BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25871_g3_i3 len=2147 path=[3557:0-75 3633:76-114 2615:115-131
2632:132-152 18449:153-160 17158:161-245 3801:246-277 1586:278-303
3857:304-410 3963:411-446 2068:447-484 16916:485-511 4063:512-587
4139:588-614 18666:615-627 2255:628-729 2357:730-774 863:775-1104
1193:1105-1131 9421:1132-1169 9459:1170-1195 12050:1196-1333
12188:1334-1511 12366:1512-1583 12438:1584-2146]

Length=2147
                                                                      Score     E

ref|XP_009628381.1|  PREDICTED: polyphenol oxidase E, chloroplast...    590   0.0      
ref|XP_009603530.1|  PREDICTED: polyphenol oxidase E, chloroplast...    583   0.0      
gb|AEO00529.1|  polyphenol oxidase                                      563   0.0      
emb|CAA73103.1|  polyphenol oxidase                                     562   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009767375.1|  PREDICTED: polyphenol oxidase E, chloroplast...    559   0.0      
sp|Q08296.1|PPOF_SOLLC  RecName: Full=Polyphenol oxidase F, chlor...    558   0.0      Solanum lycopersicum
sp|Q06355.1|PPOB_SOLTU  RecName: Full=Catechol oxidase B, chlorop...    558   0.0      Solanum tuberosum [potatoes]
ref|XP_004246033.1|  PREDICTED: polyphenol oxidase F, chloroplastic     556   0.0      
ref|XP_010325653.1|  PREDICTED: polyphenol oxidase E, chloroplastic     556   0.0      
gb|AGK83468.1|  polyphenol oxidase                                      556   0.0      
sp|Q08307.1|PPOE_SOLLC  RecName: Full=Polyphenol oxidase E, chlor...    555   0.0      Solanum lycopersicum
ref|XP_009590067.1|  PREDICTED: polyphenol oxidase E, chloroplast...    553   0.0      
gb|AAA02877.1|  propolyphenol oxidase                                   552   0.0      Solanum tuberosum [potatoes]
ref|XP_004246041.1|  PREDICTED: polyphenol oxidase E, chloroplast...    552   0.0      
ref|XP_006365391.1|  PREDICTED: polyphenol oxidase E, chloroplast...    551   0.0      
gb|ABE96885.1|  polyphenol oxidase                                      548   0.0      Nicotiana tabacum [American tobacco]
gb|AAB22610.1|  polyphenoloxidase                                       549   0.0      Solanum lycopersicum
ref|XP_006355239.1|  PREDICTED: catechol oxidase B, chloroplastic       547   0.0      
ref|XP_009791071.1|  PREDICTED: polyphenol oxidase E, chloroplast...    543   0.0      
gb|ADY18412.1|  chloroplast polyphenol oxidase precursor                541   0.0      
ref|XP_009624738.1|  PREDICTED: polyphenol oxidase E, chloroplast...    541   1e-180   
gb|ADY18410.1|  chloroplast polyphenol oxidase precursor                534   3e-178   
gb|AAA85122.1|  polyphenol oxidase                                      533   6e-178   Solanum tuberosum [potatoes]
gb|ACN78382.1|  polyphenol oxidase                                      522   3e-175   Solanum quitoense [lulo]
ref|XP_004246032.1|  PREDICTED: polyphenol oxidase B, chloroplastic     523   7e-174   
ref|XP_009616674.1|  PREDICTED: polyphenol oxidase E, chloroplast...    522   1e-173   
ref|XP_009771442.1|  PREDICTED: polyphenol oxidase E, chloroplast...    522   2e-173   
gb|ADY18411.1|  chloroplast polyphenol oxidase precursor                520   7e-173   
ref|XP_009588337.1|  PREDICTED: polyphenol oxidase E, chloroplast...    520   1e-172   
gb|AFJ79639.1|  chloroplast polyphenol oxidase                          518   4e-172   
gb|AFJ79641.1|  chloroplast polyphenol oxidase                          518   8e-172   
gb|AFJ79643.1|  chloroplast polyphenol oxidase                          518   9e-172   
gb|AFJ79640.1|  chloroplast polyphenol oxidase                          515   1e-170   
gb|ACT22523.1|  chloroplast polyphenol oxidase precursor                512   1e-169   Solanum melongena [aubergine]
ref|XP_006365382.1|  PREDICTED: polyphenol oxidase B, chloroplast...    508   5e-168   
ref|XP_006365383.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    506   6e-167   
ref|XP_004246030.1|  PREDICTED: polyphenol oxidase D, chloroplastic     502   1e-165   
pir||S34786  catechol oxidase (EC 1.10.3.1) precursor - potato (f...    497   5e-164
gb|AAA85121.1|  polyphenol oxidase                                      498   6e-164   Solanum tuberosum [potatoes]
gb|ADG56700.1|  chloroplast polyphenol oxidase precursor                494   2e-162   
ref|XP_004246029.2|  PREDICTED: polyphenol oxidase A, chloroplast...    489   1e-160   
gb|ADY18409.1|  chloroplast polyphenol oxidase precursor                489   1e-160   
ref|XP_004293528.1|  PREDICTED: polyphenol oxidase, chloroplastic...    488   4e-160   
sp|Q08306.2|PPOD_SOLLC  RecName: Full=Polyphenol oxidase D, chlor...    487   5e-160   Solanum lycopersicum
gb|AFJ79642.1|  chloroplast polyphenol oxidase                          479   5e-157   
gb|ACR61398.1|  polyphenol oxidase                                      479   9e-157   Solanum melongena [aubergine]
ref|XP_010100570.1|  Polyphenol oxidase                                 479   1e-156   
ref|XP_002316632.1|  hypothetical protein POPTR_0011s04710g             478   2e-156   Populus trichocarpa [western balsam poplar]
gb|AAU12257.1|  polyphenol oxidase                                      476   1e-155   Populus trichocarpa x Populus deltoides
ref|XP_008224998.1|  PREDICTED: polyphenol oxidase, chloroplastic       475   2e-155   
ref|XP_010100574.1|  Polyphenol oxidase                                 474   7e-155   
gb|AAW65103.1|  polyphenol oxidase                                      473   3e-154   Prunus salicina var. cordata
ref|XP_011002749.1|  PREDICTED: polyphenol oxidase, chloroplastic...    472   3e-154   
ref|XP_007211392.1|  hypothetical protein PRUPE_ppa003257mg             472   4e-154   
sp|Q08303.2|PPOA_SOLLC  RecName: Full=Polyphenol oxidase A, chlor...    473   6e-154   Solanum lycopersicum
ref|XP_008383785.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    472   6e-154   
sp|Q9MB14.2|PPO2_IPOBA  RecName: Full=Polyphenol oxidase II, chlo...    471   6e-154   Ipomoea batatas [batate]
ref|XP_006370115.1|  hypothetical protein POPTR_0001s39630g             471   1e-153   
ref|XP_006370120.1|  hypothetical protein POPTR_0001s39680g             470   1e-153   
gb|AEL95440.1|  polyphenol oxidase                                      470   3e-153   
ref|XP_006370118.1|  hypothetical protein POPTR_0001s39660g             469   3e-153   
dbj|BAA92317.1|  polyphenol oxidase I                                   469   4e-153   Ipomoea batatas [batate]
ref|XP_011014565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    469   5e-153   
gb|AAU12256.1|  polyphenol oxidase                                      468   8e-153   Populus trichocarpa x Populus deltoides
dbj|BAB64530.1|  polyphenol oxidase                                     469   9e-153   Pyrus pyrifolia [sha li]
ref|XP_011047843.1|  PREDICTED: polyphenol oxidase, chloroplastic...    468   1e-152   
ref|XP_006370127.1|  hypothetical protein POPTR_0001s39940g             468   1e-152   
gb|AEG78292.1|  polyphenol oxidase                                      468   2e-152   
gb|AEE61322.1|  polyphenol oxidase I                                    468   2e-152   
ref|XP_004246037.1|  PREDICTED: polyphenol oxidase B, chloroplast...    467   5e-152   
gb|ABS88291.1|  polyphenol oxidase                                      466   1e-151   Pyrus x bretschneideri [bai li]
gb|AFO55217.1|  chloroplast polyphenol oxidase I                        465   2e-151   
ref|XP_006370125.1|  hypothetical protein POPTR_0001s39920g             464   3e-151   
gb|AFL03159.1|  polyphenol oxidase                                      464   3e-151   
gb|ADF59058.2|  polyphenol oxidase IV                                   463   9e-151   
gb|ADI44162.1|  polyphenol oxidase 1                                    464   1e-150   
sp|Q08305.1|PPOC_SOLLC  RecName: Full=Polyphenol oxidase C, chlor...    464   1e-150   Solanum lycopersicum
ref|XP_009334438.1|  PREDICTED: polyphenol oxidase, chloroplastic...    462   2e-150   
ref|XP_010686568.1|  PREDICTED: polyphenol oxidase, chloroplastic...    462   3e-150   
gb|AED02598.1|  polyphenol oxidase                                      462   3e-150   
gb|AAW78869.1|  polyphenol oxidase                                      462   3e-150   Ipomoea batatas [batate]
gb|ACM43505.1|  polyphenoloxidase                                       462   5e-150   Camellia nitidissima
gb|AAC69365.1|  polyphenol oxidase                                      454   7e-150   Diospyros kaki [Japanese persimmon]
ref|XP_010052352.1|  PREDICTED: polyphenol oxidase, chloroplastic...    461   7e-150   
emb|CBZ41490.1|  polyphenol oxidase precursor (chloroplast)             461   1e-149   
gb|KHN08551.1|  Polyphenol oxidase A1, chloroplastic                    461   1e-149   
ref|XP_003541740.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    460   3e-149   
ref|XP_006449291.1|  hypothetical protein CICLE_v10014693mg             459   3e-149   
ref|XP_006468218.1|  PREDICTED: polyphenol oxidase, chloroplastic...    459   4e-149   
gb|AFO55218.1|  chloroplast polyphenol oxidase II                       459   4e-149   
gb|KDO75857.1|  hypothetical protein CISIN_1g042556mg                   459   5e-149   
gb|AFC36521.1|  polyphenol oxidase                                      458   9e-149   
ref|XP_004293526.1|  PREDICTED: polyphenol oxidase, chloroplastic...    458   1e-148   
ref|XP_007025702.1|  Uncharacterized protein TCM_029922                 458   1e-148   
emb|CAQ76694.1|  polyphenol oxidase (chloroplast)                       457   2e-148   Taraxacum officinale [dandelion]
emb|CAC83610.1|  catechol oxidase                                       454   3e-148   Ipomoea batatas [batate]
ref|XP_008225003.1|  PREDICTED: polyphenol oxidase, chloroplastic...    457   4e-148   
gb|AGC54425.1|  polyphenol oxidase 1                                    457   4e-148   
emb|CAC29040.1|  catechol oxidase                                       453   5e-148   Ipomoea batatas [batate]
sp|Q06215.1|PPO_VICFA  RecName: Full=Polyphenol oxidase A1, chlor...    456   7e-148   Vicia faba [broad bean]
gb|AAC28935.1|  polyphenol oxidase precursor                            456   9e-148   Prunus armeniaca
gb|AII22007.1|  polyphenol oxidase-5                                    456   9e-148   
ref|XP_008371333.1|  PREDICTED: polyphenol oxidase, chloroplastic...    456   1e-147   
gb|EYU27938.1|  hypothetical protein MIMGU_mgv1a003402mg                454   2e-147   
ref|XP_010054349.1|  PREDICTED: polyphenol oxidase, chloroplastic...    454   3e-147   
ref|XP_003545882.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    455   3e-147   
ref|XP_003593515.1|  Polyphenol oxidase                                 455   3e-147   
ref|XP_006370117.1|  hypothetical protein POPTR_0001s39650g             452   3e-147   
ref|XP_008225000.1|  PREDICTED: polyphenol oxidase, chloroplastic...    454   4e-147   
gb|AHC98007.1|  PPO                                                     454   4e-147   
ref|XP_007025701.1|  Uncharacterized protein TCM_029921                 455   5e-147   
ref|XP_007025706.1|  Larreatricin hydroxylase isoform 1                 454   8e-147   
ref|XP_008366047.1|  PREDICTED: polyphenol oxidase, chloroplastic...    454   8e-147   
gb|ADR78836.1|  polyphenol oxidase                                      453   8e-147   
gb|KCW76289.1|  hypothetical protein EUGRSUZ_D00659                     455   1e-146   
ref|XP_008364151.1|  PREDICTED: polyphenol oxidase, chloroplastic...    452   1e-146   
emb|CBZ41492.1|  polyphenol oxidase precursor (chloroplast)             452   3e-146   
gb|AAK53414.1|AF368291_1  polyphenol oxidase                            451   4e-146   Populus tremuloides
gb|AHF20575.1|  polyphenol oxidase                                      451   4e-146   
emb|CDO99592.1|  unnamed protein product                                451   5e-146   
gb|ABY84850.1|  polyphenol oxidase                                      448   5e-146   Cydonia oblonga [wen po]
gb|AGU01537.1|  polyphenol oxidase                                      451   9e-146   
ref|XP_003526194.1|  PREDICTED: polyphenol oxidase, chloroplastic...    450   2e-145   
gb|KHN46528.1|  Polyphenol oxidase A1, chloroplastic                    450   2e-145   
ref|XP_007025703.1|  Larreatricin hydroxylase                           450   2e-145   
ref|XP_004303397.1|  PREDICTED: polyphenol oxidase, chloroplastic...    450   2e-145   
ref|XP_008371328.1|  PREDICTED: polyphenol oxidase, chloroplastic...    449   2e-145   
gb|AAW58109.2|  polyphenol oxidase                                      449   2e-145   Prunus salicina var. cordata
gb|AAG21983.1|AF263611_1  polyphenol oxidase PPO1                       448   3e-145   Populus trichocarpa x Populus deltoides
ref|XP_008349220.1|  PREDICTED: polyphenol oxidase, chloroplastic...    450   3e-145   
gb|AEY78528.1|  polyphenol oxidase                                      449   4e-145   
ref|XP_008224999.1|  PREDICTED: polyphenol oxidase, chloroplastic...    448   6e-145   
ref|XP_002316852.1|  hypothetical protein POPTR_0011s10950g             447   7e-145   Populus trichocarpa [western balsam poplar]
dbj|BAM15848.1|  hypothetical protein                                   448   7e-145   
ref|XP_008346980.1|  PREDICTED: polyphenol oxidase, chloroplastic...    446   8e-145   
gb|AES87890.2|  polyphenoloxidase                                       448   9e-145   
ref|XP_008371330.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    447   9e-145   
gb|AAP33165.1|  polyphenol oxidase                                      448   1e-144   Medicago sativa [alfalfa]
ref|XP_008364152.1|  PREDICTED: polyphenol oxidase, chloroplastic...    447   1e-144   
gb|KDP20931.1|  hypothetical protein JCGZ_21402                         447   2e-144   
ref|XP_010039984.1|  PREDICTED: polyphenol oxidase, chloroplastic...    447   3e-144   
ref|XP_011096441.1|  PREDICTED: aureusidin synthase-like                446   5e-144   
emb|CDP06093.1|  unnamed protein product                                446   5e-144   
ref|XP_008349252.1|  PREDICTED: polyphenol oxidase, chloroplastic...    444   6e-144   
gb|ACR61399.1|  polyphenol oxidase                                      444   6e-144   Solanum melongena [aubergine]
ref|XP_008371334.1|  PREDICTED: polyphenol oxidase, chloroplastic...    446   9e-144   
ref|XP_007214660.1|  hypothetical protein PRUPE_ppa003171mg             445   1e-143   
dbj|BAA21676.1|  polyphenol oxidase                                     445   2e-143   Malus domestica [apple tree]
ref|XP_002519016.1|  Polyphenol oxidase, chloroplast precursor, p...    444   2e-143   Ricinus communis
sp|Q9ZP19.1|PPO1_IPOBA  RecName: Full=Polyphenol oxidase I, chlor...    441   3e-143   Ipomoea batatas [batate]
gb|ABI96939.1|  putative polyphenol oxidase                             438   5e-143   Neillia thyrsiflora
gb|ADI44161.1|  polyphenol oxidase 2                                    444   5e-143   
gb|AII22006.1|  polyphenol oxidase-4                                    443   7e-143   
ref|XP_004293563.1|  PREDICTED: polyphenol oxidase, chloroplastic...    442   2e-142   
dbj|BAA21677.1|  polyphenol oxidase                                     441   3e-142   Malus domestica [apple tree]
ref|XP_007211389.1|  hypothetical protein PRUPE_ppa003190mg             441   5e-142   
gb|KHN46329.1|  Polyphenol oxidase A1, chloroplastic                    441   7e-142   
ref|XP_010647098.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    441   9e-142   
gb|ACN86310.1|  polyphenol oxidase                                      440   1e-141   Juglans regia
ref|XP_003522849.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    440   2e-141   
