEKQKNMHQGSVAFAINAKSEDGRN  499



>ref|XP_002877380.1| ATNRT2.3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53639.1| ATNRT2.3 [Arabidopsis lyrata subsp. lyrata]
Length=542

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/520 (73%), Positives = 442/520 (85%), Gaps = 7/520 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAV---ASPIVPT----DTTAKFALPVDSEHKAKVFKLF  253
             D EGS G+SMHGVT RE V SF+V   AS ++      D TAKF+LPVDSEH+AKVFK F
Sbjct  6     DDEGSIGTSMHGVTAREQVFSFSVDGNASHLIQVVRSDDPTAKFSLPVDSEHRAKVFKPF  65

Query  254   SLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSR  433
             S A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SR
Sbjct  66    SFAKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKNDIGNAGVASVSGAIFSR  125

Query  434   LVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWM  613
             L MGAVCDLLG RYG AFL+ML+APTVF MSFV++AGGY+AVRFMIGF LATFVSCQYW 
Sbjct  126   LAMGAVCDLLGARYGTAFLLMLSAPTVFSMSFVANAGGYLAVRFMIGFCLATFVSCQYWT  185

Query  614   STMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLH  793
             S MFN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGA+PF AWRIAFF+PG+L 
Sbjct  186   SVMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGASPFVAWRIAFFVPGFLQ  245

Query  794   VVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVE  973
             V+MGILVLTLGQDLPDGNL +LQKKG+++KDKFSKVFWYAV NYRT++  LLYG+SMG+E
Sbjct  246   VIMGILVLTLGQDLPDGNLSTLQKKGDVSKDKFSKVFWYAVMNYRTYVLFLLYGFSMGIE  305

Query  974   LSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTL  1153
             ++ +NVI+EYFFDRF L+LHTAG+IAA+FGMAN  ARP GG+ASD +A+FFGMRGRLWTL
Sbjct  306   MTINNVISEYFFDRFQLQLHTAGMIAASFGMANFFARPLGGYASDMSARFFGMRGRLWTL  365

Query  1154  WILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLT  1333
             WILQT GGLFC  LGRA +LP+A+  M++FS+G QAACGA FGI PF+SRRSLG+ISGLT
Sbjct  366   WILQTSGGLFCVWLGRATSLPIAILAMMLFSVGVQAACGAIFGIVPFVSRRSLGLISGLT  425

Query  1334  GAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDA  1513
             GAGGNFGSGLTQLIFFS+S+F TA GLS MGIM M  TL V  +HFPQWG MFF  + D 
Sbjct  426   GAGGNFGSGLTQLIFFSSSRFHTADGLSMMGIMAMVFTLLVAFIHFPQWGSMFFGPTSDE  485

Query  1514  VRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +  EEHYY +EW EEEK++G+H+ SLKFAENSRSERG++
Sbjct  486   KKVLEEHYYAAEWTEEEKRQGLHEGSLKFAENSRSERGRK  525



>dbj|BAC76606.1| putative high affinity nitrate transporter [Phragmites australis]
Length=523

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/511 (77%), Positives = 439/511 (86%), Gaps = 6/511 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTA-KFALPVDSEHKAKVFKLFSLANPHMRT  280
             G+PGSS+HGVTGREP  +F+ ++  VP D  A KF LPVDSEHKAK  +LFS ANPHMRT
Sbjct  4     GAPGSSLHGVTGREPAFAFSTSA--VPDDDAASKFDLPVDSEHKAKSIRLFSFANPHMRT  61

Query  281   FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDL  460
             FHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGA+CDL
Sbjct  62    FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLAMGAICDL  121

Query  461   LGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKII  640
             LGPRYGCAFLIMLTAPTVFCMS +  A GY+ VRF+IGFSLATFVSCQYWMSTMFNSKII
Sbjct  122   LGPRYGCAFLIMLTAPTVFCMSLIDDAAGYIVVRFLIGFSLATFVSCQYWMSTMFNSKII  181

Query  641   GLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLT  820
             G  NG AAGWGNMGGGATQL MP++YD+IRK GATPF+AWRIA+F+PG +HVVMGILVLT
Sbjct  182   GTVNGLAAGWGNMGGGATQLPMPLVYDVIRKCGATPFTAWRIAYFVPGLMHVVMGILVLT  241

Query  821   LGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAE  1000
             LGQDLPDGNL SLQKKG+ NKDKFSKV WYAVTNYRTWIF LLYGY MGVEL+TDNVIAE
Sbjct  242   LGQDLPDGNLRSLQKKGDANKDKFSKVLWYAVTNYRTWIFVLLYGYCMGVELTTDNVIAE  301

Query  1001  YFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGL  1180
             Y++D FDL L  AGIIAA FGMAN+VARP GG  SD  A+++GMR RLW +WILQT GG 
Sbjct  302   YYYDHFDLDLRVAGIIAACFGMANIVARPLGGILSDIGARYWGMRARLWNIWILQTAGGA  361

Query  1181  FCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSG  1360
             FC  LGRA+TLP ++T M++FS  AQAACGA FG+TPF++RRSLGI+SG+TGAGGNFG+G
Sbjct  362   FCLWLGRASTLPASITAMVLFSFCAQAACGAIFGVTPFVTRRSLGIMSGMTGAGGNFGAG  421

Query  1361  LTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYY  1540
             LTQL+FF++SK+ST  GL YMGIMIMACTLPV  VHFPQWG M  P S  AV   EEHYY
Sbjct  422   LTQLLFFTSSKYSTGMGLEYMGIMIMACTLPVVFVHFPQWGSMLLPPSAGAV---EEHYY  478

Query  1541  CSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              SEW+EEEK KG+H +SLKF+EN RSERG R
Sbjct  479   SSEWSEEEKSKGLHSSSLKFSENCRSERGNR  509



>ref|XP_006419072.1| hypothetical protein EUTSA_v10002793mg [Eutrema salsugineum]
 gb|ESQ37508.1| hypothetical protein EUTSA_v10002793mg [Eutrema salsugineum]
Length=543

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/518 (73%), Positives = 438/518 (85%), Gaps = 7/518 (1%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFAVASPIVPT-------DTTAKFALPVDSEHKAKVFKLFSL  259
             EGS G+SMHGVT RE V SF+V     P+       D TAKFALPVDSEH+AKVFK FS 
Sbjct  8     EGSIGTSMHGVTAREQVFSFSVDDKDGPSSQEVQSDDPTAKFALPVDSEHRAKVFKPFSF  67

Query  260   ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLV  439
             A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL 
Sbjct  68    AKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKNDIGNAGVASVSGAIFSRLA  127

Query  440   MGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMST  619
             MGAVCDLLG RYG AFL++L+APTVF MSFV++AGGY+AVRFMIGF LATFVSCQYW S 
Sbjct  128   MGAVCDLLGARYGTAFLLLLSAPTVFSMSFVANAGGYLAVRFMIGFCLATFVSCQYWTSV  187

Query  620   MFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVV  799
             MFN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRIAFFIPG+L V+
Sbjct  188   MFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKVAGATPFMAWRIAFFIPGFLQVI  247

Query  800   MGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             MGILVLTLGQDLPDGNL +LQKKG+++KDKFSKVFWYAV NYRT++  LLYG+SMG+E++
Sbjct  248   MGILVLTLGQDLPDGNLSALQKKGDVSKDKFSKVFWYAVMNYRTYVLFLLYGFSMGIEMT  307

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
              +NVI+EYFFDRF L+LHTAG+IAA+FGMAN  ARP GG+ASD +A+FFGMRGRLWTLWI
Sbjct  308   INNVISEYFFDRFQLQLHTAGMIAASFGMANFFARPLGGYASDLSARFFGMRGRLWTLWI  367

Query  1160  LQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGA  1339
             LQT GGLFC  LGRA +LP+A+  M++FS+G QAACGA FGI PF+SRRSLG+ISGLTGA
Sbjct  368   LQTSGGLFCVWLGRATSLPIAILSMMLFSVGVQAACGAIFGIVPFVSRRSLGLISGLTGA  427

Query  1340  GGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVR  1519
             GGNFGSGLTQLIFFS+S F TA GLS MGI+ M  TL V  +HFPQWG MFF  + D  +
Sbjct  428   GGNFGSGLTQLIFFSSSTFQTADGLSLMGIVAMFFTLLVAFIHFPQWGSMFFGPTSDEKK  487

Query  1520  GTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EEHYY +EW EEEK++G+H+ SLKFAENSRSERG++
Sbjct  488   SKEEHYYAAEWTEEEKRQGLHEGSLKFAENSRSERGRK  525



>ref|XP_009118513.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Brassica 
rapa]
Length=506

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/515 (75%), Positives = 429/515 (83%), Gaps = 16/515 (3%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G  GSSMHGV+                TD T K+ LPVD E +A VFKLFS A P
Sbjct  1     MGDSTGDTGSSMHGVS----------------TDKTGKYDLPVDLEDRATVFKLFSFAKP  44

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K D+GNAGVASVSGSI SRLVMGA
Sbjct  45    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDVGNAGVASVSGSIFSRLVMGA  104

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MS VS A G++ VRFMIGF LATFVSCQYWMSTMF 
Sbjct  105   VCDLLGPRYGCAFLVMLSAPTVFSMSCVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFT  164

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+ GAT F+AWRIAFF+PGWLH++MGI
Sbjct  165   SKIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRCGATAFTAWRIAFFVPGWLHIIMGI  224

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLP GN  +++KKG + +DK  K+ W AV+NYRTWIF LLYGYSMGVELSTDN
Sbjct  225   LVLTLGQDLPGGNRKAVEKKGKVVQDKLGKIMWCAVSNYRTWIFVLLYGYSMGVELSTDN  284

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  285   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDIAAKYFGMRGRLWALWIIQT  344

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LG ANTL  A+  MI+FS+GAQAACGATF I PF+SRRSLGIISGLTGAGGN
Sbjct  345   AGGLFCVWLGLANTLVTAIVAMILFSLGAQAACGATFAIVPFVSRRSLGIISGLTGAGGN  404

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPV L+HFPQWG MF P S D V+GT 
Sbjct  405   FGSGLTQLIFFSTSQFTTEQGLTWMGVMIVACTLPVMLIHFPQWGSMFRPPSTDPVKGTA  464

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E+YY SEWNEEEKQK MHQ S+ FA N++SE G+ 
Sbjct  465   EYYYVSEWNEEEKQKNMHQGSVAFAINAKSEDGRN  499



>ref|XP_010541315.1| PREDICTED: high affinity nitrate transporter 2.6 [Tarenaya hassleriana]
Length=540

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/516 (73%), Positives = 436/516 (84%), Gaps = 5/516 (1%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFAV-----ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLAN  265
             EGS G+S+HGVTGRE V SF+V     +  +   D T KF LPVDSEH+AKVFK  S A 
Sbjct  8     EGSIGTSLHGVTGREQVFSFSVDIDPSSQTVGSEDPTCKFTLPVDSEHRAKVFKPLSFAK  67

Query  266   PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMG  445
             PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL MG
Sbjct  68    PHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLSKTDIGNAGVASVSGAIFSRLAMG  127

Query  446   AVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF  625
             AVCDLLG RYG AFL+MLTAPTVF MSFV+ AGGY+AVRFMIGF LATFVSCQYW S MF
Sbjct  128   AVCDLLGARYGTAFLLMLTAPTVFSMSFVADAGGYLAVRFMIGFCLATFVSCQYWTSVMF  187

Query  626   NSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMG  805
             N KIIGL NG + GWG+MGGG TQLLMP+++ +IR AGATPF+AWRI+FF+PG+L VV+G
Sbjct  188   NGKIIGLVNGCSGGWGDMGGGVTQLLMPMVFHVIRLAGATPFTAWRISFFVPGFLQVVIG  247

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             ILVLTLGQDLPDGNL  LQ+KG++ KDKFSKVFW+AV NYRTWI  LLYG+SMGVEL+ +
Sbjct  248   ILVLTLGQDLPDGNLSVLQRKGDVAKDKFSKVFWFAVKNYRTWILFLLYGFSMGVELTIN  307

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             NVI+ YFFDRF LKLHTAGI+AA+FGMAN  ARP GG+ASD AA+FFGMRGRLWTLWILQ
Sbjct  308   NVISGYFFDRFHLKLHTAGIVAASFGMANFFARPLGGWASDKAARFFGMRGRLWTLWILQ  367

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T+GGLFC  LG+AN+LP+A+T M++FS+G QAACGA FGI PF+SRRSLGIISGLTGAGG
Sbjct  368   TIGGLFCIWLGQANSLPIAITAMMLFSVGTQAACGAIFGIVPFVSRRSLGIISGLTGAGG  427

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             NFGSGLTQL+FFS+S+F TA GLS MG+M +  T+PV  +HFPQWG MF  A+ D  R  
Sbjct  428   NFGSGLTQLLFFSSSRFHTAEGLSLMGVMAVVFTIPVAFIHFPQWGSMFLGATTDEERSK  487

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EE+YY +EW EEEKQ G+H+ S+KFAENSRSERG+ 
Sbjct  488   EEYYYSAEWTEEEKQLGLHEGSIKFAENSRSERGRN  523



>ref|XP_006648223.1| PREDICTED: high affinity nitrate transporter 2.4-like [Oryza 
brachyantha]
Length=521

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/479 (78%), Positives = 420/479 (88%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF+LPVDSEHKAK  +L S A PHMRTFHLSWISFF+CFVSTFAAAPLVPIIRDNL+L 
Sbjct  28    SKFSLPVDSEHKAKTIRLLSFARPHMRTFHLSWISFFSCFVSTFAAAPLVPIIRDNLSLT  87

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGAVCD+LGPRYGCAFLIML APTVFCMS + SA GY+ 
Sbjct  88    KADIGNAGVASVSGSIFSRLAMGAVCDMLGPRYGCAFLIMLAAPTVFCMSLIESAAGYIV  147

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIGL NG AAGWGNMGGGATQL+MP++YD+IRK 
Sbjct  148   VRFLIGFSLATFVSCQYWMSTMFNSKIIGLVNGLAAGWGNMGGGATQLIMPLVYDVIRKC  207

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF+AWR+A+F+PG LHVVMGILVLTLGQDLPDGNL SLQKKG++NKD FSKV  YAV
Sbjct  208   GATPFTAWRLAYFVPGTLHVVMGILVLTLGQDLPDGNLRSLQKKGDVNKDSFSKVLRYAV  267

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGYSMGVEL+TDNVIAEYF+DRFDL L  AGIIAA+FGMAN+VARP GG
Sbjct  268   TNYRTWIFVLLYGYSMGVELTTDNVIAEYFYDRFDLDLRVAGIIAASFGMANIVARPTGG  327

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
               SD  A++FGMR RLW +W+LQT GG FC LLGRA+TLP +V  M++FS  AQAACGA 
Sbjct  328   LLSDLGARYFGMRARLWNIWLLQTAGGAFCLLLGRASTLPTSVVCMVLFSFCAQAACGAI  387

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PFISRRSLGIISG+TGAGGNFG+GLTQL+FF++S++ST +GL YMGIMIMACTLPV
Sbjct  388   FGVIPFISRRSLGIISGMTGAGGNFGAGLTQLLFFTSSRYSTGTGLEYMGIMIMACTLPV  447

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              LVHFPQWG M  P +  A    EEHYY SEW++EEK KG+H  SLKFAEN+RSERG+R
Sbjct  448   VLVHFPQWGSMLLPPNAGA---EEEHYYGSEWSDEEKSKGLHGASLKFAENARSERGRR  503



>gb|KFK27603.1| hypothetical protein AALP_AA8G405000 [Arabis alpina]
Length=533

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/516 (72%), Positives = 436/516 (84%), Gaps = 0/516 (0%)
 Frame = +2

Query  86    LMADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLAN  265
             + ++ EGS G+S+HGVT RE V SF+V +     D TAKFALPVDSEH+AKVF   S A 
Sbjct  1     MASNEEGSIGTSLHGVTAREQVFSFSVDASSQTDDPTAKFALPVDSEHRAKVFNPLSFAK  60

Query  266   PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMG  445
             PHMR FHL WISFFTCF+STFAAAPLVP+IRDNL+L K+DIGNAGVASVSG+I SRL MG
Sbjct  61    PHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLDLTKTDIGNAGVASVSGAIFSRLAMG  120

Query  446   AVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF  625
             AVCDLLG RYG AF +MLTAPTVF MSFV+ AGGY+AVRFMIGF LATFVSCQYW S MF
Sbjct  121   AVCDLLGARYGTAFSLMLTAPTVFTMSFVADAGGYLAVRFMIGFCLATFVSCQYWTSVMF  180

Query  626   NSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMG  805
             N KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF+AWRIAFF+PG+L VVMG
Sbjct  181   NGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFQVIQLAGATPFTAWRIAFFVPGFLQVVMG  240

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             ILVLTLGQDLPDGNL +LQK G ++KD+FSKVFW+AV NYRTWI  +LYG SMG+EL+ +
Sbjct  241   ILVLTLGQDLPDGNLSTLQKSGQVSKDQFSKVFWFAVKNYRTWILFVLYGSSMGIELTIN  300

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             NVI+ YF+DRF+LKL TAGI+AA+FGMAN  ARPFGG+ASD AA+ FGMRGRLWTLWI Q
Sbjct  301   NVISGYFYDRFNLKLQTAGIVAASFGMANFFARPFGGYASDVAARIFGMRGRLWTLWIFQ  360

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAGG
Sbjct  361   TVGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAGG  420

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             NFGSG+TQL+FFS+S+FSTA GLS MG+M + CTLPV  +HFPQWG MF   S D  R  
Sbjct  421   NFGSGVTQLLFFSSSRFSTAEGLSLMGVMAVVCTLPVAFIHFPQWGSMFLRPSSDGERSK  480

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EE+YY SEW E+EK++G+H+ S+KFAENSRSERG++
Sbjct  481   EEYYYGSEWTEDEKRQGLHEGSIKFAENSRSERGRK  516



>gb|KFK22683.1| hypothetical protein AALP_AAs42556U000400 [Arabis alpina]
Length=520

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/509 (75%), Positives = 426/509 (84%), Gaps = 3/509 (1%)
 Frame = +2

Query  107   SPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFH  286
             +PGSSMHGVTG++   +F VASPI   D TA F LPVD EHKA   KLFS A PHMRTFH
Sbjct  4     TPGSSMHGVTGKQQSYAFEVASPI---DRTAHFDLPVDVEHKAMKLKLFSFAKPHMRTFH  60

Query  287   LSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLG  466
             LSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGS+ SRLVMGAVCDLLG
Sbjct  61    LSWISFATCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSMFSRLVMGAVCDLLG  120

Query  467   PRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGL  646
             PRYGCAFL+ML+APTVF MSFV+ A G++ VRFMIGF LATFVSCQYWMSTMFN +I+GL
Sbjct  121   PRYGCAFLVMLSAPTVFSMSFVTGAAGFITVRFMIGFCLATFVSCQYWMSTMFNGQIVGL  180

Query  647   angtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLG  826
              NGTAAGWGN+GGG  QLLMP +Y+I R+ G+T F+AWRIAFF+PGWLH +MGILVLTLG
Sbjct  181   VNGTAAGWGNIGGGIAQLLMPGMYEITRRCGSTAFTAWRIAFFVPGWLHTIMGILVLTLG  240

Query  827   QDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYF  1006
             QDLPDGN  +L KKG + KDKF K+ WYAVTNYRTWI  LLYGYS+GVEL+TDNVIAEYF
Sbjct  241   QDLPDGNKAALVKKGEVVKDKFGKIMWYAVTNYRTWILVLLYGYSLGVELTTDNVIAEYF  300

Query  1007  FDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFC  1186
             FDRF L LHTAGIIAA+ GMAN+  RP GG+ASD AAK+FGMRGRLW LWI+QT GGLFC
Sbjct  301   FDRFHLNLHTAGIIAASSGMANIFTRPAGGYASDVAAKYFGMRGRLWALWIIQTSGGLFC  360

Query  1187  FLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLT  1366
               LGRANTL  AV  MI+FSIG+QAACGATFGI PF+SRRSLGIISGLTGAGGNFGSGLT
Sbjct  361   VWLGRANTLANAVVAMILFSIGSQAACGATFGIVPFVSRRSLGIISGLTGAGGNFGSGLT  420

Query  1367  QLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCS  1546
             QL+FFST  F+T  GL+ MG MI+ACTLPV L+HFPQWG MF P SKD  +GTE HYY S
Sbjct  421   QLLFFSTHHFTTEQGLTLMGWMIVACTLPVMLIHFPQWGSMFLPPSKDPFKGTELHYYES  480

Query  1547  EWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EW+EEEK + MH  S  FA ++ SE G +
Sbjct  481   EWDEEEKARNMHYGSKLFAMSAVSEGGPK  509



>ref|XP_009796419.1| PREDICTED: high affinity nitrate transporter 2.4-like [Nicotiana 
sylvestris]
Length=534

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/518 (73%), Positives = 449/518 (87%), Gaps = 4/518 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTD---TTAKFALPVDSEHKAKVFKLFSL  259
             MA+ EG  GSS+HG+TG+E   +F+V+S   P+D   T  KF+LPVDSEHKAK  K+FS 
Sbjct  1     MANTEGPIGSSVHGLTGKEQTFAFSVSSQPHPSDNNDTATKFSLPVDSEHKAKTLKIFSF  60

Query  260   ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLV  439
             A PHMR+FHL+WISFFTC +STFAAAPLVPIIRDNL+L +SDIGNAGVASVSGSI SRLV
Sbjct  61    AQPHMRSFHLAWISFFTCLISTFAAAPLVPIIRDNLDLTRSDIGNAGVASVSGSIFSRLV  120

Query  440   MGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMST  619
             MG +CDL+GPRYGCAF+ +LTAP VF ++FVSSA GYVAVRFMIG SLATFVSCQYW ST
Sbjct  121   MGVLCDLIGPRYGCAFVNLLTAPVVFSVAFVSSAEGYVAVRFMIGVSLATFVSCQYWTST  180

Query  620   MFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVV  799
             MFN +IIGL NG AAGWG+MGGGATQLLMP L+ II+  GATPF+AWRIAFFIPGWLH++
Sbjct  181   MFNGQIIGLVNGVAAGWGDMGGGATQLLMPFLFHIIQLTGATPFTAWRIAFFIPGWLHII  240

Query  800   MGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             +G++VL LGQDLPDGNL +LQK+G+++KDKFSK+FW+AVTNYRTWIF  +YG+SMGV+L 
Sbjct  241   VGVMVLILGQDLPDGNLSALQKRGDVHKDKFSKIFWFAVTNYRTWIFFFIYGFSMGVQLC  300

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
              +NVI EYF+DRF+LKLHTAG+IAAT+GM N VARPFGG+ASD AA+ FGMRGRLW LWI
Sbjct  301   MNNVIVEYFYDRFNLKLHTAGVIAATYGMINFVARPFGGYASDLAARKFGMRGRLWILWI  360

Query  1160  LQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGA  1339
             +QT GG+FC  LG+A TLP A+  MI+FS+GAQAACGAT+G+ PF+SRRSLG+ISGLTGA
Sbjct  361   VQTFGGVFCVWLGKAETLPTAIVAMILFSVGAQAACGATYGVIPFVSRRSLGLISGLTGA  420

Query  1340  GGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVR  1519
             GGNFG GLTQL+FFST+KFSTA+GL++MG M +ACT+PV  +HFPQWG MF PASKD  +
Sbjct  421   GGNFGGGLTQLVFFSTTKFSTATGLTWMGFMAVACTVPVAFIHFPQWGSMFLPASKDK-K  479

Query  1520  GTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EEHYYCSEW ++EKQKG+H  S+KFAENSRSERG++
Sbjct  480   YNEEHYYCSEWTDDEKQKGLHHGSIKFAENSRSERGRK  517



>ref|XP_008467040.1| PREDICTED: high affinity nitrate transporter 2.4-like, partial 
[Cucumis melo]
Length=446

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/446 (85%), Positives = 411/446 (92%), Gaps = 0/446 (0%)
 Frame = +2

Query  272   MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAV  451
             MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGV SVSGSI SRLVMGAV
Sbjct  1     MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKVDIGNAGVTSVSGSIFSRLVMGAV  60

Query  452   CDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS  631
             CDLLGPRYGCAFLIML+APTVFCMSFVS+A GY+AVRFMIGFSLATFVSCQYWMSTMFNS
Sbjct  61    CDLLGPRYGCAFLIMLSAPTVFCMSFVSNAAGYIAVRFMIGFSLATFVSCQYWMSTMFNS  120

Query  632   KIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGIL  811
             +IIGL NGTAAGWGNMGGGATQL+MP+LYD+I++AGATPF+AWRIAFFIPG+LHV+MGIL
Sbjct  121   QIIGLVNGTAAGWGNMGGGATQLIMPLLYDVIQRAGATPFTAWRIAFFIPGFLHVLMGIL  180

Query  812   VLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNV  991
             VLTLGQDLPDGNL SLQKKGN+ KDKFS V WYAVTNYRTWIF LLYGYSMGVELSTDNV
Sbjct  181   VLTLGQDLPDGNLASLQKKGNVAKDKFSNVLWYAVTNYRTWIFVLLYGYSMGVELSTDNV  240

Query  992   IAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTM  1171
             IAEYF+DRFDLKLHTAGIIAATFGMANLVARPFGG+ASD AA++FGMRGRLWTLWILQT 
Sbjct  241   IAEYFYDRFDLKLHTAGIIAATFGMANLVARPFGGYASDVAARYFGMRGRLWTLWILQTA  300

Query  1172  GGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNF  1351
             GG+FC  LG+A  LP+A+  MI+FSIGAQAACGATFGI PFISRRSLGIISGLTGAGGNF
Sbjct  301   GGVFCMWLGKATKLPIAIVAMILFSIGAQAACGATFGIIPFISRRSLGIISGLTGAGGNF  360

Query  1352  GSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEE  1531
             GSGLTQL+FFST+K+ST +GL  MGIMI+ CTLP+TLVHFPQWG MF P +K   + TEE
Sbjct  361   GSGLTQLVFFSTTKYSTDTGLFLMGIMIVCCTLPITLVHFPQWGSMFLPPTKHVEKSTEE  420

Query  1532  HYYCSEWNEEEKQKGMHQNSLKFAEN  1609
              YY SEW E+EK+KG+HQ S+KFAEN
Sbjct  421   FYYGSEWTEDEKKKGLHQQSIKFAEN  446



>ref|XP_009149905.1| PREDICTED: high affinity nitrate transporter 2.6-like [Brassica 
rapa]
Length=546

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/521 (72%), Positives = 436/521 (84%), Gaps = 8/521 (2%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAVAS----PIVPT----DTTAKFALPVDSEHKAKVFKL  250
             + EGS G+SMHGVT RE V SF+V      P   T    D TAKFALPVDSEH+A  FK 
Sbjct  6     EDEGSIGTSMHGVTAREQVFSFSVQGEDDGPSSHTVGFDDPTAKFALPVDSEHRATAFKP  65

Query  251   FSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILS  430
             FS A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L KSDIGNAGVASVSG+I S
Sbjct  66    FSFAKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKSDIGNAGVASVSGAIFS  125

Query  431   RLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYW  610
             RL MGAVCDLLG RYG AFL+ML+APTVF MSFVS AGGY++VRFMIGF LATFVSCQYW
Sbjct  126   RLAMGAVCDLLGARYGTAFLLMLSAPTVFSMSFVSDAGGYLSVRFMIGFCLATFVSCQYW  185

Query  611   MSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWL  790
              S MFN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF+AWRIAFFIPG+L
Sbjct  186   TSVMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFTAWRIAFFIPGFL  245

Query  791   HVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGV  970
              V+MGILVLTLGQDLPDGNL +LQK+G ++KDKF+KVFWYAV NYRT++  LLYG+SMG+
Sbjct  246   QVIMGILVLTLGQDLPDGNLSTLQKRGEVSKDKFTKVFWYAVLNYRTYVLFLLYGFSMGI  305

Query  971   ELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWT  1150
             E++ +NVI+EYFFDRF L+LHTAG+IAA+FGMAN  ARP GG+ASD +A+FFGMRGRLWT
Sbjct  306   EMTINNVISEYFFDRFQLELHTAGMIAASFGMANFFARPLGGYASDISARFFGMRGRLWT  365

Query  1151  LWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGL  1330
             LWILQT GG+FC  LGRA +LP+A+  M++FS+G QAACGA FGI PF+SRRSLG+ISGL
Sbjct  366   LWILQTSGGIFCVWLGRATSLPIAILSMMLFSVGVQAACGAIFGIVPFVSRRSLGLISGL  425

Query  1331  TGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKD  1510
             TGAGGNFGSGLTQLIFFS+SKF  A GLS MGIM M  TL V  +HFPQWG MFF  + D
Sbjct  426   TGAGGNFGSGLTQLIFFSSSKFHAADGLSLMGIMGMIFTLLVAFIHFPQWGSMFFGPTSD  485

Query  1511  AVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               +  EEHYY +EW EEEK++G+H+ SLKFAENSRSERG++
Sbjct  486   EKKSKEEHYYAAEWTEEEKRQGLHEGSLKFAENSRSERGRK  526



