BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25873_g4_i11 len=884 path=[1416:0-62 28178:63-79 1496:80-97
1514:98-209 28351:210-251 19980:252-297 21393:298-395 27867:396-399
93:400-883]

Length=884
                                                                      Score     E

dbj|BAF64710.1|  putative transposase                                 74.7    9e-12   Ipomoea tricolor [campanilla]
ref|XP_009804787.1|  PREDICTED: uncharacterized protein LOC104249953  55.1    2e-05   
ref|XP_009759827.1|  PREDICTED: uncharacterized protein LOC104212304  54.3    6e-05   



>dbj|BAF64710.1| putative transposase [Ipomoea tricolor]
Length=517

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -3

Query  273  YDDTKLYLNASYQEVDDFRSKISDVHSPMKSLSTATVLSQSIGISEFTSGAVSVTSVGGL  94
            +D T++++N+ + E  +FR ++    +PM+S+ + + +S      +F+SG ++V ++  +
Sbjct  225  FDVTQIWVNSDFPEFQEFRDRLKGEQTPMRSIVSMSNMSYGSAFEDFSSGQMNVFTISEI  284

Query  93   LKIKEDGEFYVPAEIVGIESSFGWMYISCMS  1
             + KE G+F+V A+IVGIESS+ W Y+SC S
Sbjct  285  YQKKEYGDFWVAAKIVGIESSWDWFYVSCKS  315



>ref|XP_009804787.1| PREDICTED: uncharacterized protein LOC104249953 [Nicotiana sylvestris]
Length=249

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = -3

Query  273  YDDTKLYLNASYQEVDDFRSKISDVHSPMKSLSTATVLSQSIGIS-EFTSGAVSVTSVGG  97
            ++ +KL++N ++ + D+F++++  V        T T+  QS  +S E   G V V ++G 
Sbjct  146  WNASKLWINPNFPQSDEFKTRLLSVRDNNSERLTQTISQQSYSVSDELEKGIVQVKTIGQ  205

Query  96   LLKIKEDGEFYVPAEIVGIESSFGWMYISC  7
            L++  ++G  ++ A I  +E   GW Y+SC
Sbjct  206  LVESMQEGPCWIVASIENLELEKGWSYVSC  235



>ref|XP_009759827.1| PREDICTED: uncharacterized protein LOC104212304 [Nicotiana sylvestris]
Length=639

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/90 (29%), Positives = 51/90 (57%), Gaps = 1/90 (1%)
 Frame = -3

Query  273  YDDTKLYLNASYQEVDDFRSKISDVHSPMKSLSTATVLSQSIGIS-EFTSGAVSVTSVGG  97
            ++ +KL++N ++ + D+F++++  V        T T+  QS  +S E   G V V ++G 
Sbjct  226  WNASKLWINPNFPQSDEFKTRLLSVRDNNSERLTQTISQQSYPVSDELEKGIVQVKTIGQ  285

Query  96   LLKIKEDGEFYVPAEIVGIESSFGWMYISC  7
            L++  ++G  ++ A I  +E   GW Y+SC
Sbjct  286  LVESMQEGPCWIVASIENLELEKGWSYVSC  315



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1798677760698