dbj|BAO79387.1|  polyphenol_oxidase                                     440   2e-141   
emb|CAN61652.1|  hypothetical protein VITISV_006012                     439   2e-141   Vitis vinifera
emb|CDP22269.1|  unnamed protein product                                433   3e-141   
ref|XP_010910928.1|  PREDICTED: polyphenol oxidase, chloroplastic...    438   4e-141   
ref|XP_006594327.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    441   5e-141   
emb|CAC83609.1|  catechol oxidase                                       434   6e-141   Ipomoea batatas [batate]
gb|AAK56323.1|AF380300_1  polyphenol oxidase 2 precursor                437   2e-140   Malus domestica [apple tree]
gb|AEQ30073.1|  polyphenol oxidase                                      437   2e-140   
gb|ABI96941.1|  putative polyphenol oxidase                             431   2e-140   Physocarpus capitatus
ref|XP_009408264.1|  PREDICTED: polyphenol oxidase, chloroplastic...    436   2e-140   
gb|ABI96925.1|  putative polyphenol oxidase                             431   4e-140   Adenostoma fasciculatum [chamise]
ref|XP_008371327.1|  PREDICTED: polyphenol oxidase, chloroplastic...    436   5e-140   
emb|CDP06099.1|  unnamed protein product                                435   5e-140   
ref|XP_008225002.1|  PREDICTED: polyphenol oxidase I, chloroplast...    435   7e-140   
gb|AHH92831.1|  polyphenol oxidase                                      434   1e-139   
ref|XP_011016645.1|  PREDICTED: polyphenol oxidase, chloroplastic...    434   1e-139   
ref|XP_009773173.1|  PREDICTED: polyphenol oxidase, chloroplastic...    435   2e-139   
ref|XP_009334704.1|  PREDICTED: polyphenol oxidase, chloroplastic...    434   2e-139   
ref|XP_009610962.1|  PREDICTED: polyphenol oxidase, chloroplastic...    434   2e-139   
ref|XP_008442274.1|  PREDICTED: polyphenol oxidase, chloroplastic...    433   2e-139   
gb|ADF59059.2|  polyphenol oxidase V                                    434   4e-139   
ref|XP_004485748.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    434   4e-139   
ref|XP_009414395.1|  PREDICTED: polyphenol oxidase, chloroplastic...    433   5e-139   
gb|ABI96945.1|  putative polyphenol oxidase                             428   6e-139   Prunus mexicana [Mexican plum]
ref|XP_009334541.1|  PREDICTED: polyphenol oxidase, chloroplastic...    433   6e-139   
ref|XP_009782447.1|  PREDICTED: polyphenol oxidase, chloroplastic...    432   9e-139   
ref|XP_006347083.1|  PREDICTED: polyphenol oxidase, chloroplastic...    433   9e-139   
ref|XP_011083298.1|  PREDICTED: polyphenol oxidase I, chloroplast...    432   1e-138   
ref|XP_007148200.1|  hypothetical protein PHAVU_006G188500g             432   1e-138   
gb|ABI96946.1|  putative polyphenol oxidase                             427   1e-138   Pyrus communis subsp. caucasica
ref|XP_004146644.1|  PREDICTED: polyphenol oxidase, chloroplastic...    431   2e-138   
gb|ABI96929.1|  putative polyphenol oxidase                             426   3e-138   Chamaebatiaria millefolium
gb|AII22011.1|  polyphenol oxidase-9                                    430   3e-138   
ref|XP_003593517.1|  Polyphenol oxidase A1                              432   3e-138   
gb|AFO55219.1|  chloroplast polyphenol oxidase III                      432   3e-138   
gb|ABI96926.1|  putative polyphenol oxidase                             426   4e-138   Cercocarpus betuloides
ref|XP_010245321.1|  PREDICTED: polyphenol oxidase, chloroplastic...    431   5e-138   
gb|ABI96951.1|  putative polyphenol oxidase                             425   7e-138   Vauquelinia californica
gb|ABI96932.1|  putative polyphenol oxidase                             425   1e-137   Fallugia paradoxa
ref|XP_010242012.1|  PREDICTED: polyphenol oxidase, chloroplastic...    430   1e-137   
gb|AAK13242.1|  polyphenol oxidase                                      430   1e-137   Trifolium pratense [peavine clover]
gb|ABI96928.1|  putative polyphenol oxidase                             424   2e-137   Chamaebatia foliolosa
gb|ABI96930.1|  putative polyphenol oxidase                             424   2e-137   Crataegus monogyna
gb|ABI96938.1|  putative polyphenol oxidase                             424   2e-137   Lyonothamnus floribundus
sp|Q6UIL3.1|LAHY_LARTR  RecName: Full=(+)-larreatricin hydroxylas...    427   5e-137   Larrea tridentata
gb|ABI96944.1|  putative polyphenol oxidase                             422   1e-136   Prunus dulcis [sweet almond]
gb|ACM09905.1|  polyphenol oxidase 1/4                                  427   1e-136   Trifolium pratense [peavine clover]
dbj|BAM15846.1|  hypothetical protein                                   427   1e-136   
gb|ABI96934.1|  putative polyphenol oxidase                             422   1e-136   Gillenia trifoliata [Bowman's root]
ref|XP_008225030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    426   3e-136   
gb|ABI96948.1|  putative polyphenol oxidase                             420   5e-136   Sorbus californica
ref|XP_007159290.1|  hypothetical protein PHAVU_002G225600g             425   7e-136   
gb|ABI96935.1|  putative polyphenol oxidase                             420   7e-136   Heteromeles arbutifolia
gb|ABI96940.1|  putative polyphenol oxidase                             420   9e-136   Oemleria cerasiformis [Oregon plum]
ref|XP_008345876.1|  PREDICTED: polyphenol oxidase, chloroplastic...    424   1e-135   
gb|ABI96937.1|  putative polyphenol oxidase                             419   2e-135   Kageneckia oblonga
gb|ABX09994.1|  chloroplast polyphenol oxidase                          424   2e-135   Taraxacum officinale [dandelion]
gb|AAO16865.1|  polyphenol oxidase                                      423   2e-135   Ananas comosus
ref|XP_004232833.2|  PREDICTED: polyphenol oxidase, chloroplastic...    424   3e-135   
gb|ABI96927.1|  putative polyphenol oxidase                             418   3e-135   Chaenomeles speciosa [boke]
ref|XP_008778193.1|  PREDICTED: polyphenol oxidase, chloroplastic...    423   4e-135   
gb|ACB12082.1|  polyphenol oxidase                                      422   4e-135   Triticum monococcum subsp. aegilopoides [wild einkorn]
gb|ADC92563.1|  polyphenol oxidase                                      423   6e-135   
dbj|BAO79386.1|  polyphenol_oxidase                                     423   6e-135   
ref|XP_008779317.1|  PREDICTED: polyphenol oxidase, chloroplastic...    422   6e-135   
gb|ABI96950.1|  putative polyphenol oxidase                             417   7e-135   Spiraea densiflora
gb|AFH00996.1|  polyphenol oxidase II                                   422   8e-135   
gb|ACB12083.1|  polyphenol oxidase                                      421   1e-134   Triticum monococcum [einkorn wheat]
ref|XP_003567197.1|  PREDICTED: polyphenol oxidase I, chloroplast...    421   2e-134   
sp|P43311.1|PPO_VITVI  RecName: Full=Polyphenol oxidase, chloropl...    421   3e-134   Vitis vinifera
gb|ABR57235.1|  polyphenol oxidase                                      421   3e-134   Camellia sinensis [black tea]
gb|ACB12081.1|  polyphenol oxidase                                      420   4e-134   Triticum urartu
gb|ABF19601.1|  polyphenol oxidase                                      421   4e-134   Camellia ptilophylla
gb|ABR10907.1|  polyphenol oxidase                                      421   5e-134   Camellia sinensis [black tea]
gb|KHN46328.1|  Polyphenol oxidase A1, chloroplastic                    421   5e-134   
gb|ACF17425.1|  polyphenol oxidase                                      420   5e-134   Camellia sinensis [black tea]
gb|ACN38060.1|  polyphenol oxidase                                      420   6e-134   Camellia sinensis [black tea]
ref|XP_011098121.1|  PREDICTED: polyphenol oxidase I, chloroplast...    419   7e-134   
ref|XP_010926766.1|  PREDICTED: polyphenol oxidase, chloroplastic...    420   7e-134   
gb|ABI96947.1|  putative polyphenol oxidase                             414   9e-134   Rhodotypos scandens [jetbead]
gb|ACJ04908.1|  polyphenol oxidase                                      419   1e-133   Camellia sinensis [black tea]
dbj|BAM15849.1|  hypothetical protein                                   420   2e-133   
gb|ABI96943.1|  putative polyphenol oxidase                             414   2e-133   Prinsepia sinensis
gb|ABM68052.1|  polyphenol oxidase                                      419   2e-133   Trifolium pratense [peavine clover]
gb|ABR24120.1|  polyphenol oxidase                                      419   2e-133   Camellia sinensis [black tea]
gb|ABI96931.1|  putative polyphenol oxidase                             414   2e-133   Exochorda racemosa
gb|ABR57236.1|  polyphenol oxidase                                      419   3e-133   Camellia sinensis [black tea]
gb|AAK13244.1|  polyphenol oxidase                                      417   6e-133   Trifolium pratense [peavine clover]
ref|NP_001268045.1|  polyphenol oxidase, chloroplastic                  418   6e-133   
gb|ABK62804.1|  polyphenol oxidase                                      417   7e-133   Triticum aestivum [Canadian hard winter wheat]
gb|ADG85002.1|  polyphenol oxidase                                      417   7e-133   
ref|XP_003529305.2|  PREDICTED: polyphenol oxidase A1, chloroplastic    418   9e-133   
gb|ACR82078.1|  polyphenol oxidase                                      417   1e-132   Camellia sinensis [black tea]
ref|XP_010910924.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    415   1e-132   
gb|ABF19602.1|  polyphenol oxidase                                      416   2e-132   Camellia sinensis var. assamica [Assam tea]
emb|CAN62983.1|  hypothetical protein VITISV_035472                     415   6e-132   Vitis vinifera
ref|XP_010100567.1|  Polyphenol oxidase                                 415   7e-132   
ref|XP_006370128.1|  hypothetical protein POPTR_0001s39950g             414   9e-132   
gb|ABI96942.1|  putative polyphenol oxidase                             409   9e-132   Dasiphora fruticosa
ref|XP_008236801.1|  PREDICTED: polyphenol oxidase, chloroplastic...    413   1e-131   
emb|CCA94610.1|  polyphenol oxidase precursor (chloroplast)             414   2e-131   
gb|ABI96949.1|  putative polyphenol oxidase                             409   2e-131   Spiraea cantoniensis
gb|ABM68051.1|  polyphenol oxidase                                      414   2e-131   Trifolium pratense [peavine clover]
gb|ABI96936.1|  putative polyphenol oxidase                             407   5e-131   Holodiscus microphyllus
ref|XP_009773174.1|  PREDICTED: polyphenol oxidase, chloroplastic...    413   6e-131   
gb|AEY79824.1|  polyphenol oxidase                                      412   7e-131   
gb|AAK13243.1|  polyphenol oxidase                                      413   7e-131   Trifolium pratense [peavine clover]
gb|ACB12084.1|  polyphenol oxidase                                      410   1e-130   Triticum dicoccoides [wild emmer wheat]
gb|EPS59410.1|  polyphenoloxidase                                       410   2e-130   
gb|ADP89908.1|  polyphenol oxidase                                      407   3e-130   
gb|EYU26238.1|  hypothetical protein MIMGU_mgv1a025156mg                410   4e-130   
gb|ABI96933.1|  putative polyphenol oxidase                             405   4e-130   Gillenia stipulata [American-ipecac]
ref|XP_010100571.1|  Polyphenol oxidase                                 409   4e-130   
gb|ABN13632.1|  polyphenol oxidase                                      408   7e-130   Doritis pulcherrima x Phalaenopsis hybrid cultivar
gb|AHX26182.1|  polyphenol oxidase                                      408   8e-130   
gb|ABK62801.1|  polyphenol oxidase                                      409   9e-130   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ10871.1|  polyphenol oxidase                                     407   2e-129   
gb|EYU26236.1|  hypothetical protein MIMGU_mgv1a027162mg                407   3e-129   
gb|ABK62802.1|  polyphenol oxidase                                      407   4e-129   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011098120.1|  PREDICTED: polyphenol oxidase I, chloroplast...    407   4e-129   
gb|ABK62803.1|  polyphenol oxidase                                      406   6e-129   
gb|ACB12086.1|  polyphenol oxidase                                      406   8e-129   
dbj|BAH36897.1|  polyphenol oxidase                                     406   1e-128   
gb|AAS00454.1|  polyphenol oxidase                                      404   1e-128   
ref|XP_010686565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    406   1e-128   
gb|EYU34161.1|  hypothetical protein MIMGU_mgv1a003495mg                405   2e-128   
ref|XP_004972211.1|  PREDICTED: polyphenol oxidase, chloroplastic...    405   4e-128   
gb|AFW59500.1|  putative polyphenol oxidase family protein              405   7e-128   
gb|AEM45935.1|  polyphenol oxidase                                      403   7e-128   
ref|XP_007211883.1|  hypothetical protein PRUPE_ppa003608mg             403   8e-128   
ref|XP_010100565.1|  Polyphenol oxidase                                 404   1e-127   
gb|EYU26237.1|  hypothetical protein MIMGU_mgv1a026995mg                403   2e-127   
gb|AEM45936.1|  polyphenol oxidase                                      402   2e-127   
gb|AEY79826.1|  polyphenol oxidase                                      402   2e-127   
gb|ACJ04909.1|  polyphenol oxidase                                      403   2e-127   
ref|XP_010686567.1|  PREDICTED: polyphenol oxidase, chloroplastic...    402   3e-127   
sp|Q9FRX6.1|AS1_ANTMA  RecName: Full=Aureusidin synthase; Short=A...    401   5e-127   
ref|XP_011082866.1|  PREDICTED: polyphenol oxidase I, chloroplast...    402   5e-127   
ref|XP_009407067.1|  PREDICTED: polyphenol oxidase, chloroplastic...    401   5e-127   
ref|XP_011082857.1|  PREDICTED: polyphenol oxidase I, chloroplast...    401   5e-127   
ref|XP_002446944.1|  hypothetical protein SORBIDRAFT_06g025570          400   9e-127   
ref|XP_010686675.1|  PREDICTED: polyphenol oxidase, chloroplastic...    401   1e-126   
gb|AHX26181.1|  polyphenol oxidase                                      399   1e-126   
gb|AEM45933.1|  polyphenol oxidase                                      400   1e-126   
ref|XP_010686564.1|  PREDICTED: polyphenol oxidase, chloroplastic...    401   2e-126   
gb|AEM45934.1|  polyphenol oxidase                                      399   3e-126   
gb|AAT75166.1|  polyphenol oxidase                                      399   3e-126   
gb|AEY79825.1|  polyphenol oxidase                                      398   5e-126   
ref|XP_010686566.1|  PREDICTED: polyphenol oxidase, chloroplastic...    399   7e-126   
ref|XP_003605693.1|  Polyphenol oxidase A1                              394   1e-125   
emb|CBZ41491.1|  polyphenol oxidase precursor (chloroplast)             399   1e-125   
gb|AEM45931.1|  polyphenol oxidase                                      397   1e-125   
gb|ABA62017.1|  polyphenol oxidase                                      397   1e-125   
ref|XP_008663490.1|  PREDICTED: polyphenol oxidase, chloroplastic...    397   1e-125   
ref|XP_010100566.1|  Polyphenol oxidase                                 397   2e-125   
ref|XP_008383783.1|  PREDICTED: polyphenol oxidase I, chloroplast...    397   3e-125   
ref|XP_011082867.1|  PREDICTED: polyphenol oxidase I, chloroplast...    397   3e-125   
dbj|BAH36895.1|  polyphenol oxidase                                     395   4e-125   
ref|XP_011098119.1|  PREDICTED: polyphenol oxidase I, chloroplast...    397   4e-125   
ref|XP_003541548.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    397   5e-125   
gb|AHZ59731.1|  copper-containing polyphenol oxidase                    395   5e-125   