>gb|EMS65310.1| High-affinity nitrate transporter 2.1 [Triticum urartu]
Length=507

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/483 (77%), Positives = 418/483 (87%), Gaps = 4/483 (1%)
 Frame = +2

Query  188   DTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             DT A KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN
Sbjct  10    DTAASKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  69

Query  365   LNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAG  544
             LNL K+DIGNAGVASVSGSI SRL MGAVCDLLGPRYGCAFL+ML+APTVFCM+ +  A 
Sbjct  70    LNLAKADIGNAGVASVSGSIFSRLAMGAVCDLLGPRYGCAFLVMLSAPTVFCMAVIDDAS  129

Query  545   GYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDI  724
             GY+AVRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  
Sbjct  130   GYIAVRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHA  189

Query  725   IRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVF  904
             I+K GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV 
Sbjct  190   IQKCGATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDVAKDKFSKVL  249

Query  905   WYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVAR  1084
             W AVTNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VAR
Sbjct  250   WGAVTNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANIVAR  309

Query  1085  PFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAA  1264
             P GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAA
Sbjct  310   PMGGYLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAA  369

Query  1265  CGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMAC  1444
             CGA FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMAC
Sbjct  370   CGAVFGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMAC  429

Query  1445  TLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSER  1624
             TLPVTLVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSER
Sbjct  430   TLPVTLVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKNKGLHIAGQKFAENSRSER  486

Query  1625  GKR  1633
             G+R
Sbjct  487   GRR  489



>ref|XP_006400813.1| hypothetical protein EUTSA_v10013201mg [Eutrema salsugineum]
 gb|ESQ42266.1| hypothetical protein EUTSA_v10013201mg [Eutrema salsugineum]
Length=537

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/516 (72%), Positives = 431/516 (84%), Gaps = 3/516 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAV---ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLAN  265
             D EGS G+S+HGVT RE V SF+V   +  I+  D TAKFA+PVDSEH+AKVF   S A 
Sbjct  5     DDEGSIGTSLHGVTAREQVFSFSVDVSSQTIISDDPTAKFAMPVDSEHRAKVFNPLSFAK  64

Query  266   PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMG  445
             PHMR FHL W+SFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL MG
Sbjct  65    PHMRAFHLGWVSFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRLAMG  124

Query  446   AVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF  625
             AVCDLLG RYG AF +MLTAP VF MSFV+ AGGY+AVRFMIGF LATFVSCQYW S MF
Sbjct  125   AVCDLLGARYGTAFSLMLTAPMVFSMSFVTDAGGYLAVRFMIGFCLATFVSCQYWTSVMF  184

Query  626   NSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMG  805
             N KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRIAFF+PG+L VVMG
Sbjct  185   NGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFMAWRIAFFVPGFLQVVMG  244

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             ILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  LLYG SMG+EL+ +
Sbjct  245   ILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFLLYGSSMGIELTIN  304

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             NVI+ YF+DRF+LKL TAGI+AA+FGMAN  ARPFGG+ASD AA+ FGMRGRLW LWI Q
Sbjct  305   NVISGYFYDRFNLKLQTAGIVAASFGMANFFARPFGGYASDVAARLFGMRGRLWILWIFQ  364

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T+G LFC  LGRANTLP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAGG
Sbjct  365   TIGALFCIWLGRANTLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAGG  424

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             NFGSG+TQL+FFSTS+FSTA GLS MG M +  TLPV  +HFPQWG MF   S+D  R  
Sbjct  425   NFGSGVTQLLFFSTSRFSTAEGLSLMGAMAVLSTLPVAFIHFPQWGSMFLRPSRDGERSK  484

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EE+YY SEW E+EK++G+H+ S+KFAENSRSER ++
Sbjct  485   EEYYYGSEWTEDEKRQGLHEGSIKFAENSRSERSRK  520



>gb|EMS65311.1| High-affinity nitrate transporter 2.1 [Triticum urartu]
Length=507

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/479 (78%), Positives = 416/479 (87%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  14    SKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  73

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGAVCDLLGPRYGCAFL+ML+APTVFCM+ V  A GY+A
Sbjct  74    KADIGNAGVASVSGSIFSRLAMGAVCDLLGPRYGCAFLVMLSAPTVFCMAVVDDASGYIA  133

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  134   VRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  193

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W AV
Sbjct  194   GATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVLWGAV  253

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VARP GG
Sbjct  254   TNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANIVARPMGG  313

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA 
Sbjct  314   YLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAACGAV  373

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMACTLPV
Sbjct  374   FGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMACTLPV  433

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             TLVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSERG+R
Sbjct  434   TLVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKGKGLHIAGQKFAENSRSERGRR  489



>ref|XP_009120613.1| PREDICTED: high affinity nitrate transporter 2.3-like [Brassica 
rapa]
Length=536

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/519 (72%), Positives = 434/519 (84%), Gaps = 3/519 (1%)
 Frame = +2

Query  86    LMADIEGSPGSSMHGVTGREPVLSFAV--ASPIVPT-DTTAKFALPVDSEHKAKVFKLFS  256
             + ++ EGS G+S+HGVT +E V SF+   +S +VP+ D T+KFALPVDSEH+AKVF   S
Sbjct  1     MASNEEGSIGTSLHGVTAKEHVFSFSADASSQVVPSNDPTSKFALPVDSEHRAKVFNPLS  60

Query  257   LANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRL  436
              A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL
Sbjct  61    FAKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRL  120

Query  437   VMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMS  616
              MGAVCDLLG RYG AF +MLTAP VF MSFV+   GY+AVRFMIGF LATFVSCQYW S
Sbjct  121   AMGAVCDLLGARYGTAFSLMLTAPMVFTMSFVTGPVGYLAVRFMIGFCLATFVSCQYWTS  180

Query  617   TMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHV  796
              MFN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRIAFF+PG+L V
Sbjct  181   VMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFMAWRIAFFVPGFLQV  240

Query  797   VMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVEL  976
             VMGILVLT GQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMG+EL
Sbjct  241   VMGILVLTFGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFVLYGFSMGIEL  300

Query  977   STDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLW  1156
             + +NVI+ YFFDRF+LKL TAGI+AA+FGMAN  ARPFGG+ASD AAK FGMRGRLW LW
Sbjct  301   TINNVISGYFFDRFNLKLQTAGIVAASFGMANFFARPFGGYASDVAAKLFGMRGRLWILW  360

Query  1157  ILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTG  1336
             I QT+G LFC  LGRAN+LP+AV  MI+FSIG QAACGA FG+ PF+SRRSLG+ISGLTG
Sbjct  361   IFQTVGALFCIWLGRANSLPIAVLAMILFSIGTQAACGALFGVAPFVSRRSLGLISGLTG  420

Query  1337  AGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAV  1516
             AGGNFGSGLTQL+FFSTS+FSTA GLS MG M + CTLPV  +HFPQWG MF   S+D  
Sbjct  421   AGGNFGSGLTQLLFFSTSRFSTAEGLSLMGAMAVLCTLPVAFIHFPQWGSMFLRPSRDGE  480

Query  1517  RGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             R  EE+YY SEW E+EK++G+H+ S+KFAENSRSER ++
Sbjct  481   RSKEEYYYSSEWTEDEKRQGLHEGSIKFAENSRSERSRK  519



>ref|XP_006419073.1| hypothetical protein EUTSA_v10002919mg [Eutrema salsugineum]
 gb|ESQ37509.1| hypothetical protein EUTSA_v10002919mg [Eutrema salsugineum]
Length=542

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/520 (71%), Positives = 436/520 (84%), Gaps = 6/520 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV-----ASPIVPTD-TTAKFALPVDSEHKAKVFKLF  253
             ++ +GS GSS+HGVTGRE V SF+V     +S  + +D  TAKFALPVDSEH+A VF+  
Sbjct  6     SNEDGSIGSSLHGVTGREQVFSFSVQEDGPSSQAIRSDYATAKFALPVDSEHRATVFRPL  65

Query  254   SLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSR  433
             S A PHMR FHL WISFFTCF+STFAAAPLVP+IRDNL+L K+DIGNAGVASVSG+I SR
Sbjct  66    SFAKPHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLDLTKTDIGNAGVASVSGAIFSR  125

Query  434   LVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWM  613
             L MGAVCDLLG RYG AF +ML+AP VF MSFVS AG Y+AVRFMIGF LATFVSCQYW 
Sbjct  126   LAMGAVCDLLGARYGTAFSLMLSAPAVFSMSFVSDAGSYLAVRFMIGFCLATFVSCQYWT  185

Query  614   STMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLH  793
             S MF+ KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF+AWR AFFIPG+L 
Sbjct  186   SVMFSGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFTAWRFAFFIPGFLQ  245

Query  794   VVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVE  973
             +VMGILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMGVE
Sbjct  246   IVMGILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVRNYRTWILFVLYGFSMGVE  305

Query  974   LSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTL  1153
             L+ +NVI+ YFFDRF+L LHTAGI+AA+FGMAN  ARPFGG+ASD AA+ FGMRGRLWTL
Sbjct  306   LTINNVISGYFFDRFNLTLHTAGIVAASFGMANFFARPFGGYASDVAARLFGMRGRLWTL  365

Query  1154  WILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLT  1333
             WILQT+G LFC  LGRAN+LP+A+  M++FS+G QAACGA FG+ PF+SRRSLG+ISGLT
Sbjct  366   WILQTVGALFCIWLGRANSLPIAILAMMLFSVGTQAACGALFGVAPFVSRRSLGLISGLT  425

Query  1334  GAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDA  1513
             GAGGNFGSG+TQL+FFS+S+FSTA GLS MG+M + CTLPV  +HFPQWG MF   S+  
Sbjct  426   GAGGNFGSGVTQLLFFSSSRFSTAEGLSLMGVMAVVCTLPVAFIHFPQWGSMFLRPSQHE  485

Query  1514  VRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              R  EEHYY SEW EEEK  G+H+ S+KFAENSRSERG++
Sbjct  486   ERSKEEHYYGSEWTEEEKSLGLHEGSIKFAENSRSERGRK  525



>gb|AAK19519.1|AF332214_1 high affinity nitrate transporter [Triticum aestivum]
Length=507

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/479 (77%), Positives = 415/479 (87%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  14    SKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  73

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML+APTVFCM+ +  A GY+A
Sbjct  74    KADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLSAPTVFCMAVIDDASGYIA  133

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  134   VRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  193

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W AV
Sbjct  194   GATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVLWGAV  253

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VARP GG
Sbjct  254   TNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANIVARPMGG  313

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA 
Sbjct  314   YLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAACGAV  373

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMACTLPV
Sbjct  374   FGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMACTLPV  433

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              LVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSERG+R
Sbjct  434   ALVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKNKGLHIAGQKFAENSRSERGRR  489



>gb|AAG01172.1| high affinity nitrate transporter TaNRT2 [Triticum aestivum]
Length=507

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/483 (77%), Positives = 417/483 (86%), Gaps = 4/483 (1%)
 Frame = +2

Query  188   DTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             DT A KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN
Sbjct  10    DTAASKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  69

Query  365   LNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAG  544
             LNL K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML+APTVFCM+ +  A 
Sbjct  70    LNLAKADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLSAPTVFCMAAIDDAS  129

Query  545   GYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDI  724
             GY+AVRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  
Sbjct  130   GYIAVRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHA  189

Query  725   IRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVF  904
             I+K GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV 
Sbjct  190   IQKCGATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVL  249

Query  905   WYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVAR  1084
             W AVTNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VAR
Sbjct  250   WGAVTNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANIVAR  309

Query  1085  PFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAA  1264
             P GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAA
Sbjct  310   PMGGYLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAA  369

Query  1265  CGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMAC  1444
             CGA FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMAC
Sbjct  370   CGAVFGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMAC  429

Query  1445  TLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSER  1624
             TLPV LVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSER
Sbjct  430   TLPVALVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKGKGLHITGQKFAENSRSER  486

Query  1625  GKR  1633
             G+R
Sbjct  487   GRR  489



>gb|AAC49531.1| BCH1 [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/483 (77%), Positives = 417/483 (86%), Gaps = 4/483 (1%)
 Frame = +2

Query  188   DTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             DT A KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCF+STFAAAPLVPIIRDN
Sbjct  10    DTAASKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFISTFAAAPLVPIIRDN  69

Query  365   LNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAG  544
             LNL K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML+APTVFCM+ +  A 
Sbjct  70    LNLAKADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLSAPTVFCMAVIDDAS  129

Query  545   GYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDI  724
             GY+AVRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  
Sbjct  130   GYIAVRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHA  189

Query  725   IRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVF  904
             I+K GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV 
Sbjct  190   IQKCGATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVL  249

Query  905   WYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVAR  1084
             W AVTNYRTWIF LLYGY MGVEL+TDNVIAEY+FD F L L  AG IAA FGMAN+VAR
Sbjct  250   WGAVTNYRTWIFVLLYGYCMGVELTTDNVIAEYYFDHFHLDLRAAGTIAACFGMANIVAR  309

Query  1085  PFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAA  1264
             P GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAA
Sbjct  310   PTGGYLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAA  369

Query  1265  CGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMAC  1444
             CGA FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMAC
Sbjct  370   CGAIFGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMAC  429

Query  1445  TLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSER  1624
             TLPV LVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSER
Sbjct  430   TLPVALVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKAKGLHIAGQKFAENSRSER  486

Query  1625  GKR  1633
             G+R
Sbjct  487   GRR  489



>ref|XP_009620497.1| PREDICTED: high affinity nitrate transporter 2.4-like [Nicotiana 
tomentosiformis]
 ref|XP_009622610.1| PREDICTED: high affinity nitrate transporter 2.4-like [Nicotiana 
tomentosiformis]
Length=530

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/516 (72%), Positives = 448/516 (87%), Gaps = 4/516 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFA-VASPIVPTDTTAKFALPVDSEHKAKVFKLFSLAN  265
             MA+ EG  GSS+HG+TG+E   +F+ V+S   P+DT  KF+LPVDSEHKAK  K+FS A 
Sbjct  1     MANTEGPIGSSVHGLTGKEQTFAFSSVSSQPHPSDT--KFSLPVDSEHKAKTLKIFSFAQ  58

Query  266   PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMG  445
             PHMR+FHL+WISFFTC +STFAAAPLVPIIRDNL+L +SDIGNAGVASVSGSI SRLVMG
Sbjct  59    PHMRSFHLAWISFFTCLISTFAAAPLVPIIRDNLDLTRSDIGNAGVASVSGSIFSRLVMG  118

Query  446   AVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF  625
              +CDL+GPRYGCAF+ +LTAP VF ++FVSSA GYVAVRFMIG SLATFVSCQYW STMF
Sbjct  119   VLCDLIGPRYGCAFVNLLTAPVVFSVAFVSSAQGYVAVRFMIGVSLATFVSCQYWTSTMF  178

Query  626   NSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMG  805
             N +IIGL NG AAGWG+MGGG TQLLMP L+ II+  GATPF+AWRIAFFIPGWLH+++G
Sbjct  179   NGQIIGLVNGVAAGWGDMGGGVTQLLMPFLFRIIQLTGATPFTAWRIAFFIPGWLHIIVG  238

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             ++VL LGQDLPDGNL +LQK+G+++KDKFSK+FW+AVTNYRTWIF  +YG+SMGV+L  +
Sbjct  239   VMVLILGQDLPDGNLTTLQKRGDVHKDKFSKIFWFAVTNYRTWIFFFIYGFSMGVQLCMN  298

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             NVI EYF+DRF+LKLHTAG+IAAT+GM N VARPFGG+ASD AA+ FGMRGRLW LWI+Q
Sbjct  299   NVIVEYFYDRFNLKLHTAGVIAATYGMINFVARPFGGYASDLAARKFGMRGRLWILWIVQ  358

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T GG+FC  LG+A TLP A+  MI+FSIGAQAACGAT+G+ PF+SRRSLG+ISGLTGAGG
Sbjct  359   TFGGVFCVWLGKAETLPTAIVAMILFSIGAQAACGATYGVIPFVSRRSLGLISGLTGAGG  418

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             NFG GLTQLIFFST++FSTA+GL++MG M +AC++P+  +HFPQWG MF PASKD  +  
Sbjct  419   NFGGGLTQLIFFSTTRFSTATGLTWMGFMAVACSVPIAFIHFPQWGSMFLPASKDK-KYN  477

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EEHYYCSEW ++EKQKG+H  S+KFAENSRSERG++
Sbjct  478   EEHYYCSEWTDDEKQKGLHHKSIKFAENSRSERGRK  513



>ref|XP_010456747.1| PREDICTED: high affinity nitrate transporter 2.3-like [Camelina 
sativa]
Length=540

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/516 (71%), Positives = 429/516 (83%), Gaps = 3/516 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAV---ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLAN  265
             D EGS G+S+HGVTGRE V SF+V   +  +   D TAKFALPVDSEH+AKVF   S A 
Sbjct  8     DDEGSIGTSLHGVTGREQVFSFSVDPSSQTVQSDDPTAKFALPVDSEHRAKVFNPLSFAK  67

Query  266   PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMG  445
             PHMR FHL W+SFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL MG
Sbjct  68    PHMRAFHLGWLSFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRLAMG  127

Query  446   AVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF  625
             AVCDLLG RYG AF +MLTAPTVF MSFV    GY+ VRFMIGF LATFVSCQYW S MF
Sbjct  128   AVCDLLGARYGTAFSLMLTAPTVFSMSFVGGPSGYLGVRFMIGFCLATFVSCQYWTSVMF  187

Query  626   NSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMG  805
             N KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRIAFF+PG L ++MG
Sbjct  188   NGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFQVIKLAGATPFMAWRIAFFVPGLLQIIMG  247

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             ILVLTLGQDLPDGNL +LQK+G I+KDKFSKVFW+AV NYRTWI  +LYG+SMG+EL+ +
Sbjct  248   ILVLTLGQDLPDGNLSTLQKRGQISKDKFSKVFWFAVRNYRTWILFVLYGFSMGIELTIN  307

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             NVI+ YF+DRF+LKL TAGI+AA+FGMAN +ARPFGG+ASD AA+ FGMRGRLW LWI Q
Sbjct  308   NVISGYFYDRFNLKLQTAGIVAASFGMANFIARPFGGYASDVAARIFGMRGRLWILWIFQ  367

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAGG
Sbjct  368   TIGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAGG  427

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             NFGSGLTQL+FFS+S+FSTA GLS MG M + CTLPV  +HFPQWG MF   S D  R  
Sbjct  428   NFGSGLTQLLFFSSSRFSTAEGLSLMGAMAVLCTLPVAFIHFPQWGSMFLRPSSDGERSK  487

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EE+YY SEW E EK +G+H+ S+KFAENSRSERG++
Sbjct  488   EEYYYSSEWTENEKNQGLHEGSIKFAENSRSERGRK  523



>gb|EMT10645.1| Nitrate transporter [Aegilops tauschii]
Length=507

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/478 (77%), Positives = 414/478 (87%), Gaps = 3/478 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  14    SKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  73

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGAVCDLLGPRYGCAFL+ML+APTVFCM+ +  A GY+A
Sbjct  74    KADIGNAGVASVSGSIFSRLAMGAVCDLLGPRYGCAFLVMLSAPTVFCMAVIDDASGYIA  133

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  134   VRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  193

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W AV
Sbjct  194   GATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVLWGAV  253

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VARP GG
Sbjct  254   TNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANIVARPMGG  313

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA 
Sbjct  314   YLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAACGAV  373

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMACTLPV
Sbjct  374   FGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMACTLPV  433

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGK  1630
              LVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSERG+
Sbjct  434   ALVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKNKGLHIAGQKFAENSRSERGR  488



>gb|AAL11016.1| high-affinity nitrate transporter [Triticum aestivum]
Length=507

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/479 (77%), Positives = 415/479 (87%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  14    SKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  73

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGAVCDLLGPRYGCAFL+ML+APTVFCM+ +  A GY+A
Sbjct  74    KADIGNAGVASVSGSIFSRLAMGAVCDLLGPRYGCAFLVMLSAPTVFCMAVIDDASGYIA  133

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLA FVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  134   VRFLIGFSLAAFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  193

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W AV
Sbjct  194   GATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVLWGAV  253

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VARP GG
Sbjct  254   TNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLHLRAAGTIAACFGMANIVARPMGG  313

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA 
Sbjct  314   YLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAACGAV  373

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMACTLP+
Sbjct  374   FGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMACTLPI  433

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             TLVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSERG+R
Sbjct  434   TLVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKGKGLHIAGQKFAENSRSERGRR  489



>gb|EMT10646.1| Nitrate transporter [Aegilops tauschii]
Length=507

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/483 (77%), Positives = 417/483 (86%), Gaps = 4/483 (1%)
 Frame = +2

Query  188   DTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             DT A KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN
Sbjct  10    DTAASKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  69

Query  365   LNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAG  544
             LNL K+DIGNAGVASVSGSI SRL MGAVCDLLGPRYGCAFL+ML+APTVFCM+ +  A 
Sbjct  70    LNLAKADIGNAGVASVSGSIFSRLAMGAVCDLLGPRYGCAFLVMLSAPTVFCMAVIDDAS  129

Query  545   GYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDI  724
             GY+AVRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  
Sbjct  130   GYIAVRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHA  189

Query  725   IRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVF  904
             I+K GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV 
Sbjct  190   IQKCGATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVL  249

Query  905   WYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVAR  1084
             W AVTNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VAR
Sbjct  250   WGAVTNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANIVAR  309

Query  1085  PFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAA  1264
             P GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAA
Sbjct  310   PMGGYLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAA  369

Query  1265  CGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMAC  1444
             CGA FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMAC
Sbjct  370   CGAVFGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMAC  429

Query  1445  TLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSER  1624
             TLPV LVHFPQWG MFFPAS DA   TEE YY SEW+EEEK+ G+H    KFAENSRSER
Sbjct  430   TLPVALVHFPQWGSMFFPASADA---TEEEYYGSEWSEEEKRNGLHIAGQKFAENSRSER  486

Query  1625  GKR  1633
             G+R
Sbjct  487   GRR  489



>gb|ABG20829.1| high affinity nitrate transporter NRT2.6 [Hordeum vulgare subsp. 
vulgare]
Length=507

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/479 (77%), Positives = 414/479 (86%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  14    SKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  73

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML+APTVFCM+ +  A GY+A
Sbjct  74    KADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLSAPTVFCMAVIDDASGYIA  133

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  134   VRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  193

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W AV
Sbjct  194   GATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVLWGAV  253

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGY MGVEL+TDNVIAEY+FD F L L  AG IAA FGMAN+VARP GG
Sbjct  254   TNYRTWIFVLLYGYCMGVELTTDNVIAEYYFDHFHLDLRAAGTIAACFGMANIVARPMGG  313

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA 
Sbjct  314   YLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAACGAV  373

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMACTLPV
Sbjct  374   FGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMACTLPV  433

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              LVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KF ENSRSERG+R
Sbjct  434   ALVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKSKGLHIAGQKFVENSRSERGRR  489



>gb|AAL99362.1| high-affinity nitrate transporter [Daucus carota]
Length=535

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/522 (75%), Positives = 439/522 (84%), Gaps = 10/522 (2%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D+EGSPGSSMHGVTGREP L+F+VAS I   DT+A+F +PVDSEHKAKVFK  S + P
Sbjct  1     MGDMEGSPGSSMHGVTGREPSLAFSVASRI---DTSAEFHVPVDSEHKAKVFKFKSFSPP  57

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             H   F L+WISF TCFVSTFAA PLV IIRDNLN  K D+GNAGVASV+GSILSR  MGA
Sbjct  58    HGLQFQLTWISFPTCFVSTFAARPLVVIIRDNLNPTKMDVGNAGVASVTGSILSRGAMGA  117

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CD+LGPRYGCAFLIML+AP V CMSFVSSAGGYVAVRFMIGFSLATFVSC+YWMST  +
Sbjct  118   ICDMLGPRYGCAFLIMLSAPKVLCMSFVSSAGGYVAVRFMIGFSLATFVSCRYWMSTSMH  177

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S IIGL NGTAAGWGNM GGATQL+MP+LYDIIR+AGATPF+AWRIA FIPGWLHV+ GI
Sbjct  178   SDIIGLVNGTAAGWGNMTGGATQLIMPLLYDIIREAGATPFTAWRIALFIPGWLHVISGI  237

Query  809   LVLTLGQDLPDGNL---GSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             LVLTLGQDLPDGN     SL+KKG ++KDKFSK+  YA TNYRTWI  LLYGYSMGVEL+
Sbjct  238   LVLTLGQDLPDGNAQNEASLRKKGRVHKDKFSKILRYAATNYRTWILVLLYGYSMGVELT  297

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
             TDNVIAEYFFDRFDLKLHT GIIAATFGMANL+ARPFGG++SD AAK FGMRGR W  W 
Sbjct  298   TDNVIAEYFFDRFDLKLHTPGIIAATFGMANLLARPFGGWSSDVAAKHFGMRGRHWNSWD  357

Query  1160  LQTMGGLFCFLLGRANTLP---LAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGL  1330
             LQT+GG+FC LL RA T P   LA+TWMIIFSIGAQAA G TFGI PFISRR LGIIS +
Sbjct  358   LQTLGGVFCLLLVRATTSPIDALAITWMIIFSIGAQAATGVTFGIIPFISRRYLGIISQM  417

Query  1331  TGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKD  1510
             TGA GNFGSG TQ + F ++K++T  GL+YMG+MI+ACTLP  LV F Q G MF P SKD
Sbjct  418   TGANGNFGSGQTQPLEFDSTKYNTGLGLTYMGMMIIACTLPPMLVWFWQDGSMFLPPSKD  477

Query  1511  AVRGTE-EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              ++GTE EHY+ SE+ E+EK KGMHQNS+KFAENSR+E GK+
Sbjct  478   PIKGTEPEHYFGSEYTEDEKVKGMHQNSIKFAENSRTEFGKK  519



>gb|EMT10648.1| Nitrate transporter [Aegilops tauschii]
Length=507

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/479 (77%), Positives = 414/479 (86%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  14    SKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  73

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML+APTVFCM+ +  A GY+A
Sbjct  74    KADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLSAPTVFCMAVIDDASGYIA  133

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  134   VRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  193

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W AV
Sbjct  194   GATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVLWGAV  253

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VARP GG
Sbjct  254   TNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANIVARPMGG  313

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA 
Sbjct  314   YLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAACGAV  373

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF +S++ST  GL YMGIMIMACTLP+
Sbjct  374   FGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFISSQYSTGRGLEYMGIMIMACTLPI  433

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              LVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSERG+R
Sbjct  434   ALVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKSKGLHIAGQKFAENSRSERGRR  489



>ref|XP_010503158.1| PREDICTED: high affinity nitrate transporter 2.6-like [Camelina 
sativa]
 ref|XP_010425940.1| PREDICTED: high affinity nitrate transporter 2.6-like [Camelina 
sativa]
Length=543

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/517 (71%), Positives = 430/517 (83%), Gaps = 7/517 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPT-------DTTAKFALPVDSEHKAKVFKLFSLA  262
             GS GSS+HGVTG+E V SF+V     P+       DTTAKFALPVDSEH+AKVFK  S A
Sbjct  10    GSIGSSLHGVTGKEQVFSFSVHDESGPSSQAVRSDDTTAKFALPVDSEHRAKVFKPLSFA  69

Query  263   NPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVM  442
              PHMR FHL WISFFTCF+STFAAAPLVP+IRDNL+L K+DIGNAGVASVSG+I SRL M
Sbjct  70    KPHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLDLTKTDIGNAGVASVSGAIFSRLAM  129

Query  443   GAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTM  622
             GAVCDLLG RYG AF +MLTAP VF MSFV+ AG Y+AVRFMIGF LATFVSCQYW S M
Sbjct  130   GAVCDLLGARYGTAFSLMLTAPAVFSMSFVADAGSYLAVRFMIGFCLATFVSCQYWTSVM  189

Query  623   FNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVM  802
             F  KIIGL NG A GWG+MGGG TQLLMP+++ +I+  GATPF+AWR AFFIPG L ++M
Sbjct  190   FTGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLTGATPFTAWRFAFFIPGVLQIIM  249

Query  803   GILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELST  982
             GILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMGVEL+ 
Sbjct  250   GILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVRNYRTWILFVLYGFSMGVELTI  309

Query  983   DNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWIL  1162
             +NVI+ YF+DRF+L LHTAGIIAA+FGMAN  ARPFGG+ASD AA+ FGMRGRLW LWIL
Sbjct  310   NNVISGYFYDRFNLTLHTAGIIAASFGMANFFARPFGGYASDVAARLFGMRGRLWILWIL  369

Query  1163  QTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAG  1342
             QT+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAG
Sbjct  370   QTVGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAG  429

Query  1343  GNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRG  1522
             GNFGSG+TQL+FFS+S+FSTA GLS MG+M + C+LPV  +HFPQWG MF   S+D  + 
Sbjct  430   GNFGSGVTQLLFFSSSRFSTAEGLSLMGVMAVVCSLPVAFIHFPQWGSMFLRPSQDGEKS  489

Query  1523  TEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              EEHYY +EW EEEK  G+H+ S+KFAENSRSERG++
Sbjct  490   KEEHYYGAEWTEEEKSLGLHEGSIKFAENSRSERGRK  526