gb|AAO16863.1|  polyphenol oxidase                                      394   1e-124   
dbj|BAP82256.1|  polyphenol oxidase                                     395   2e-124   
emb|CCD61123.1|  polyphenol oxidase precursor (chloroplast)             396   2e-124   
gb|AAK29782.1|AF261957_1  polyphenol oxidase                            395   3e-124   
gb|ABG23081.1|  polyphenol oxidase                                      394   3e-124   
dbj|BAP82254.1|  polyphenol oxidase                                     394   3e-124   
ref|XP_011013403.1|  PREDICTED: polyphenol oxidase, chloroplastic...    394   3e-124   
dbj|BAP82255.1|  polyphenol oxidase                                     394   3e-124   
ref|XP_009408745.1|  PREDICTED: polyphenol oxidase, chloroplastic...    393   3e-124   
dbj|BAA08234.1|  polyphenol oxidase                                     394   3e-124   
ref|XP_010227274.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    394   4e-124   
gb|AGC55012.1|  polyphenoloxidase                                       394   8e-124   
ref|XP_002446945.1|  hypothetical protein SORBIDRAFT_06g025580          392   1e-123   
emb|CCD61124.1|  polyphenol oxidase precursor (chloroplast)             394   1e-123   
gb|AHX26180.1|  polyphenol oxidase                                      392   2e-123   
ref|XP_011082856.1|  PREDICTED: polyphenol oxidase I, chloroplast...    392   2e-123   
gb|EYU34166.1|  hypothetical protein MIMGU_mgv1a003279mg                392   2e-123   
ref|NP_001053932.1|  Os04g0624500                                       391   3e-123   
ref|XP_002458623.1|  hypothetical protein SORBIDRAFT_03g036870          392   4e-123   
dbj|BAK03848.1|  predicted protein                                      391   6e-123   
gb|ABG23097.1|  polyphenol oxidase                                      390   7e-123   
gb|ABG23077.1|  polyphenol oxidase                                      390   7e-123   
gb|ABG23093.1|  polyphenol oxidase                                      390   7e-123   
gb|ABG23059.1|  polyphenol oxidase                                      390   7e-123   
dbj|BAP82257.1|  polyphenol oxidase                                     390   8e-123   
dbj|BAJ10872.1|  polyphenol oxidase                                     390   8e-123   
gb|ABG23065.1|  polyphenol oxidase                                      390   8e-123   
gb|ACS15337.1|  polyphenol oxidase                                      390   9e-123   
gb|ACS15326.1|  polyphenol oxidase                                      389   1e-122   
gb|ACS15330.1|  polyphenol oxidase                                      390   1e-122   
gb|ABG23062.1|  polyphenol oxidase                                      390   2e-122   
gb|ABG23092.1|  polyphenol oxidase                                      390   2e-122   
gb|ACS15319.1|  polyphenol oxidase                                      389   2e-122   
emb|CAE03510.2|  OSJNBa0053K19.18                                       389   3e-122   
gb|ABG23057.1|  polyphenol oxidase                                      389   4e-122   
ref|XP_007139960.1|  hypothetical protein PHAVU_008G073200g             389   4e-122   
gb|ABG23047.1|  polyphenol oxidase                                      389   4e-122   
gb|ABG23098.1|  polyphenol oxidase                                      389   4e-122   
ref|XP_003552355.1|  PREDICTED: polyphenol oxidase, chloroplastic...    389   6e-122   
gb|KHN07285.1|  Polyphenol oxidase A1, chloroplastic                    388   7e-122   
emb|CAH66802.1|  H0215F08.13                                            388   7e-122   
gb|AII22009.1|  polyphenol oxidase-7                                    389   8e-122   
gb|ABG23070.1|  polyphenol oxidase                                      388   8e-122   
gb|ABG23045.1|  polyphenol oxidase                                      387   1e-121   
gb|ABG23084.1|  polyphenol oxidase                                      387   1e-121   
gb|ABG23042.1|  polyphenol oxidase                                      387   2e-121   
gb|ABG23083.1|  polyphenol oxidase                                      386   3e-121   
gb|ABG23086.1|  polyphenol oxidase                                      386   3e-121   
dbj|BAA08235.1|  polyphenol oxidase                                     383   3e-121   
ref|NP_001149552.1|  polyphenol oxidase II                              383   4e-121   
gb|ABG23073.1|  polyphenol oxidase                                      386   4e-121   
gb|ABG23060.1|  polyphenol oxidase                                      385   5e-121   
gb|ABG23085.1|  polyphenol oxidase                                      385   6e-121   
gb|ABG23075.1|  polyphenol oxidase                                      385   6e-121   
gb|EYU34165.1|  hypothetical protein MIMGU_mgv1a003246mg                386   7e-121   
gb|ABG23090.1|  polyphenol oxidase                                      385   8e-121   
gb|EEC78048.1|  hypothetical protein OsI_17489                          384   1e-120   
gb|ABG23087.1|  polyphenol oxidase                                      384   2e-120   
ref|XP_006653782.1|  PREDICTED: polyphenol oxidase, chloroplastic...    382   4e-120   
gb|ABG23061.1|  polyphenol oxidase                                      384   4e-120   
gb|ABG23066.1|  polyphenol oxidase                                      383   4e-120   
gb|ABG23072.1|  polyphenol oxidase                                      383   6e-120   
ref|XP_006595376.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    385   6e-120   
ref|XP_008674942.1|  PREDICTED: polyphenol oxidase, chloroplastic...    384   7e-120   
ref|XP_003528444.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    382   1e-119   
gb|ABG23067.1|  polyphenol oxidase                                      382   2e-119   
ref|XP_011098100.1|  PREDICTED: polyphenol oxidase I, chloroplast...    382   2e-119   
ref|XP_006644832.1|  PREDICTED: polyphenol oxidase, chloroplastic...    381   4e-119   
gb|KHN08552.1|  Polyphenol oxidase A1, chloroplastic                    380   6e-119   
pdb|1BT1|A  Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet...    372   8e-119   
gb|AII22005.1|  polyphenol oxidase-3                                    381   2e-118   
gb|EYU34163.1|  hypothetical protein MIMGU_mgv1a003224mg                380   2e-118   
gb|AII22008.1|  polyphenol oxidase-6                                    380   2e-118   
dbj|BAP82258.1|  polyphenol oxidase                                     379   3e-118   
ref|XP_010100568.1|  Polyphenol oxidase                                 378   7e-118   
gb|AII22010.1|  polyphenol oxidase-8                                    378   1e-117   
gb|EMT06707.1|  Polyphenol oxidase A1, chloroplastic                    376   2e-117   
emb|CDP06098.1|  unnamed protein product                                375   5e-117   
gb|AFH00998.1|  polyphenol oxidase III                                  376   6e-117   
ref|XP_006370119.1|  hypothetical protein POPTR_0001s39670g             369   2e-116   
ref|XP_002438681.1|  hypothetical protein SORBIDRAFT_10g024220          375   2e-116   
ref|XP_007025704.1|  Larreatricin hydroxylase                           373   2e-116   
gb|ADF59060.1|  polyphenol oxidase 6 precursor                          374   2e-116   
dbj|BAH36896.1|  polyphenol oxidase                                     370   1e-115   
gb|AFS28698.1|  putative polyphenol oxidase                             367   2e-115   
gb|AFS28697.1|  putative polyphenol oxidase                             367   4e-115   
ref|XP_008225001.1|  PREDICTED: polyphenol oxidase I, chloroplast...    370   1e-114   
ref|XP_011076536.1|  PREDICTED: polyphenol oxidase I, chloroplast...    369   3e-114   
gb|EPS57764.1|  polyphenol oxidase                                      367   4e-114   
gb|KHN03175.1|  Polyphenol oxidase, chloroplastic                       368   5e-114   
ref|XP_007214570.1|  hypothetical protein PRUPE_ppa019877mg             369   5e-114   
dbj|BAB89047.1|  putative polyphenol oxidase                            367   5e-114   
ref|XP_009352971.1|  PREDICTED: polyphenol oxidase, chloroplastic...    362   7e-114   
emb|CAH66801.1|  H0215F08.12                                            365   7e-114   
ref|XP_003551647.1|  PREDICTED: polyphenol oxidase, chloroplastic       368   8e-114   
gb|EYU34157.1|  hypothetical protein MIMGU_mgv1a003435mg                366   2e-113   
gb|AGK88243.1|  polyphenol oxidase                                      366   3e-113   
gb|ACJ70698.1|  polyphenol oxidase                                      365   6e-113   
ref|NP_001147867.1|  polyphenol oxidase precursor                       364   1e-112   
pdb|2P3X|A  Chain A, Crystal Structure Of Grenache (Vitis Vinifer...    355   1e-112   
gb|EMT09670.1|  Polyphenol oxidase, chloroplastic                       357   8e-112   
ref|XP_003564367.2|  PREDICTED: polyphenol oxidase I, chloroplast...    362   8e-112   
gb|AHN09736.1|  aurone synthase                                         362   1e-111   
gb|AFW87458.1|  putative polyphenol oxidase family protein              361   1e-111   
ref|XP_006377743.1|  hypothetical protein POPTR_0011s10940g             355   4e-111   
gb|AFN53703.1|  putative phenol oxidase                                 353   5e-110   
emb|CDM84541.1|  unnamed protein product                                356   5e-110   
gb|KHN03178.1|  Polyphenol oxidase II, chloroplastic                    351   5e-110   
dbj|BAJ90144.1|  predicted protein                                      356   2e-109   
gb|ACB12087.1|  truncated polyphenol oxidase                            351   3e-109   
emb|CCD61126.1|  polyphenol oxidase precursor (chloroplast)             356   6e-109   
gb|EEC71623.1|  hypothetical protein OsI_04042                          353   6e-109   
ref|XP_003567194.1|  PREDICTED: polyphenol oxidase I, chloroplast...    353   1e-108   
ref|XP_002976938.1|  hypothetical protein SELMODRAFT_175858             354   1e-108   
ref|XP_002980542.1|  hypothetical protein SELMODRAFT_178281             353   2e-108   
gb|EYU34162.1|  hypothetical protein MIMGU_mgv1a005754mg                349   3e-108   
gb|EEC78047.1|  hypothetical protein OsI_17486                          350   3e-108   
ref|XP_002976812.1|  hypothetical protein SELMODRAFT_175861             352   4e-108   
dbj|BAM15847.1|  hypothetical protein                                   353   4e-108   
ref|XP_010921586.1|  PREDICTED: polyphenol oxidase, chloroplastic...    352   7e-108   
gb|AAT06525.1|  polyphenol oxidase                                      345   1e-107   
ref|XP_002990241.1|  hypothetical protein SELMODRAFT_185154             350   3e-107   
emb|CCD61125.1|  polyphenol oxidase precursor (chloroplast)             352   3e-107   
ref|XP_002980680.1|  hypothetical protein SELMODRAFT_178277             349   8e-107   
ref|XP_004965883.1|  PREDICTED: aureusidin synthase-like                348   2e-106   
ref|XP_007025707.1|  Larreatricin hydroxylase isoform 2                 342   2e-106   
ref|XP_002974314.1|  hypothetical protein SELMODRAFT_101213             347   4e-106   
gb|ACS15320.1|  polyphenol oxidase                                      342   6e-106   
ref|XP_002961891.1|  hypothetical protein SELMODRAFT_164684             346   7e-106   
gb|EMS49817.1|  Polyphenol oxidase, chloroplastic                       345   1e-105   
gb|ACS15325.1|  polyphenol oxidase                                      340   1e-105   
ref|XP_006646401.1|  PREDICTED: polyphenol oxidase, chloroplastic...    344   4e-105   
ref|XP_010680714.1|  PREDICTED: polyphenol oxidase, chloroplastic...    344   9e-105   
ref|XP_002458568.1|  hypothetical protein SORBIDRAFT_03g035850          343   1e-104   
dbj|BAM15845.1|  hypothetical protein                                   343   2e-104   
ref|XP_002990877.1|  hypothetical protein SELMODRAFT_132508             341   3e-104   
ref|XP_002982245.1|  hypothetical protein SELMODRAFT_116300             342   6e-104   
ref|XP_006583806.1|  PREDICTED: polyphenol oxidase II, chloroplas...    340   1e-103   
ref|XP_009388016.1|  PREDICTED: polyphenol oxidase, chloroplastic...    339   6e-103   
ref|XP_006583805.1|  PREDICTED: polyphenol oxidase II, chloroplas...    337   3e-102   
ref|XP_008809956.1|  PREDICTED: polyphenol oxidase I, chloroplast...    337   5e-102   
ref|XP_010910148.1|  PREDICTED: polyphenol oxidase, chloroplastic...    335   1e-101   
ref|XP_010110268.1|  Polyphenol oxidase A1                              333   7e-101   
ref|XP_009388329.1|  PREDICTED: polyphenol oxidase, chloroplastic...    331   6e-100   
ref|XP_010680713.1|  PREDICTED: polyphenol oxidase, chloroplastic...    332   7e-100   
ref|XP_010680712.1|  PREDICTED: polyphenol oxidase, chloroplastic...    328   1e-98    
ref|XP_002990879.1|  hypothetical protein SELMODRAFT_11755              321   8e-98    
emb|CCE45701.1|  polyphenol oxidase precursor (chloroplast)             326   1e-97    
ref|XP_002990878.1|  hypothetical protein SELMODRAFT_429255             324   1e-97    
ref|XP_009380367.1|  PREDICTED: polyphenol oxidase I, chloroplast...    323   5e-97    
gb|ABJ90144.1|  polyphenol oxidase                                      323   5e-97    
ref|XP_010099505.1|  Polyphenol oxidase                                 319   9e-97    
ref|XP_010263628.1|  PREDICTED: aureusidin synthase-like                322   2e-96    
ref|XP_009388018.1|  PREDICTED: polyphenol oxidase, chloroplastic...    319   2e-96    
ref|XP_006583808.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    322   3e-96    
gb|AGT28746.1|  aurone synthase                                         321   9e-96    
gb|AGT28745.1|  aurone synthase                                         320   1e-95    
ref|XP_010110269.1|  Polyphenol oxidase                                 318   2e-95    
ref|XP_010099507.1|  Polyphenol oxidase                                 314   9e-95    
ref|XP_008446626.1|  PREDICTED: polyphenol oxidase I, chloroplast...    321   1e-94    
gb|ACB45128.1|  polyphenol oxidase                                      307   4e-94    
ref|XP_006370123.1|  hypothetical protein POPTR_0001s39900g             306   3e-93    
ref|XP_004146641.1|  PREDICTED: polyphenol oxidase, chloroplastic...    312   3e-93    
ref|XP_007042162.1|  Uncharacterized protein isoform 4                  311   4e-93    
ref|XP_007042160.1|  Uncharacterized protein isoform 2                  312   6e-93    
ref|XP_002969567.1|  hypothetical protein SELMODRAFT_170754             311   1e-92    
ref|XP_010254790.1|  PREDICTED: aureusidin synthase-like                311   1e-92    
ref|XP_007042159.1|  Uncharacterized protein isoform 1                  311   2e-92    
ref|XP_009388330.1|  PREDICTED: polyphenol oxidase, chloroplastic...    306   2e-91    
ref|XP_008809953.1|  PREDICTED: polyphenol oxidase, chloroplastic...    303   4e-91    
ref|XP_004295273.1|  PREDICTED: polyphenol oxidase, chloroplastic...    306   7e-91    
ref|XP_008446638.1|  PREDICTED: polyphenol oxidase, chloroplastic...    305   1e-90    
ref|XP_002970835.1|  hypothetical protein SELMODRAFT_94153              305   1e-90    
gb|ABG23046.1|  polyphenol oxidase                                      301   7e-89    
ref|XP_004292030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    300   9e-89    
ref|XP_010645091.1|  PREDICTED: aureusidin synthase-like                301   1e-88    
gb|ABG23091.1|  polyphenol oxidase                                      300   2e-88    
gb|EMT12603.1|  Polyphenol oxidase, chloroplastic                       300   2e-88    
gb|ACJ76786.1|  tyrosinase polyphenol oxidase                           299   7e-88    



>ref|XP_009628381.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/505 (57%), Positives = 353/505 (70%), Gaps = 15/505 (3%)
 Frame = +1

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV  504
             ALA P+P P +  CG A I      VPY CCPPI +   V YY  P  S+  VRPAAH V
Sbjct  79    ALASPIPSPTLTQCGTAIIE-GDKPVPYTCCPPIPEIKDVPYYNPPPVSRFRVRPAAHTV  137

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFH  684
             D  Y+ KY  A  +MK LP+DDPR+F QQAN+HCAYCNGAY + G   Q+HF+W FFPFH
Sbjct  138   DDEYIAKYNEAYSRMKALPTDDPRSFMQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFH  197

Query  685   RWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYG  864
             RWY+YF+ERI+ S+I+DPTF LPYWNWDNP GM  P +FD E   + +Y++ RNQ HR G
Sbjct  198   RWYIYFYERILASLIDDPTFALPYWNWDNPKGMHLPDMFDVEG--TSIYNERRNQKHRNG  255

Query  865   HVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIE  1044
              ++DL Y+G+D++A D  K+ NNL +MYRQMITNAPCP LFFGKP R  +  S GMGTIE
Sbjct  256   FIMDLGYAGEDVVANDLQKLVNNLTLMYRQMITNAPCPSLFFGKPYRFGSEPSPGMGTIE  315

Query  1045  NIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIAD  1224
             N+PHNS+HRWVGDPR  N EDMGNFYS+  DP F+SLH+NVDRMWTIWKTLGGKR DI+D
Sbjct  316   NVPHNSIHRWVGDPRQPNEEDMGNFYSSGKDPAFFSLHANVDRMWTIWKTLGGKRKDISD  375

Query  1225  KDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT---RKRTVKLSI  1395
              D+LDTEF F+DE     +V+VRDCLD +KLGYTFQ M IPWK+FKP     K+ VK+  
Sbjct  376   PDYLDTEFFFYDEKAKPFRVRVRDCLDEKKLGYTFQPMDIPWKNFKPQPRKNKKNVKID-  434

Query  1396  TESVPASTDVLP-APLSKNLTFYVTRSTSVPETQEEMLNLDLV------YDDTKFIRFDV  1554
               SVP ++ V P   L K +TF V R   +   +E+    +L+       D  KF+RFDV
Sbjct  435   PNSVPPASQVFPIKKLDKTVTFSVARPKRLRTKKEKEDEEELLTFKNVELDVRKFVRFDV  494

Query  1555  FLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKV  1734
             FLNED DV   E+DRTE+ GSF NLPH+H+      K   F+LAI+EL++DL LEGDD V
Sbjct  495   FLNEDNDVIANEIDRTEFVGSFANLPHIHDDPKKE-KFPEFSLAINELLEDLKLEGDDLV  553

Query  1735  LVTLVPKVGGSFVTVNNAYINTLDC  1809
             +VTLVPK GG  V++    I  + C
Sbjct  554   VVTLVPKSGGENVSIEAVEIQLVPC  578



>ref|XP_009603530.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/504 (57%), Positives = 350/504 (69%), Gaps = 13/504 (3%)
 Frame = +1

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV  504
             ALA P+P P +  CG A I      V Y CCPPI D   V  Y +P  S   VRPAA  V
Sbjct  79    ALASPIPSPTITQCGTAFID-PKIPVCYTCCPPIPDKKDVPCYDLPLVSGFRVRPAAQTV  137

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFH  684
             D  Y+ KY  A  +MK LP+DDPR+F QQAN+HCAYCNGAY + G   Q+HF+W FFPFH
Sbjct  138   DDEYIAKYNEAYSRMKALPTDDPRSFMQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFH  197

Query  685   RWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYG  864
             RWYLYF ERI+ S+I DPTF LPYWNWD+P GM  P +FD E   + +Y++ RNQ HR G
Sbjct  198   RWYLYFHERILASLIGDPTFALPYWNWDHPKGMHLPDMFDVEG--TSIYNERRNQKHRNG  255

Query  865   HVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIE  1044
              ++DL Y+G+D++A D  K+ NNLAIMYRQMITNAPCPLLFFGKP R  +  S GMGTIE
Sbjct  256   FIMDLGYAGEDVVANDLQKMVNNLAIMYRQMITNAPCPLLFFGKPYRLGSKPSPGMGTIE  315

Query  1045  NIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIAD  1224
             N+PHNS+HRWVGDPR  N EDMGNFYS+  DP F+SLH+NVDRMWTIWKTLGGKR DI+D
Sbjct  316   NVPHNSIHRWVGDPRQPNQEDMGNFYSSGKDPAFFSLHANVDRMWTIWKTLGGKRKDISD  375

Query  1225  KDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP-TRKRTVKLSIT-  1398
              D+LDTEF F+DE     +V+V+DCLD +KLGYTFQ M  PWK+FKP  RK T  + I  
Sbjct  376   PDYLDTEFFFYDEKAKPFRVRVQDCLDEKKLGYTFQPMDTPWKNFKPLLRKNTKNVKIDP  435

Query  1399  ESVPASTDVLP-APLSKNLTFYVTRSTSVPETQEEMLNLDLV------YDDTKFIRFDVF  1557
              SVP ++ V P   L K +TF V R   +   +E+    +L+       D  KF+RFDVF
Sbjct  436   NSVPPASQVFPIKKLDKIVTFSVARPKKLRTKKEKEDEEELLTFKNVELDVRKFVRFDVF  495

Query  1558  LNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVL  1737
             LNED DV   E+DRTE+ GSF NLPH+H+      K   F+LAI+EL++DL LEGDD V+
Sbjct  496   LNEDNDVIANEIDRTEFVGSFANLPHIHDDPKKE-KFPEFSLAINELLEDLKLEGDDLVV  554

Query  1738  VTLVPKVGGSFVTVNNAYINTLDC  1809
             VTLVPK+GG  V++    I  + C
Sbjct  555   VTLVPKIGGDNVSIEAVEIQLVPC  578



>gb|AEO00529.1| polyphenol oxidase [Nicotiana benthamiana]
Length=588

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/576 (51%), Positives = 380/576 (66%), Gaps = 33/576 (6%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+FL+       +R    K  C A+S   D+N D++     DRRNVLLGLGGLYGA NL 
Sbjct  32    QLFLH------GKRNQNFKFSCNANSSETDKNLDAV-----DRRNVLLGLGGLYGAANLA  80

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
                  P A A P+P PD+ +C  A I+    +V Y CCPPI +D   V YYK PS  KL 
Sbjct  81    -----PLATAAPIPPPDLKSCSKAHIN-DQEEVSYSCCPPIPSDMDSVPYYKFPSMPKLR  134

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQI  654
             +RPAAHA D  Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY + G   Q+
Sbjct  135   IRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQV  194

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             HF+W FFPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LYD
Sbjct  195   HFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMFDREG--SSLYD  252

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RNQ HR G ++DL + G ++      ++ NNL IMYRQMITNAPCPLLFFG+P     
Sbjct  253   ARRNQSHRNGTIIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGT  312

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANH----EDMGNFYSAANDPVFYSLHSNVDRMWT  1182
               S GMGTIENIPH  VH WVG   + N+    EDMGNFYSA  DP+FYS H+NVDRMW+
Sbjct  313   DPSPGMGTIENIPHTPVHIWVGSRPNENNVSHGEDMGNFYSAGLDPLFYSHHANVDRMWS  372

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
              WK LGGKR D+ +KDWL++EF F+DE +   +VKVRDCL ++K+G+ +  MP PW++FK
Sbjct  373   EWKALGGKRRDLTNKDWLNSEFFFYDENRNPFRVKVRDCLHSKKMGFDYAPMPTPWRNFK  432

Query  1363  PTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-DLV  1521
             PTRK         SVP ++ V P + L + ++F + R +S         QEEML   ++ 
Sbjct  433   PTRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIK  492

Query  1522  YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELI  1701
             YDD+K+IRFDVFLN D+ VN  ELD+ EYAGS+ +LPHVH   +    + TF LAI+EL+
Sbjct  493   YDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNATHVTSVTFQLAITELL  552

Query  1702  KDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             +D+ LE +D + VT+VPK GG  +++    I  +DC
Sbjct  553   EDIGLEDEDAIAVTVVPKTGGEEISIQGVEIKLVDC  588



>emb|CAA73103.1| polyphenol oxidase [Nicotiana tabacum]
Length=592

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/576 (52%), Positives = 379/576 (66%), Gaps = 33/576 (6%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+FL+       +R    K  C A+S   D+N D++     DRRNVLLGLGGLYGA NL 
Sbjct  36    QLFLH------GKRNQNFKFSCNANSGEHDKNLDAV-----DRRNVLLGLGGLYGAANLA  84

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
                  P A A P+P PD+ +C  A I+    +V Y CCPPI +D   V YYK PS  KL 
Sbjct  85    -----PLATAAPIPPPDLKSCSKAHIN-DKEEVSYSCCPPIPSDMDSVPYYKFPSMPKLR  138

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQI  654
             +RPAAHA D  Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY + G   Q+
Sbjct  139   IRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQV  198

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             HF+W FFPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LYD
Sbjct  199   HFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMGIPPMFDREG--SSLYD  256

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RNQ HR G ++DL + G ++      ++ NNL IMYRQMITNAPCPLLFFG+P     
Sbjct  257   ARRNQSHRNGTIIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGT  316

Query  1015  TQSSGMGTIENIPHNSVHRWVG---DPRSANH-EDMGNFYSAANDPVFYSLHSNVDRMWT  1182
               S GMGTIENIPH  VH WVG   D  +  H EDMGNFYSA  DP+FYS H+NVDRMW+
Sbjct  317   DPSPGMGTIENIPHTPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWS  376

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
              WK LGGKR D+  KDWL++EF F+DE +   +VKVRDCLD++K+G+ +  MP PW++FK
Sbjct  377   EWKALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFK  436

Query  1363  PTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-DLV  1521
             P RK         SVP ++ V P + L + ++F + R +S         QEEML   ++ 
Sbjct  437   PIRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIK  496