>gb|KFK33916.1| hypothetical protein AALP_AA5G077200 [Arabis alpina]
Length=543

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/521 (70%), Positives = 432/521 (83%), Gaps = 7/521 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAVASPIVPT-------DTTAKFALPVDSEHKAKVFKL  250
             ++ +GS GSS+HGVT RE V SF+V    VP+       D T+KFALPVDSEH+AKVFK 
Sbjct  6     SNEDGSIGSSLHGVTAREQVFSFSVHDEDVPSSQAVRSDDPTSKFALPVDSEHRAKVFKP  65

Query  251   FSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILS  430
              S A PHMR FHL WISFFTCF+STFAAAPLVP+IRDNL+L K+DIGNAGVASVSG+I S
Sbjct  66    LSFAKPHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLDLTKTDIGNAGVASVSGAIFS  125

Query  431   RLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYW  610
             RL MGAVCDLLG RYG AF +ML+AP VF MSFV+ AG Y+AVRFMIGF LATFVSCQYW
Sbjct  126   RLAMGAVCDLLGARYGTAFSLMLSAPAVFSMSFVADAGSYLAVRFMIGFCLATFVSCQYW  185

Query  611   MSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWL  790
              S MF+ KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF+AWR AFFIPG+L
Sbjct  186   TSVMFSGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFTAWRFAFFIPGFL  245

Query  791   HVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGV  970
              ++MGILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMGV
Sbjct  246   QIIMGILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFVLYGFSMGV  305

Query  971   ELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWT  1150
             EL+ +NVI+ YF+DRF+L LHTAGI+AA+FGMAN  ARP GG+ASD AA+ FGMRGRLWT
Sbjct  306   ELTINNVISGYFYDRFNLTLHTAGIVAASFGMANFFARPLGGYASDVAARLFGMRGRLWT  365

Query  1151  LWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGL  1330
             LWILQT+G L C  LGRA++LP+A+  M++FSIG QAACGA +G+ PF+SRRSLG+ISGL
Sbjct  366   LWILQTVGALLCIWLGRASSLPIAILAMMLFSIGTQAACGALYGVAPFVSRRSLGLISGL  425

Query  1331  TGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKD  1510
             TGAGGNFGSG+TQL+FFS+S+FSTA GLS MG+M + CTLPV  +HFPQWG MF   S+ 
Sbjct  426   TGAGGNFGSGITQLLFFSSSRFSTAEGLSLMGVMAVVCTLPVAFIHFPQWGSMFLKPSQH  485

Query  1511  AVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               R  EEHYY +EW EEEK  G+H  SLKFAENSRSERG+R
Sbjct  486   EERSKEEHYYGAEWTEEEKSLGLHVGSLKFAENSRSERGRR  526



>ref|XP_010443885.1| PREDICTED: high affinity nitrate transporter 2.3 [Camelina sativa]
Length=539

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/517 (71%), Positives = 430/517 (83%), Gaps = 3/517 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV---ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  262
             ++ E S G+S+HGVTGRE V SF+V   +  +   D TAKFALPVDSEH+AKVF   S A
Sbjct  6     SNEEDSIGTSLHGVTGREQVFSFSVDPSSQTVQSDDPTAKFALPVDSEHRAKVFNPLSFA  65

Query  263   NPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVM  442
              PHMR FHL W+SFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL M
Sbjct  66    KPHMRAFHLGWLSFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRLAM  125

Query  443   GAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTM  622
             GAVCDLLG RYG AF +MLTAPTVF MSFV    GY+ VRFMIGF LATFVSCQYW S M
Sbjct  126   GAVCDLLGARYGTAFSLMLTAPTVFSMSFVGGPSGYLGVRFMIGFCLATFVSCQYWTSVM  185

Query  623   FNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVM  802
             FN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRIAFF+PG L +VM
Sbjct  186   FNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFQVIKLAGATPFMAWRIAFFVPGLLQIVM  245

Query  803   GILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELST  982
             GILVLTLGQDLPDGNL +LQK+G ++KDKFSKVFW+AV NYRTWI  +LYG+SMG+EL+ 
Sbjct  246   GILVLTLGQDLPDGNLSTLQKRGQVSKDKFSKVFWFAVRNYRTWILFVLYGFSMGIELTI  305

Query  983   DNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWIL  1162
             +NVI+ YF+DRF+LKL TAGI+AA+FGMAN +ARPFGG+ASD AA+ FGMRGRLW LWI 
Sbjct  306   NNVISGYFYDRFNLKLQTAGIVAASFGMANFIARPFGGYASDVAARIFGMRGRLWILWIF  365

Query  1163  QTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAG  1342
             QT+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAG
Sbjct  366   QTIGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAG  425

Query  1343  GNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRG  1522
             GNFGSGLTQL+FFS+S+FSTA GLS MG M + CT+PV  +HFPQWG MF   S D  R 
Sbjct  426   GNFGSGLTQLLFFSSSRFSTAEGLSLMGAMAVLCTVPVAFIHFPQWGSMFLRPSSDGERS  485

Query  1523  TEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              EE+YY SEW E EKQ+G+H+ S+KFAENSRSERG++
Sbjct  486   KEEYYYSSEWTENEKQQGLHEGSIKFAENSRSERGRK  522



>ref|NP_200886.1| nitrate transporter 2.3 [Arabidopsis thaliana]
 sp|Q9FJH7.1|NRT23_ARATH RecName: Full=High affinity nitrate transporter 2.3; Short=AtNRT2:3 
[Arabidopsis thaliana]
 dbj|BAB10099.1| high affinity nitrate transporter [Arabidopsis thaliana]
 gb|ABE66265.1| high-affinity nitrate transporter [Arabidopsis thaliana]
 gb|AED97376.1| nitrate transporter 2.3 [Arabidopsis thaliana]
Length=539

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/517 (71%), Positives = 431/517 (83%), Gaps = 3/517 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV---ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  262
             ++ EGS G+S+HGVT RE V SF+V   +  +   D TAKFALPVDSEH+AKVF   S A
Sbjct  6     SNEEGSIGTSLHGVTAREQVFSFSVDASSQTVQSDDPTAKFALPVDSEHRAKVFNPLSFA  65

Query  263   NPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVM  442
              PHMR FHL W+SFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL M
Sbjct  66    KPHMRAFHLGWLSFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRLAM  125

Query  443   GAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTM  622
             GAVCDLLG RYG AF +MLTAPTVF MSFV    GY+ VRFMIGF LATFVSCQYW S M
Sbjct  126   GAVCDLLGARYGTAFSLMLTAPTVFSMSFVGGPSGYLGVRFMIGFCLATFVSCQYWTSVM  185

Query  623   FNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVM  802
             FN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRIAFF+PG+L VVM
Sbjct  186   FNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFMAWRIAFFVPGFLQVVM  245

Query  803   GILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELST  982
             GILVL+LGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG SMG+EL+ 
Sbjct  246   GILVLSLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFVLYGSSMGIELTI  305

Query  983   DNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWIL  1162
             +NVI+ YF+DRF+LKL TAGI+AA+FGMAN +ARPFGG+ASD AA+ FGMRGRLWTLWI 
Sbjct  306   NNVISGYFYDRFNLKLQTAGIVAASFGMANFIARPFGGYASDVAARVFGMRGRLWTLWIF  365

Query  1163  QTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAG  1342
             QT+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAG
Sbjct  366   QTVGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAG  425

Query  1343  GNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRG  1522
             GNFGSGLTQL+FFS+++FSTA GLS MG+M + CTLPV  +HFPQWG MF   S D  R 
Sbjct  426   GNFGSGLTQLLFFSSARFSTAEGLSLMGVMAVLCTLPVAFIHFPQWGSMFLRPSTDGERS  485

Query  1523  TEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              EE+YY SEW E EKQ+G+H+ S+KFAENSRSERG++
Sbjct  486   QEEYYYGSEWTENEKQQGLHEGSIKFAENSRSERGRK  522



>ref|XP_010514842.1| PREDICTED: high affinity nitrate transporter 2.6 [Camelina sativa]
Length=544

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/518 (71%), Positives = 430/518 (83%), Gaps = 8/518 (2%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAV--------ASPIVPTDTTAKFALPVDSEHKAKVFKLFSL  259
             GS GSS+HGVTG+E V SF+V        +  +   DTTAKFALPVDSEH+AKVFK  S 
Sbjct  10    GSIGSSLHGVTGKEQVFSFSVHEEKSGPSSQAVRSDDTTAKFALPVDSEHRAKVFKPLSF  69

Query  260   ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLV  439
             A PHMR FHL WISFFTCF+STFAAAPLVP+IRDNL+L K+DIGNAGVASVSG+I SRL 
Sbjct  70    AKPHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLDLTKTDIGNAGVASVSGAIFSRLA  129

Query  440   MGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMST  619
             MGAVCDLLG RYG AF +MLTAP VF MSFV+ AG Y+AVRFMIGF LATFVSCQYW S 
Sbjct  130   MGAVCDLLGARYGTAFSLMLTAPAVFSMSFVADAGSYLAVRFMIGFCLATFVSCQYWTSV  189

Query  620   MFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVV  799
             MF  KIIGL NG A GWG+MGGG TQLLMP+++ +I+  GATPF+AWR AFFIPG L ++
Sbjct  190   MFTGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLTGATPFTAWRFAFFIPGVLQII  249

Query  800   MGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             MGILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMGVEL+
Sbjct  250   MGILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVRNYRTWILFVLYGFSMGVELT  309

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
              +NVI+ YF+DRF+L LHTAGIIAA+FGMAN  ARPFGG+ASD AA+ FGMRGRLW LWI
Sbjct  310   INNVISGYFYDRFNLTLHTAGIIAASFGMANFFARPFGGYASDVAARLFGMRGRLWILWI  369

Query  1160  LQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGA  1339
             LQT+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGA
Sbjct  370   LQTVGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGA  429

Query  1340  GGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVR  1519
             GGNFGSG+TQL+FFS+S+FSTA GLS MG+M + C+LPV  +HFPQWG MF   S+D  +
Sbjct  430   GGNFGSGVTQLLFFSSSRFSTAEGLSLMGVMAVVCSLPVAFIHFPQWGSMFLRPSQDGQK  489

Query  1520  GTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EEHYY +EW EEEK  G+H+ S+KFAENSRSERG++
Sbjct  490   SKEEHYYGAEWTEEEKSLGLHEGSIKFAENSRSERGRK  527



>ref|XP_002864703.1| ATNRT2.3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40962.1| ATNRT2.3 [Arabidopsis lyrata subsp. lyrata]
Length=539

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/517 (71%), Positives = 429/517 (83%), Gaps = 3/517 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV---ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  262
             ++ EGS G+S+HGVT RE V SF+V   +  +   D TAKFALPVDSEH+AKVF   S A
Sbjct  6     SNEEGSIGTSLHGVTAREQVFSFSVDASSQTVQSDDPTAKFALPVDSEHRAKVFNPLSFA  65

Query  263   NPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVM  442
              PHMR FHL W+SFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL M
Sbjct  66    KPHMRAFHLGWLSFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRLAM  125

Query  443   GAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTM  622
             GAVCDLLG RYG AF +MLTAP VF MSFV    GY+ VRFMIGF LATFVSCQYW S M
Sbjct  126   GAVCDLLGARYGTAFSLMLTAPIVFSMSFVGGPSGYLGVRFMIGFCLATFVSCQYWTSVM  185

Query  623   FNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVM  802
             FN KIIGL NG A GWG+MGGG TQLLMP+++ II+ AGATPF AWRI+FF PG+L VVM
Sbjct  186   FNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHIIKLAGATPFMAWRISFFAPGFLQVVM  245

Query  803   GILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELST  982
             GILVL+LGQDLPDGNL  LQK+G ++KDKFSKVFW+AV NYRTWI  +LYG SMG+EL+ 
Sbjct  246   GILVLSLGQDLPDGNLSILQKRGQVSKDKFSKVFWFAVKNYRTWILFVLYGSSMGIELTI  305

Query  983   DNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWIL  1162
             +NVI+ YF+DRF+LKL TAGI+AA+FGMAN +ARPFGG+ASD AA+ FGMRGRLWTLWI 
Sbjct  306   NNVISGYFYDRFNLKLQTAGIVAASFGMANFIARPFGGYASDVAARIFGMRGRLWTLWIF  365

Query  1163  QTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAG  1342
             QT+G LFC  LGRA+TLP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAG
Sbjct  366   QTVGALFCIWLGRASTLPIAILAMVLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAG  425

Query  1343  GNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRG  1522
             GNFGSGLTQL+FFS+S+FSTA GLS MG+M + CT+PV  +HFPQWG MF   S D  R 
Sbjct  426   GNFGSGLTQLLFFSSSRFSTAEGLSLMGVMAVLCTIPVAFIHFPQWGSMFLRPSSDGERS  485

Query  1523  TEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              EE+YY SEW E EKQ+G+H+ S+KFAENSRSERG++
Sbjct  486   QEEYYYSSEWTENEKQQGLHEGSIKFAENSRSERGRK  522



>ref|NP_190092.1| high affinity nitrate transporter 2.6 [Arabidopsis thaliana]
 sp|Q9LXH0.1|NRT26_ARATH RecName: Full=High affinity nitrate transporter 2.6; Short=AtNRT2:6 
[Arabidopsis thaliana]
 emb|CAB89321.1| high-affinity nitrate transporter-like protein [Arabidopsis thaliana]
 gb|AAS49050.1| At3g45060 [Arabidopsis thaliana]
 gb|AAU05505.1| At3g45060 [Arabidopsis thaliana]
 gb|AEE77987.1| high affinity nitrate transporter 2.6 [Arabidopsis thaliana]
Length=542

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/520 (70%), Positives = 431/520 (83%), Gaps = 6/520 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV------ASPIVPTDTTAKFALPVDSEHKAKVFKLF  253
             ++ +GS G+S+HGVT RE V SF+V      +  +   D TAKFALPVDSEH+AKVFK  
Sbjct  6     SNEDGSIGTSLHGVTAREQVFSFSVQEDVPSSQAVRTNDPTAKFALPVDSEHRAKVFKPL  65

Query  254   SLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSR  433
             S A PHMR FHL WISFFTCF+STFAAAPLVP+IRDNL+L K+DIGNAGVASVSG+I SR
Sbjct  66    SFAKPHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLDLTKTDIGNAGVASVSGAIFSR  125

Query  434   LVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWM  613
             L MGAVCDLLG RYG AF +MLTAP VF MSFV+ AG Y+AVRFMIGF LATFVSCQYW 
Sbjct  126   LAMGAVCDLLGARYGTAFSLMLTAPAVFSMSFVADAGSYLAVRFMIGFCLATFVSCQYWT  185

Query  614   STMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLH  793
             S MF  KIIGL NG A GWG+MGGG TQLLMP+++ +I+  GATPF+AWR AFFIPG L 
Sbjct  186   SVMFTGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLTGATPFTAWRFAFFIPGILQ  245

Query  794   VVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVE  973
             +VMGILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMGVE
Sbjct  246   IVMGILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFMLYGFSMGVE  305

Query  974   LSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTL  1153
             L+ +NVI+ YF+DRF+L LHTAGIIAA+FGMAN  ARPFGG+ASD AA+ FGMRGRLW L
Sbjct  306   LTINNVISGYFYDRFNLTLHTAGIIAASFGMANFFARPFGGYASDVAARLFGMRGRLWIL  365

Query  1154  WILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLT  1333
             WILQT+G LFC  LGRA++LP+A+  M++FS+G QAACGA FG+ PF+SRRSLG+ISGLT
Sbjct  366   WILQTVGALFCIWLGRASSLPIAILAMMLFSMGTQAACGALFGVAPFVSRRSLGLISGLT  425

Query  1334  GAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDA  1513
             GAGGNFGSG+TQL+FFS+S+FSTA GLS MG+M + C+LPV  +HFPQWG MF   S+D 
Sbjct  426   GAGGNFGSGVTQLLFFSSSRFSTAEGLSLMGVMAVVCSLPVAFIHFPQWGSMFLRPSQDG  485

Query  1514  VRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +  EEHYY +EW EEEK  G+H+ S+KFAENSRSERG++
Sbjct  486   EKSKEEHYYGAEWTEEEKSLGLHEGSIKFAENSRSERGRK  525



>ref|XP_010483732.1| PREDICTED: high affinity nitrate transporter 2.3-like [Camelina 
sativa]
Length=539

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/517 (70%), Positives = 428/517 (83%), Gaps = 3/517 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV---ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  262
             ++ E S G+S+HGVTGRE V SF+V   +  +   D TAKFALPVDSEH+AKVF   S A
Sbjct  6     SNEEDSIGTSLHGVTGREQVFSFSVDPSSQTVQSDDPTAKFALPVDSEHRAKVFNPLSFA  65

Query  263   NPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVM  442
              PHMR FHL W+SFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL M
Sbjct  66    KPHMRAFHLGWLSFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRLAM  125

Query  443   GAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTM  622
             GAVCDLLG RYG AF +MLTAP+VF MSFV    GY+ VRFMIGF LATFVSCQYW S M
Sbjct  126   GAVCDLLGARYGTAFSLMLTAPSVFSMSFVGGPSGYLGVRFMIGFCLATFVSCQYWTSVM  185

Query  623   FNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVM  802
             FN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRIAFF+PG L +VM
Sbjct  186   FNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFQVIKLAGATPFMAWRIAFFVPGLLQIVM  245

Query  803   GILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELST  982
             GILVL LGQDLPDGNL +LQK+G ++KDKFSKVFW+AV NYRTWI  +LYG+SMG+E++ 
Sbjct  246   GILVLNLGQDLPDGNLSTLQKRGQVSKDKFSKVFWFAVRNYRTWILFVLYGFSMGIEVTI  305

Query  983   DNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWIL  1162
             +NVI+ YF+DRF+LKL TAGI+AA+FGMAN +ARPFGG+ASD AA+ FGMRGRLW LWI 
Sbjct  306   NNVISGYFYDRFNLKLQTAGIVAASFGMANFIARPFGGYASDVAARIFGMRGRLWILWIF  365

Query  1163  QTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAG  1342
             QT+G LFC  LGRA +LP+A+  M++FS+G QAACGA FG+ PF+SRRSLG+ISGLTGAG
Sbjct  366   QTVGALFCIWLGRACSLPIAILAMMLFSVGTQAACGALFGVAPFVSRRSLGLISGLTGAG  425

Query  1343  GNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRG  1522
             GNFGSGLTQL+FFS+S+FSTA GLS MG M + CTLPV  +HFPQWG MF   S D  R 
Sbjct  426   GNFGSGLTQLLFFSSSRFSTAEGLSLMGAMAVLCTLPVAFIHFPQWGSMFLRPSSDGERS  485

Query  1523  TEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              EEHYY SEW E EKQ+G+H+ S+KFAENSRSERG++
Sbjct  486   KEEHYYSSEWTENEKQQGLHEGSIKFAENSRSERGRK  522



>ref|XP_009149884.1| PREDICTED: high affinity nitrate transporter 2.6 [Brassica rapa]
Length=541

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/519 (70%), Positives = 430/519 (83%), Gaps = 5/519 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV-----ASPIVPTDTTAKFALPVDSEHKAKVFKLFS  256
             ++  GS GSS+HGVT RE + SF+V     +  I   D TAKFALPVDSEH+AKVFK  S
Sbjct  6     SNENGSIGSSLHGVTAREQIFSFSVEDGPSSQAIRSDDPTAKFALPVDSEHRAKVFKPLS  65

Query  257   LANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRL  436
              A PHMR FHL WISFFTCF+STFAAAPLVP+IRDNL+L K+DIGNAGVASVSG+I SRL
Sbjct  66    FAKPHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLDLTKTDIGNAGVASVSGAIFSRL  125

Query  437   VMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMS  616
              MGAVCDLLG RYG AF +ML+AP VF MSFV+ AG Y+AVRFMIGF LATFVSCQYW S
Sbjct  126   AMGAVCDLLGARYGTAFSLMLSAPAVFSMSFVADAGSYLAVRFMIGFCLATFVSCQYWTS  185

Query  617   TMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHV  796
              MF  KIIGL NG A GWG+MGGG TQLLMP+++ +I+  GATPF+AWR AFFIPG+L +
Sbjct  186   VMFTGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLTGATPFTAWRFAFFIPGFLQI  245

Query  797   VMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVEL  976
             +MGILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMGVEL
Sbjct  246   IMGILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFVLYGFSMGVEL  305

Query  977   STDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLW  1156
             + +NVI+ YF+DRF+L LHTAGI+AA+FGMAN  ARPFGG+ASD AA+ FGMRGRLWTLW
Sbjct  306   TINNVISGYFYDRFNLTLHTAGIVAASFGMANFFARPFGGYASDVAARLFGMRGRLWTLW  365

Query  1157  ILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTG  1336
             ILQT+G LFC  LGRA++LP+A+  M++FS+G QAACGA FG+ PF+SRRSLG+ISGLTG
Sbjct  366   ILQTVGALFCIWLGRASSLPIAILAMMLFSVGTQAACGALFGVAPFVSRRSLGLISGLTG  425

Query  1337  AGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAV  1516
             AGGNFGSG+TQL+FFS+S+FSTA GLS MG+M + CT+PV  +HFPQWG MF   S+   
Sbjct  426   AGGNFGSGVTQLLFFSSSRFSTAEGLSLMGVMAVVCTIPVAFIHFPQWGSMFLRPSQHEE  485

Query  1517  RGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             R  EEHYY  EW EEEK  G+H+ S+KFAENSRSERG++
Sbjct  486   RSKEEHYYGGEWTEEEKSLGLHEGSIKFAENSRSERGRK  524



>gb|ABK28768.1| unknown [Arabidopsis thaliana]
Length=540

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/515 (71%), Positives = 429/515 (83%), Gaps = 3/515 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV---ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  262
             ++ EGS G+S+HGVT RE V SF+V   +  +   D TAKFALPVDSEH+AKVF   S A
Sbjct  6     SNEEGSIGTSLHGVTAREQVFSFSVDASSQTVQSDDPTAKFALPVDSEHRAKVFNPLSFA  65

Query  263   NPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVM  442
              PHMR FHL W+SFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL M
Sbjct  66    KPHMRAFHLGWLSFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRLAM  125

Query  443   GAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTM  622
             GAVCDLLG RYG AF +MLTAPTVF MSFV    GY+ VRFMIGF LATFVSCQYW S M
Sbjct  126   GAVCDLLGARYGTAFSLMLTAPTVFSMSFVGGPSGYLGVRFMIGFCLATFVSCQYWTSVM  185

Query  623   FNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVM  802
             FN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRIAFF+PG+L VVM
Sbjct  186   FNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFMAWRIAFFVPGFLQVVM  245

Query  803   GILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELST  982
             GILVL+LGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG SMG+EL+ 
Sbjct  246   GILVLSLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFVLYGSSMGIELTI  305

Query  983   DNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWIL  1162
             +NVI+ YF+DRF+LKL TAGI+AA+FGMAN +ARPFGG+ASD AA+ FGMRGRLWTLWI 
Sbjct  306   NNVISGYFYDRFNLKLQTAGIVAASFGMANFIARPFGGYASDVAARVFGMRGRLWTLWIF  365

Query  1163  QTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAG  1342
             QT+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAG
Sbjct  366   QTVGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAG  425

Query  1343  GNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRG  1522
             GNFGSGLTQL+FFS+++FSTA GLS MG+M + CTLPV  +HFPQWG MF   S D  R 
Sbjct  426   GNFGSGLTQLLFFSSARFSTAEGLSLMGVMAVLCTLPVAFIHFPQWGSMFLRPSTDGERS  485

Query  1523  TEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERG  1627
              EE+YY SEW E EKQ+G+H+ S+KFAENSRSERG
Sbjct  486   QEEYYYGSEWTENEKQQGLHEGSIKFAENSRSERG  520



>ref|XP_006281631.1| hypothetical protein CARUB_v10027761mg [Capsella rubella]
 gb|EOA14529.1| hypothetical protein CARUB_v10027761mg [Capsella rubella]
Length=539

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/517 (71%), Positives = 427/517 (83%), Gaps = 3/517 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV---ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLA  262
             ++ EGS G+S+HGVT RE V SF+V      I   D TAKF +PVDSEH+AKVF   S A
Sbjct  6     SNDEGSIGTSLHGVTAREQVFSFSVDPSCQTIQSDDPTAKFHVPVDSEHRAKVFNPLSFA  65

Query  263   NPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVM  442
              PHMR FHL W+SFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL M
Sbjct  66    KPHMRAFHLGWLSFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRLAM  125

Query  443   GAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTM  622
             GAVCDLLG RYG AF +MLTAPTVF MSFV    GY+ VRFMIGF LATFVSCQYW S M
Sbjct  126   GAVCDLLGARYGTAFSLMLTAPTVFSMSFVGGPSGYLCVRFMIGFCLATFVSCQYWTSVM  185

Query  623   FNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVM  802
             FN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRIAFF+PG L ++M
Sbjct  186   FNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFQVIKLAGATPFMAWRIAFFVPGLLQIIM  245

Query  803   GILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELST  982
             GILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMG+EL+ 
Sbjct  246   GILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFILYGFSMGIELTI  305

Query  983   DNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWIL  1162
             +NVI+ YF+DRF+LKL TAGI+AA+FGMAN +ARPFGG+ASD AA+ FGMRGRLW LWI 
Sbjct  306   NNVISGYFYDRFNLKLQTAGIVAASFGMANFIARPFGGYASDVAARVFGMRGRLWILWIF  365

Query  1163  QTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAG  1342
             QT+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAG
Sbjct  366   QTVGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAG  425

Query  1343  GNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRG  1522
             GNFGSGLTQLIFFS+S+FSTA GLS MG M + CTLPV  +HFPQWG MF   S D  R 
Sbjct  426   GNFGSGLTQLIFFSSSRFSTAEGLSLMGAMAVLCTLPVAFIHFPQWGSMFLRPSSDGERS  485

Query  1523  TEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              EE+YY SEW E EKQ+G+H+ S+KFAENSRSERG++
Sbjct  486   KEEYYYTSEWTENEKQQGLHEGSIKFAENSRSERGRK  522



>gb|AAD28363.1|AF091115_1 putative high affinity nitrate transporter [Hordeum vulgare subsp. 
vulgare]
Length=506

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/483 (77%), Positives = 416/483 (86%), Gaps = 5/483 (1%)
 Frame = +2

Query  188   DTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             DT A KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN
Sbjct  10    DTAASKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  69

Query  365   LNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAG  544
             LNL K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML+APTVFCM+ +  A 
Sbjct  70    LNLAKADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLSAPTVFCMAVIDDAS  129

Query  545   GYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDI  724
             GY+AVRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  
Sbjct  130   GYIAVRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHA  189

Query  725   IRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVF  904
             I+K GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQK+G++ KDKFSKV 
Sbjct  190   IQKCGATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKRGDMAKDKFSKVL  249

Query  905   WYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVAR  1084
             W AVTNYRTWIF LLYGY MGVEL+TDNVIAEY+FD F L L  AG IAA FGMAN+VAR
Sbjct  250   WGAVTNYRTWIFVLLYGYCMGVELTTDNVIAEYYFDHFHLDLRAAGTIAACFGMANIVAR  309

Query  1085  PFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAA  1264
             P GG+ SD  A++FGMR  LW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAA
Sbjct  310   PMGGYLSDLGARYFGMRA-LWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAA  368

Query  1265  CGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMAC  1444
             CGA FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMAC
Sbjct  369   CGAIFGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMAC  428

Query  1445  TLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSER  1624
             TLPV LVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSER
Sbjct  429   TLPVALVHFPQWGSMFFPASADA---TEEEYYASEWSEEEKGKGLHIAGQKFAENSRSER  485

Query  1625  GKR  1633
             G+R
Sbjct  486   GRR  488



>gb|AAD28364.1|AF091116_1 putative high affinity nitrate transporter [Hordeum vulgare subsp. 
vulgare]
Length=507

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/479 (77%), Positives = 412/479 (86%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  14    SKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  73

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML+APTVFCM+ +  A GY+A
Sbjct  74    KADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLSAPTVFCMAVIDDASGYIA  133

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  134   VRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  193

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W AV
Sbjct  194   GATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVLWGAV  253

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGY MGVEL+T NVIAEY+FD F L L  AG IAA FGMAN+VARP GG
Sbjct  254   TNYRTWIFVLLYGYCMGVELTTGNVIAEYYFDHFHLNLRAAGTIAACFGMANIVARPMGG  313

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA 
Sbjct  314   YLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAACGAI  373

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMACTLPV
Sbjct  374   FGVEPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMACTLPV  433

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              LVHFPQWG MF  AS DA   TEE YY SEW+EEEK KG+H    KFAENSRSERG+R
Sbjct  434   ALVHFPQWGSMFLAASADA---TEEEYYASEWSEEEKSKGLHIAGQKFAENSRSERGRR  489



>ref|XP_009621124.1| PREDICTED: high affinity nitrate transporter 2.4-like [Nicotiana 
tomentosiformis]
Length=534