Query  1522  YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELI  1701
             YDD+K+IRFDVFLN D+ VN  ELD+ EYAGS+ +LPHVH    +   + TF LAI+EL+
Sbjct  497   YDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSVTFQLAITELL  556

Query  1702  KDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             +D+ LE +D + VT+VPK GG  +++    I  +DC
Sbjct  557   EDIGLEDEDTIAVTVVPKTGGEEISIEGVEIKLVDC  592



>ref|XP_009767375.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=591

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/576 (51%), Positives = 378/576 (66%), Gaps = 33/576 (6%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+FL+       +R    K  C A+S   D+N D++     DRRNVLLGLGGLYGA NL 
Sbjct  35    QLFLH------GKRNQNFKFSCNANSGEHDKNLDAV-----DRRNVLLGLGGLYGAANLA  83

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
                  P A A P+P PD+ +C  A I+    +V Y CCPPI +D   V  YK PS  KL 
Sbjct  84    -----PLATAAPIPSPDLKSCSKAHIN-DKEEVSYSCCPPIPSDMDSVPCYKFPSMPKLR  137

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQI  654
             +RPAAHA D  Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY + G   Q+
Sbjct  138   IRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQV  197

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             HF+W FFPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LYD
Sbjct  198   HFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMFDREG--SSLYD  255

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RNQ HR G ++DL + G ++      ++ NNL IMYRQMITNAPCPLLFFG+P     
Sbjct  256   ARRNQSHRNGTIIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGT  315

Query  1015  TQSSGMGTIENIPHNSVHRWVG---DPRSANH-EDMGNFYSAANDPVFYSLHSNVDRMWT  1182
               S GMGTIENIPH  VH WVG   D  +  H EDMGNFYSA  DP+FYS H+NVDRMW+
Sbjct  316   DPSPGMGTIENIPHTPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWS  375

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
              WK LGGKR D+  KDWL++EF F+DE +   +VKVRDCLD++K+G+ +  MP PW++FK
Sbjct  376   EWKALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFK  435

Query  1363  PTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-DLV  1521
             P RK         SVP ++ V P + L + ++F + R +S         QEEML   ++ 
Sbjct  436   PIRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIK  495

Query  1522  YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELI  1701
             YDD+K+IRFDVFLN D+ VN  ELD+ EYAGS+ +LPHVH    +   + TF LAI+EL+
Sbjct  496   YDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSVTFQLAITELL  555

Query  1702  KDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             +D+ LE +D + VT+VPK GG  +++    I  +DC
Sbjct  556   EDIGLEDEDTIAVTVVPKTGGEEISIEGVEIKLVDC  591



>sp|Q08296.1|PPOF_SOLLC RecName: Full=Polyphenol oxidase F, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78300.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=585

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/566 (51%), Positives = 373/566 (66%), Gaps = 27/566 (5%)
 Frame = +1

Query  145   PSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPF  324
             P    RR  + K+ C       D+N D++     DRRNVLLGLGG YGA NL      P 
Sbjct  36    PFLHGRRCQSFKVSCNVGEH--DKNLDAV-----DRRNVLLGLGGFYGAANLA-----PL  83

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHA  501
             A A P+P PD+ +CG A I     +V Y CCPP+  D   V YYK P  +KL +RP AHA
Sbjct  84    ASAAPIPPPDLKSCGVAHIDDKGTEVSYSCCPPVPDDIDSVPYYKFPPMTKLRIRPPAHA  143

Query  502   VDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFF  675
              D  Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY + G   Q+HF+W FF
Sbjct  144   ADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWLFF  203

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LYD+ RNQ+H
Sbjct  204   PFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREG--SSLYDEKRNQNH  261

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             R G ++DL + G D+  P    + NNL +MYRQM+TNAPCP  FFG PL +D     GMG
Sbjct  262   RNGTIIDLGHFGKDVRTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAPLGSD--PEPGMG  319

Query  1036  TIENIPHNSVHRWVGD-PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRT  1212
             TIENIPH  VH W GD PR  + EDMGNFYSA  DP+FY  H+NVDRMW  WK +GGKR 
Sbjct  320   TIENIPHTPVHIWTGDSPRQGHGEDMGNFYSAGLDPLFYCHHANVDRMWNEWKLIGGKRR  379

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLS  1392
             D+++KDWL++EF F+DE +   +VKVRDCLD++K+G+ +  MP PW++FKP R+ +    
Sbjct  380   DLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYPPMPTPWRNFKPIRRSSSGKV  439

Query  1393  ITESVPASTDVLP-APLSKNLTFYVTRSTSVPETQE-----EMLNLD-LVYDDTKFIRFD  1551
              T S+   + V P A L + ++F +TR  S   TQE     E+L  + + YDDTK++RFD
Sbjct  440   NTASIAPVSKVFPLAKLDRAISFSLTRPASSRTTQEKNEQQEILTFNKMAYDDTKYVRFD  499

Query  1552  VFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDK  1731
             VFLN D+ VN  ELD+ E+AGS+ +LPHVH       K  TF LAI+EL++D+ LE +D 
Sbjct  500   VFLNVDKTVNAEELDKAEFAGSYTSLPHVHGNNDNHVKDVTFTLAITELLEDIGLEDEDT  559

Query  1732  VLVTLVPKVGGSFVTVNNAYINTLDC  1809
             + VTLVPKVGG  V++ +  I   DC
Sbjct  560   IAVTLVPKVGGEGVSIESVEIKLEDC  585



>sp|Q06355.1|PPOB_SOLTU RecName: Full=Catechol oxidase B, chloroplastic; AltName: Full=Polyphenol 
oxidase; Short=PPO; Flags: Precursor, partial [Solanum 
tuberosum]
 gb|AAA02879.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=588

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/606 (50%), Positives = 396/606 (65%), Gaps = 32/606 (5%)
 Frame = +1

Query  31    ATSTHPIVSCTNInsfstnsssprnfsrppsQIFLNPNPSRAARRGDAVKIRCAASSE--  204
             ++ST  I  CTN +  S+ +++  +F   PSQ+FL+       RR  + K+ C A++   
Sbjct  2     SSSTTTIPLCTNKSLSSSFTTNNSSFLSKPSQLFLH------GRRNQSFKVSCNANNNVG  55

Query  205   GRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATIS  384
               D+N D++     DRRNVLLGLGGLYGA NL      P A A P+P PD+ +CG A ++
Sbjct  56    EHDKNLDTV-----DRRNVLLGLGGLYGAANLA-----PLASASPIPPPDLKSCGVAHVT  105

Query  385   FSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLP  561
                  V Y CCPP+  D   V YYK P  +KL +RP AHA D  Y+ KY+ A  +M++L 
Sbjct  106   -EGVDVTYSCCPPVPDDIDSVPYYKFPPMTKLRIRPPAHAADEEYVAKYQLATSRMRELD  164

Query  562   SD--DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLYFFERIMQSMIND  735
              D  DP  F QQAN+HCAYCNGAY + G   Q+HF+W FFPFHRWYLYF+ERI+ S+IND
Sbjct  165   KDSFDPLGFKQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLIND  224

Query  736   PTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDP  915
             PTF LPYWNWD+P GM  P +FD E   S LYD  RNQ+HR G ++DL + G ++  P  
Sbjct  225   PTFALPYWNWDHPKGMRIPPMFDREG--SSLYDDKRNQNHRNGTIIDLGHFGQEVDTPQL  282

Query  916   TKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGD-PRS  1092
               + NNL +MYRQM+TNAPCP  FFG         S GMGTIENIPH  VH W GD PR 
Sbjct  283   QIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGTEPSPGMGTIENIPHTPVHIWTGDSPRQ  342

Query  1093  ANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKT  1272
              N E+MGNFYSA  DP+FY  H+NVDRMW  WK +GGKR D+++KDWL++EF F+DE + 
Sbjct  343   KNGENMGNFYSAGLDPIFYCHHANVDRMWDEWKLIGGKRRDLSNKDWLNSEFFFYDENRN  402

Query  1273  AVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPASTDVLP-APLSKN  1449
               +VKVRDCLD++K+G+++  MP PW++FKP RK T     T S+   T V P A L + 
Sbjct  403   PYRVKVRDCLDSKKMGFSYAPMPTPWRNFKPIRKTTAGKVNTASIAPVTKVFPLAKLDRA  462

Query  1450  LTFYVTRSTSVPET-----QEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYA  1611
             ++F +TR  S   T     QEE+L  + V YDDTK++RFDVFLN D+ VN  ELD+ E+A
Sbjct  463   ISFSITRPASSRTTQEKNEQEEILTFNKVAYDDTKYVRFDVFLNVDKTVNADELDKAEFA  522

Query  1612  GSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAY  1791
             GS+ +LPHVH   +    + TF LAI+EL++D  LE +D + VTLVPKVGG  V++ +  
Sbjct  523   GSYTSLPHVHGNNTNHVTSVTFKLAITELLEDNGLEDEDTIAVTLVPKVGGEGVSIESVE  582

Query  1792  INTLDC  1809
             I   DC
Sbjct  583   IKLEDC  588



>ref|XP_004246033.1| PREDICTED: polyphenol oxidase F, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/567 (51%), Positives = 370/567 (65%), Gaps = 25/567 (4%)
 Frame = +1

Query  142   NPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNP  321
              P    RR  + K+ C       D+N D++     DRRNVLLGLGG YGA NL      P
Sbjct  35    QPFLHGRRCQSFKVSCNVGEH--DKNLDAV-----DRRNVLLGLGGFYGAANLA-----P  82

Query  322   FALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAH  498
              A A P+P PD+ +CG A I     +V Y CCPP+  D   V YYK P  +KL +RP AH
Sbjct  83    LASAAPIPPPDLKSCGVAHIDDKGTEVSYSCCPPVPDDIDSVPYYKFPPMTKLRIRPPAH  142

Query  499   AVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFF  672
             A D  Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY + G   Q+HF+W F
Sbjct  143   AADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWLF  202

Query  673   FPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQD  852
             FPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LYD+ RNQ+
Sbjct  203   FPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREG--SSLYDEKRNQN  260

Query  853   HRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGM  1032
             HR G ++DL + G D+  P    + NNL +MYRQM+TNAPCP  FFG      +    GM
Sbjct  261   HRNGTIIDLGHFGKDVETPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGSDPEPGM  320

Query  1033  GTIENIPHNSVHRWVGD-PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
             GTIENIPH  VH W GD PR  + EDMGNFYSA  DP+FY  H+NVDRMW  WK +GGKR
Sbjct  321   GTIENIPHTPVHIWTGDSPRQGHGEDMGNFYSAGLDPLFYCHHANVDRMWNEWKLIGGKR  380

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKL  1389
              D+++KDWL++EF F+DE +   +VKVRDCLD++K+G+ +  MP PW++FKP R+ +   
Sbjct  381   RDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRRSSSGK  440

Query  1390  SITESVPASTDVLP-APLSKNLTFYVTRSTSVPET-----QEEMLNLD-LVYDDTKFIRF  1548
               T S+   + V P A L + ++F +TR  S   T     QEE+L  + + YDDTK++RF
Sbjct  441   VNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKMAYDDTKYVRF  500

Query  1549  DVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDD  1728
             DVFLN D+ VN  ELD+ E+AGS+ +LPHVH       K  TF LAI+EL++D+ LE +D
Sbjct  501   DVFLNVDKTVNAEELDKAEFAGSYTSLPHVHGNNDNHVKDVTFTLAITELLEDIGLEDED  560

Query  1729  KVLVTLVPKVGGSFVTVNNAYINTLDC  1809
              + VTLVPKVGG  V++ +  I   DC
Sbjct  561   TIAVTLVPKVGGEGVSIESVEIKLEDC  587



>ref|XP_010325653.1| PREDICTED: polyphenol oxidase E, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/603 (50%), Positives = 393/603 (65%), Gaps = 34/603 (6%)
 Frame = +1

Query  34    TSTHPIVSCTNInsfstnsssprnfsrppsQIFLNPNPSRAARRGDAVKIRCAASSEGRD  213
             T+T P+  CTN +  S+ +++  +    PSQ+FL+       RR  + K+ C A++   D
Sbjct  8     TTTLPL--CTNKSLSSSFTTTNSSLLSKPSQLFLH------GRRNQSFKVSCNANNV--D  57

Query  214   ENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSS  393
             +NPD++     DRRNVLLGLGGLYGA NL      P A A P+P PD+ +CG A +    
Sbjct  58    KNPDAV-----DRRNVLLGLGGLYGAANLA-----PLATAAPIPPPDLKSCGTAHVK-EG  106

Query  394   CKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSD-  567
               V Y CCPP+  D   V YYK PS +KL +RP AHA D  Y+ KY+ A  +M++L  D 
Sbjct  107   VDVIYSCCPPVPDDIDSVPYYKFPSMTKLRIRPPAHAADEEYVAKYQLATSRMRELDKDP  166

Query  568   -DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTF  744
              DP  F QQAN+HCAYCNGAY + G   Q+HF+W FFPFHRWYLYF+ERI+ S+INDPTF
Sbjct  167   FDPLGFKQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTF  226

Query  745   TLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKV  924
              LPYWNWD+P GM  P +FD E   S LYD+ RNQ+HR G ++DL + G ++  P    +
Sbjct  227   ALPYWNWDHPKGMRIPPMFDREG--SSLYDEKRNQNHRNGTIIDLGHFGKEVDTPQLQIM  284

Query  925   KNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGD-PRSANH  1101
              NNL +MYRQM+TNAPCP  FFG      +  S G GTIENIPH  VH W GD PR  N 
Sbjct  285   TNNLTLMYRQMVTNAPCPSQFFGAAYPLGSEPSPGQGTIENIPHTPVHIWTGDKPRQKNG  344

Query  1102  EDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVK  1281
             EDMGNFYSA  DP+FY  H+NVDRMW  WK +GGKR D+ DKDWL++EF F+DE +   +
Sbjct  345   EDMGNFYSAGLDPIFYCHHANVDRMWNEWKLIGGKRRDLTDKDWLNSEFFFYDENRNPYR  404

Query  1282  VKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTF  1458
             VKVRDCLD++K+G+ +  MP PW++FKP RK +     T S+   + V P A L + ++F
Sbjct  405   VKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSSSGKVNTASIAPVSKVFPLAKLDRAISF  464

Query  1459  YVTRSTSVPET-----QEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
              +TR  S   T     QEE+L  + + YDD  ++RFDVFLN D+ VN  ELD+ E+AGS+
Sbjct  465   SITRPASSRTTQEKNEQEEILTFNKISYDDRNYVRFDVFLNVDKTVNADELDKAEFAGSY  524

Query  1621  GNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINT  1800
              +LPHVH   +    + TF LAI+EL++D+ LE +D + VTLVPK GG  V++ +  I  
Sbjct  525   TSLPHVHGSNTNHVTSVTFKLAITELLEDIGLEDEDTIAVTLVPKAGGEEVSIESVEIKL  584

Query  1801  LDC  1809
              DC
Sbjct  585   EDC  587



>gb|AGK83468.1| polyphenol oxidase [Nicotiana tabacum]
Length=590

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/576 (51%), Positives = 377/576 (65%), Gaps = 33/576 (6%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+FL+       +R    K    A+S   D+N D++     DRRNVLLGLGGLYGA NL 
Sbjct  34    QLFLH------GKRNQNFKFSRNANSGEHDKNLDAV-----DRRNVLLGLGGLYGAANLA  82

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
                  P A A P+P PD+ +C  A I+    +V Y CCPPI +D   V YYK PS  KL 
Sbjct  83    -----PLATAAPIPPPDLKSCSKAHIN-DKEEVSYSCCPPIPSDMDSVPYYKFPSMPKLR  136

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQI  654
             +RPAAHA D  Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY + G   Q+
Sbjct  137   IRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQV  196

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             HF+W FFPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LYD
Sbjct  197   HFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMFDREG--SSLYD  254

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RNQ HR G ++DL + G ++      ++ NNL IMYRQMITNAPCPLLFFG+P     
Sbjct  255   ARRNQSHRNGTIIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGT  314

Query  1015  TQSSGMGTIENIPHNSVHRWVG---DPRSANH-EDMGNFYSAANDPVFYSLHSNVDRMWT  1182
               S GMGTIENIPH   H WVG   D  +  H EDMGNFYSA  DP+FYS H+NVDRMW+
Sbjct  315   DPSPGMGTIENIPHTPAHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWS  374

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
              WK LGGKR D+  KDWL++EF F+DE +   +VKVRDCLD++K+G+ +  MP PW++FK
Sbjct  375   EWKALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFK  434

Query  1363  PTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-DLV  1521
             P RK         SVP ++ V P + L + ++F + R +S         QEEML   ++ 
Sbjct  435   PIRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIK  494

Query  1522  YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELI  1701
             YDD+K+IRFDVFLN D+ VN  ELD+ EYAGS+ +LPHVH    +   + TF LAI+EL+
Sbjct  495   YDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSVTFQLAITELL  554

Query  1702  KDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             +D+ LE +D + VT+VPK GG  +++    I  +DC
Sbjct  555   EDIGLEDEDTIAVTVVPKTGGEEISIEGVEIKLVDC  590



>sp|Q08307.1|PPOE_SOLLC RecName: Full=Polyphenol oxidase E, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78299.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=587

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/603 (50%), Positives = 393/603 (65%), Gaps = 34/603 (6%)
 Frame = +1

Query  34    TSTHPIVSCTNInsfstnsssprnfsrppsQIFLNPNPSRAARRGDAVKIRCAASSEGRD  213
             T+T P+  CTN +  S+ +++  +    PSQ+FL+       RR  + K+ C A++   D
Sbjct  8     TTTLPL--CTNKSLSSSFTTTNSSLLSKPSQLFLH------GRRNQSFKVSCNANNV--D  57

Query  214   ENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSS  393
             +NPD++     DRRNVLLGLGGLYGA NL      P A A P+P PD+ +CG A +    
Sbjct  58    KNPDAV-----DRRNVLLGLGGLYGAANLA-----PLATAAPIPPPDLKSCGTAHVK-EG  106

Query  394   CKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSD-  567
               V Y CCPP+  D   V YYK PS +KL +RP AHA D  Y+ KY+ A  +M++L  D 
Sbjct  107   VDVIYSCCPPVPDDIDSVPYYKFPSMTKLRIRPPAHAADEEYVAKYQLATSRMRELDKDP  166

Query  568   -DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTF  744
              DP  F QQAN+HCAYCNGAY + G   Q+HF+W FFPFHRWYLYF+ERI+ S+INDPTF
Sbjct  167   FDPLGFKQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTF  226

Query  745   TLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKV  924
              LPYWNWD+P GM  P +FD E   S LYD+ RNQ+HR G ++DL + G ++  P    +
Sbjct  227   ALPYWNWDHPKGMRIPPMFDREG--SSLYDEKRNQNHRNGTIIDLGHFGKEVDTPQLQIM  284

Query  925   KNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGD-PRSANH  1101
              NNL +MYRQM+TNAPCP  FFG      +  S G GTIENIPH  VH W GD PR  N 
Sbjct  285   TNNLTLMYRQMVTNAPCPSQFFGAAYPLGSEPSPGQGTIENIPHTPVHIWTGDKPRQKNG  344

Query  1102  EDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVK  1281
             EDMGNFYSA  DP+FY  H+NVDRMW  WK +GGKR D+ DKDWL++EF F+DE +   +
Sbjct  345   EDMGNFYSAGLDPIFYCHHANVDRMWNEWKLIGGKRRDLTDKDWLNSEFFFYDENRNPYR  404

Query  1282  VKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTF  1458
             VKVRDCLD++K+G+ +  MP PW++FKP RK +     T S+   + V P A L + ++F
Sbjct  405   VKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSSSGKVNTASIAPVSKVFPLAKLDRAISF  464

Query  1459  YVTRSTSVPET-----QEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
              +TR  S   T     QEE+L  + + YDD  ++RFDVFLN D+ VN  ELD+ E+AGS+
Sbjct  465   SITRPASSRTTQEKNEQEEILTFNKISYDDRNYVRFDVFLNVDKTVNADELDKAEFAGSY  524

Query  1621  GNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINT  1800
              +LPHVH   +    + TF LAI+EL++D+ LE +D + VTLVPK GG  V++ +  I  
Sbjct  525   TSLPHVHGSNTNHVTSLTFKLAITELLEDIGLEDEDTIAVTLVPKAGGEEVSIESVEIKL  584

Query  1801  LDC  1809
              DC
Sbjct  585   EDC  587



>ref|XP_009590067.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/610 (50%), Positives = 395/610 (65%), Gaps = 37/610 (6%)
 Frame = +1

Query  22    AAMATSTHPIVSCTNInsfstnsssprnfsrppsQIFLNPNPSRAARRGDAVKIRCAASS  201
             A+ ++ST P+  C N    S+ +++  +F   PSQ+FL+       +R    K  C A+S
Sbjct  2     ASSSSSTLPL--CANKTPSSSFTNTNSSFFAKPSQLFLH------GKRNQNFKFSCNANS  53

Query  202   EGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATI  381
                    D  +   +DRRNVLLGLGGLYGA NL      P A A P+P PD+ +C  A I
Sbjct  54    -------DKNNLEAVDRRNVLLGLGGLYGAANLA-----PLATAAPIPPPDLKSCSKAHI  101

Query  382   SFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDL  558
             +    +V Y CCPPI +D   V YYK  S  KL +RPAAHA D  Y+ KY+ A  +M++L
Sbjct  102   N-DKTEVSYSCCPPIPSDMDSVPYYKFSSMPKLRIRPAAHAADEEYIAKYQLATSRMREL  160

Query  559   PSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLYFFERIMQSMIN  732
               D  DP  F QQAN+HCAYCNGAY + G   Q+HF+W FFPFHRWYLYF+ERI+ S+IN
Sbjct  161   DKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLIN  220

Query  733   DPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPD  912
             DPTF LPYWNWD+P GM  P +FD E   S LYD+ RNQ HR G ++DL + G ++    
Sbjct  221   DPTFGLPYWNWDHPKGMRIPPMFDREG--SSLYDEKRNQSHRNGTIIDLGHFGQEVQTTQ  278

Query  913   PTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVG---D  1083
               ++ NNL IMYRQMITNAPCPLLFFG+P       S GMGTIENIPH  VH WVG   D
Sbjct  279   LQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGTDPSPGMGTIENIPHTPVHIWVGSRLD  338

Query  1084  PRSANH-EDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFD  1260
               +  H EDMGNFYSA  DP+FYS H+NVDRMW+ WK LGGKR D+  KDWL++EF F+D
Sbjct  339   ENNTKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEWKALGGKRRDLTHKDWLNSEFFFYD  398

Query  1261  ETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPASTDVLP-AP  1437
             E +   +VKVRDCLD++K+G+ +  MP PW++FKP RK         SVP ++ V P + 
Sbjct  399   ENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSNAGKVNLSSVPPASRVFPLSK  458

Query  1438  LSKNLTFYVTRSTSV-----PETQEEMLNL-DLVYDDTKFIRFDVFLNEDEDVNTVELDR  1599
             L + ++F + R +S         QEEML   ++ YDD+K+IRFDVFLN D+ VN  ELD+
Sbjct  459   LDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDSKYIRFDVFLNVDKTVNADELDK  518

Query  1600  TEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTV  1779
              EYAGS+ +LPHVH    +   + TF LAI+EL++D+ LE +D + VT+VPK GG  +++
Sbjct  519   AEYAGSYTSLPHVHGDNVSHVTSVTFQLAITELLEDIGLEDEDTIAVTVVPKKGGEEISI  578

Query  1780  NNAYINTLDC  1809
                 I  ++C
Sbjct  579   EAVEIKLVNC  588



>gb|AAA02877.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=583

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/575 (50%), Positives = 377/575 (66%), Gaps = 32/575 (6%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSE--GRDENPDSLSKAKLDRRNVllglgglygayn  297
             Q+FL+       RR  + K+ C A++     D+N D++     DRRNVLLGLGGLYGA N
Sbjct  28    QLFLH------GRRNQSFKVSCNANNNVGEHDKNLDAV-----DRRNVLLGLGGLYGAAN  76

Query  298   lgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSK  474
             L      P A A P+P PD+ +CG A +      V Y CCPP+  D   V YYK PS +K
Sbjct  77    LA-----PLASASPIPPPDLKSCGVAHVK-EGVDVSYSCCPPVPDDIDSVPYYKFPSMTK  130

Query  475   LNVRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPY  648
             L +RP AHA D  Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY + G   
Sbjct  131   LRIRPPAHAADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGGKEL  190

Query  649   QIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPL  828
             Q+HF+W FFPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S L
Sbjct  191   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREG--SSL  248

Query  829   YDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             YD  RNQ+HR G ++DL + G ++  P    + NNL +MYRQM+TNAPCP  FFG     
Sbjct  249   YDDKRNQNHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPL  308

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGD-PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTI  1185
                 S G GTIENIPH  VH W GD PR  N E+MGNFYSA  DP+FY  H+NVDRMW  
Sbjct  309   GTEPSPGQGTIENIPHTPVHIWTGDKPRQKNGENMGNFYSAGLDPLFYCHHANVDRMWDE  368

Query  1186  WKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP  1365
             WK +GGKR D+++KDWL++EF F+DE +   +VKVRD LD++K+G+++  MP PW++FKP
Sbjct  369   WKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDSLDSKKMGFSYAPMPTPWRNFKP  428

Query  1366  TRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSVPET-----QEEMLNL-DLVY  1524
              RK T  +  T S+   T V P A L + ++F +TR  S   T     QEE+L    + Y
Sbjct  429   IRKTTAGIVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFKKIAY  488

Query  1525  DDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIK  1704
             DDT+++RFDVFLN D+ VN  ELD+ E+AGS+ +LPHVH   +    + TF +AI+EL++
Sbjct  489   DDTQYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHATSVTFTVAITELLE  548

Query  1705  DLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             D+ LE +D + VTLVPKVGG  V++ +  I   DC
Sbjct  549   DIGLEDEDTIAVTLVPKVGGEGVSIESVEIKLEDC  583



>ref|XP_004246041.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Solanum 
lycopersicum]
Length=589

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/578 (51%), Positives = 396/578 (69%), Gaps = 25/578 (4%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKA---KLDRRNVllglgglygay  294
             +IF+ P      +R D  K+ C   +     + D+  K+   KLDRRNVLLGLGGLYGA 
Sbjct  19    KIFIRP------KRIDNFKVNCEIKNSNTINDDDNEGKSFPGKLDRRNVLLGLGGLYGAS  72

Query  295   nlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFS  471
             NL    + PFAL  PVP PD + C  A++   S +VP+ CCPP+  D T +  YK+P+ S
Sbjct  73    NLIGVPNEPFALGAPVPPPDFSTCSTASLPDGS-QVPFSCCPPLPKDLTNIPTYKLPNVS  131

Query  472   KLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYL---LNGN  642
             K+ +RPAAH V   Y+ KY TAIQKMK L  DDP +F QQAN+HCAYCN  Y      G 
Sbjct  132   KVKIRPAAHNVTQEYITKYNTAIQKMKSLDKDDPLSFIQQANIHCAYCNSGYKELGFPGV  191

Query  643   PYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLS  822
             P Q+HF+W FFPFHRWYLYFFERI+ S+I D TF LP+WN+D+  GM  P +++D N  S
Sbjct  192   PLQVHFSWLFFPFHRWYLYFFERILGSLIGDDTFALPFWNYDSQVGMQLPSLYNDVN--S  249

Query  823   PLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPL  1002
             PLYD  RNQ+H   +V+DL ++  D+ A D  K+ NNL +MYRQM+TNAPCP LFFG P+
Sbjct  250   PLYDPNRNQNHFPPNVVDLGFTTIDLDASDQQKINNNLTMMYRQMLTNAPCPQLFFGNPI  309

Query  1003  RADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             R       GMGTIEN+PHNSVHRWVG+P +   E+MG FYSAA DP+FY+ H+NVDRMWT
Sbjct  310   RGGEQPIRGMGTIENVPHNSVHRWVGNPNNKFRENMGTFYSAARDPIFYAHHANVDRMWT  369

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
             IWKTLGG R D  D+DWLD+ FLF+DE +T VKV V+DC++NEKLGY +Q++PIPWK++K
Sbjct  370   IWKTLGGNRRDYNDRDWLDSAFLFYDENRTLVKVTVQDCINNEKLGYKYQNVPIPWKNYK  429

Query  1363  PTRKRTVKLSITESVPASTDVLPAPLSKNLTFY-----VTRSTSVPETQEEMLNL-DLVY  1524
             P  ++       ++V  ST++ P+ L K L+F      ++R+    + +EE+L   ++ +
Sbjct  430   PVPRKQKVKKNPKNVKPSTEIFPSTLKKTLSFSIKRPNISRTQQDKDIEEELLVFNNMTF  489

Query  1525  DDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT---FNLAISE  1695
             D+ ++IRFDVF+NEDE V    LDRTEY GSF NLPHVH  GS++  + T    +L ISE
Sbjct  490   DENEYIRFDVFINEDEGVKAKVLDRTEYVGSFANLPHVHAAGSSSSSSGTPAVMSLGISE  549

Query  1696  LIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             +++DL LE +++++V +VP+ GG  +T+ +  INTL C
Sbjct  550   ILEDLGLEDEEEIVVVVVPQSGGKEITIGSVEINTLAC  587



>ref|XP_006365391.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Solanum 
tuberosum]
Length=604

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/563 (52%), Positives = 391/563 (69%), Gaps = 19/563 (3%)
 Frame = +1