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/519 (72%), Positives = 445/519 (86%), Gaps = 5/519 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPI--VPTDTT--AKFALPVDSEHKAKVFKLFS  256
             MA+ E   GSS+HG+TG+E   +F+V+S     P + +   KF LPVDSEHKAK  K+FS
Sbjct  1     MANFESPLGSSVHGLTGKEQTFAFSVSSHSHNNPDNKSLATKFDLPVDSEHKAKAIKIFS  60

Query  257   LANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRL  436
              A PHMR+FHL+WISFF CF+STFAAAPLVPIIRDNLNL ++DIGNAGVASVSGSI SRL
Sbjct  61    FAQPHMRSFHLAWISFFACFISTFAAAPLVPIIRDNLNLTRADIGNAGVASVSGSIFSRL  120

Query  437   VMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMS  616
             VMG +CDL+GPRYGCAFL +LTAP VF ++FVS+A GY+A+RF++GFSLATFVSCQYW S
Sbjct  121   VMGVLCDLIGPRYGCAFLNLLTAPIVFSVAFVSNAEGYLAMRFLVGFSLATFVSCQYWTS  180

Query  617   TMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHV  796
              MFNS+IIGL NG A GWG+MGGG TQLLMP L+ II+  GATPF+AWRIAFFIPGWLH+
Sbjct  181   VMFNSQIIGLVNGVAGGWGDMGGGVTQLLMPFLFHIIKITGATPFTAWRIAFFIPGWLHI  240

Query  797   VMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVEL  976
             ++G++VLTLGQD PDGNL +LQK+G++ KD+FSKV  YAVTNYRTW+F LLYG+SMGVEL
Sbjct  241   IIGLMVLTLGQDFPDGNLSTLQKRGDVAKDQFSKVLRYAVTNYRTWVFFLLYGFSMGVEL  300

Query  977   STDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLW  1156
               +NVIAEYF+D+F+LKLHTAG+IAATFGMAN VARPFGG+ASD AA+ FGMRGRLW LW
Sbjct  301   CINNVIAEYFYDKFNLKLHTAGMIAATFGMANFVARPFGGYASDLAARKFGMRGRLWVLW  360

Query  1157  ILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTG  1336
             I+QT+GG FC  LGRA +LP+A+  MI+FSIGAQAACGAT+GI PF+SRRSLG+ISGLTG
Sbjct  361   IVQTLGGAFCIWLGRAESLPIAIVSMILFSIGAQAACGATYGIIPFVSRRSLGLISGLTG  420

Query  1337  AGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAV  1516
             AGGNFG GLTQL+FFST++FSTA GL++MG+M +ACT+PV  +HFPQWG MFFPASKD  
Sbjct  421   AGGNFGGGLTQLLFFSTTRFSTAMGLTWMGVMAVACTIPVAFIHFPQWGSMFFPASKDG-  479

Query  1517  RGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             +  EEHYY SEW E+EK KG+HQ S+KFAEN RSERGK+
Sbjct  480   KYDEEHYYGSEWTEDEKSKGLHQGSVKFAENCRSERGKK  518



>ref|XP_009791006.1| PREDICTED: high affinity nitrate transporter 2.4-like [Nicotiana 
sylvestris]
Length=534

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/519 (72%), Positives = 443/519 (85%), Gaps = 5/519 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPI--VPTDT--TAKFALPVDSEHKAKVFKLFS  256
             MA  E   GSS+HG+TG+E   +F+V+S     P +     KF LPVDSEHKAK  K+FS
Sbjct  1     MATFESPLGSSVHGLTGKEQTFAFSVSSHSHNNPDNNGLATKFDLPVDSEHKAKAIKIFS  60

Query  257   LANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRL  436
              A PHMR+FHL+WISFF CF+STFAAAPLVPIIRDNLNL ++DIGNAGVASVSGSI SRL
Sbjct  61    FAQPHMRSFHLAWISFFACFISTFAAAPLVPIIRDNLNLTRADIGNAGVASVSGSIFSRL  120

Query  437   VMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMS  616
             VMG +CDL+GPRYGCAFL +LTAP VF ++FVS+A GY+A+RF++GFSLATFVSCQYW S
Sbjct  121   VMGVLCDLIGPRYGCAFLNLLTAPIVFSVAFVSNAEGYLAMRFLVGFSLATFVSCQYWTS  180

Query  617   TMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHV  796
              MFNS+IIGL NG A GWG+MGGG TQLLMP L+ II+  GATPF+AWRIAFFIPGWLH+
Sbjct  181   VMFNSQIIGLVNGVAGGWGDMGGGVTQLLMPFLFHIIKITGATPFTAWRIAFFIPGWLHI  240

Query  797   VMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVEL  976
             ++G++VLTLGQD PDGNL +LQK+G++ KD+FSKV  YAVTNYRTW+F LLYG+SMGVEL
Sbjct  241   IIGLMVLTLGQDFPDGNLSTLQKRGDVAKDQFSKVLRYAVTNYRTWVFFLLYGFSMGVEL  300

Query  977   STDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLW  1156
               +NVIAEYF+D+F+LKLHTAG+IAATFGMAN VARPFGG+ASD AA+ FGMRGRLW LW
Sbjct  301   CINNVIAEYFYDKFNLKLHTAGMIAATFGMANFVARPFGGYASDLAARKFGMRGRLWVLW  360

Query  1157  ILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTG  1336
             I+QT+GG FC  LGRA +LP+A+  MI+FSIGAQAACGAT+GI PF+SRRSLG+ISGLTG
Sbjct  361   IVQTLGGAFCIWLGRAESLPIAIVSMILFSIGAQAACGATYGIVPFVSRRSLGLISGLTG  420

Query  1337  AGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAV  1516
             AGGNFG GLTQL+FFST++FSTA GL++MG+M +ACT+PV  +HFPQWG MFFPASKD  
Sbjct  421   AGGNFGGGLTQLLFFSTTRFSTAMGLTWMGVMAVACTIPVAFIHFPQWGSMFFPASKDG-  479

Query  1517  RGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             +  EEHYY SEW E+EK KG+HQ S+KFAENSR+ERG +
Sbjct  480   KYDEEHYYVSEWTEDEKLKGLHQGSVKFAENSRTERGNK  518



>gb|EMS65307.1| High-affinity nitrate transporter 2.1 [Triticum urartu]
Length=509

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/482 (75%), Positives = 413/482 (86%), Gaps = 3/482 (1%)
 Frame = +2

Query  188   DTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNL  367
             +  +KF+LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNL
Sbjct  13    EAASKFSLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNL  72

Query  368   NLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGG  547
             NL K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML APTVFCMS +  A G
Sbjct  73    NLAKADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLAAPTVFCMSLIDDAAG  132

Query  548   YVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDII  727
             Y+ VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I
Sbjct  133   YITVRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAI  192

Query  728   RKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFW  907
             +K GATPF AWRIA+F+PG +H+VMG++VLT+GQDLPDGNL SLQKKG++ KDKFSKV W
Sbjct  193   QKCGATPFVAWRIAYFVPGMMHIVMGLMVLTMGQDLPDGNLASLQKKGDVAKDKFSKVLW  252

Query  908   YAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARP  1087
              AVTNYRTWIF LLYGY MGVEL+TDNVIAEY+FD F L L T+G IAA FGMANLVARP
Sbjct  253   GAVTNYRTWIFVLLYGYCMGVELTTDNVIAEYYFDHFHLDLRTSGTIAACFGMANLVARP  312

Query  1088  FGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAAC  1267
              GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA  LP +VT M++FS+ AQAAC
Sbjct  313   MGGYLSDLGARYFGMRARLWNIWILQTAGGAFCLWLGRAKALPESVTAMVLFSVCAQAAC  372

Query  1268  GATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACT  1447
             GA FG+ PF+SRRSLGIISG++GAGGNFG+GLTQL+FF++SK+ T  GL YMGIMIMACT
Sbjct  373   GAVFGVIPFVSRRSLGIISGMSGAGGNFGAGLTQLLFFTSSKYGTGRGLEYMGIMIMACT  432

Query  1448  LPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERG  1627
             LPV LVHFPQWG M  P + +A   TEE +Y +EW+EEEK+KG+H    KFAENSRSERG
Sbjct  433   LPVALVHFPQWGSMLLPPNANA---TEEDFYAAEWSEEEKKKGLHIPGQKFAENSRSERG  489

Query  1628  KR  1633
             +R
Sbjct  490   RR  491



>gb|EMT10644.1| Nitrate transporter [Aegilops tauschii]
Length=509

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/482 (76%), Positives = 413/482 (86%), Gaps = 3/482 (1%)
 Frame = +2

Query  188   DTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNL  367
             +  +KF+LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNL
Sbjct  13    EAASKFSLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNL  72

Query  368   NLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGG  547
             NL K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML APTVFCMS +  A G
Sbjct  73    NLAKADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLAAPTVFCMSLIDDAAG  132

Query  548   YVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDII  727
             Y+ VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I
Sbjct  133   YITVRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAI  192

Query  728   RKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFW  907
             +K GATPF AWRIA+F+PG +HVVMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W
Sbjct  193   QKCGATPFVAWRIAYFVPGLMHVVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVVW  252

Query  908   YAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARP  1087
              AVTNYRTWIF LLYGY MGVEL+TDNVIAEY+FD F L L T+G IAA FGMANLVARP
Sbjct  253   GAVTNYRTWIFVLLYGYCMGVELTTDNVIAEYYFDHFHLDLRTSGTIAACFGMANLVARP  312

Query  1088  FGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAAC  1267
              GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA  LP ++T M++FSI AQAAC
Sbjct  313   MGGYLSDLGARYFGMRARLWNIWILQTAGGAFCLWLGRAKALPESITAMVLFSICAQAAC  372

Query  1268  GATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACT  1447
             GA FG+ PF+SRRSLGIISGL+GAGGNFG+GLTQL+FF++SK+ T  GL YMGIMIMACT
Sbjct  373   GAIFGVIPFVSRRSLGIISGLSGAGGNFGAGLTQLLFFTSSKYGTGMGLEYMGIMIMACT  432

Query  1448  LPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERG  1627
             LPV LVHFPQWG M  P + +A   TEE +Y +EW+EEEK+KG+H    KFAENSRSERG
Sbjct  433   LPVVLVHFPQWGSMLLPPNANA---TEEDFYAAEWSEEEKKKGLHIPGQKFAENSRSERG  489

Query  1628  KR  1633
             +R
Sbjct  490   RR  491



>ref|XP_009150094.1| PREDICTED: high affinity nitrate transporter 2.6-like [Brassica 
rapa]
Length=538

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/516 (71%), Positives = 426/516 (83%), Gaps = 5/516 (1%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFAV-----ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLAN  265
             +GS GSS+HGV  RE V S +V     +  I   D TAKFA+PVDSEH+AKVFK  S A 
Sbjct  6     DGSIGSSLHGVRAREQVFSLSVEDGPSSQAIRSDDPTAKFAIPVDSEHRAKVFKPLSFAK  65

Query  266   PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMG  445
             PHMR FHL  ISFFTCF+S FAAAPLVP+IRDNL+L K+DIGNAGVASVSG+I SRL MG
Sbjct  66    PHMRAFHLGRISFFTCFISAFAAAPLVPVIRDNLDLNKTDIGNAGVASVSGAIFSRLAMG  125

Query  446   AVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF  625
             AVCDLLG RYG AF ++L+AP VF MSFVS AG Y+AVRFMIGF LATFVSCQYW S MF
Sbjct  126   AVCDLLGARYGTAFSLLLSAPAVFFMSFVSDAGSYLAVRFMIGFCLATFVSCQYWTSVMF  185

Query  626   NSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMG  805
             N KIIGL NG A GWG+MGGG TQLLMP++Y +I+  GATPF+AWR AFFIPG+L ++MG
Sbjct  186   NGKIIGLVNGCAGGWGDMGGGVTQLLMPMVYHVIKLPGATPFTAWRFAFFIPGFLQIIMG  245

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             ILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMGVEL+ +
Sbjct  246   ILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFVLYGFSMGVELTIN  305

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             NVI+EYF+DRF L LHTAGIIAA+FGMAN  ARPFGG+ASD AA+ FGMRGRLWTLWILQ
Sbjct  306   NVISEYFYDRFHLTLHTAGIIAASFGMANFFARPFGGYASDVAARLFGMRGRLWTLWILQ  365

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGAGG
Sbjct  366   TVGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGAGG  425

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             NFGSG+TQL+FFS+S+FSTA GLS MG+M + CTLPV  +HFPQWG MF   S+   R  
Sbjct  426   NFGSGVTQLLFFSSSRFSTAEGLSLMGVMAVVCTLPVAFIHFPQWGSMFLRPSQHEERSK  485

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EEHYY  EW +EEK  G+H+ S+KFAENSRSERG++
Sbjct  486   EEHYYGGEWTKEEKSLGLHEGSIKFAENSRSERGRK  521



>gb|EMT10649.1| Nitrate transporter [Aegilops tauschii]
Length=704

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/479 (77%), Positives = 415/479 (87%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  14    SKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  73

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML+APTVFCM+ +  A GY+A
Sbjct  74    KADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLSAPTVFCMAVIDDASGYIA  133

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  134   VRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  193

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W AV
Sbjct  194   GATPFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVLWGAV  253

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VARP GG
Sbjct  254   TNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANIVARPMGG  313

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA 
Sbjct  314   YLSDLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAACGAV  373

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMACTLPV
Sbjct  374   FGVAPFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMACTLPV  433

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              LVHFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSERG+R
Sbjct  434   ALVHFPQWGSMFFPASTDA---TEEEYYASEWSEEEKSKGLHIAGQKFAENSRSERGRR  489



>gb|AAC49532.1| BCH2 [Hordeum vulgare subsp. vulgare]
 dbj|BAK01367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/482 (75%), Positives = 411/482 (85%), Gaps = 3/482 (1%)
 Frame = +2

Query  188   DTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNL  367
             +  +KF+LPVDSEHKAK  +LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNL
Sbjct  13    EAASKFSLPVDSEHKAKSIRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNL  72

Query  368   NLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGG  547
             NL K+DIGNAGVASVSGSI SRL MGA+CDLLGPRYGCAFL+ML APTVFCMS +  A G
Sbjct  73    NLAKADIGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLAAPTVFCMSLIDDAAG  132

Query  548   YVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDII  727
             Y+ VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I
Sbjct  133   YITVRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAI  192

Query  728   RKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFW  907
             +K GATPF AWRIA+F+PG +HVVMG+LVLT+GQDLPDGNL SLQKKG + KDKFSKV W
Sbjct  193   QKCGATPFVAWRIAYFVPGMMHVVMGLLVLTMGQDLPDGNLASLQKKGEMAKDKFSKVVW  252

Query  908   YAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARP  1087
              AVTNYRTWIF LLYGY MGVEL+TDNVIAEY+FD F L L T+G IAA FGMAN+VARP
Sbjct  253   GAVTNYRTWIFVLLYGYCMGVELTTDNVIAEYYFDHFHLDLRTSGTIAACFGMANIVARP  312

Query  1088  FGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAAC  1267
              GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA  LP ++T M++FSI AQAAC
Sbjct  313   AGGYLSDLGARYFGMRARLWNIWILQTAGGAFCLWLGRAKALPESITAMVLFSICAQAAC  372

Query  1268  GATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACT  1447
             GA FG+ PF+SRRSLGIISGL+GAGGNFG+GLTQL+FF++SK+ T  GL YMGIMIMACT
Sbjct  373   GAVFGVIPFVSRRSLGIISGLSGAGGNFGAGLTQLLFFTSSKYGTGRGLEYMGIMIMACT  432

Query  1448  LPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERG  1627
             LPV LVHFPQWG M  P + +A   TEE +Y +EW+EEEK+KG+H    KFAENSRSERG
Sbjct  433   LPVALVHFPQWGSMLLPPNANA---TEEEFYAAEWSEEEKKKGLHIPGQKFAENSRSERG  489

Query  1628  KR  1633
             +R
Sbjct  490   RR  491



>ref|XP_006293136.1| hypothetical protein CARUB_v10019442mg [Capsella rubella]
 gb|EOA26034.1| hypothetical protein CARUB_v10019442mg [Capsella rubella]
Length=545

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/518 (70%), Positives = 427/518 (82%), Gaps = 8/518 (2%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTD--------TTAKFALPVDSEHKAKVFKLFSL  259
             GS G+S+HGVT +E V SF+V     P+         T AKFALPVDSEH+A VFK  S 
Sbjct  11    GSIGTSLHGVTAKEQVFSFSVQDESGPSSSRAVRSDVTMAKFALPVDSEHRATVFKPLSF  70

Query  260   ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLV  439
             A PHMR FHL WISFFTCF+STFAAAPLVP+IRDNL+L K+DIGNAGVASVSG+I SRL 
Sbjct  71    AKPHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLDLTKTDIGNAGVASVSGAIFSRLA  130

Query  440   MGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMST  619
             MGAVCDLLG RYG AF ++L+AP VF MSFV+ AG Y+AVRFMIGF LATFVSCQYW S 
Sbjct  131   MGAVCDLLGARYGTAFSLLLSAPAVFSMSFVADAGSYLAVRFMIGFCLATFVSCQYWTSV  190

Query  620   MFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVV  799
             MF  KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF+AWR AFFIPG L ++
Sbjct  191   MFTGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFTAWRFAFFIPGILQIL  250

Query  800   MGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             MGILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMGVEL+
Sbjct  251   MGILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVRNYRTWILFVLYGFSMGVELT  310

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
              +NVI+ YF+DRF+L LHTAGIIAA+FGMAN  ARPFGG+ASD AA+ FGMRGRLW LWI
Sbjct  311   INNVISGYFYDRFNLTLHTAGIIAASFGMANFFARPFGGYASDVAARLFGMRGRLWILWI  370

Query  1160  LQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGA  1339
             LQT+G LFC  LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLTGA
Sbjct  371   LQTVGALFCIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLTGA  430

Query  1340  GGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVR  1519
             GGNFGSG+TQL+FFS+S+F+TA GLS MG+M + C+LPV  +HFPQWG MF   S+D  +
Sbjct  431   GGNFGSGITQLLFFSSSRFTTAEGLSLMGVMAVVCSLPVAFIHFPQWGSMFLRPSQDGEK  490

Query  1520  GTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EEHYY +EW EEEK  G+H+ S+KFAENSRSERG++
Sbjct  491   SKEEHYYGAEWTEEEKSLGLHEGSIKFAENSRSERGRK  528



>ref|XP_002877379.1| ATNRT2.6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53638.1| ATNRT2.6 [Arabidopsis lyrata subsp. lyrata]
Length=542

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/520 (70%), Positives = 428/520 (82%), Gaps = 6/520 (1%)
 Frame = +2

Query  92    ADIEGSPGSSMHGVTGREPVLSFAV------ASPIVPTDTTAKFALPVDSEHKAKVFKLF  253
             ++ +GS G+S+HGVT RE V SF+V      +  +   D T KFALPVDSEH+AKVFK  
Sbjct  6     SNEDGSIGTSLHGVTAREQVFSFSVQEDGPSSQAVRSDDPTVKFALPVDSEHRAKVFKPL  65

Query  254   SLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSR  433
             S A PHMR FHL WISFFTCF+STFAAAPLVP+IRDNLNL K+DIGNAGVASVSG+I SR
Sbjct  66    SFAKPHMRAFHLGWISFFTCFISTFAAAPLVPVIRDNLNLTKTDIGNAGVASVSGAIFSR  125

Query  434   LVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWM  613
             L MGAVCDLLG RYG AF +MLTAP VF MSFV+ AG Y+AVRFMIGF LATFVSCQYW 
Sbjct  126   LAMGAVCDLLGARYGTAFSLMLTAPAVFSMSFVADAGSYLAVRFMIGFCLATFVSCQYWT  185

Query  614   STMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLH  793
             S MF+ KIIGL NG A GWG+MGGG TQLLMP+++ +I+  GAT F+AWR AFFIPG L 
Sbjct  186   SVMFSGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLTGATAFTAWRFAFFIPGILQ  245

Query  794   VVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVE  973
             ++MGILVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTW+  +LYG+SMGVE
Sbjct  246   IIMGILVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWVLFMLYGFSMGVE  305

Query  974   LSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTL  1153
             L+ +NVI+ YF+DRF+L LHTAGIIAA+FGMAN  ARPFGG+ASD AA+ FGMRGRLW L
Sbjct  306   LTINNVISGYFYDRFNLTLHTAGIIAASFGMANFFARPFGGYASDVAARLFGMRGRLWIL  365

Query  1154  WILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLT  1333
             WILQT+G LF   LGRA++LP+A+  M++FSIG QAACGA FG+ PF+SRRSLG+ISGLT
Sbjct  366   WILQTVGALFGIWLGRASSLPIAILAMMLFSIGTQAACGALFGVAPFVSRRSLGLISGLT  425

Query  1334  GAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDA  1513
             GAGGNFGSG+TQL+FFS+S+FSTA GLS MG+M + C+LPV  +HFPQWG MF   S+D 
Sbjct  426   GAGGNFGSGVTQLLFFSSSRFSTAEGLSLMGVMAVVCSLPVAFIHFPQWGSMFLRPSQDG  485

Query  1514  VRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
                 EEHYY +EW EEEK  G+H+ S+KFAENSRSERG++
Sbjct  486   EISKEEHYYGAEWTEEEKSLGLHEGSIKFAENSRSERGRK  525



>ref|XP_003572454.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Brachypodium 
distachyon]
Length=509

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/479 (76%), Positives = 408/479 (85%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF+LPVDSEHKA+  +LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  15    SKFSLPVDSEHKAESIRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  74

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGAVCDLLGPRYGCAFL+ML+APTVFCMS +  A GY+ 
Sbjct  75    KADIGNAGVASVSGSIFSRLAMGAVCDLLGPRYGCAFLVMLSAPTVFCMSLIDDAAGYIT  134

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  135   VRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  194

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             G+TPF AWRIA+F+PG +H+VMGILVLT+GQDLPDGNL SLQKKGN+NKDKFSKV W AV
Sbjct  195   GSTPFVAWRIAYFVPGMMHIVMGILVLTMGQDLPDGNLRSLQKKGNVNKDKFSKVLWGAV  254

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTW+F LLYGY MGVEL+TDNVIAEY++D F L L TAG IAA FGMAN+VARP GG
Sbjct  255   TNYRTWVFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRTAGTIAACFGMANIVARPAGG  314

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
               SD+ A++FGMR RLW +WILQT GG FC  LG A  LP +VT M++FSI AQAACGA 
Sbjct  315   ILSDFGARYFGMRARLWNIWILQTAGGAFCLWLGSATELPASVTAMVLFSICAQAACGAI  374

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISG+TGAGGN G+GLTQL+FF++S +ST  GL YMGIMIM CTLPV
Sbjct  375   FGVAPFVSRRSLGIISGMTGAGGNVGAGLTQLLFFTSSSYSTGKGLQYMGIMIMCCTLPV  434

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              LVHFPQWG MFFPA   A   TEE YY +EW+EEEK +G+H    KFA NSRSERG R
Sbjct  435   ALVHFPQWGSMFFPAKSGA---TEEEYYAAEWSEEEKSQGLHLAGQKFAVNSRSERGSR  490



>ref|XP_003572550.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Brachypodium 
distachyon]
Length=505

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/479 (76%), Positives = 408/479 (85%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             +KF+LPVDSEHKA+  +LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL 
Sbjct  12    SKFSLPVDSEHKAESIRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLA  71

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSGSI SRL MGAVCDLLGPRYGCAFL+ML APTVFCMS +  A GY+ 
Sbjct  72    KADIGNAGVASVSGSIFSRLAMGAVCDLLGPRYGCAFLVMLAAPTVFCMSLIDDAAGYIT  131

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             VRF+IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K 
Sbjct  132   VRFLIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKC  191

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             G+TPF AWRIA+F+PG +HVVMG+LVLT+GQDLPDGNL SLQKKG +NKDKFSKV W AV
Sbjct  192   GSTPFVAWRIAYFVPGLMHVVMGLLVLTMGQDLPDGNLRSLQKKGEMNKDKFSKVLWGAV  251

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMANLVARP GG
Sbjct  252   TNYRTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANLVARPMGG  311

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA 
Sbjct  312   YLSDLGARYFGMRARLWNIWILQTAGGAFCLWLGRASALPASVTAMVLFSICAQAACGAV  371

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             FG+ PF+SRRSLGIISG+TGAGGN G+GLTQL+FF++S +ST  GL YMGIMIM CTLPV
Sbjct  372   FGVAPFVSRRSLGIISGMTGAGGNVGAGLTQLLFFTSSSYSTGRGLEYMGIMIMCCTLPV  431

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              LVHFPQWG M FPA+  A   TEE YY +EW+EEEK KG+H    KFAEN RSERG+R
Sbjct  432   ALVHFPQWGSMLFPANAGA---TEEEYYAAEWSEEEKSKGLHLPGQKFAENCRSERGRR  487



>ref|XP_009150093.1| PREDICTED: high affinity nitrate transporter 2.6-like [Brassica 
rapa]
Length=543

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/518 (71%), Positives = 424/518 (82%), Gaps = 7/518 (1%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFA-------VASPIVPTDTTAKFALPVDSEHKAKVFKLFSL  259
             EGS G+SMHGVT +E V SF+        +  +   D TA FA PVDSEHKAKVFK  S 
Sbjct  8     EGSIGTSMHGVTAKEHVFSFSDQGEDAWSSHSVQSDDPTAMFAFPVDSEHKAKVFKPLSF  67

Query  260   ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLV  439
             A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL 
Sbjct  68    AKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRLA  127

Query  440   MGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMST  619
             MGAVCDLLG RYG AFL+ML+AP VF MSFV+ AGGY++VRFMIGF LATFVSC YW S 
Sbjct  128   MGAVCDLLGARYGTAFLLMLSAPAVFSMSFVADAGGYLSVRFMIGFCLATFVSCSYWTSV  187

Query  620   MFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVV  799
             MF  KIIGL NG A GWG+MGGG TQLLMP+++ II+ AGATPF+AWRIAFFIPG+L V+
Sbjct  188   MFTGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHIIKVAGATPFTAWRIAFFIPGFLQVI  247

Query  800   MGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELS  979
             MGILVLTLGQD PDGNL +LQKKG+++KDK +KVFWYA+ NYRT++  +LYG+SMG+E++
Sbjct  248   MGILVLTLGQDFPDGNLSTLQKKGDVSKDKLTKVFWYALRNYRTYVLFILYGFSMGIEMT  307

Query  980   TDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWI  1159
              +NVI+EYFFDRF L+LHTAG+IAA+FGMAN  ARP GGFASD +A+FFGMRGRLWTLWI
Sbjct  308   INNVISEYFFDRFQLELHTAGMIAASFGMANFFARPIGGFASDVSARFFGMRGRLWTLWI  367

Query  1160  LQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGA  1339
             LQT GGLFC  LGRA +LP+A+  M++FS G QAACGA FGI PF+SRRSLGIISGLTGA
Sbjct  368   LQTSGGLFCVWLGRATSLPIAILAMMLFSFGVQAACGAIFGIVPFVSRRSLGIISGLTGA  427

Query  1340  GGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVR  1519
             GGNFGSGLTQL FFS+S+F TA GLS MGI  M  TL V  +HFPQWG MF   + D   
Sbjct  428   GGNFGSGLTQLPFFSSSRFHTADGLSLMGITAMIFTLLVAFIHFPQWGSMFLGPTSDNRT  487

Query  1520  GTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
               EEHYY +EW EEEK +G+H+ SLKFAENSRSERGK+
Sbjct  488   SKEEHYYVAEWTEEEKLQGLHEGSLKFAENSRSERGKK  525



>ref|XP_011090039.1| PREDICTED: high affinity nitrate transporter 2.3-like [Sesamum 
indicum]
Length=522

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/516 (72%), Positives = 433/516 (84%), Gaps = 15/516 (3%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTA-KFALPVDSEHKAKVFKLFSLAN  265
             MADI  S   S+H +T          A   VP D  A KF LPVDSEH+AK  K+FS A 
Sbjct  1     MADISAS---SLHVIT----------APQTVPYDLQATKFDLPVDSEHRAKTLKIFSFAQ  47

Query  266   PHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMG  445
             PHMR+FHL+WISFFTCFVSTFAAAPLVPIIRDNL+L +SDIGNAGVASVSGSI SRLVMG
Sbjct  48    PHMRSFHLAWISFFTCFVSTFAAAPLVPIIRDNLDLTRSDIGNAGVASVSGSIFSRLVMG  107

Query  446   AVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMF  625
              +CDL+GPRYGCAF+ +LTAP VF ++FVSSA GY+AVRFMIGFSLATFVSCQYW + MF
Sbjct  108   VICDLIGPRYGCAFVNLLTAPVVFSVAFVSSAQGYIAVRFMIGFSLATFVSCQYWTTIMF  167

Query  626   NSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMG  805
             NS IIG  NG A GWG+MGGG TQLLMP LY +I+ +GATPF+AWRIAFFIPGWLH+++G
Sbjct  168   NSSIIGTVNGIAGGWGDMGGGVTQLLMPFLYHVIKVSGATPFTAWRIAFFIPGWLHIIIG  227