Query  166   GDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
             G   KIR  A ++   + P    + KLDRRNVLLGLGGLYGA NL    + PFAL  PVP
Sbjct  44    GKRSKIR-QAYNQMLGDYPKVDWRGKLDRRNVLLGLGGLYGASNLIGVTNEPFALGAPVP  102

Query  346   LPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLE  522
              PD + C  A++   S +VP+ CCPP+  D T +  YK+P+ SK+ +RPAAH V   Y+ 
Sbjct  103   PPDFSTCSTASLPDGS-QVPFSCCPPLPKDLTNIPTYKLPNVSKVKIRPAAHNVTQEYIT  161

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYL---LNGNPYQIHFNWFFFPFHRWY  693
             KY TAIQKMK L  DDP +F QQAN+HCAYCN  Y      G P Q+HF+W FFPFHRWY
Sbjct  162   KYNTAIQKMKSLDKDDPLSFIQQANIHCAYCNSGYKELGFPGVPLQVHFSWLFFPFHRWY  221

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFERI+ S+I D TF LP+WN+D+  GM FP +++D N  S LYD  RNQ+H   +V+
Sbjct  222   LYFFERILGSLIGDDTFALPFWNYDSQVGMQFPSLYNDVN--SSLYDPNRNQNHFPPNVI  279

Query  874   DLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIP  1053
             DL ++  D+ A D  K+ NNL +MYRQM+TNAPCP LFFG P+R       GMGTIEN+P
Sbjct  280   DLGFTTIDLDASDQQKINNNLTMMYRQMLTNAPCPQLFFGNPIRGGEQPIRGMGTIENVP  339

Query  1054  HNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDW  1233
             HNSVHRWVG+P +   E+MG FYSAA DP+FY+ H+NVDRMWTIWKTLGG R D  D+DW
Sbjct  340   HNSVHRWVGNPNNKFRENMGTFYSAARDPIFYAHHANVDRMWTIWKTLGGNRRDFNDRDW  399

Query  1234  LDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPA  1413
             LD+ FLF+DE +T VKV V+DC++NEKLGY ++++PIPWK++KP  ++       ++V  
Sbjct  400   LDSAFLFYDENRTLVKVTVQDCINNEKLGYKYENVPIPWKNYKPVPRKQKLKKNPKNVKP  459

Query  1414  STDVLPAPLSKNLTF-----YVTRSTSVPETQEEMLNL-DLVYDDTKFIRFDVFLNEDED  1575
             ST++ P+ L K L+F      ++R+    + +EE+L   ++ +D+ ++IRFDVF+NEDE 
Sbjct  460   STEIFPSTLKKTLSFSIKRPKISRTQQDKDIEEELLVFNNMTFDENEYIRFDVFINEDEG  519

Query  1576  VNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT-----FNLAISELIKDLDLEGDDKVLV  1740
             V +  LDRTEY GSF NLPHVH  G+ T  +++      +LAISE+++DL LE +++++V
Sbjct  520   VKSKVLDRTEYVGSFANLPHVHAAGNNTGSSSSGTPAVMSLAISEILEDLGLEDEEEIVV  579

Query  1741  TLVPKVGGSFVTVNNAYINTLDC  1809
              +VPK GG  +T+ +  I+TL C
Sbjct  580   VVVPKFGGKEITIASVEIDTLAC  602



>gb|ABE96885.1| polyphenol oxidase [Nicotiana tabacum]
Length=502

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/505 (53%), Positives = 341/505 (68%), Gaps = 17/505 (3%)
 Frame = +1

Query  337   PVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAA  513
             P+P PD+ +C  A I+    +V Y CCPPI +D   V YYK PS  KL +RPAAHA D  
Sbjct  1     PIPPPDLKSCSKAHIN-DKAEVSYSCCPPIPSDMDSVPYYKFPSMPKLRIRPAAHAADEE  59

Query  514   YLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHR  687
             Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY + G   Q+HF+W FFPFHR
Sbjct  60    YIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWLFFPFHR  119

Query  688   WYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGH  867
             WYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LYD  RNQ HR G 
Sbjct  120   WYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMFDREG--SSLYDARRNQSHRNGT  177

Query  868   VLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIEN  1047
             ++DL + G ++      ++ NNL IMYRQMITNAPCPLLFFG+P       S GMGTIEN
Sbjct  178   IIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGTDPSPGMGTIEN  237

Query  1048  IPHNSVHRWVG---DPRSANH-EDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTD  1215
             IPH  VH WVG   D  +  H EDMGNFYSA  DP+FYS H+NVDRMW+ WK LGGKR D
Sbjct  238   IPHTPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEWKALGGKRRD  297

Query  1216  IADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSI  1395
             +  KDWL++EF F+DE +   +VKVRDCLD++K+G+ +  MP PW++FKP RK       
Sbjct  298   LTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSNAGKVN  357

Query  1396  TESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-DLVYDDTKFIRFDV  1554
               SVP ++ V P + L + ++F + R +S         QEEML   ++ YDD+K+IRFDV
Sbjct  358   LSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDSKYIRFDV  417

Query  1555  FLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKV  1734
             FLN D+ VN  ELD+ EYAGS+ +LPHVH    +   + TF LAI+EL++D+ LE +D +
Sbjct  418   FLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSVTFQLAITELLEDIGLEDEDTI  477

Query  1735  LVTLVPKVGGSFVTVNNAYINTLDC  1809
              VT+VPK GG  +++    I  +DC
Sbjct  478   AVTVVPKTGGEEISIEGVEIKLVDC  502



>gb|AAB22610.1| polyphenoloxidase (chloroplast) [Solanum lycopersicum]
Length=587

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/603 (49%), Positives = 391/603 (65%), Gaps = 34/603 (6%)
 Frame = +1

Query  34    TSTHPIVSCTNInsfstnsssprnfsrppsQIFLNPNPSRAARRGDAVKIRCAASSEGRD  213
             T+T P+  CTN +  S+ +++  +    PSQ+FL+       RR  + K+ C A++   D
Sbjct  8     TTTLPL--CTNKSLSSSFTTTNSSLLSKPSQLFLH------GRRNQSFKVSCNANNV--D  57

Query  214   ENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSS  393
             +NPD++     DRRNVLLGLGGLYGA NL      P A A P+P PD+ +CG A +    
Sbjct  58    KNPDAV-----DRRNVLLGLGGLYGAANLA-----PLATAAPIPPPDLKSCGTAHVK-EG  106

Query  394   CKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSD-  567
               V Y CCPP+  D   V YYK PS +KL +RP AHA D  Y+ KY+ A  +M++L  D 
Sbjct  107   VDVIYSCCPPVPDDIDSVPYYKFPSMTKLRIRPPAHAADEEYVAKYQLATSRMRELDKDP  166

Query  568   -DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTF  744
              DP  F QQAN+HCAYCNGAY + G   Q+HF+W FFPFHRWYLYF+ERI+ S+INDPTF
Sbjct  167   FDPLGFKQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTF  226

Query  745   TLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKV  924
              LPYWNWD+P GM  P +FD E   S LYD+ RNQ+HR G ++DL + G ++  P    +
Sbjct  227   ALPYWNWDHPKGMRIPPMFDREG--SSLYDEKRNQNHRNGTIIDLGHFGKEVDTPQLQIM  284

Query  925   KNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGD-PRSANH  1101
              NNL +MYRQM+TNAPCP  FFG         S G GTIENIPH  VH W GD PR  N 
Sbjct  285   TNNLTLMYRQMVTNAPCPSQFFGAAYLWVLNPSPGQGTIENIPHTPVHIWTGDKPRQKNG  344

Query  1102  EDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVK  1281
             EDMGNFYSA  DP+FY  H+NVDRMW  WK +GGKR D+ DKDWL++EF F+DE +   +
Sbjct  345   EDMGNFYSAGLDPIFYCHHANVDRMWNEWKLIGGKRRDLTDKDWLNSEFFFYDENRNPYR  404

Query  1282  VKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTF  1458
             VKVRD LD++K+G+ +  MP PW++FKP RK +     T S+   + V P A L + ++F
Sbjct  405   VKVRDVLDSKKMGFDYAPMPTPWRNFKPIRKSSSGKVNTASIAPVSKVFPLAKLDRAISF  464

Query  1459  YVTRSTSVPET-----QEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
              +TR  S   T     QEE+L  + + YDD  ++RFDVFLN D+ VN  ELD+ E+AGS+
Sbjct  465   SITRPASSRTTQEKNEQEEILTFNKISYDDRNYVRFDVFLNVDKTVNADELDKAEFAGSY  524

Query  1621  GNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINT  1800
              +LPHVH   +    + TF LAI+EL++D+ LE +D + VTL+PK GG  V++ +  I  
Sbjct  525   TSLPHVHGSNTNHVTSVTFKLAITELLEDIGLEDEDTIAVTLIPKAGGEGVSIESVEIKL  584

Query  1801  LDC  1809
              DC
Sbjct  585   EDC  587



>ref|XP_006355239.1| PREDICTED: catechol oxidase B, chloroplastic [Solanum tuberosum]
Length=589

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/609 (49%), Positives = 395/609 (65%), Gaps = 34/609 (6%)
 Frame = +1

Query  22    AAMATSTHPIVSCTNInsfstnsssprnfsrppsQIFLNPNPSRAARRGDAVKIRCAASS  201
             ++ +T+T P+  CTN +  S+ +++  +F   PSQ+FL+       RR  + K+ C  ++
Sbjct  2     SSSSTTTLPL--CTNKSLSSSFTTNNSSFLSKPSQLFLH------GRRNQSFKVSCNVNN  53

Query  202   E--GRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPA  375
                  ++N D++     DRRNVLLGLGGLYGA NL      P A A P+P PD+ +CG A
Sbjct  54    NVGEHEKNLDAV-----DRRNVLLGLGGLYGAANLA-----PLASASPIPPPDLKSCGVA  103

Query  376   TISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMK  552
              +      V Y CCPP+  D   V YYK P  +KL +RP AHA D  Y+ KY+ A  +M+
Sbjct  104   HVK-EGVDVLYSCCPPVPDDIDSVPYYKFPPMTKLRIRPPAHAADEEYVAKYQLATSRMR  162

Query  553   DLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLYFFERIMQSM  726
             +L  D  DP  F QQAN+HCAYCNGAY + G   Q+HF+W FFPFHRWYLYF+ERI+ S+
Sbjct  163   ELDKDSFDPLGFKQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSL  222

Query  727   INDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIA  906
             INDPTF LPYWNWD+P GM  P +FD E   S LYD  RNQ+HR G ++DL + G ++  
Sbjct  223   INDPTFALPYWNWDHPKGMRIPPMFDREG--SSLYDDKRNQNHRNGTIIDLGHFGKEVDT  280

Query  907   PDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGD-  1083
             P    + NNL +MYRQM+TNAPCP  FFG         S GMGTIENIPH  VH W GD 
Sbjct  281   PQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGTKPSPGMGTIENIPHTPVHIWTGDT  340

Query  1084  PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDE  1263
             PR  N E+MGNFYSA  DP+FY  H+NVDRMW  WK +GGKR D+++KDWL++EF F+DE
Sbjct  341   PRQKNGENMGNFYSAGLDPIFYCHHANVDRMWDEWKLIGGKRRDLSNKDWLNSEFFFYDE  400

Query  1264  TKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPASTDVLP-APL  1440
              +   +VKVRD LD++K+G+++  MP PW++FKP RK T     T S+   T V P A L
Sbjct  401   NRNPYRVKVRDSLDSKKMGFSYAPMPTPWRNFKPIRKTTAGKVNTASIAPVTKVFPLAKL  460

Query  1441  SKNLTFYVTRSTSVPET-----QEEMLNLD-LVYDDTKFIRFDVFLNEDEDVNTVELDRT  1602
              + ++F +TR  S   T     QEE+L  + + YDDT+++RFDVFLN D+ VN  ELD+ 
Sbjct  461   DRAISFSITRPASSRTTQEKNEQEEILTFNKIAYDDTQYVRFDVFLNVDKTVNADELDKA  520

Query  1603  EYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVN  1782
             E+AGS+ +LPHVH   +    +  F LAI+EL++D  LE +D + VTLVPKVGG  V++ 
Sbjct  521   EFAGSYTSLPHVHGNNTNHVTSVIFKLAITELLEDNGLEDEDTIAVTLVPKVGGEGVSIE  580

Query  1783  NAYINTLDC  1809
             +  I   DC
Sbjct  581   SVEIKLEDC  589



>ref|XP_009791071.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=600

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/578 (51%), Positives = 364/578 (63%), Gaps = 30/578 (5%)
 Frame = +1

Query  139   PNPSR---AARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R  + K+ C  S+   DEN  ++    +DRRNVLLGLGGLYGA N+   
Sbjct  32    PKPSQLFLRGKRNHSFKVSCKVSNG--DEN-KTVEANSVDRRNVLLGLGGLYGASNVV--  86

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPP--ITDTTKVEYYKIPSFSKLNV  483
                P A A P+P P  +             VPY CCPP    D   + YYK P+ SKL +
Sbjct  87    ---PLASATPIPAPTTSCSKTGATIKPGVPVPYSCCPPPLKIDPKDIPYYKFPTGSKLRI  143

Query  484   RPAAHAVDAAYLEKYKTAIQKMKDLP---SDDPRNFYQQANVHCAYCNGAYLLNGNPYQI  654
             RPA+HAVD  Y+ KY  AI KMK+L     DDPR F  QA +HCAYCNGAY + G   QI
Sbjct  144   RPASHAVDEEYMAKYNLAITKMKELDVTDPDDPRGFTAQAKIHCAYCNGAYTVAGKELQI  203

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             HF+W FFPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD  N    LYD
Sbjct  204   HFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRLPHMFDQPNVYPDLYD  263

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RNQ+HR   ++DL + G D+   D   + NNL +MYRQMITN+PCP LFFGKP   + 
Sbjct  264   PRRNQEHRGSVIMDLGHFGQDVKGTDLQMMSNNLTLMYRQMITNSPCPQLFFGKPYCTEV  323

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANH----EDMGNFYSAANDPVFYSLHSNVDRMWT  1182
                 G G IENIPH  VH WVG   + N+    EDMGNFYSA  DP FYS H+NVDRMWT
Sbjct  324   GPKPGQGAIENIPHTPVHIWVGSKPNENNCKNGEDMGNFYSAGKDPAFYSHHANVDRMWT  383

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
             IWKTLGGKR DI   D+L+TEF F+DE K    VKVRDCLDN+K+GY FQ MP PW++FK
Sbjct  384   IWKTLGGKRKDINKPDYLNTEFFFYDEKKNPYLVKVRDCLDNKKMGYDFQAMPTPWRNFK  443