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             ++VL+LGQDLPDGNL +LQK+G++ KDKFSK+F YA+TNYRTWIF LLYGYSMG++L  +
Sbjct  228   VMVLSLGQDLPDGNLSTLQKRGDVAKDKFSKIFRYAITNYRTWIFFLLYGYSMGLQLCIN  287

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             NVIAEYF+DRF LKLHTAGI+AATFGM N  ARP GG+ SD AA+ FGMRGRLW LWI+Q
Sbjct  288   NVIAEYFYDRFHLKLHTAGIVAATFGMTNFAARPLGGYTSDLAARKFGMRGRLWILWIVQ  347

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T+G +FC  LGRAN+LP A+  MI+FSIGAQAACGAT+G+ PF+SRRSLG+ISGLTGAGG
Sbjct  348   TLGAVFCICLGRANSLPTAIASMILFSIGAQAACGATYGVIPFVSRRSLGLISGLTGAGG  407

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             NFG GLTQL+FFST++FSTA+GL+YMG+M +ACT+PV  +HFPQWG MF P SK   + T
Sbjct  408   NFGGGLTQLVFFSTTRFSTANGLTYMGVMAVACTIPVAFIHFPQWGSMFLPPSKKG-KYT  466

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EE YY +EWNE+EK+KG+H  SLKFAENSRSERGKR
Sbjct  467   EESYYSAEWNEDEKEKGLHHGSLKFAENSRSERGKR  502



>emb|CDY22703.1| BnaC08g43370D [Brassica napus]
Length=502

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/515 (74%), Positives = 426/515 (83%), Gaps = 20/515 (4%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G  GSSMHGV+                TD T K+ LPVD E +A VFKLFS A P
Sbjct  1     MGDSIGDTGSSMHGVS----------------TDKTGKYDLPVDLEDRATVFKLFSFAKP  44

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K D+GNAGVASVSGSI SRLVMGA
Sbjct  45    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDVGNAGVASVSGSIFSRLVMGA  104

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMF 
Sbjct  105   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFT  164

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             SKIIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+ GAT F+AWRIAFF+PGWLH++MGI
Sbjct  165   SKIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRCGATAFTAWRIAFFVPGWLHIIMGI  224

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVLTLGQDLP GN  +++KKG + +DK  K+ W AV+NYRTWIF LLYGYSMGVELSTDN
Sbjct  225   LVLTLGQDLPGGNRNAVEKKGKVVQDKLGKIMWCAVSNYRTWIFVLLYGYSMGVELSTDN  284

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  285   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDLAAKYFGMRGRLWALWIIQT  344

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  MI+FS+GAQAACGATF I PF+SRR+LGIISGLTGAGGN
Sbjct  345   AGGLFCVWLGRANTLVTAVVAMILFSLGAQAACGATFAIVPFVSRRALGIISGLTGAGGN  404

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLTQLIFFSTS+F+T  GL++MG+MI+ACTLPVTL HFPQWG MF P S      T 
Sbjct  405   FGSGLTQLIFFSTSRFTTEQGLTWMGVMIVACTLPVTLCHFPQWGSMFLPPSTV----TT  460

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW+EEEK+K MH  SL FA+++ SE G+R
Sbjct  461   EQYYVSEWSEEEKEKNMHLGSLAFAKDAESEGGRR  495



>ref|XP_006340412.1| PREDICTED: high affinity nitrate transporter 2.4-like [Solanum 
tuberosum]
Length=525

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/507 (72%), Positives = 433/507 (85%), Gaps = 2/507 (0%)
 Frame = +2

Query  116   SSMHGVTGREPVLSFAVASPIVPTDTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLS  292
             +S     GRE   +F+V S  V  ++ + KF LPVDSEHKAK  K+FS A PHMR+FHL+
Sbjct  2     ASFESPLGREQAFAFSVTSQNVCNNSQSNKFDLPVDSEHKAKSIKIFSFAQPHMRSFHLA  61

Query  293   WISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPR  472
             WISFFTCF+STFAAAPLVPIIRDNLNL ++DIGNAGVASVSGSI SRLVMGA+CDL+GPR
Sbjct  62    WISFFTCFISTFAAAPLVPIIRDNLNLTRADIGNAGVASVSGSIFSRLVMGALCDLIGPR  121

Query  473   YGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLan  652
             YGCAFL +LTAP VF ++F+S+A GY+A+RF++GFSLATFVSCQYW S MFNS+IIGL N
Sbjct  122   YGCAFLNLLTAPIVFSVAFISNAEGYIAMRFLVGFSLATFVSCQYWTSVMFNSQIIGLVN  181

Query  653   gtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQD  832
             G A GWG+MGGG TQLLMP L+ II+  GATPF+AWRIAFFIPGWLH+++G++VL LGQD
Sbjct  182   GVAGGWGDMGGGVTQLLMPFLFHIIKLTGATPFTAWRIAFFIPGWLHIIIGLMVLILGQD  241

Query  833   LPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFD  1012
             LPDGNL +LQKKG++ KD+FSKV   AVTNYRTW+F LLYG+SMGVEL  +NVIAEYF+D
Sbjct  242   LPDGNLSALQKKGDVTKDQFSKVLRNAVTNYRTWVFFLLYGFSMGVELCINNVIAEYFYD  301

Query  1013  RFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFL  1192
             +F+LKLHTAG+IAATFGMAN VARPFGG+ASD AA+ FGMRGRLW LWI+QT GG FC  
Sbjct  302   KFNLKLHTAGMIAATFGMANFVARPFGGYASDLAARKFGMRGRLWVLWIVQTTGGAFCIW  361

Query  1193  LGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQL  1372
             LGRA +LP+A+  MI+FSIGAQAACGAT+GI PF+SRRSLG+ISGLTGAGGNFG GLTQL
Sbjct  362   LGRAESLPIAIVSMILFSIGAQAACGATYGIIPFVSRRSLGLISGLTGAGGNFGGGLTQL  421

Query  1373  IFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEW  1552
             +FFST++FST  GL++MG+M +ACTLPV  +HFPQWG MFFPAS D  +  EE+YY SEW
Sbjct  422   LFFSTTRFSTGMGLTWMGLMAIACTLPVAFIHFPQWGSMFFPASNDG-KYNEENYYESEW  480

Query  1553  NEEEKQKGMHQNSLKFAENSRSERGKR  1633
              E EKQKG+H  S+KFAENSRSERGK+
Sbjct  481   TENEKQKGLHLASVKFAENSRSERGKK  507



>ref|XP_004251405.1| PREDICTED: high affinity nitrate transporter 2.4-like [Solanum 
lycopersicum]
Length=525

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/500 (72%), Positives = 430/500 (86%), Gaps = 2/500 (0%)
 Frame = +2

Query  137   GREPVLSFAVASPIVPTDTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTC  313
             GRE   +F++ S  V  ++ + KF LPVDSEHKAK  K+FS A PHMR+FHL+WISFFTC
Sbjct  9     GREQTFAFSITSQNVCNNSQSNKFDLPVDSEHKAKSIKIFSFAQPHMRSFHLAWISFFTC  68

Query  314   FVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLI  493
             F+STFAAAPLVPIIRDNLNL ++DIGNAGVASVSGSI SRL+MG +CDL+GPRYGCAFL 
Sbjct  69    FISTFAAAPLVPIIRDNLNLTRADIGNAGVASVSGSIFSRLIMGVLCDLIGPRYGCAFLN  128

Query  494   MLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwg  673
             +LTAP VF ++F+S+A GY+A+RF++GFSLATFVSCQYW S MFNS+IIGL NG A GWG
Sbjct  129   LLTAPIVFSVAFISNAEGYIAMRFLVGFSLATFVSCQYWTSVMFNSQIIGLVNGVAGGWG  188

Query  674   nmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLG  853
             +MGGG TQLLMP L+ II+  GATP++AWRIAFFIPGWLH+++G++VL LGQDLPDGNL 
Sbjct  189   DMGGGVTQLLMPFLFHIIKLTGATPYTAWRIAFFIPGWLHIIIGLMVLILGQDLPDGNLS  248

Query  854   SLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLH  1033
             +LQKKG++ KD+FSKV   AVTNYRTW+F LLYG+SMGVEL  +NVIAEYF+D+F+LKLH
Sbjct  249   TLQKKGDVTKDQFSKVLRNAVTNYRTWVFFLLYGFSMGVELCINNVIAEYFYDKFNLKLH  308

Query  1034  TAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTL  1213
             TAG+IAATFGMAN VARPFGG+ASD AA+ FGMRGRLW LWI+QT GG FC  LGRA +L
Sbjct  309   TAGMIAATFGMANFVARPFGGYASDLAARKFGMRGRLWVLWIVQTTGGAFCIWLGRAESL  368

Query  1214  PLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSK  1393
             P+A+  MI+FSIGAQAACGAT+GI PF+SRRSLG+ISGLTGAGGNFG GLTQL+FFST++
Sbjct  369   PIAIVSMILFSIGAQAACGATYGIIPFVSRRSLGLISGLTGAGGNFGGGLTQLLFFSTTR  428

Query  1394  FSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQK  1573
             FST  GL++MG+M +ACT+PV  VHFPQWG MFFPAS D  +  EE+YY SEW E EKQK
Sbjct  429   FSTGMGLTWMGLMAIACTVPVAFVHFPQWGSMFFPASNDG-KYNEENYYESEWTENEKQK  487

Query  1574  GMHQNSLKFAENSRSERGKR  1633
             G+H  S+KFAENSRSERGK+
Sbjct  488   GLHLASVKFAENSRSERGKK  507



>gb|EMT10647.1| Nitrate transporter [Aegilops tauschii]
Length=560

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/536 (69%), Positives = 417/536 (78%), Gaps = 57/536 (11%)
 Frame = +2

Query  188   DTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             DT A KF LPVDSEHKAK F+LFS ANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN
Sbjct  10    DTAASKFTLPVDSEHKAKSFRLFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  69

Query  365   LNLVKSDIGNAGVA----------------------------------------------  406
             LNL K+DIGNAGVA                                              
Sbjct  70    LNLAKADIGNAGVALFSFANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLAKAD  129

Query  407   -------SVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRF  565
                    SVSGSI SRL MGA+CDLLGPRYGCAFL+ML+APTVFCM+ +  A GY+AVRF
Sbjct  130   IGNAGVASVSGSIFSRLAMGAICDLLGPRYGCAFLVMLSAPTVFCMAVIDDASGYIAVRF  189

Query  566   MIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGAT  745
             +IGFSLATFVSCQYWMSTMFNSKIIG  NG AAGWGNMGGGATQL+MP+++  I+K GAT
Sbjct  190   LIGFSLATFVSCQYWMSTMFNSKIIGTVNGLAAGWGNMGGGATQLIMPLVFHAIQKCGAT  249

Query  746   PFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNY  925
             PF AWRIA+F+PG +H+VMG+LVLT+GQDLPDGNL SLQKKG++ KDKFSKV W AVTNY
Sbjct  250   PFVAWRIAYFVPGMMHIVMGLLVLTMGQDLPDGNLASLQKKGDMAKDKFSKVLWGAVTNY  309

Query  926   RTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFAS  1105
             RTWIF LLYGY MGVEL+TDNVIAEY++D F L L  AG IAA FGMAN+VARP GG+ S
Sbjct  310   RTWIFVLLYGYCMGVELTTDNVIAEYYYDHFHLDLRAAGTIAACFGMANIVARPMGGYLS  369

Query  1106  DYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGI  1285
             D  A++FGMR RLW +WILQT GG FC  LGRA+ LP +VT M++FSI AQAACGA FG+
Sbjct  370   DLGARYFGMRARLWNIWILQTAGGAFCIWLGRASALPASVTAMVLFSICAQAACGAVFGV  429

Query  1286  TPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLV  1465
              PF+SRRSLGIISGLTGAGGN G+GLTQL+FF++S++ST  GL YMGIMIMACTLPV LV
Sbjct  430   APFVSRRSLGIISGLTGAGGNVGAGLTQLLFFTSSQYSTGRGLEYMGIMIMACTLPVALV  489

Query  1466  HFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             HFPQWG MFFPAS DA   TEE YY SEW+EEEK KG+H    KFAENSRSERG+R
Sbjct  490   HFPQWGSMFFPASADA---TEEEYYASEWSEEEKGKGLHIAGQKFAENSRSERGRR  542



>ref|XP_007016830.1| Nitrate transporter 2:1 [Theobroma cacao]
 gb|EOY34449.1| Nitrate transporter 2:1 [Theobroma cacao]
Length=466

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/515 (72%), Positives = 410/515 (80%), Gaps = 64/515 (12%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MADIEGSPGSSMHGVTGREPVL+ +VASPIVP DTTAKF LPVD EHKAKVFKLFS +NP
Sbjct  1     MADIEGSPGSSMHGVTGREPVLALSVASPIVPPDTTAKFDLPVDLEHKAKVFKLFSFSNP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISFFTCF+STFAAAPL                                   
Sbjct  61    HMRTFHLSWISFFTCFISTFAAAPLF----------------------------------  86

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
              CDLLGPRY  AFLIML+APTVFCMSFVS AGGY+AV FMIGFSLATFVSCQYWMS MF 
Sbjct  87    -CDLLGPRYRDAFLIMLSAPTVFCMSFVSDAGGYIAVLFMIGFSLATFVSCQYWMSRMFK  145

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              KIIGL NGTAA WGNMGGGATQLLMP+++DIIR+AGATPF+AWRIAFF+PGW HV+ GI
Sbjct  146   CKIIGLVNGTAAAWGNMGGGATQLLMPLVFDIIRQAGATPFTAWRIAFFVPGWFHVIRGI  205

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LV+                             W+A+TNYRTWIF LLY YSMGVELSTDN
Sbjct  206   LVM-----------------------------WFAITNYRTWIFVLLYDYSMGVELSTDN  236

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             V+AEYF+D+ DLKL TAG IAATFGMANL+ARPFGGFASD AA++FGMRGRLW LWILQT
Sbjct  237   VVAEYFYDKVDLKLRTAGTIAATFGMANLLARPFGGFASDRAARYFGMRGRLWVLWILQT  296

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRANTLP+A+  MI+ SIGAQAACGATFGI PFISRRSLGIISGLTGA G+
Sbjct  297   LGGVFCIWLGRANTLPIAILAMILLSIGAQAACGATFGIIPFISRRSLGIISGLTGARGD  356

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FGSGLT+LI FST+ FSTA GL++MG+MI+ACTLPVTLVHFPQWG MF P SKD ++GTE
Sbjct  357   FGSGLTELIVFSTTTFSTAQGLTWMGVMIVACTLPVTLVHFPQWGSMFLPPSKDVIKGTE  416

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNEEEKQKG+ Q SLKFAENSRSERG++
Sbjct  417   EHYYGSEWNEEEKQKGLRQGSLKFAENSRSERGRK  451



>gb|EYU17587.1| hypothetical protein MIMGU_mgv1a004788mg [Erythranthe guttata]
Length=510

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/479 (75%), Positives = 410/479 (86%), Gaps = 1/479 (0%)
 Frame = +2

Query  200   KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVK  379
             KF LPVDSEHKAK  K+ S   PHMR+FHL+WISFFTCF+STFAAAPLVPIIRDNLNL +
Sbjct  12    KFDLPVDSEHKAKTLKILSFKQPHMRSFHLAWISFFTCFISTFAAAPLVPIIRDNLNLTR  71

Query  380   SDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAV  559
             SDIGNAGVASVSGSI SRL+MG +CDL+ PRYGCAFL +LTAP VF ++F+SSA GY+AV
Sbjct  72    SDIGNAGVASVSGSIASRLIMGVICDLIAPRYGCAFLNLLTAPVVFSVAFISSAQGYIAV  131

Query  560   RFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRK-A  736
             RFMIGFSLATFVSCQYW S MF S IIG  NG A GWG+MGGG TQLLMP L+ +I    
Sbjct  132   RFMIGFSLATFVSCQYWTSVMFTSSIIGTVNGVAGGWGDMGGGVTQLLMPFLFHMITTYG  191

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF+AWRIAFFIPGWLH+++G++VL LGQD PDGNLG+LQK G++ KDKFSKV  +AV
Sbjct  192   GATPFTAWRIAFFIPGWLHIIIGVMVLALGQDFPDGNLGALQKSGDVAKDKFSKVLKHAV  251

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTW+F LLYG+SMGVEL  +NVIAEYF+DRF+LKLHTAGIIAATFGMAN  ARP GG
Sbjct  252   TNYRTWVFFLLYGFSMGVELCINNVIAEYFYDRFNLKLHTAGIIAATFGMANFAARPLGG  311

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             +ASD A++ FGMRGRLW LWI+QT+GG+FC  LGRAN+L +A+  MI+FSIGAQAACGAT
Sbjct  312   YASDVASRKFGMRGRLWVLWIVQTLGGVFCIWLGRANSLSVAIASMILFSIGAQAACGAT  371

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             +GI PF+SRRSLG+ISGLTGAGGNFG GLTQLIFFST++FSTASGL+YMG M +ACT+PV
Sbjct  372   YGIIPFVSRRSLGLISGLTGAGGNFGGGLTQLIFFSTTRFSTASGLTYMGAMAVACTIPV  431

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              +VHFPQWG MF P SK     TEE YY SEWNEEE+ KG+H  S+KFAENSRSERG R
Sbjct  432   AVVHFPQWGSMFLPPSKKGGGCTEESYYSSEWNEEERMKGLHHGSVKFAENSRSERGSR  490



>ref|XP_002451374.1| hypothetical protein SORBIDRAFT_04g000970 [Sorghum bicolor]
 gb|EES04350.1| hypothetical protein SORBIDRAFT_04g000970 [Sorghum bicolor]
Length=535

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/514 (68%), Positives = 412/514 (80%), Gaps = 6/514 (1%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAK-FALPVDSEHKAKVFKLFSLANPHMR  277
             E   GSS+HGVT REP   FA ++   P     K F LPVDSEHKAK  +L S ANPHMR
Sbjct  4     EAPAGSSLHGVTAREPSFPFAFSTEETPAAAAGKSFDLPVDSEHKAKSIRLLSFANPHMR  63

Query  278   TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCD  457
             TFHLSW+SFFTC VSTFAAAPL+PIIR+NL L K+DIGNAGVASVSG+I SRL MGAVCD
Sbjct  64    TFHLSWMSFFTCVVSTFAAAPLIPIIRENLGLTKADIGNAGVASVSGAIFSRLAMGAVCD  123

Query  458   LLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKI  637
             LLGPRYGCAF++ML AP VFCM+ + SA GYV  RF+IGFSLATFVSCQYW STMFN KI
Sbjct  124   LLGPRYGCAFVVMLAAPAVFCMAIIDSAAGYVVCRFLIGFSLATFVSCQYWTSTMFNIKI  183

Query  638   IGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVL  817
             IG  N  A+GWG+MGGGATQL+MP +Y+ I + GATPF+AWRIA+F+PG +H+ +GILVL
Sbjct  184   IGTVNALASGWGDMGGGATQLIMPFVYEGILRCGATPFAAWRIAYFVPGLMHIAVGILVL  243

Query  818   TLGQDLPDGNLGSLQKKG--NINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNV  991
             T GQDLPDGNL +LQK+G  +  +D FS+V W+AV NYRTW+F  +YGY MGV+L+T+N+
Sbjct  244   TAGQDLPDGNLRTLQKQGGDSCRRDNFSRVLWHAVANYRTWVFVFVYGYCMGVQLTTNNI  303

Query  992   IAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTM  1171
             IAE+F+D+FDL +  AGIIAA+FGMANLV+RP GG  SD  A+++GMR RLW +WILQT 
Sbjct  304   IAEFFYDQFDLDIRVAGIIAASFGMANLVSRPLGGVLSDVGARYWGMRARLWNIWILQTA  363

Query  1172  GGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNF  1351
             GG FC  LGRA+ LP +VT M++FS+ AQAACGATFG+ PF+SRRSLG+ISGLTGAGGN 
Sbjct  364   GGAFCLWLGRASWLPASVTAMVLFSLCAQAACGATFGVIPFVSRRSLGVISGLTGAGGNV  423

Query  1352  GSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEE  1531
             G+GLTQL+FF+TS +ST  G+  MGIM MACTLP+ LVHFPQWG M  P S DA    EE
Sbjct  424   GAGLTQLLFFTTSSYSTGKGIENMGIMTMACTLPLVLVHFPQWGSMLLPPSADA---DEE  480

Query  1532  HYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              YY +EW+EEEK  G H  SLKFAEN RSERG+R
Sbjct  481   SYYAAEWSEEEKSVGRHSTSLKFAENCRSERGRR  514



>emb|CDY32821.1| BnaC08g02430D [Brassica napus]
Length=464

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/515 (71%), Positives = 397/515 (77%), Gaps = 66/515 (13%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTDTTAKF LPVD+EHKAKVFKLFS ANP
Sbjct  1     MGDPSGEPGSSMHGVTGREQSFAFSVASPIVPTDTTAKFDLPVDTEHKAKVFKLFSFANP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV  AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVDGAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+                         
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRC------------------------  216

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
                  GQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  217   -----GQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  271

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AA +FGMRGRLW LWI+QT
Sbjct  272   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDIAATYFGMRGRLWALWIIQT  331

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  A+  MI+FS+GAQAACGATF I PF+SRR+LGIIS        
Sbjct  332   AGGLFCVWLGRANTLVTAIVAMILFSLGAQAACGATFAIVPFVSRRALGIIS--------  383

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
                                          +ACTLPVTL+HFPQWG MF P SKD V+GTE
Sbjct  384   -----------------------------VACTLPVTLIHFPQWGSMFLPPSKDPVKGTE  414

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EKQK MHQ SL+FAENS+SE G+R
Sbjct  415   EHYYASEWNEQEKQKNMHQGSLRFAENSKSEGGRR  449



>ref|XP_009126582.1| PREDICTED: LOW QUALITY PROTEIN: high affinity nitrate transporter 
2.3-like [Brassica rapa]
Length=536

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/519 (70%), Positives = 427/519 (82%), Gaps = 3/519 (1%)
 Frame = +2

Query  86    LMADIEGSPGSSMHGVTGREPVLSFAVA---SPIVPTDTTAKFALPVDSEHKAKVFKLFS  256
             + ++ EGS G+S+HGVT RE V SF+V      +   D TAKFALPVDSEH+AKVFK  S
Sbjct  1     MASNEEGSIGTSLHGVTAREQVFSFSVDSSSQTLQSDDPTAKFALPVDSEHRAKVFKPLS  60

Query  257   LANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRL  436
              A PHMR FHL WI FF+CF+STF+AAPL PIIRDNL+L K+D+GNAGVASVSG+I SRL
Sbjct  61    FAKPHMRAFHLRWICFFSCFISTFSAAPLGPIIRDNLDLTKTDVGNAGVASVSGAIFSRL  120

Query  437   VMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMS  616
              MGAVCDLLG R G AF +MLTAPTVF MSFV+   GY+AVRFMIGF LATFVSCQYW S
Sbjct  121   AMGAVCDLLGARXGTAFSLMLTAPTVFSMSFVTGPVGYLAVRFMIGFCLATFVSCQYWTS  180

Query  617   TMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHV  796
              MFN KIIGL NG A G G+MGGG TQLLMP+++ +IR AG TPF AWRIAFFIPG+L V
Sbjct  181   VMFNGKIIGLVNGCAGGGGDMGGGVTQLLMPMVFQVIRLAGTTPFMAWRIAFFIPGFLQV  240

Query  797   VMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVEL  976
             V+G+LVLTLGQDLPDGNL +LQK G ++KDKFSKVFW+AV NYRTWI  +LYG+SMG+EL
Sbjct  241   VVGVLVLTLGQDLPDGNLSTLQKSGQVSKDKFSKVFWFAVKNYRTWILFVLYGFSMGIEL  300

Query  977   STDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLW  1156
             + +NVI+ YFFDRF+LKL TAGI+AA+FGMAN  ARPFGG+ASD AA+ FGMRGRLW LW
Sbjct  301   TINNVISGYFFDRFNLKLQTAGIVAASFGMANFFARPFGGYASDLAARLFGMRGRLWILW  360

Query  1157  ILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTG  1336
             I QT+G LFC  LGRA++LP+A+  M++FS+G QAACGA FG+ PF+SRRSLG+ISGLTG
Sbjct  361   IFQTVGALFCIWLGRASSLPIAILAMMLFSVGTQAACGALFGVAPFVSRRSLGLISGLTG  420

Query  1337  AGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAV  1516
             AGGNFGSGLTQL+FFSTS+FSTA GLS MG M + CT+PV  +HFPQWG MF   S D  
Sbjct  421   AGGNFGSGLTQLLFFSTSRFSTADGLSLMGAMAVLCTVPVAFIHFPQWGSMFLRPSSDGE  480

Query  1517  RGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             R  EE+YY SEW EEEK++G+H+ S+KFAENSRSER ++
Sbjct  481   RSKEEYYYSSEWTEEEKRQGLHEGSIKFAENSRSERSRK  519



>ref|XP_006359576.1| PREDICTED: high affinity nitrate transporter 2.4-like [Solanum 
tuberosum]
Length=524

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/515 (70%), Positives = 436/515 (85%), Gaps = 4/515 (1%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             MA+ EG  G+S HG+TG+E   +F+++S    +    KF+LPVDSEHKAK  K+ S A P
Sbjct  1     MANAEGCVGTSAHGLTGKEETFTFSMSSS---SSGVTKFSLPVDSEHKAKTLKILSFAQP  57

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMR+FHL+WISFF C +S FAAAPLVPIIRDNL+L +SDIGNAGVASVSGSI SRLVMG 
Sbjct  58    HMRSFHLAWISFFPCLISPFAAAPLVPIIRDNLDLTRSDIGNAGVASVSGSIFSRLVMGV  117

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDL+GPRYGCAF+ +LTAP VF ++FVS+  GY+AVRFMIG SLATFVSCQYW STMFN
Sbjct  118   VCDLIGPRYGCAFVNLLTAPVVFSVAFVSTPQGYIAVRFMIGVSLATFVSCQYWTSTMFN  177

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
              +IIGL NG AAGWG+MGGG TQLLMP L+ II+  GATPF+AWRIAFFIPGWLH+++G+
Sbjct  178   GQIIGLVNGVAAGWGDMGGGVTQLLMPFLFHIIQLTGATPFTAWRIAFFIPGWLHIIVGV  237

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             +VL LGQDLPDGNL  LQK G+++KDKFSKVF +AVTNYRTW+F L+YGYSMGV+L  +N
Sbjct  238   MVLVLGQDLPDGNLSDLQKSGHVHKDKFSKVFRFAVTNYRTWVFFLVYGYSMGVQLCMNN  297

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFD+F+LKLHTAG+IA  +GM N VARPFGG+ASD AA+ FGMRGRLW LWI+QT
Sbjct  298   VIAEYFFDKFNLKLHTAGVIAGAYGMVNFVARPFGGYASDLAARKFGMRGRLWILWIVQT  357

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC  LGRA TLP+A+  MI+FS+GAQAACGAT+G+ PF+SRRSLG+ISGLTGAGGN
Sbjct  358   LGGVFCVWLGRAETLPIAILAMILFSVGAQAACGATYGVIPFVSRRSLGLISGLTGAGGN  417

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
             FG GLTQLIFFS++ FST+ GL++MG M +ACT+P+ L+HFPQWG MF PASKD  +  E
Sbjct  418   FGGGLTQLIFFSSTTFSTSMGLTWMGFMAVACTVPIALIHFPQWGSMFLPASKDE-KYNE  476

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             E YY SEW+++EKQKG+H  S+KFAENS SERG++
Sbjct  477   EKYYSSEWSDDEKQKGLHNASIKFAENSISERGRK  511



>emb|CDX93591.1| BnaA06g04570D [Brassica napus]
Length=464

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/515 (70%), Positives = 395/515 (77%), Gaps = 66/515 (13%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQTFAFSVASPIVPTDKTAKFDLPVDSEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV  AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVHDAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+                         
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRC------------------------  216

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
                  GQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  217   -----GQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  271

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AA++FGMRGRLW LWI+QT
Sbjct  272   VIAEYFFDRFHLKLHTAGIIAACFGMANFFARPAGGYASDLAARYFGMRGRLWALWIIQT  331

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GGLFC  LGRANTL  AV  MI+FS+GAQAACGATF I PF+SRR+LGIIS        
Sbjct  332   LGGLFCVWLGRANTLVTAVVAMILFSLGAQAACGATFAIVPFVSRRALGIIS--------  383

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
                                          +ACTLPVTL+HFPQWG MF P SKD V+GTE
Sbjct  384   -----------------------------VACTLPVTLIHFPQWGSMFLPPSKDPVKGTE  414

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EK+K MHQ SL+FAEN++SE G+R
Sbjct  415   EHYYASEWNEQEKEKNMHQGSLRFAENAKSEGGRR  449



>ref|XP_004952138.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Setaria 
italica]
Length=524

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/508 (69%), Positives = 410/508 (81%), Gaps = 5/508 (1%)
 Frame = +2

Query  116   SSMHGVTGREPVLSFAVAS--PIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHL  289
             +S+HGVTGREP  SF+     P       AKF LPVDSEHKAK  ++ S+ANPHMRTFHL
Sbjct  2     ASVHGVTGREPTFSFSTEDGRPDAEDAAPAKFDLPVDSEHKAKSIRILSMANPHMRTFHL  61

Query  290   SWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGP  469
             SW+SFFTC VSTFAAAPL+PIIR+NLNL KSDIGNAGVASVSG+I SRL MGAVCDLLGP
Sbjct  62    SWMSFFTCVVSTFAAAPLIPIIRENLNLTKSDIGNAGVASVSGAIFSRLAMGAVCDLLGP  121

Query  470   RYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLa  649
             RYGCAF++ML AP VFCM+ + SA GY+ +RF+IG SLATFVSCQYW STMFN KIIG  
Sbjct  122   RYGCAFVMMLAAPPVFCMAVIDSAAGYITIRFLIGVSLATFVSCQYWTSTMFNIKIIGTV  181

Query  650   ngtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQ  829
             N  A+GWG+MGGGATQL+MP +Y+ I K G +PF AWRIA+F+PG +HVVMGILVLT GQ
Sbjct  182   NALASGWGDMGGGATQLIMPFVYEGILKCGVSPFEAWRIAYFVPGLMHVVMGILVLTTGQ  241

Query  830   DLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFF  1009
             DLPDGNL +LQK+G+ NKD FSKVF +AVTNYRTW+F  +YGYSMGV+L+T+N+IAEYF+
Sbjct  242   DLPDGNLRNLQKQGDANKDNFSKVFMHAVTNYRTWVFVFIYGYSMGVQLTTNNIIAEYFY  301

Query  1010  DRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCF  1189
             D+FDL +  AGIIAA FGMANLV+RP GG  SD  A+++GMR RLW +WILQT GG FC 
Sbjct  302   DQFDLDIRVAGIIAACFGMANLVSRPLGGVLSDLGARYWGMRARLWNIWILQTAGGAFCL  361

Query  1190  LLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQ  1369
              LG A +LP ++T M++FS  AQAACGATFG+ PF+SRRSLGIISG+TGAGGN G+G+TQ
Sbjct  362   WLGSAKSLPASITAMVLFSFCAQAACGATFGVIPFVSRRSLGIISGMTGAGGNVGAGVTQ  421

Query  1370  LIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSE  1549
             LIFF+ S +ST  G+  MGIM M CTLP+ L+HFPQWG M  P S DA    EE YY SE
Sbjct  422   LIFFTLSNYSTGKGIQNMGIMAMVCTLPLVLIHFPQWGSMLLPPSADA---DEERYYASE  478

Query  1550  WNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             W+EEEK  G H  SLKFAEN RSERG+R
Sbjct  479   WSEEEKSLGRHSASLKFAENCRSERGRR  506



>ref|XP_004240585.1| PREDICTED: high affinity nitrate transporter 2.4-like [Solanum 
lycopersicum]
Length=498

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/478 (73%), Positives = 415/478 (87%), Gaps = 1/478 (0%)
 Frame = +2

Query  200   KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVK  379
             KF+LPVDSEHKAK  K+FS A PHMR+FHL+WISFFTC +STFAAAPLVPIIRDNL+L +
Sbjct  9     KFSLPVDSEHKAKTLKIFSFAQPHMRSFHLAWISFFTCLISTFAAAPLVPIIRDNLDLTR  68

Query  380   SDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAV  559
             SDIGNAGVASVSGSI SRLVMG VCDL+GPRYGCAF+ +LTAP VF ++FVS+  GY+AV
Sbjct  69    SDIGNAGVASVSGSIFSRLVMGVVCDLIGPRYGCAFVNLLTAPVVFSVAFVSTPQGYIAV  128

Query  560   RFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAG  739
             RFMIG SLATFVSCQYW STMFN +IIGL NG AAGWG+MGGG TQLLMP L+ II+  G
Sbjct  129   RFMIGVSLATFVSCQYWTSTMFNGQIIGLVNGVAAGWGDMGGGVTQLLMPFLFHIIQLTG  188

Query  740   ATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVT  919
             ATPF+AWRIAFFIPGWLH+++G++VL LGQDLPDGNL  LQK G+++KDKFSKV W+AVT
Sbjct  189   ATPFTAWRIAFFIPGWLHIIVGVMVLVLGQDLPDGNLSDLQKSGDVHKDKFSKVVWFAVT  248

Query  920   NYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGF  1099
             NYRTW+F L+YGYSMGV+L  +NVIAEYFFD+F+LKLHTAG+IA  +GM N VARPFGG+
Sbjct  249   NYRTWVFFLVYGYSMGVQLCMNNVIAEYFFDKFNLKLHTAGVIAGAYGMVNFVARPFGGY  308

Query  1100  ASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATF  1279
             ASD AA+ FGMRGRLW LWI+QT+GG+FC  LGRA TLP+A+  MI+FSIGAQAACGAT+
Sbjct  309   ASDLAARKFGMRGRLWILWIVQTLGGVFCVWLGRAETLPIAILAMILFSIGAQAACGATY  368

Query  1280  GITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVT  1459
             G+ PF+SRRSLG+ISGLTGAGGNFG GLTQLIFFS++ FST+ GL++MG M +AC++P+ 
Sbjct  369   GVIPFVSRRSLGLISGLTGAGGNFGGGLTQLIFFSSTTFSTSMGLTWMGFMAVACSVPIA  428

Query  1460  LVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             L+HFPQWG MF PASKD     EE YY SEW+ +EKQKG+H  S+KFAENS SERG++
Sbjct  429   LIHFPQWGSMFLPASKDE-NYNEEKYYSSEWSYDEKQKGLHNASIKFAENSVSERGRK  485



>emb|CDY22704.1| BnaC08g43380D [Brassica napus]
Length=463

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/515 (70%), Positives = 390/515 (76%), Gaps = 66/515 (13%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQTFAFSVASPIVPTDKTAKFDLPVDSEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS A G++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAAGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMPV+Y+IIR+                         
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPVVYEIIRRC------------------------  216

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
                  GQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  217   -----GQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  271

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  272   VIAEYFFDRFHLKLHTAGIIAACFGMANFFARPAGGYASDLAAKYFGMRGRLWALWIIQT  331

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GG+FC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIIS        
Sbjct  332   AGGVFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIIS--------  383

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
                                          +ACTLPV L HFPQWG MF P S D V+GTE
Sbjct  384   -----------------------------VACTLPVCLCHFPQWGSMFLPPSNDPVKGTE  414

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EKQK +HQ SL+FAEN++SE G R
Sbjct  415   EHYYGSEWNEQEKQKNLHQGSLRFAENAKSEGGPR  449



>ref|XP_004954761.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Setaria 
italica]
Length=580

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/509 (68%), Positives = 407/509 (80%), Gaps = 6/509 (1%)
 Frame = +2

Query  116   SSMHGVTGREPVLSFAVAS---PIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFH  286
             +S+H VTGREP  SF+      P       A+F LPVDSEHKAK  ++FS+ANPHMRTFH
Sbjct  57    ASVHEVTGREPTFSFSTEDAGRPDAENAAAARFHLPVDSEHKAKSIRIFSMANPHMRTFH  116

Query  287   LSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLG  466
             LSW+SFFTC VSTFAAAPL+PIIR NLNL KSDIGNAGVASVSG+I SRL MGAVCDLLG
Sbjct  117   LSWMSFFTCVVSTFAAAPLIPIIRQNLNLTKSDIGNAGVASVSGAIFSRLAMGAVCDLLG  176

Query  467   PRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGL  646
             PRYGCAF++ML AP VFCM+ + SA GY+ +RF+IG SLATFVSCQYW STMFN KIIG 
Sbjct  177   PRYGCAFVMMLAAPPVFCMAVIDSAAGYITIRFLIGVSLATFVSCQYWTSTMFNIKIIGT  236

Query  647   angtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLG  826
              N  A+GWG+MGGGATQL+MP +Y+ I K G +PF AWRIA+F+PG +HVVMGILVLT G
Sbjct  237   VNALASGWGDMGGGATQLIMPFVYEGILKCGVSPFEAWRIAYFVPGLMHVVMGILVLTTG  296

Query  827   QDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYF  1006
             QDLPDGNL +LQK+G+ NKD FSKVF +AVTNYRTW+F  +YGYSMGV+L+T N+IAEY+
Sbjct  297   QDLPDGNLRNLQKQGDANKDNFSKVFMHAVTNYRTWVFVFIYGYSMGVQLTTTNIIAEYY  356

Query  1007  FDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFC  1186
             +D+FDL +  AGIIAA FGMANLV+RP GG  SD  A+++GMR RLW +WILQT GG FC
Sbjct  357   YDQFDLNIRVAGIIAACFGMANLVSRPLGGVLSDLGARYWGMRARLWNIWILQTAGGAFC  416

Query  1187  FLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLT  1366
               LG A  LP ++T M++FS  AQAACGATFG+ PF+SRRSLGIISG+TGAGGN G+G+T
Sbjct  417   LWLGSAKALPASITAMVLFSFCAQAACGATFGVIPFVSRRSLGIISGMTGAGGNVGAGVT  476

Query  1367  QLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCS  1546
             QLIFF+ S +ST  G+  MGIM M CTLP+ L+HFPQWG M  P S DA    EE YY S
Sbjct  477   QLIFFTLSNYSTGKGIQNMGIMAMVCTLPLVLIHFPQWGSMLLPPSADA---DEERYYAS  533

Query  1547  EWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EW+EEEK  G H  SLKFAEN RSERG+R
Sbjct  534   EWSEEEKSLGRHSASLKFAENCRSERGRR  562



>ref|XP_002966266.1| hypothetical protein SELMODRAFT_168278 [Selaginella moellendorffii]
 gb|EFJ32293.1| hypothetical protein SELMODRAFT_168278 [Selaginella moellendorffii]
Length=536

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/514 (67%), Positives = 414/514 (81%), Gaps = 4/514 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAK-FALPVDSEHKAKVFKLFSLANPH  271
             D  G PG SMHGVTG+E   +F+V +P    D  AK FALPVDSEHK+KVF +FSLANPH
Sbjct  12    DAAGDPGVSMHGVTGKEQAFAFSVEAPSPIADPAAKKFALPVDSEHKSKVFNIFSLANPH  71

Query  272   MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAV  451
             MRTFHLSWI+FFTCF STFAA PL+PIIRDNL L K D+G AG+ASV+G+I+SR  MG V
Sbjct  72    MRTFHLSWIAFFTCFTSTFAAPPLLPIIRDNLGLTKLDVGRAGIASVTGAIVSRFAMGPV  131

Query  452   CDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS  631
             CDL+GPRYGCAF+IM+TAP VF MS VSSA G++  RF IGF LATFVSCQ+WMS+MFNS
Sbjct  132   CDLVGPRYGCAFVIMMTAPAVFSMSLVSSATGFILARFFIGFGLATFVSCQFWMSSMFNS  191

Query  632   KIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGIL  811
             KI+G ANGTAAGWGN+GGGATQL+MP+++  I+  G+  F AWRIAFF+PG+ H+ MG++
Sbjct  192   KIVGSANGTAAGWGNLGGGATQLIMPLVFKAIQSMGSDKFIAWRIAFFVPGFFHIFMGLM  251

Query  812   VLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNV  991
             VLTLGQDLPDGN   L++ G  NKD FSKVF  A+ NYRTWIFALLYGYS GVEL+ DN+
Sbjct  252   VLTLGQDLPDGNYALLKETGKKNKDAFSKVFVNAIRNYRTWIFALLYGYSFGVELTVDNI  311

Query  992   IAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTM  1171
             IAEYF+DRF L LHTAGI+A+TFGMANL ARP GG  SD  A+ FGMRGRLW LW++Q+M
Sbjct  312   IAEYFYDRFGLDLHTAGIVASTFGMANLFARPLGGILSDVVARRFGMRGRLWALWLMQSM  371

Query  1172  GGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNF  1351
             G + C +LG   +L  ++  MI+FS+  Q ACG TFGI PF+S RSLG+ISGLTGAGGN 
Sbjct  372   GAVLCIVLGLVGSLGPSIGVMILFSLFLQGACGCTFGIIPFVSHRSLGVISGLTGAGGNV  431

Query  1352  GSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEE  1531
             G+ LTQLIFF+++++ST  G+S MG+M +ACT+PV LV+FPQWGG  FPAS +    TEE
Sbjct  432   GAVLTQLIFFTSNQYSTQKGISLMGVMSLACTMPVLLVYFPQWGGALFPASGEV---TEE  488

Query  1532  HYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             HYY SEW + EK++GMH  S+KFAEN+RSERG+R
Sbjct  489   HYYTSEWTKAEKEQGMHNASVKFAENARSERGRR  522



>emb|CDX93592.1| BnaA06g04560D [Brassica napus]
Length=460

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/515 (69%), Positives = 390/515 (76%), Gaps = 70/515 (14%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQTFAFSVASPIVPTDKTAKFDLPVDSEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFV  AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVHDAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+                         
Sbjct  181   SQIIGLVNGTAAGWGNMGGGITQLLMPIVYEIIRRC------------------------  216

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
                  GQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  217   -----GQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  271

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA+FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  272   VIAEYFFDRFHLKLHTAGIIAASFGMANFFARPAGGYASDLAAKYFGMRGRLWALWIIQT  331

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
              GGLFC  LGRANTL  AV  MI+FS+GAQAACGATF I PF+SRR+L            
Sbjct  332   AGGLFCVWLGRANTLVTAVVAMILFSLGAQAACGATFAIVPFVSRRAL------------  379

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
                                          +ACTLPVTL+HFPQWG MF P S D V+GTE
Sbjct  380   -----------------------------VACTLPVTLIHFPQWGSMFLPPSTDPVKGTE  410

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EHYY SEWNE+EK+K MHQ SL+FA+N++SE G+R
Sbjct  411   EHYYASEWNEQEKEKNMHQGSLRFAKNAKSEGGRR  445



>ref|XP_002978307.1| hypothetical protein SELMODRAFT_443813 [Selaginella moellendorffii]
 gb|EFJ20964.1| hypothetical protein SELMODRAFT_443813 [Selaginella moellendorffii]
Length=536

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/514 (66%), Positives = 413/514 (80%), Gaps = 4/514 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAK-FALPVDSEHKAKVFKLFSLANPH  271
             D  G PG SMHGVTG+E   +F+V +P    D  AK FALPVDSEHK+KVF +FSLANPH
Sbjct  12    DAAGDPGVSMHGVTGKEQAFAFSVEAPSPIADPAAKKFALPVDSEHKSKVFNIFSLANPH  71

Query  272   MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAV  451
             MRTFHLSWI+FFTCF STFAA PL+PIIRDNL L K D+G AG+ASV+G+I+SR  MG V
Sbjct  72    MRTFHLSWIAFFTCFTSTFAAPPLLPIIRDNLGLTKLDVGRAGIASVTGAIVSRFAMGPV  131

Query  452   CDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS  631
             CDL+GPRYGCAF+IM+TAP VF MS VSSA G++  RF IGF LATFVSCQ+WMS+MFNS
Sbjct  132   CDLVGPRYGCAFVIMMTAPAVFSMSLVSSATGFILARFFIGFGLATFVSCQFWMSSMFNS  191

Query  632   KIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGIL  811
             KI+G ANGTAAGWGN+GGGATQL+MP+++  I+  G+  F AWRIAFF+PG+ H+ MG++
Sbjct  192   KIVGSANGTAAGWGNLGGGATQLIMPLVFRAIQSMGSDKFIAWRIAFFVPGFFHIFMGLM  251

Query  812   VLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNV  991
             VLTLGQDLPDGN   L++ G  NKD FSKVF  A+ NYRTWIFALLYGYS GVEL+ DN+
Sbjct  252   VLTLGQDLPDGNYALLKETGKKNKDAFSKVFVNAIRNYRTWIFALLYGYSFGVELTVDNI  311

Query  992   IAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTM  1171
             IAEYF+DRF L LHTAGI+A+TFGMANL ARP GG  SD  A+ FGMRGRLW LW++Q+ 
Sbjct  312   IAEYFYDRFGLDLHTAGIVASTFGMANLFARPLGGILSDVVARRFGMRGRLWALWLMQST  371

Query  1172  GGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNF  1351
             G + C +LG   +L  ++  MI+FS+  Q ACG TFGI PF+S RSLG+ISGLTGAGGN 
Sbjct  372   GAVLCIVLGLVGSLGPSIGVMILFSLFLQGACGCTFGIIPFVSHRSLGVISGLTGAGGNV  431

Query  1352  GSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEE  1531
             G+ LTQLIFF+++++ST  G+S MG+M +ACT+PV LV+FPQWGG  FPAS +    TEE
Sbjct  432   GAVLTQLIFFTSNQYSTQKGISLMGVMSLACTMPVLLVYFPQWGGALFPASGEV---TEE  488

Query  1532  HYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             HYY SEW + EK++GMH  S+KFAEN+RSERG+R
Sbjct  489   HYYTSEWTKAEKEQGMHNASVKFAENARSERGRR  522



>ref|XP_008645163.1| PREDICTED: high affinity nitrate transporter 2.4-like [Zea mays]
 gb|AFW69783.1| high affinity nitrate transporter [Zea mays]
Length=522

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/523 (65%), Positives = 405/523 (77%), Gaps = 33/523 (6%)
 Frame = +2

Query  101   EGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRT  280
             + + GSS+ GVT                   ++KF LPVDSEHKAK  +L S ANPHMRT
Sbjct  4     DAAHGSSLDGVT------------------PSSKFDLPVDSEHKAKTIRLLSFANPHMRT  45

Query  281   FHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDL  460
             FHLSW+SFFTC VSTFAAAPL+PIIR+NL L K+DIGNAGVASVSG+I SRL MGAVCDL
Sbjct  46    FHLSWMSFFTCVVSTFAAAPLIPIIRENLGLTKADIGNAGVASVSGAIFSRLAMGAVCDL  105

Query  461   LGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKII  640
             LGPRYGCAF++ML AP VFCM+ + SA GYVA RF+IGFSLATFVSCQYW STMFN KII
Sbjct  106   LGPRYGCAFVVMLAAPAVFCMAVIDSAAGYVACRFLIGFSLATFVSCQYWTSTMFNIKII  165

Query  641   GLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLT  820
             G  N  A+GWG+MGGGATQL+MP +Y+ I + GATPF+AWRIA+F+PG +H+ +GILVLT
Sbjct  166   GTVNALASGWGDMGGGATQLIMPFVYEAILRCGATPFAAWRIAYFVPGIMHIAVGILVLT  225

Query  821   LGQDLPDGNLGSLQK------------KGNINKDKFSKVFWYAVTNYRTWIFALLYGYSM  964
              GQDLPDGNL SL+K                 +D FS+V W+AV NYRTW+F  +YGYSM
Sbjct  226   AGQDLPDGNLRSLRKQQQQQQQGDGGDASCCRRDSFSRVLWHAVANYRTWVFVFVYGYSM  285

Query  965   GVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRL  1144
             GV+L+T+N+IAE+++D+F+L +  AGIIAA FGMANLV+RP GG  SD  A+++GMR RL
Sbjct  286   GVQLTTNNIIAEFYYDQFELDIRVAGIIAACFGMANLVSRPLGGVLSDLGARYWGMRARL  345

Query  1145  WTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIIS  1324
             W +WILQT GG FCF LGRA+ LP +VT M++FS  AQAACGATFG+ PF+SRRSLG+IS
Sbjct  346   WNIWILQTAGGAFCFWLGRASELPASVTAMVLFSFCAQAACGATFGVIPFVSRRSLGVIS  405

Query  1325  GLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPAS  1504
             GLTGAGGN G+GLTQL+FF+TS +ST  G+  MGIM MACTLP+ LVHFPQWG M  P S
Sbjct  406   GLTGAGGNVGAGLTQLLFFTTSSYSTRKGIENMGIMAMACTLPLVLVHFPQWGSMLLPPS  465

Query  1505  KDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              DA    EE YY SEW+E+EK  G H  SLKFAENSRSERGKR
Sbjct  466   ADA---DEERYYASEWSEDEKSVGRHSASLKFAENSRSERGKR  505



>gb|EEC72338.1| hypothetical protein OsI_05554 [Oryza sativa Indica Group]
Length=478

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/510 (69%), Positives = 395/510 (77%), Gaps = 58/510 (11%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G+PGSS+HGVTGREP  +F+           +KF LPVDSEHKAK  +L S ANPHMRTF
Sbjct  7     GAPGSSLHGVTGREPAFAFSTEVGGDDAAAASKFDLPVDSEHKAKTIRLLSFANPHMRTF  66

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSWISFF+CFVSTFAAAPLVPIIRDNLNL K+DIGNAGVASVSGSI SRL MGAVCD+L
Sbjct  67    HLSWISFFSCFVSTFAAAPLVPIIRDNLNLTKADIGNAGVASVSGSIFSRLAMGAVCDML  126

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCAFLIML APTVFCMS + SA GY+AVRF+IGFSLATFVSCQYWMSTMFNSKIIG
Sbjct  127   GPRYGCAFLIMLAAPTVFCMSLIDSAAGYIAVRFLIGFSLATFVSCQYWMSTMFNSKIIG  186

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTL  823
             L NG AAGWGNMGGGATQL+MP++YD+IRK GATPF+AWR+A+F+PG LHVVMG+LVLTL
Sbjct  187   LVNGLAAGWGNMGGGATQLIMPLVYDVIRKCGATPFTAWRLAYFVPGTLHVVMGVLVLTL  246

Query  824   GQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEY  1003
             GQDLPDGNL SLQKKG++N+D FS V WYAVTNYRTWIF LLYGYSMGVEL+TDNVIA  
Sbjct  247   GQDLPDGNLRSLQKKGDVNRDSFSSVLWYAVTNYRTWIFVLLYGYSMGVELTTDNVIAR-  305

Query  1004  FFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLF  1183
                       TAG                                            G F
Sbjct  306   ----------TAG--------------------------------------------GAF  311

Query  1184  CFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGL  1363
             C LLGRA+TLP +V  M++FS  AQAACGA FG+ PF+SRRSLGIISG+TGAGGNFG+GL
Sbjct  312   CLLLGRASTLPTSVVCMVLFSFCAQAACGAIFGVIPFVSRRSLGIISGMTGAGGNFGAGL  371

Query  1364  TQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYC  1543
             TQL+FF++S++ST +GL YMGIMIMACTLPV LVHFPQWG MF P +  A    EEHYY 
Sbjct  372   TQLLFFTSSRYSTGTGLEYMGIMIMACTLPVVLVHFPQWGSMFLPPNAGA---EEEHYYG  428

Query  1544  SEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             SEW+E+EK KG+H  SLKFAENSRSERG+R
Sbjct  429   SEWSEQEKSKGLHGASLKFAENSRSERGRR  458



>emb|CDY06298.1| BnaA09g49050D [Brassica napus]
Length=421

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/416 (81%), Positives = 368/416 (88%), Gaps = 0/416 (0%)
 Frame = +2

Query  89    MADIEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             M D  G PGSSMHGVTGRE   +F+VASPIVPTD TAKF LPVDSEHKA VFKLFS A P
Sbjct  1     MGDSTGEPGSSMHGVTGREQTFAFSVASPIVPTDKTAKFDLPVDSEHKATVFKLFSFAKP  60

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HMRTFHLSWISF TCFVSTFAAAPLVPIIR+NLNL K DIGNAGVASVSGSI SRLVMGA
Sbjct  61    HMRTFHLSWISFSTCFVSTFAAAPLVPIIRENLNLTKQDIGNAGVASVSGSIFSRLVMGA  120

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             VCDLLGPRYGCAFL+ML+APTVF MSFVS AGG++ VRFMIGF LATFVSCQYWMSTMFN
Sbjct  121   VCDLLGPRYGCAFLVMLSAPTVFSMSFVSGAGGFITVRFMIGFCLATFVSCQYWMSTMFN  180

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGI  808
             S+IIGL NGTAAGWGNMGGG TQLLMP++Y+IIR+ GAT F+AWR+AFF+PGWLH++MG+
Sbjct  181   SQIIGLVNGTAAGWGNMGGGVTQLLMPIVYEIIRRCGATAFTAWRLAFFVPGWLHIIMGV  240

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGN  +L+KKG + KDKF K+ WYAVTNYRTWIF LLYGYSMGVELSTDN
Sbjct  241   LVLNLGQDLPDGNRSALEKKGEVAKDKFGKIMWYAVTNYRTWIFVLLYGYSMGVELSTDN  300

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             VIAEYFFDRF LKLHTAGIIAA FGMAN  ARP GG+ASD AAK+FGMRGRLW LWI+QT
Sbjct  301   VIAEYFFDRFHLKLHTAGIIAACFGMANFFARPAGGYASDLAAKYFGMRGRLWALWIIQT  360

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTG  1336
              GGLFC  LGRANTL  AV  M++FS+GAQAACGATF I PF+SRR+LGIISGLTG
Sbjct  361   AGGLFCVWLGRANTLVTAVVAMVLFSLGAQAACGATFAIVPFVSRRALGIISGLTG  416



>ref|XP_003572590.2| PREDICTED: high-affinity nitrate transporter 2.1-like [Brachypodium 
distachyon]
Length=509

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/479 (70%), Positives = 395/479 (82%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             AKF+LPVDSE+KAK  K+FS  NPHMR FHL W+SFF C VSTFAAAPLVPIIRDNLNL 
Sbjct  16    AKFSLPVDSENKAKSIKIFSFGNPHMRAFHLGWMSFFVCVVSTFAAAPLVPIIRDNLNLT  75

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAGVASVSG+I SRL MGAVCDLLGPRYGCAFL+ML+AP VFCMS + SA GY+ 
Sbjct  76    KADIGNAGVASVSGAIFSRLAMGAVCDLLGPRYGCAFLVMLSAPAVFCMSVIDSAAGYIV  135

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             +RF+IG SLATFVSC YWMSTMF+SKI G  +G  AGWG+MGGGATQL+MP+++D I   
Sbjct  136   IRFLIGVSLATFVSCSYWMSTMFSSKITGTVSGLTAGWGDMGGGATQLIMPLVFDAIEAC  195

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF+AWRIA+F+PG + +VMG+LVLT+GQDLPDGNL SLQK G++NKDKFSKVF  AV
Sbjct  196   GATPFTAWRIAYFVPGLMLMVMGLLVLTMGQDLPDGNLRSLQKNGDMNKDKFSKVFRGAV  255

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTWI   +YGY MGVEL+T+NVIAEY++D F L L  AG IAA FG+AN+ ARP GG
Sbjct  256   TNYRTWILVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRAAGTIAACFGLANIFARPMGG  315

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG+FC  LGRA+ LP ++  M+++SI  +AACGA 
Sbjct  316   YLSDLGARYFGMRARLWNIWILQTAGGVFCLCLGRASALPASIVCMVLYSICVEAACGAV  375

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             +G+ PF+SRRSLGIISG++GAGGN G G+TQ +FF++S++STA GL YMGIMIMACTLPV
Sbjct  376   YGVIPFVSRRSLGIISGMSGAGGNVGGGVTQFLFFTSSQYSTAKGLEYMGIMIMACTLPV  435

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              L+HFPQWG M  P S DA   TEE YY SEW EEEK KG+H    KFAENSRSERG+R
Sbjct  436   ALIHFPQWGSMLLPPSTDA---TEEDYYGSEWREEEKSKGLHLAGQKFAENSRSERGRR  491



>gb|EMS46095.1| High affinity nitrate transporter 2.4 [Triticum urartu]
Length=509

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/490 (69%), Positives = 397/490 (81%), Gaps = 3/490 (1%)
 Frame = +2

Query  164   VASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPL  343
             V SP   T     F+LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL
Sbjct  5     VGSPAAATAAPIHFSLPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPL  64

Query  344   VPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCM  523
             +PIIRDNLNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYGCAFL+ML+AP VFCM
Sbjct  65    IPIIRDNLNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGCAFLVMLSAPAVFCM  124

Query  524   SFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLL  703
             S +   GGY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+
Sbjct  125   SVIDGPGGYITIRFLIGVSLATFVSCQYWISTMFNSKIIGTVGGLTAGWGDMGGGATQLI  184

Query  704   MPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINK  883
             MP+++D I   GAT F+AWRIA+F+PG + VVMG+LVLT+GQDLPDGNL SLQK G++NK
Sbjct  185   MPLVFDGILACGATSFTAWRIAYFVPGMMLVVMGLLVLTMGQDLPDGNLRSLQKNGDMNK  244

Query  884   DKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFG  1063
             DKFSKV   AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA+FG
Sbjct  245   DKFSKVLRGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRAAGTIAASFG  304

Query  1064  MANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIF  1243
             +AN+ ARP GG+ SD  A++FGMR RLW +WILQT GG+FC  LGRA++LP +VT M+++
Sbjct  305   LANIFARPMGGYLSDLGARYFGMRARLWNIWILQTAGGVFCICLGRASSLPTSVTCMVLY  364

Query  1244  SIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYM  1423
             SI  +AACGA +G+ PF+SRRSLG+ISG++GAGGN G GLTQ +FF++S+++T  GL YM
Sbjct  365   SICVEAACGAVYGVIPFVSRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYTTGKGLQYM  424

Query  1424  GIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFA  1603
             GIMIM CTLPV LVHFPQWG M  P S DA   TEE YY +EW EEEK KG+H    KFA
Sbjct  425   GIMIMVCTLPVALVHFPQWGSMLLPPSADA---TEEEYYGAEWTEEEKSKGLHIAGQKFA  481

Query  1604  ENSRSERGKR  1633
             ENS SERGKR
Sbjct  482   ENSISERGKR  491



>gb|EMS46096.1| High affinity nitrate transporter 2.4 [Triticum urartu]
Length=509

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/490 (69%), Positives = 397/490 (81%), Gaps = 3/490 (1%)
 Frame = +2

Query  164   VASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPL  343
             V SP   T     F+LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL
Sbjct  5     VGSPATATAAPINFSLPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPL  64

Query  344   VPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCM  523
             +PIIRDNLNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYGCAFL+ML+AP VFCM
Sbjct  65    IPIIRDNLNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGCAFLVMLSAPAVFCM  124

Query  524   SFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLL  703
             S +   GGY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+
Sbjct  125   SVIDGPGGYITIRFLIGVSLATFVSCQYWISTMFNSKIIGTVGGLTAGWGDMGGGATQLI  184

Query  704   MPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINK  883
             MP+++D I   GAT F+AWRIA+F+PG + VVMG+LVLT+GQDLPDGNL SLQK GN+NK
Sbjct  185   MPLVFDGILACGATRFTAWRIAYFVPGMMLVVMGLLVLTMGQDLPDGNLRSLQKNGNMNK  244

Query  884   DKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFG  1063
             DKFS V   AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA+FG
Sbjct  245   DKFSNVLCGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRAAGTIAASFG  304

Query  1064  MANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIF  1243
             +AN+ ARP GG+ SD  A++FGMR RLW +WILQT GG+FC  LGRA++LP +VT M+++
Sbjct  305   LANIFARPMGGYLSDLGARYFGMRARLWNIWILQTAGGVFCICLGRASSLPTSVTCMVLY  364

Query  1244  SIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYM  1423
             SI  +AACGA +G+ PF+SRRSLG+ISG++GAGGN G GLTQ +FF++S+++T  GL YM
Sbjct  365   SICVEAACGAVYGVIPFVSRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYTTGKGLQYM  424

Query  1424  GIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFA  1603
             GIMIM CTLP+TLVHFPQWG M  P S DA   TEE YY +EW E EK KG+H   LKFA
Sbjct  425   GIMIMVCTLPITLVHFPQWGSMLLPPSADA---TEEDYYGAEWTEGEKSKGLHLAGLKFA  481

Query  1604  ENSRSERGKR  1633
             ENS SERGKR
Sbjct  482   ENSVSERGKR  491



>gb|EMT29902.1| Nitrate transporter [Aegilops tauschii]
Length=509

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/490 (69%), Positives = 396/490 (81%), Gaps = 3/490 (1%)
 Frame = +2

Query  164   VASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPL  343
             V SP   T     F+LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL
Sbjct  5     VGSPAAATAAPINFSLPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPL  64

Query  344   VPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCM  523
             +PIIRDNLNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYGCAFL+ML+AP VFCM
Sbjct  65    IPIIRDNLNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGCAFLVMLSAPAVFCM  124

Query  524   SFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLL  703
             S +   GGY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+
Sbjct  125   SVIDGPGGYITIRFLIGVSLATFVSCQYWISTMFNSKIIGTVGGLTAGWGDMGGGATQLI  184

Query  704   MPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINK  883
             MP+++D I   GAT F AWRIA+F+PG + VVMG+LVLT+GQDLPDGNL SLQK G++NK
Sbjct  185   MPLVFDGILACGATSFMAWRIAYFVPGMMLVVMGLLVLTMGQDLPDGNLRSLQKNGDMNK  244

Query  884   DKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFG  1063
             DKFSKV   AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA+FG
Sbjct  245   DKFSKVLRGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRAAGTIAASFG  304

Query  1064  MANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIF  1243
             +AN+ ARP GG+ SD  A++FGMR RLW +WILQT GG+FC  LGRA++LP +VT M+++
Sbjct  305   LANIFARPMGGYLSDLGARYFGMRARLWNIWILQTAGGVFCICLGRASSLPTSVTCMVLY  364

Query  1244  SIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYM  1423
             SI  +AACGA +G+ PF+SRRSLG+ISG++GAGGN G GLTQ +FF++S+++T  GL YM
Sbjct  365   SICVEAACGAVYGVIPFVSRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYTTGKGLQYM  424

Query  1424  GIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFA  1603
             GIMIM CTLPV LVHFPQWG M  P S DA   TEE YY +EW EEEK KG+H    KFA
Sbjct  425   GIMIMVCTLPVALVHFPQWGSMLLPPSADA---TEEEYYGAEWTEEEKSKGLHIAGQKFA  481

Query  1604  ENSRSERGKR  1633
             ENS SERGKR
Sbjct  482   ENSISERGKR  491



>gb|EMT29903.1| Nitrate transporter [Aegilops tauschii]
Length=507

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/483 (69%), Positives = 397/483 (82%), Gaps = 4/483 (1%)
 Frame = +2

Query  188   DTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             DT A +F+LPVDSE+KAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL+PIIRDN
Sbjct  10    DTVAGRFSLPVDSENKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPLIPIIRDN  69

Query  365   LNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAG  544
             LNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYGCAFL+ML+AP VFCMS +    
Sbjct  70    LNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGCAFLVMLSAPAVFCMSIIDGPA  129

Query  545   GYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDI  724
             GY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+MP+++D 
Sbjct  130   GYITIRFLIGVSLATFVSCQYWVSTMFNSKIIGTVGGLTAGWGDMGGGATQLIMPLVFDA  189

Query  725   IRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVF  904
             I   GATPF+AWRIA+F+PG + VVMG+LVLT GQDLPDGNL SLQK G++NKDKFS V 
Sbjct  190   IIACGATPFTAWRIAYFVPGLMLVVMGLLVLTTGQDLPDGNLRSLQKNGDMNKDKFSNVL  249

Query  905   WYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVAR  1084
               AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA+FG+AN+ AR
Sbjct  250   RGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRAAGTIAASFGLANIFAR  309

Query  1085  PFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAA  1264
             P GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA+TLP ++T M+++SI  +AA
Sbjct  310   PMGGYLSDLGARYFGMRARLWNIWILQTAGGAFCLCLGRASTLPTSITCMVLYSICVEAA  369

Query  1265  CGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMAC  1444
             CGA +G+ PF+SRRSLG+ISG++GAGGN G GLTQ +FF++S++ST  GL YMGIM+MAC
Sbjct  370   CGAVYGVIPFVSRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYSTGKGLQYMGIMVMAC  429

Query  1445  TLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSER  1624
             TLPV L+HFPQWG M  P S DA   TEE YY +EW EEEK KG+H  SLKFAENS SER
Sbjct  430   TLPVALIHFPQWGSMLLPPSADA---TEEDYYGAEWTEEEKNKGLHIASLKFAENSISER  486

Query  1625  GKR  1633
             G+R
Sbjct  487   GRR  489



>ref|XP_003570801.1| PREDICTED: high-affinity nitrate transporter 2.1-like [Brachypodium 
distachyon]
Length=505

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/479 (69%), Positives = 396/479 (83%), Gaps = 3/479 (1%)
 Frame = +2

Query  197   AKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLV  376
             ++F+LPVDSE+KAK  ++FS  NPHMR FHL W+SFF C VSTFAAAPLVPIIRDNLNL 
Sbjct  16    SRFSLPVDSENKAKSIRIFSFGNPHMRAFHLGWMSFFVCVVSTFAAAPLVPIIRDNLNLT  75

Query  377   KSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVA  556
             K+DIGNAG+ASVSG+I SRL MGAVCDLLGPRYGCAFL+ML+AP VFCMS + SA GY+ 
Sbjct  76    KADIGNAGIASVSGAIFSRLAMGAVCDLLGPRYGCAFLVMLSAPAVFCMSVIDSAAGYIT  135

Query  557   VRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKA  736
             +RF+IG SLATFVSC YW+STMFNSKIIG  +G  AGWG+MGGGATQL+MP+++D I   
Sbjct  136   IRFLIGVSLATFVSCSYWVSTMFNSKIIGTVSGLTAGWGDMGGGATQLIMPLVFDAIEAC  195

Query  737   GATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAV  916
             GATPF+AWRIA+F+PG + VVMG+LVLT+GQDLPDGNL SLQK G+++KDKFSKV   AV
Sbjct  196   GATPFTAWRIAYFVPGLMLVVMGLLVLTMGQDLPDGNLRSLQKNGDMSKDKFSKVIHGAV  255

Query  917   TNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGG  1096
             TNYRTW+F  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA FG+AN+ ARP GG
Sbjct  256   TNYRTWVFVFIYGYCMGVELTTNNVIAEYYYDSFQLDLRAAGTIAACFGLANIFARPMGG  315

Query  1097  FASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGAT  1276
             + SD  A++FGMR RLW +WILQT GG+FC  LGRA+ LP ++  M+++SI  +AACGA 
Sbjct  316   YLSDLGARYFGMRARLWNIWILQTAGGVFCLCLGRASALPASIVCMVLYSICVEAACGAV  375

Query  1277  FGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPV  1456
             +G+ PF+SRRSLGIISG+TGAGGN G GLTQ +FF+TSK+ T+ GL YMG+MI+ CTLPV
Sbjct  376   YGVIPFVSRRSLGIISGMTGAGGNVGGGLTQFLFFTTSKYPTSKGLEYMGVMIICCTLPV  435

Query  1457  TLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
              LVHFPQWG MFFPAS DA   TEE YY SEW+ EEK KG+H    KFAENS SERG+R
Sbjct  436   VLVHFPQWGSMFFPASTDA---TEEDYYGSEWSHEEKSKGLHLAGQKFAENSFSERGRR  491



>gb|EMT29898.1| Nitrate transporter [Aegilops tauschii]
Length=506

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/489 (68%), Positives = 394/489 (81%), Gaps = 5/489 (1%)
 Frame = +2

Query  167   ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLV  346
             ++P  P      F LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL+
Sbjct  5     STPTTPAPI--NFLLPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPLI  62

Query  347   PIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMS  526
             PIIRDNLNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYGCAFL+ML+AP VFCMS
Sbjct  63    PIIRDNLNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGCAFLVMLSAPAVFCMS  122

Query  527   FVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLM  706
              +   GGY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+M
Sbjct  123   VIDGPGGYITIRFLIGVSLATFVSCQYWVSTMFNSKIIGTVGGLTAGWGDMGGGATQLIM  182

Query  707   PVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKD  886
             P+++D I   GATPF+AWR+A+F+PG + VVMG+LVLT+GQDLPDGNL SLQK G++NKD
Sbjct  183   PLVFDAILACGATPFTAWRLAYFVPGMMLVVMGLLVLTMGQDLPDGNLRSLQKNGDMNKD  242

Query  887   KFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGM  1066
             KFS V   AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA FG+
Sbjct  243   KFSNVLRGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRAAGTIAACFGL  302

Query  1067  ANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFS  1246
             AN+ ARP GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA TLP ++T M+++S
Sbjct  303   ANVFARPMGGYLSDLGARYFGMRARLWNIWILQTAGGAFCLCLGRATTLPTSITCMVLYS  362

Query  1247  IGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMG  1426
             I  +AACGA +G+ PF+SRRSLG+ISG++GAGGN G GLTQ +FF++S++ST  GL YMG
Sbjct  363   ICVEAACGAVYGVIPFVSRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYSTGKGLQYMG  422

Query  1427  IMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAE  1606
             IM+MACTLPV LVHFPQWG M  P +  A   TEE YY +EW EEEK KG+H   +KFAE
Sbjct  423   IMVMACTLPVALVHFPQWGSMLLPPTAGA---TEEDYYAAEWTEEEKSKGLHNAGIKFAE  479

Query  1607  NSRSERGKR  1633
             NS SERG+R
Sbjct  480   NSVSERGRR  488



>gb|EMT31431.1| Nitrate transporter [Aegilops tauschii]
Length=508

 Score =   668 bits (1724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/483 (69%), Positives = 394/483 (82%), Gaps = 3/483 (1%)
 Frame = +2

Query  185   TDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             T  +  F+LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL+PIIRDN
Sbjct  11    TAASTNFSLPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPLIPIIRDN  70

Query  365   LNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAG  544
             LNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYG AFLIML+AP VFCMS + S  
Sbjct  71    LNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGGAFLIMLSAPAVFCMSVIDSPA  130

Query  545   GYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDI  724
             GY+ VRF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+MP ++D 
Sbjct  131   GYITVRFLIGVSLATFVSCQYWISTMFNSKIIGTVGGLTAGWGDMGGGATQLIMPFVFDA  190

Query  725   IRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVF  904
             I+  GAT F+AWRIA+F+PG + VVMG+LVLTLGQDLPDGNL SLQK G +NKDKFSKV 
Sbjct  191   IKACGATRFTAWRIAYFVPGMMLVVMGLLVLTLGQDLPDGNLRSLQKNGGMNKDKFSKVL  250

Query  905   WYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVAR  1084
               A+TNYRTWIF  +YGY MGVEL+++NVIA Y++D F L L  AGIIAA FG+AN+ AR
Sbjct  251   RGAITNYRTWIFVFIYGYCMGVELTSNNVIAGYYYDSFYLDLRKAGIIAACFGLANIFAR  310

Query  1085  PFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAA  1264
             P GG+ SD  A++FGMR RLW +WILQT GG+FC  LGRA+TLP ++  M+++SI  +AA
Sbjct  311   PMGGYLSDLGARYFGMRARLWNIWILQTAGGVFCLCLGRASTLPTSIACMVLYSICVEAA  370

Query  1265  CGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMAC  1444
             CGA +G+ PF+SRRSLG++SG+TGAGGN G GLTQL+FF++S+++T  GL YMGIMIMAC
Sbjct  371   CGAVYGVIPFVSRRSLGLVSGMTGAGGNVGGGLTQLLFFTSSQYTTGKGLQYMGIMIMAC  430

Query  1445  TLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSER  1624
             TLPV LVHFPQWG M  P S DA   TEE YY +EW EEEK KG+H   LKFAENS SER
Sbjct  431   TLPVILVHFPQWGSMLVPPSADA---TEEEYYAAEWTEEEKGKGLHMAGLKFAENSISER  487

Query  1625  GKR  1633
             G+R
Sbjct  488   GRR  490



>gb|EMT31430.1| Nitrate transporter [Aegilops tauschii]
Length=506

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/483 (69%), Positives = 395/483 (82%), Gaps = 3/483 (1%)
 Frame = +2

Query  185   TDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             T  +  F+LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL+PIIRDN
Sbjct  9     TAASTNFSLPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPLIPIIRDN  68

Query  365   LNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAG  544
             LNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYG AFLIML+AP VFCMS V S  
Sbjct  69    LNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGGAFLIMLSAPAVFCMSVVDSPA  128

Query  545   GYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDI  724
             GY+ VRF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+MP ++D 
Sbjct  129   GYIIVRFLIGVSLATFVSCQYWISTMFNSKIIGTVGGLTAGWGDMGGGATQLIMPFVFDA  188

Query  725   IRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVF  904
             I+  GAT F+AWRIA+F+PG + VVMG+LVLTLGQDLPDGNL +LQK G++NKDKFSKV 
Sbjct  189   IKACGATRFTAWRIAYFVPGMMLVVMGLLVLTLGQDLPDGNLRNLQKNGDMNKDKFSKVL  248

Query  905   WYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVAR  1084
               AVTNYRTWIF  +YGY MGVEL+++NVIA Y++D F L L  AGIIAA FG+AN+ AR
Sbjct  249   RGAVTNYRTWIFVFIYGYCMGVELTSNNVIAGYYYDSFYLDLRKAGIIAACFGLANIFAR  308

Query  1085  PFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAA  1264
             P GG+ SD  A++FGMR RLW +WILQT GG+FC  LGRA+TLP ++  M+++SI  +AA
Sbjct  309   PMGGYLSDLGARYFGMRARLWNIWILQTAGGVFCLCLGRASTLPTSIACMVLYSICVEAA  368

Query  1265  CGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMAC  1444
             CGA +G+ PF+SRRSLG++SG+TGAGGN G GLTQL+FF++S+++T  GL YMGIMIMAC
Sbjct  369   CGAVYGVIPFVSRRSLGLVSGMTGAGGNVGGGLTQLLFFTSSQYTTGKGLQYMGIMIMAC  428

Query  1445  TLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSER  1624
             TLPV LVHFPQWG M  P S DA   TEE YY +EW EEEK KG+H   LKFAENS SER
Sbjct  429   TLPVILVHFPQWGSMLVPPSMDA---TEEEYYAAEWTEEEKGKGLHMAGLKFAENSISER  485

Query  1625  GKR  1633
             G+R
Sbjct  486   GRR  488



>dbj|BAP28462.1| putative high affinity nitrate transporter, partial [Ranunculus 
nipponicus var. submersus]
Length=411

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/410 (81%), Positives = 375/410 (91%), Gaps = 0/410 (0%)
 Frame = +2

Query  239   VFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSG  418
             VFKLFSLANPHMRTFHLSW++FFT FVSTFAAAPLVPIIRDNLNLVK DIGNAG+ASVSG
Sbjct  2     VFKLFSLANPHMRTFHLSWMAFFTTFVSTFAAAPLVPIIRDNLNLVKGDIGNAGIASVSG  61

Query  419   SILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVS  598
             SI SRL MGAVCDLLGPRYGCAFL+ML+AP VF MS VSSAGGYVAVRFMIGFSLATFVS
Sbjct  62    SIFSRLTMGAVCDLLGPRYGCAFLMMLSAPCVFSMSLVSSAGGYVAVRFMIGFSLATFVS  121

Query  599   CQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFI  778
             CQYWMSTMFN KIIGL NGTAAGWGNMGGGATQL+MP+L+++I+K GAT F+AWRIAFFI
Sbjct  122   CQYWMSTMFNGKIIGLVNGTAAGWGNMGGGATQLIMPILFEVIQKCGATQFTAWRIAFFI  181

Query  779   PGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGY  958
             PG +H++ GI+VLTLGQDLPDGNL  LQKKG++ KDKFSKV WY VTNYRTWIF LLYGY
Sbjct  182   PGCMHIITGIMVLTLGQDLPDGNLSRLQKKGDVAKDKFSKVLWYVVTNYRTWIFILLYGY  241

Query  959   SMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRG  1138
             SMGVEL+TDNVI+EY FDRFDLKLHTAG+IAA FGMAN+VARPFGG+ SDY A+ FGMR 
Sbjct  242   SMGVELTTDNVISEYMFDRFDLKLHTAGVIAARFGMANIVARPFGGWMSDYGARRFGMRA  301

Query  1139  RLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGI  1318
             RLW +WILQT+GG+FC  LGRAN+LPL+V  M++FS+ AQAACGATFG+ PFISRRSLGI
Sbjct  302   RLWNVWILQTLGGVFCICLGRANSLPLSVLAMVLFSVCAQAACGATFGVIPFISRRSLGI  361

Query  1319  ISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVH  1468
             ISGLTGAGGNFGSGLTQL+FF++S +STA G++YMGIMI+ CT+PVTLVH
Sbjct  362   ISGLTGAGGNFGSGLTQLLFFTSSSYSTAMGITYMGIMIIGCTIPVTLVH  411



>gb|EMS65038.1| High-affinity nitrate transporter 2.1 [Triticum urartu]
Length=508

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/483 (69%), Positives = 394/483 (82%), Gaps = 3/483 (1%)
 Frame = +2

Query  185   TDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDN  364
             T  +  F+LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL+PIIRDN
Sbjct  11    TAASTNFSLPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPLIPIIRDN  70

Query  365   LNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAG  544
             LNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYG AFLIML+AP VFCMS + S  
Sbjct  71    LNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGGAFLIMLSAPAVFCMSVIDSPA  130

Query  545   GYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDI  724
             GY+ VRF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+MP ++D 
Sbjct  131   GYIIVRFLIGVSLATFVSCQYWISTMFNSKIIGTVGGLTAGWGDMGGGATQLIMPFVFDA  190

Query  725   IRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVF  904
             I+  GAT F+AWRIA+F+PG + VVMG+LVLTLGQDLPDGNL +LQK G++NKDKFSKV 
Sbjct  191   IKACGATRFTAWRIAYFVPGMMLVVMGLLVLTLGQDLPDGNLRNLQKNGDMNKDKFSKVL  250

Query  905   WYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVAR  1084
               AVTNYRTWIF  +YGY MGVEL+++NVIA Y++D F L L  AGIIAA FG+AN+ AR
Sbjct  251   RGAVTNYRTWIFVFIYGYCMGVELTSNNVIAGYYYDSFYLDLRKAGIIAACFGLANIFAR  310

Query  1085  PFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAA  1264
             P GG+ SD  A++FGMR RLW +WILQT GG+FC  LGRA+TLP ++  M+++SI  +AA
Sbjct  311   PMGGYLSDLGARYFGMRARLWNIWILQTAGGVFCLCLGRASTLPTSIACMVLYSICVEAA  370

Query  1265  CGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMAC  1444
             CGA +G+ PF+SRRSLG++SG+TGAGGN G GLTQL+FF++S+++T  GL YMGIMIM C
Sbjct  371   CGAVYGVIPFVSRRSLGLVSGMTGAGGNVGGGLTQLLFFTSSQYTTGKGLQYMGIMIMVC  430

Query  1445  TLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSER  1624
             TLPV LVHFPQWG M  P S DA   TEE YY +EW EEEK KG+H   LKFAENS SER
Sbjct  431   TLPVILVHFPQWGSMLVPPSADA---TEEEYYAAEWTEEEKGKGLHMAGLKFAENSISER  487

Query  1625  GKR  1633
             GKR
Sbjct  488   GKR  490



>gb|EMT29900.1| Nitrate transporter [Aegilops tauschii]
Length=642

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/494 (68%), Positives = 400/494 (81%), Gaps = 3/494 (1%)
 Frame = +2

Query  152   LSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFA  331
             +   V SP         FALPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFA
Sbjct  1     MEMEVGSPAATGAAPINFALPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFA  60

Query  332   AAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPT  511
             AAPL+PIIRDNLNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYGCAFL+ML+AP 
Sbjct  61    AAPLIPIIRDNLNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGCAFLVMLSAPA  120

Query  512   VFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmggga  691
             VFCMS +   GGY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGA
Sbjct  121   VFCMSVIDGPGGYITIRFLIGVSLATFVSCQYWISTMFNSKIIGTVGGLTAGWGDMGGGA  180

Query  692   tQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKG  871
             TQL+MP+++D I   GAT F+AWR+A+F+PG + VVMG+LVLT+GQDLPDGNLGSLQK G
Sbjct  181   TQLIMPLVFDGILACGATRFTAWRLAYFVPGMMLVVMGLLVLTMGQDLPDGNLGSLQKNG  240

Query  872   NINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIA  1051
             ++NKDKFSKV   AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IA
Sbjct  241   DMNKDKFSKVLRGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRAAGTIA  300

Query  1052  ATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTW  1231
             A+FG+AN+ ARP GG+ SD  A +FGMR RLW +WILQT GG+FC  LGRA++LP++VT+
Sbjct  301   ASFGLANIFARPMGGYLSDLGACYFGMRARLWNVWILQTAGGVFCICLGRASSLPISVTF  360

Query  1232  MIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASG  1411
             M+++SI  +AACGA +G+ PFISRRSLG+ISG++GAGGN G GLTQ +FF++S+++T  G
Sbjct  361   MVLYSISVEAACGAVYGVIPFISRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYTTGKG  420

Query  1412  LSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNS  1591
             L YMGIMI+ CTLPVTLVHFPQWG M  P   DA   TEE YY +EW EEEK KG+H   
Sbjct  421   LQYMGIMIIVCTLPVTLVHFPQWGSMLLPPRADA---TEEDYYGAEWTEEEKSKGLHLAG  477

Query  1592  LKFAENSRSERGKR  1633
             +KFAENS SERGKR
Sbjct  478   VKFAENSVSERGKR  491



>gb|EMS46094.1| High-affinity nitrate transporter 2.1 [Triticum urartu]
Length=507

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/484 (69%), Positives = 397/484 (82%), Gaps = 4/484 (1%)
 Frame = +2

Query  185   TDTTA-KFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRD  361
             +DT A +F+LPVDSE+KAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL+PIIRD
Sbjct  9     SDTVAGRFSLPVDSENKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPLIPIIRD  68

Query  362   NLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSA  541
             NLNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYG AFL+ML+AP VFCMS +   
Sbjct  69    NLNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGSAFLVMLSAPAVFCMSIIDGP  128

Query  542   GGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYD  721
              GY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+MP+++D
Sbjct  129   AGYITIRFLIGVSLATFVSCQYWVSTMFNSKIIGTVGGLTAGWGDMGGGATQLIMPLVFD  188

Query  722   IIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKV  901
              I   GATPF+AWRIA+F+PG + VVMG+LVLT+GQDLPDGNL SLQK G++NKDKFS V
Sbjct  189   AIIACGATPFTAWRIAYFVPGLMLVVMGLLVLTMGQDLPDGNLRSLQKNGDMNKDKFSNV  248

Query  902   FWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVA  1081
                AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA FG+AN+ A
Sbjct  249   LRGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRAAGTIAACFGLANIFA  308

Query  1082  RPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQA  1261
             RP GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA++LP ++T M+++SI  +A
Sbjct  309   RPMGGYLSDLGARYFGMRARLWNIWILQTAGGAFCLCLGRASSLPTSITCMVLYSICVEA  368

Query  1262  ACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMA  1441
             ACGA +G+ PFISRRSLG+ISG++GAGGN G GLTQ +FF++S++ST  GL YMGIM+MA
Sbjct  369   ACGAVYGVIPFISRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYSTGKGLQYMGIMVMA  428

Query  1442  CTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSE  1621
             CTLPV LVHFPQWG M  P S +A   TEE YY +EW EEEK KG+H  SLKFAENS SE
Sbjct  429   CTLPVALVHFPQWGSMLLPPSANA---TEEDYYGAEWTEEEKNKGLHIASLKFAENSISE  485

Query  1622  RGKR  1633
             RG+R
Sbjct  486   RGRR  489



>gb|EMT29897.1| Nitrate transporter [Aegilops tauschii]
Length=583

 Score =   668 bits (1723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/489 (67%), Positives = 393/489 (80%), Gaps = 5/489 (1%)
 Frame = +2

Query  167   ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLV  346
             ++P  P      F LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL+
Sbjct  5     STPTTPAPI--NFLLPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPLI  62

Query  347   PIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMS  526
             PIIRDNLNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYGCAFL+ML+AP VFCMS
Sbjct  63    PIIRDNLNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGCAFLVMLSAPAVFCMS  122

Query  527   FVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLM  706
              +    GY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+M
Sbjct  123   VIDGPSGYITIRFLIGVSLATFVSCQYWVSTMFNSKIIGTVGGLTAGWGDMGGGATQLIM  182

Query  707   PVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKD  886
             P+++D I   GATPF+AWR+A+F+PG + VVMG+LVLT+GQDLPDGNL SLQK G++NKD
Sbjct  183   PLVFDAILACGATPFTAWRLAYFVPGMMLVVMGLLVLTMGQDLPDGNLRSLQKNGDMNKD  242

Query  887   KFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGM  1066
             KFS V   AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA FG+
Sbjct  243   KFSNVLRGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRAAGTIAACFGL  302

Query  1067  ANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFS  1246
             AN+ ARP GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA TLP ++T M+++S
Sbjct  303   ANVFARPMGGYLSDLGARYFGMRARLWNIWILQTAGGAFCLCLGRATTLPTSITCMVLYS  362

Query  1247  IGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMG  1426
             I  +AACGA +G+ PF+SRRSLG+ISG++GAGGN G GLTQ +FF++S++ST  GL YMG
Sbjct  363   ICVEAACGAVYGVIPFVSRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYSTGKGLQYMG  422

Query  1427  IMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAE  1606
             IM+MACTLPV LVHFPQWG M  P +  A   TEE YY +EW EEEK KG+H   +KFAE
Sbjct  423   IMVMACTLPVALVHFPQWGSMLLPPTAGA---TEEEYYAAEWTEEEKSKGLHNAGIKFAE  479

Query  1607  NSRSERGKR  1633
             NS SERG+R
Sbjct  480   NSVSERGRR  488



>gb|EMS46098.1| High affinity nitrate transporter 2.4 [Triticum urartu]
Length=585

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/489 (67%), Positives = 395/489 (81%), Gaps = 5/489 (1%)
 Frame = +2

Query  167   ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLV  346
             ++P  P      F LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL+
Sbjct  5     STPTTPAPI--NFLLPVDSEHKAKSIKIFSFGNPHMRAFHLGWMSFFTCVVSTFAAAPLI  62

Query  347   PIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMS  526
             PIIRDNLNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYGCAFL+ML+AP VFCMS
Sbjct  63    PIIRDNLNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGCAFLVMLSAPAVFCMS  122

Query  527   FVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLM  706
              +   GGY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+M
Sbjct  123   VIDGPGGYITIRFLIGVSLATFVSCQYWVSTMFNSKIIGTVGGLTAGWGDMGGGATQLIM  182

Query  707   PVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKD  886
             P+++D I   GATPF+AWR+A+F+PG + VVMG+LVLT+GQDLPDGNL SLQK G++NKD
Sbjct  183   PLVFDAILACGATPFTAWRLAYFVPGMMLVVMGLLVLTMGQDLPDGNLRSLQKNGDMNKD  242

Query  887   KFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGM  1066
             KFS V   AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA FG+
Sbjct  243   KFSNVLRGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRVAGTIAACFGL  302

Query  1067  ANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFS  1246
             AN+ ARP GG+ SD  A++FGMR RLW +WILQT GG FC  LGRA++LP ++T M+++S
Sbjct  303   ANVFARPMGGYLSDLGARYFGMRARLWNIWILQTAGGAFCLCLGRASSLPTSITCMVLYS  362

Query  1247  IGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMG  1426
             I  +AACGA +G+ PF+SRRSLG+ISG++GAGGN G GLTQ +FF++S++ST  GL YMG
Sbjct  363   ICVEAACGAVYGVIPFVSRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYSTGKGLQYMG  422

Query  1427  IMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAE  1606
             IM+MACTLPV LVHFPQWG M  P +  A   TEE YY +EW EEEK KG+H   +KFAE
Sbjct  423   IMVMACTLPVALVHFPQWGSMLLPPTAGA---TEEDYYAAEWTEEEKSKGLHNAGIKFAE  479

Query  1607  NSRSERGKR  1633
             NS SERG+R
Sbjct  480   NSVSERGRR  488



>gb|EYU21097.1| hypothetical protein MIMGU_mgv1a0054572mg, partial [Erythranthe 
guttata]
Length=373

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/373 (88%), Positives = 353/373 (95%), Gaps = 0/373 (0%)
 Frame = +2

Query  98    IEGSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMR  277
             +EGSPG+SMHGVTGREPVL+F+VASP+VPTD TA F LPVDSEHKAK FKLFSLANPHMR
Sbjct  1     MEGSPGTSMHGVTGREPVLAFSVASPMVPTDKTAHFDLPVDSEHKAKKFKLFSLANPHMR  60

Query  278   TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCD  457
             TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNL K DIGNAGVASVSGSI SRLVMGAVCD
Sbjct  61    TFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLTKGDIGNAGVASVSGSIFSRLVMGAVCD  120

Query  458   LLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKI  637
             LLGPRYGCAFL+M+TAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS+I
Sbjct  121   LLGPRYGCAFLVMMTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSQI  180

Query  638   IGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVL  817
             IGL NGTAAGWGNMGGGATQLLMP+L++II+ AGATPF+AWRIAFFIPGWLH++MG+LVL
Sbjct  181   IGLVNGTAAGWGNMGGGATQLLMPLLFEIIKSAGATPFTAWRIAFFIPGWLHIIMGLLVL  240

Query  818   TLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIA  997
             TLGQDLPDGNL +LQKKG + KDKF KV WYAVTNYRTWIF LLYGYSMGVELSTDNVIA
Sbjct  241   TLGQDLPDGNLSTLQKKGEVAKDKFGKVLWYAVTNYRTWIFVLLYGYSMGVELSTDNVIA  300

Query  998   EYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGG  1177
             EYF+DRFDLKLHTAG+IAATFGMANL+ARPFGGFASDY A+ FGMRGRLWTLW LQTMGG
Sbjct  301   EYFYDRFDLKLHTAGVIAATFGMANLLARPFGGFASDYMARHFGMRGRLWTLWTLQTMGG  360

Query  1178  LFCFLLGRANTLP  1216
             +FC LLGRA +LP
Sbjct  361   VFCILLGRATSLP  373



>gb|EMS46097.1| High affinity nitrate transporter 2.4 [Triticum urartu]
Length=572

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/489 (67%), Positives = 391/489 (80%), Gaps = 5/489 (1%)
 Frame = +2

Query  167   ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLV  346
             ++P  P      F LPVDSEHKAK  K+FS  NPHMR FHL W+SFFTC VSTFAAAPL+
Sbjct  5     STPTTPAPI--NFLLPVDSEHKAKSIKIFSFGNPHMRVFHLGWMSFFTCVVSTFAAAPLI  62

Query  347   PIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMS  526
             PIIRDNLNL K+DIGNAGVASVSG+I SRL MGA+CDLLGPRYGCAFL+ML+AP VFCMS
Sbjct  63    PIIRDNLNLTKADIGNAGVASVSGAIFSRLAMGAICDLLGPRYGCAFLVMLSAPAVFCMS  122

Query  527   FVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLM  706
              +    GY+ +RF+IG SLATFVSCQYW+STMFNSKIIG   G  AGWG+MGGGATQL+M
Sbjct  123   VIDGPSGYITIRFLIGVSLATFVSCQYWVSTMFNSKIIGTVGGLTAGWGDMGGGATQLIM  182

Query  707   PVLYDIIRKAGATPFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKD  886
             P+++D I   GATPF AWR+A+F+PG + VVMG+LVLT+GQDLPDGNL SLQK GN+NKD
Sbjct  183   PLVFDAILACGATPFMAWRLAYFVPGMMLVVMGLLVLTMGQDLPDGNLRSLQKNGNMNKD  242

Query  887   KFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGM  1066
             KFS V   AVTNYRTWIF  +YGY MGVEL+T+NVIAEY++D F L L  AG IAA FG+
Sbjct  243   KFSNVLCGAVTNYRTWIFVFIYGYCMGVELTTNNVIAEYYYDSFHLDLRVAGTIAACFGL  302

Query  1067  ANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFS  1246
             AN+ ARP GG+ SD  A++FGMR RLW +WILQT GG FC  LG A TLP ++T M+++S
Sbjct  303   ANVFARPMGGYLSDLGARYFGMRARLWNIWILQTAGGAFCLCLGSATTLPTSITCMVLYS  362

Query  1247  IGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMG  1426
             I  +AACGA +G+ PF+SRRSLG+ISG++GAGGN G GLTQ +FF++S++ST  GL YMG
Sbjct  363   IYVEAACGAVYGVIPFVSRRSLGLISGMSGAGGNVGGGLTQFLFFTSSQYSTGKGLQYMG  422

Query  1427  IMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAE  1606
             IM+MACTLPV LVHFPQWG M  P +  A   TEE YY +EW EEEK KG+H   +KFAE
Sbjct  423   IMVMACTLPVALVHFPQWGSMLLPPTTGA---TEEEYYAAEWTEEEKSKGLHNAIIKFAE  479

Query  1607  NSRSERGKR  1633
             NS SERG+R
Sbjct  480   NSVSERGRR  488



>gb|EPS65539.1| high-affinity nitrate transporter, partial [Genlisea aurea]
Length=426

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/416 (75%), Positives = 371/416 (89%), Gaps = 0/416 (0%)
 Frame = +2

Query  386   IGNAGVASVSGSILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRF  565
             +GNAGVASVSGSI SRLVMGAVCDL+GPRYGCAFL+ML AP+VFCMS V+S+GG+VA+RF
Sbjct  1     LGNAGVASVSGSIFSRLVMGAVCDLIGPRYGCAFLLMLAAPSVFCMSLVTSSGGFVAMRF  60

Query  566   MIGFSLATFVSCQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGAT  745
             MIGFSLATFVSCQYWMSTMFN KIIG  NGTAAGWGNMGGG TQL+MP+++  I + G+ 
Sbjct  61    MIGFSLATFVSCQYWMSTMFNGKIIGAVNGTAAGWGNMGGGFTQLIMPLIFQAIMRIGSP  120

Query  746   PFSAWRIAFFIPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNY  925
              F+AWRIAFF+PG +H+VMGILV+ LGQDLPDGNL  LQKKG++ KDKFSKV W+ VTNY
Sbjct  121   RFTAWRIAFFVPGCVHIVMGILVMILGQDLPDGNLTQLQKKGHVAKDKFSKVLWHGVTNY  180

Query  926   RTWIFALLYGYSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFAS  1105
             RTWIF L+YGYSMGVEL+TDNVIAEYF+D+F+L LH+AGI+AATFGM N+VARP GG  S
Sbjct  181   RTWIFVLVYGYSMGVELTTDNVIAEYFYDKFNLNLHSAGIVAATFGMTNIVARPVGGIIS  240

Query  1106  DYAAKFFGMRGRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGI  1285
             D  A+ +GMRGRLWTLWILQT+GG+FC LLGR+++LP AV +MI+FS+GAQ+ACGATFGI
Sbjct  241   DATARRYGMRGRLWTLWILQTLGGVFCLLLGRSSSLPTAVAFMILFSMGAQSACGATFGI  300

Query  1286  TPFISRRSLGIISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLV  1465
              PF+SRRSLG ISG+TGAGGNFGSGLTQL+FF++S++ST +G++ MGIMI+ACT+PVTLV
Sbjct  301   IPFVSRRSLGAISGMTGAGGNFGSGLTQLLFFTSSRYSTEAGITSMGIMIVACTVPVTLV  360

Query  1466  HFPQWGGMFFPASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             HFPQWG MF P S D ++ TEEHYY SE++E+EK+KGMH +SLKFAENSRSERG R
Sbjct  361   HFPQWGSMFLPPSGDGLKATEEHYYSSEYSEDEKKKGMHVHSLKFAENSRSERGSR  416



>ref|XP_001785194.1| predicted protein [Physcomitrella patens]
 dbj|BAD00100.1| nitrate transporter [Physcomitrella patens]
 dbj|BAE45928.1| nitrate transporter [Physcomitrella patens]
 gb|EDQ50004.1| predicted protein [Physcomitrella patens]
Length=548

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/516 (62%), Positives = 402/516 (78%), Gaps = 7/516 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAV--ASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANP  268
             + +G PG+SMHGVTG+EPV +F+V  A+   P    AKFALPVDSEHKA   +++S   P
Sbjct  13    NAKGDPGTSMHGVTGKEPVYAFSVLQAAKAKPDPDAAKFALPVDSEHKATTMRIYSFRAP  72

Query  269   HMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGA  448
             HM TFHLSW SFFTCF+STFAA PL+P+IRDNLNL K DIG+A +ASVSGSILSRL+MG+
Sbjct  73    HMLTFHLSWFSFFTCFLSTFAAPPLIPVIRDNLNLDKGDIGHAAIASVSGSILSRLLMGS  132

Query  449   VCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFN  628
             +CDL+GPRYGCAFL+M+ +P V+ M+ V +A G+ AVRF IGFSLATFVSCQYWMS+MFN
Sbjct  133   ICDLIGPRYGCAFLVMIISPAVYAMASVETAAGFTAVRFFIGFSLATFVSCQYWMSSMFN  192

Query  629   SKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATP-FSAWRIAFFIPGWLHVVMG  805
              KI+G ANG AAGWGN+GGGATQL+MP++Y +I+ +  +P F+AWR+AFF+PG +H  +G
Sbjct  193   GKIVGTANGIAAGWGNLGGGATQLIMPLVYALIKDSFKSPSFTAWRLAFFLPGVMHTTIG  252

Query  806   ILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTD  985
             ++VL LGQDLPDGN   L+ +G   KD F KVF  AVTNYRTWI  + YGY  GVEL+ D
Sbjct  253   LMVLFLGQDLPDGNFKELEAQGTKAKDSFRKVFVNAVTNYRTWILLITYGYCFGVELTVD  312

Query  986   NVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQ  1165
             N+IAEYF DRF+L L +AGIIA++FG  N+V+RP GG  SD  A  FGMRGRLW LWI+Q
Sbjct  313   NIIAEYFHDRFNLSLSSAGIIASSFGFMNIVSRPLGGILSDIVAVRFGMRGRLWNLWIIQ  372

Query  1166  TMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGG  1345
             T+GG+FC +LG+   L  A+  MI+FS   QAACGATFG+ PF+SRRSLG+ISG TGAGG
Sbjct  373   TLGGVFCIILGKTAALGPAIGVMIVFSFFVQAACGATFGVIPFVSRRSLGVISGFTGAGG  432

Query  1346  NFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGT  1525
             N G+ +TQ IFF+ + + T  G+ YMGIMI+  T  V  V FPQWGGM FP+SK     +
Sbjct  433   NLGAVMTQTIFFTQATYHTEVGIEYMGIMIICVTALVLFVWFPQWGGMVFPSSKM----S  488

Query  1526  EEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             EE YY SE++E E+ +GMH+ S+KFAENS+SERG+R
Sbjct  489   EEDYYASEYSEGEQDQGMHEASMKFAENSKSERGRR  524



>emb|CDY50324.1| BnaA10g13570D [Brassica napus]
Length=480

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/519 (63%), Positives = 388/519 (75%), Gaps = 59/519 (11%)
 Frame = +2

Query  86    LMADIEGSPGSSMHGVTGREPVLSFAV--ASPIVPT-DTTAKFALPVDSEHKAKVFKLFS  256
             + ++ EGS G+S+HGVT +E V SF+   +S +VP+ D T+KFALPVDSEH+AKVF   S
Sbjct  1     MASNEEGSIGTSLHGVTAKEHVFSFSADASSQVVPSNDPTSKFALPVDSEHRAKVFNPLS  60

Query  257   LANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRL  436
              A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL
Sbjct  61    FAKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRL  120

Query  437   VMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMS  616
              MGAVCDLLG R                                                
Sbjct  121   AMGAVCDLLGAR------------------------------------------------  132

Query  617   TMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHV  796
              MFN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRI+FF+PG+L V
Sbjct  133   VMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFMAWRISFFVPGFLQV  192

Query  797   VMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVEL  976
             VMGILVLT GQDLPDGNL +LQK G        +VFW+AV NYRTWI  +LYG+SMG+EL
Sbjct  193   VMGILVLTFGQDLPDGNLSTLQKSG--------QVFWFAVKNYRTWILFVLYGFSMGIEL  244

Query  977   STDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLW  1156
             + +NVI+ YFFDRF+LKL TAGI+AA+FGMAN  ARPFGG+ASD AA+ FGMRGRLW LW
Sbjct  245   TINNVISGYFFDRFNLKLQTAGIVAASFGMANFFARPFGGYASDVAARLFGMRGRLWILW  304

Query  1157  ILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTG  1336
             I QT+G LFC  LGRAN+LP+AV  MI+FSIG QAACGA FG+ PF+SRRSLG+ISGLTG
Sbjct  305   IFQTVGALFCIWLGRANSLPIAVLAMILFSIGTQAACGALFGVAPFVSRRSLGLISGLTG  364

Query  1337  AGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAV  1516
             AGGNFGSGLTQL+FFSTS+FSTA GLS MG M + CTLPV  +HFPQWG MF   S+D  
Sbjct  365   AGGNFGSGLTQLLFFSTSRFSTAEGLSLMGAMAVLCTLPVAFIHFPQWGSMFLRPSRDGE  424

Query  1517  RGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             R  EE+YY SEW E+EK++G+H+ S+KFAENSRSER ++
Sbjct  425   RSKEEYYYSSEWTEDEKRQGLHEGSIKFAENSRSERSRK  463



>ref|XP_001768210.1| nitrate transporter [Physcomitrella patens]
 dbj|BAD00097.1| nitrate transporter [Physcomitrella patens]
 dbj|BAE45925.1| nitrate transporter [Physcomitrella patens]
 gb|EDQ67083.1| nitrate transporter [Physcomitrella patens]
Length=548

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/525 (61%), Positives = 406/525 (77%), Gaps = 9/525 (2%)
 Frame = +2

Query  71    DNSKTLMAD--IEGSPGSSMHGVTGREPVLSFAV--ASPIVPTDTTAKFALPVDSEHKAK  238
             D S + + D   +G PGSSMHGVTG+E + +F++     +       KFALPVDSEHKA 
Sbjct  3     DQSSSAVGDRNAKGDPGSSMHGVTGKEALYAFSLHEGDKMNHDPDAKKFALPVDSEHKAT  62

Query  239   VFKLFSLANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSG  418
               +++S A PHM TFHLSW SFFTCF+STFAA PL+P+IRDNLNL K DIG+A +ASVSG
Sbjct  63    TMRIYSFARPHMLTFHLSWFSFFTCFLSTFAAPPLIPVIRDNLNLTKEDIGHAAIASVSG  122

Query  419   SILSRLVMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVS  598
             SILSRL+MG++CDL+GPRYGCAFL+M+ +P V+ M+ V +A G+ AVRF IGFSLATFVS
Sbjct  123   SILSRLLMGSICDLIGPRYGCAFLVMIISPAVYAMASVETAAGFTAVRFFIGFSLATFVS  182

Query  599   CQYWMSTMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATP-FSAWRIAFF  775
             CQYWMS+MFN KI+G ANG AAGWGN+GGGATQL+MP++Y +I+ +  +P ++AWR++FF
Sbjct  183   CQYWMSSMFNGKIVGTANGIAAGWGNLGGGATQLIMPLVYALIKDSFKSPSYTAWRLSFF  242

Query  776   IPGWLHVVMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYG  955
             +PG +H V+G++VL LGQDLPDGN   LQ++G   KD F KVF+ AVTNYRTWIF + YG
Sbjct  243   LPGVMHTVIGLMVLFLGQDLPDGNFKELQEQGTKVKDSFRKVFFNAVTNYRTWIFLITYG  302

Query  956   YSMGVELSTDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMR  1135
             Y  GVEL+ DN+IAEYF+DRF L L +AGIIA++FG  N+V+RP GG  SD  A+ +GM+
Sbjct  303   YCFGVELTVDNIIAEYFYDRFGLSLSSAGIIASSFGFMNIVSRPLGGILSDVVARRYGMQ  362

Query  1136  GRLWTLWILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLG  1315
             GRLW LWI+QT+GG+FC +LG+   L  A+  MI+FS   QAACGATFG+ PF+SRRSLG
Sbjct  363   GRLWNLWIIQTLGGVFCIVLGKTAALGPAIGVMIVFSFFVQAACGATFGVIPFVSRRSLG  422

Query  1316  IISGLTGAGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFF  1495
             +ISG TGAGGN G+ LTQ IFF+ + + T  G+  MGIMI+ CT  V  V FPQWG MFF
Sbjct  423   VISGFTGAGGNVGAVLTQTIFFTQATYHTEVGIENMGIMIICCTALVLFVWFPQWGSMFF  482

Query  1496  PASKDAVRGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGK  1630
              +S    R TEE YY SE++E E+ +G+HQ SLKFAEN++SERG+
Sbjct  483   KSS----RMTEEDYYASEYSEGEQDQGLHQASLKFAENAKSERGR  523



>ref|XP_001768212.1| nitrate transporter [Physcomitrella patens]
 dbj|BAD00098.1| nitrate transporter [Physcomitrella patens]
 dbj|BAE45926.1| nitrate transporter [Physcomitrella patens]
 gb|EDQ67085.1| nitrate transporter [Physcomitrella patens]
Length=547

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/514 (61%), Positives = 402/514 (78%), Gaps = 6/514 (1%)
 Frame = +2

Query  95    DIEGSPGSSMHGVTGREPVLSFAVAS-PIVPTDTTAKFALPVDSEHKAKVFKLFSLANPH  271
             + +G PGSSMHGVTG+E + +F++     +  D  AKFALPVDSEHKA   ++ S + PH
Sbjct  13    NAKGDPGSSMHGVTGKEALYAFSLHDGDKMNYDPDAKFALPVDSEHKATTMRIHSFSRPH  72

Query  272   MRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAV  451
             M TFHLSW SFFTCF+STFAA PL+P+IRDNLNL K DIG+A +ASV+GSILSRL+MG++
Sbjct  73    MLTFHLSWFSFFTCFMSTFAAPPLIPVIRDNLNLNKEDIGHAAIASVTGSILSRLLMGSL  132

Query  452   CDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNS  631
             CD++GPRYGCAFL+M+ +P V+ M+ V SA G+ AVRF +GFSLATFVSCQYWMS+MFN 
Sbjct  133   CDMIGPRYGCAFLVMIISPAVYAMAVVDSAAGFTAVRFFVGFSLATFVSCQYWMSSMFNG  192

Query  632   KIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATP-FSAWRIAFFIPGWLHVVMGI  808
             KI+G ANG AAGWGN+GGGATQ++MP++Y +I+ +  +P ++AWR+AFF+PG +H V+G+
Sbjct  193   KIVGTANGIAAGWGNLGGGATQMIMPLVYALIKDSFHSPSYTAWRLAFFLPGVMHTVIGL  252

Query  809   LVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDN  988
             LVL LGQDLPDGN   LQ++G   KD F KVF  A+TNYRTWIF + YGY  GVEL+ DN
Sbjct  253   LVLFLGQDLPDGNFKELQEQGTKPKDSFKKVFINAITNYRTWIFLITYGYCFGVELTVDN  312

Query  989   VIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQT  1168
             +IAEYF+DRF L L TAGIIA++FG+ N+ +RP GG  SD  A+ +GM+GRLW LWI+QT
Sbjct  313   IIAEYFYDRFGLSLSTAGIIASSFGLMNIFSRPLGGILSDVVARRYGMQGRLWNLWIIQT  372

Query  1169  MGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGN  1348
             +GG+FC +LG+   L  A+  MI+FS   QAACGATFG+ PF+SRRSLG+ISG TGAGGN
Sbjct  373   LGGVFCIVLGKTAALGPAIGVMIVFSFFVQAACGATFGVIPFVSRRSLGVISGFTGAGGN  432

Query  1349  FGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAVRGTE  1528
              G+ LTQ IFF+ + + T  G+  MGIMI+ CT  V  V FPQWG MFF +S    R TE
Sbjct  433   VGAVLTQTIFFTQATYHTEVGIENMGIMIICCTALVLFVWFPQWGSMFFKSS----RMTE  488

Query  1529  EHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGK  1630
             E YY SE++E E+ +G+HQ SLKFAEN++SERG+
Sbjct  489   EDYYASEYSEGEQDQGLHQASLKFAENAKSERGR  522



>emb|CDY69111.1| BnaC09g54030D [Brassica napus]
Length=480

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/519 (63%), Positives = 385/519 (74%), Gaps = 59/519 (11%)
 Frame = +2

Query  86    LMADIEGSPGSSMHGVTGREPVLSFAV--ASPIVPT-DTTAKFALPVDSEHKAKVFKLFS  256
             + ++ EGS G+S+HGVT +E V SF+   +S +VP+ D T+KFALPVDSEH+AKVF   S
Sbjct  1     MASNEEGSIGTSLHGVTAKEHVFSFSADASSQVVPSNDPTSKFALPVDSEHRAKVFNPLS  60

Query  257   LANPHMRTFHLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRL  436
              A PHMR FHL WISFFTCF+STFAAAPLVPIIRDNL+L K+DIGNAGVASVSG+I SRL
Sbjct  61    FAKPHMRAFHLGWISFFTCFISTFAAAPLVPIIRDNLDLTKTDIGNAGVASVSGAIFSRL  120

Query  437   VMGAVCDLLGPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMS  616
              MGAVCDLLG R                                                
Sbjct  121   AMGAVCDLLGAR------------------------------------------------  132

Query  617   TMFNSKIIGLangtaagwgnmgggatQLLMPVLYDIIRKAGATPFSAWRIAFFIPGWLHV  796
              MFN KIIGL NG A GWG+MGGG TQLLMP+++ +I+ AGATPF AWRI+FF+PG+L V
Sbjct  133   VMFNGKIIGLVNGCAGGWGDMGGGVTQLLMPMVFHVIKLAGATPFMAWRISFFVPGFLQV  192

Query  797   VMGILVLTLGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVEL  976
             VMGILVLT GQDLPDGNL +LQK G        +VFW+AV NYRTWI  +LYG+SMG+EL
Sbjct  193   VMGILVLTFGQDLPDGNLSTLQKSG--------QVFWFAVKNYRTWILFVLYGFSMGIEL  244

Query  977   STDNVIAEYFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLW  1156
             + +NVI+ YFFDRF+LKL TAGI+AA+FGMAN  +RPFGG+ASD AA+ FGMRGRLW LW
Sbjct  245   TINNVISGYFFDRFNLKLQTAGIVAASFGMANFFSRPFGGYASDVAARLFGMRGRLWILW  304

Query  1157  ILQTMGGLFCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTG  1336
             I QT+G LFC  LGRAN+LP+A+  MI+FSIG QAACGA F + PF+SRRSLG+ISGLTG
Sbjct  305   IFQTVGALFCIWLGRANSLPIAILAMILFSIGTQAACGAFFEVAPFVSRRSLGLISGLTG  364

Query  1337  AGGNFGSGLTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFFPASKDAV  1516
             AGGNFGSG TQL+FFSTS+FSTA GLS MG M + CTLPV  +HFPQWG MF   S D  
Sbjct  365   AGGNFGSGSTQLLFFSTSRFSTAEGLSLMGAMAVLCTLPVAFIHFPQWGSMFLRPSSDGE  424

Query  1517  RGTEEHYYCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             R  EE+YY SEW E+EKQ+G+H+ S+KFAENSRSER ++
Sbjct  425   RSKEEYYYSSEWTEDEKQQGLHEGSIKFAENSRSERSRK  463



>ref|XP_006841012.1| hypothetical protein AMTR_s00085p00099220 [Amborella trichopoda]
 gb|ERN02687.1| hypothetical protein AMTR_s00085p00099220 [Amborella trichopoda]
Length=529

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/512 (66%), Positives = 416/512 (81%), Gaps = 7/512 (1%)
 Frame = +2

Query  104   GSPGSSMHGVTGREPVLSFAVASPIVPTDTTAKFALPVDSEHKAKVFKLFSLANPHMRTF  283
             G  G+S+HG+TG+EPV + +  +    +   + F+LPVDSEHKAKVFKLFS++ PHMR+F
Sbjct  7     GQLGTSVHGLTGKEPVYAMSSPNQ---SSPPSPFSLPVDSEHKAKVFKLFSVSQPHMRSF  63

Query  284   HLSWISFFTCFVSTFAAAPLVPIIRDNLNLVKSDIGNAGVASVSGSILSRLVMGAVCDLL  463
             HLSW SFF+CF+STFAA PL+PIIRDNL L K DIGNA +ASVSG+I SR+ MGA+CDL+
Sbjct  64    HLSWFSFFSCFISTFAAPPLIPIIRDNLGLTKHDIGNASIASVSGAIFSRIAMGAICDLV  123

Query  464   GPRYGCAFLIMLTAPTVFCMSFVSSAGGYVAVRFMIGFSLATFVSCQYWMSTMFNSKIIG  643
             GPRYGCA L MLTAP VF MS V+SA G++ VRF IGFSLATFVSCQ+WMS+MF ++I+G
Sbjct  124   GPRYGCACLTMLTAPAVFFMSIVTSAHGFIIVRFFIGFSLATFVSCQFWMSSMFTTRIVG  183

Query  644   LangtaagwgnmgggatQLLMPVLYDIIRKA-GATPFSAWRIAFFIPGWLHVVMGILVLT  820
             LANG A GWGN+GGGATQL+MP++YD+I K  GATPF+AWR+AFF+PG +  +MG+ VL 
Sbjct  184   LANGLAGGWGNLGGGATQLIMPLVYDLIHKGIGATPFTAWRLAFFVPGTIQTLMGLSVLL  243

Query  821   LGQDLPDGNLGSLQKKGNINKDKFSKVFWYAVTNYRTWIFALLYGYSMGVELSTDNVIAE  1000
             LGQDLPDGN  +L+KKG+  KD FSKVF++AVTNYR WI AL YGY  GVEL+ DN++AE
Sbjct  244   LGQDLPDGNYAALKKKGDKVKDDFSKVFYHAVTNYRAWILALTYGYCFGVELTVDNIVAE  303

Query  1001  YFFDRFDLKLHTAGIIAATFGMANLVARPFGGFASDYAAKFFGMRGRLWTLWILQTMGGL  1180
             YF+DRFDL+LHTAGIIAATFG+AN+V+RPFGG  SD  AK +GMRGRLW LW +QT+GGL
Sbjct  304   YFYDRFDLQLHTAGIIAATFGLANIVSRPFGGVLSDMLAKRYGMRGRLWGLWAVQTIGGL  363

Query  1181  FCFLLGRANTLPLAVTWMIIFSIGAQAACGATFGITPFISRRSLGIISGLTGAGGNFGSG  1360
              C LLGR ++L  ++T M++FS   QAACG TFGI PFISRRSLGIISG+TG GGN G+ 
Sbjct  364   LCVLLGRVSSLGSSITVMVVFSFFVQAACGLTFGIVPFISRRSLGIISGMTGGGGNVGAV  423

Query  1361  LTQLIFFSTSKFSTASGLSYMGIMIMACTLPVTLVHFPQWGGMFF-PASKDAVRGTEEHY  1537
             LT LIFF+ S +S   G++ MG+MI+ACTLP+ L++FPQWGGM   P+ K+    TEE Y
Sbjct  424   LTTLIFFTNSSYSKERGITLMGVMILACTLPIWLIYFPQWGGMARSPSPKEG--ATEEGY  481

Query  1538  YCSEWNEEEKQKGMHQNSLKFAENSRSERGKR  1633
             Y  EWN +EK+KG H+ SLKFA+NS+SERGKR
Sbjct  482   YMGEWNSKEKEKGYHEASLKFADNSKSERGKR  513



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6009920009892