Query  1363  PTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSVPETQ-----EEMLN-LDLV  1521
             P +K   K++   SV ++T   P A + K +TF + R TS    Q     EEML  L+L 
Sbjct  444   PLKKSKSKVN-ARSVQSATQTFPIAKIDKPITFSIKRETSGRTQQEKDAKEEMLTFLELN  502

Query  1522  YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSA--TPKTTTFNLAISE  1695
              D  K IRFDVF+N D + N  ELDR E+AGS+  LPHVH   S         F LAI+E
Sbjct  503   IDQRKHIRFDVFINADANSNWHELDRAEFAGSYTALPHVHSDPSKPHVAPVAKFQLAITE  562

Query  1696  LIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             L++++ LE +D ++VTLVPK GG FV + +A I    C
Sbjct  563   LLEEIGLEDEDDIVVTLVPKTGGEFVAIKSAVITLEAC  600



>gb|ADY18412.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=584

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/574 (51%), Positives = 378/574 (66%), Gaps = 30/574 (5%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGR-DENPDSLSKAKLDRRNVllglgglygaynl  300
             Q+FL+        R  + K+ C A++ G  D+N D++     DRRNVLLGLGGLYGA NL
Sbjct  29    QLFLH------RSRSQSFKVSCNANNVGEHDKNLDAI-----DRRNVLLGLGGLYGAANL  77

Query  301   gaggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKL  477
                     A A P+P PD  +C  A I   + +VPY CCPP   D   V YYK P  +KL
Sbjct  78    APLA----ASAAPIPSPDPKSCSKAHIK-PNKEVPYSCCPPPPQDIDSVPYYKFPPMTKL  132

Query  478   NVRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQ  651
              +RP AHAVD  Y+ KY+ A  +M++L  D  DP  F QQAN+HC+YC GAY + G   Q
Sbjct  133   RIRPPAHAVDEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCSYCCGAYKVGGKVLQ  192

Query  652   IHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLY  831
             +H +W FFPFHRW+LYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LY
Sbjct  193   VHSSWLFFPFHRWFLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDHEG--SSLY  250

Query  832   DQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRAD  1011
             D+ RNQ+HR G +++L +S  +    +   + NNL +MYRQM+TNAPCPLLFFG P    
Sbjct  251   DEKRNQNHRNGKIINLGFSCKETQTTELQTMTNNLTLMYRQMVTNAPCPLLFFGNPYPLG  310

Query  1012  NTQSSGMGTIENIPHNSVHRWVGD-PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
                  GMGTIENIPHN+VH W GD PR  N E MG FYSA  DPVFYS H+NVDRMW  W
Sbjct  311   TDPKPGMGTIENIPHNAVHNWTGDQPRQPNGEHMGTFYSAGLDPVFYSHHANVDRMWNEW  370

Query  1189  KTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT  1368
             K +GGKR D+ADKDWL++EF F+DE +   KVKVRDCLD++K+G+ +  MP PW++FKP 
Sbjct  371   KAIGGKRRDLADKDWLNSEFFFYDENRNPFKVKVRDCLDSKKMGFDYAPMPTPWRNFKPI  430

Query  1369  RKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNLDLV-YD  1527
             RK T   +   S+P ++ V P A L + ++F + RS S         QEE+L  + V YD
Sbjct  431   RKTTSGKANIGSIPPASKVFPIAKLDRAISFSINRSASSRTQAEKNEQEEILTFNKVQYD  490

Query  1528  DTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
             D++ +RFDVFLN D+ VN  ELD+ E+AGS+ +LPHVH   +    + TF L I+EL++D
Sbjct  491   DSQCVRFDVFLNVDKTVNADELDKPEFAGSYTSLPHVHGDNNTHVTSVTFKLVITELLED  550

Query  1708  LDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             + LE +D + VTLVPK GG  +++ NA I  +DC
Sbjct  551   IGLEDEDTIAVTLVPKEGGEGISIENAEIVLMDC  584



>ref|XP_009624738.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=601

 Score =   541 bits (1393),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 293/578 (51%), Positives = 362/578 (63%), Gaps = 29/578 (5%)
 Frame = +1

Query  139   PNPSR---AARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R  + K+ C  S+   DEN    +   +DRRNVLLGLGGLYGA N+   
Sbjct  32    PKPSQLFLRGKRNHSFKVSCKVSNG--DENQSVETNNSVDRRNVLLGLGGLYGAANVV--  87

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPP--ITDTTKVEYYKIPSFSKLNV  483
                P A A P+P P  +             VPY CCPP    D   + +Y  P+ SKL +
Sbjct  88    ---PLASATPIPAPTTSCSKTGATIKPGLPVPYSCCPPPLKIDPKDIPHYTFPTGSKLRI  144

Query  484   RPAAHAVDAAYLEKYKTAIQKMKDLP---SDDPRNFYQQANVHCAYCNGAYLLNGNPYQI  654
             RPA+HAVD  Y+ KY  AI KMK+L     DDPR F  QA +HCAYCNGAY + G   QI
Sbjct  145   RPASHAVDEEYMAKYNLAITKMKELDVTDPDDPRGFAAQAKIHCAYCNGAYTVAGKELQI  204

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             HF+W FFPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD  N    LYD
Sbjct  205   HFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRLPHMFDQPNVYPDLYD  264

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RNQ+HR   ++DL + G D+   D   + NNL +MYRQMITN+PCP LFFGKP   + 
Sbjct  265   PRRNQEHRGSVIMDLGHFGQDVKGTDLQMMSNNLTLMYRQMITNSPCPQLFFGKPYCTEV  324

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANH----EDMGNFYSAANDPVFYSLHSNVDRMWT  1182
                 G G IENIPH  VH WVG   + N+    EDMGNFYSA  DP FYS H+NVDRMWT
Sbjct  325   GPKPGQGAIENIPHTPVHIWVGSKPNENNCKNGEDMGNFYSAGKDPAFYSHHANVDRMWT  384

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
             IWKTLGGKR DI   D+L++EF F+DE K    VKVRDCLDN+K+GY FQ MP PW++FK
Sbjct  385   IWKTLGGKRKDINKPDYLNSEFFFYDEKKNPFLVKVRDCLDNKKMGYDFQAMPTPWRNFK  444

Query  1363  PTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTS-----VPETQEEMLN-LDLV  1521
             P +K   K++   SVP  T   P A + K +TF + R TS       + +EEML  L+L 
Sbjct  445   PLKKSKSKVN-ARSVPPVTQTFPIAKIDKAITFSIKRETSGRTQQEKDAEEEMLTFLELN  503

Query  1522  YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSA--TPKTTTFNLAISE  1695
              D  K IRFDVF+N D + N  ELDR E+AGS+  LPHVH   +         F LAI+E
Sbjct  504   IDQRKHIRFDVFINADANSNWYELDRAEFAGSYTALPHVHSDPTKPHVAPIAKFQLAITE  563

Query  1696  LIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             L++++ LE +D ++VTLVPK GG FV + +A I    C
Sbjct  564   LLEEIGLEDEDDIVVTLVPKTGGEFVAIKSAVITLEAC  601



>gb|ADY18410.1| chloroplast polyphenol oxidase precursor, partial [Solanum melongena]
Length=584

 Score =   534 bits (1375),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 286/574 (50%), Positives = 374/574 (65%), Gaps = 30/574 (5%)
 Frame = +1

Query  139   PNPSR---AARRGDAVKIRCAASSEGR-DENPDSLSKAKLDRRNVllglgglygaynlga  306
             P PS+      R    K+ C A++ G  D+N D++     DRRNVLLGLGGLYGA NL  
Sbjct  24    PQPSKLFLQRTRSQRFKVSCNANNVGEHDKNLDAV-----DRRNVLLGLGGLYGAANLAP  78

Query  307   ggSNPFALADPVPLPDVANCGPATISFSSCK-VPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
               +N   +      P++  CG A ++ ++ + V Y CCPPI  D   V YYK PS +KL 
Sbjct  79    LAANAAPIP----PPELKTCGRAVVNDTTGELVKYSCCPPIPDDIDSVPYYKFPSMTKLR  134

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQI  654
             +RP AHAVD  Y+ KY+ A  +M++L  D   P  F QQAN+HCAYCNGAY   G   Q+
Sbjct  135   IRPPAHAVDEEYIAKYQLATSQMRELDKDPFGPIGFKQQANIHCAYCNGAYKAGGKELQV  194

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             HF+W FFPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LYD
Sbjct  195   HFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRLPPMFDVEG--SSLYD  252

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RNQ HR G ++DL + G +    +   + NNL +MYRQM+TNAPCPLLFFG P     
Sbjct  253   AKRNQSHRNGKIIDLGFFGQETETTELQTMTNNLTLMYRQMVTNAPCPLLFFGNPYPLGT  312

Query  1015  TQSSGMGTIENIPHNSVHRWVGD-PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK  1191
                 GMGTIENIPH  VH W GD PR  N EDMGNFYSA  DPVFY  H+NVDRMW  WK
Sbjct  313   DPKPGMGTIENIPHTPVHIWTGDSPRQPNGEDMGNFYSAGLDPVFYCHHANVDRMWNEWK  372

Query  1192  TLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTR  1371
              +GGKR D+ADKDWL++EF F+DE +   KVKVRDCLD++K+G+ +  MP PW++FKP R
Sbjct  373   AIGGKRRDLADKDWLNSEFFFYDENRNPFKVKVRDCLDSKKMGFDYAPMPTPWRNFKPVR  432

Query  1372  KRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPE-------TQEEMLNL-DLVYD  1527
             + T   + T S+P ++ V P   ++   F   R TS  +        QE   N+  + YD
Sbjct  433   RTTSGKANTRSIPPASKVFPTCETRQSDFIFHRQTSFVKDSKAEKNEQEGDTNIRQIQYD  492

Query  1528  DTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
             D++++RFDVFLN D+ V  +ELD+ E+AGS+ +LPHVH      P   TF LAI+EL++D
Sbjct  493   DSQYVRFDVFLNVDKTVKALELDQPEFAGSYTSLPHVHGDKDRAP--VTFKLAITELLED  550

Query  1708  LDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
              +LE ++ +++TL+PK GG  +++ NA I+ +DC
Sbjct  551   NNLEDEESIVITLIPKAGGDGISIQNAVIDLVDC  584



>gb|AAA85122.1| polyphenol oxidase [Solanum tuberosum]
Length=599

 Score =   533 bits (1374),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 290/581 (50%), Positives = 366/581 (63%), Gaps = 34/581 (6%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  S+ G D+N  ++    +DRRNVLLGLGGLYG  N    
Sbjct  29    PKPSQLFLHGKRNKTFKVSCKVSNSG-DQN-QNIETNSVDRRNVLLGLGGLYGVANAIPL  86

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI--TDTTKVEYYKIPSFSKLNV  483
                  A A P+P PD+  CG ATIS     VPY CCPP   T+   + YYK PS +KL +
Sbjct  87    A----ASATPIPSPDLKTCGRATISDGPL-VPYTCCPPPMPTNFDTIPYYKFPSMTKLRI  141

Query  484   RPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQI  654
             RP AHAVD  Y+ KY  AI +MKDL   DP N   F QQAN+HCAYCNGAY++ G   Q+
Sbjct  142   RPPAHAVDEEYIAKYNLAISRMKDLDKTDPLNPLGFKQQANIHCAYCNGAYIIGGKELQV  201

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H +W FFPFHRWYLYF+ERI+  +I+DPTF LPYWNWD+P GM  P +FD E   + +YD
Sbjct  202   HNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWNWDHPKGMRLPPMFDREG--TSIYD  259

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
             + RNQ  R G V+DL   GD +       + NNL +MYRQM+TNAPCPLLFFG P    N
Sbjct  260   ERRNQQVRNGTVMDLGSFGDKVQTTQLQLMSNNLTLMYRQMVTNAPCPLLFFGAPYVLGN  319

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANH--------EDMGNFYSAANDPVFYSLHSNVD  1170
                +  GTIENIPH  VH W G  R +          EDMGNFYSA  DPVFY  H NVD
Sbjct  320   NVEAP-GTIENIPHIPVHIWAGTVRGSTFPNGDTSYGEDMGNFYSAGLDPVFYCHHGNVD  378

Query  1171  RMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW  1350
             RMW  WK +GGKR D+++KDWL++EF F+DE K   +VKVRDCLD +K+GY +  MP PW
Sbjct  379   RMWNEWKAIGGKRRDLSEKDWLNSEFFFYDENKKPYRVKVRDCLDAKKMGYDYAPMPTPW  438

Query  1351  KDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL  1512
             ++FKP  K +V    T ++P    V P   + K ++F + R  S         QEEML  
Sbjct  439   RNFKPKTKASVGKVNTTTLPPVNKVFPLTKMDKAISFSINRPASSRTQQEKNEQEEMLTF  498

Query  1513  D-LVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHE-GGSATPKTTTFNLA  1686
             D + YD+  +IRFDVFLN D +VN  ELD+ E+AGS+ +LPHVH  G +    T TF LA
Sbjct  499   DNIKYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGENDHTATVTFQLA  558

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             I+EL++D+ LE ++ + VTLVPK GG  +++ N  I  LDC
Sbjct  559   ITELLEDIGLEDEETIAVTLVPKKGGEGISIENVEIKLLDC  599



>gb|ACN78382.1| polyphenol oxidase [Solanum quitoense]
Length=472

 Score =   522 bits (1345),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 251/466 (54%), Positives = 324/466 (70%), Gaps = 13/466 (3%)
 Frame = +1

Query  397   KVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSD--  567
             +V Y CCPPI  D   V YYK PS +KL +RP AHAVD  Y+ KY+ A  +M+ L  D  
Sbjct  9     EVTYSCCPPIPEDIDSVPYYKFPSMTKLRIRPPAHAVDEEYIAKYQLATSRMRGLDKDPF  68

Query  568   DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFT  747
             DP  F QQAN+HCAYCNGAY + G   Q+HF+W FFPFHRWYLYF+ERI+ S+INDPTF 
Sbjct  69    DPLGFKQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFA  128

Query  748   LPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVK  927
             LPYWNWD+P GM  P +FD E   S LYD+ RNQ+HR G ++DL + G +        + 
Sbjct  129   LPYWNWDHPKGMRIPPMFDVEG--SSLYDEKRNQNHRNGKIIDLGFFGKETQTTQLQTMT  186

Query  928   NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHED  1107
             NNL +MYRQMITNAPCP LFFG P       S GMGTIENIPHN+VH WVGDPR  N ED
Sbjct  187   NNLTLMYRQMITNAPCPSLFFGNPYPLGTDPSPGMGTIENIPHNAVHVWVGDPRQPNGED  246

Query  1108  MGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVK  1287
             MGNFYS+  +P F+  HSNVDRMW  WK +GGKR D+ADKDWL+TEFLF+DE +   +V+
Sbjct  247   MGNFYSSGLEPAFFCHHSNVDRMWNEWKAIGGKRRDLADKDWLNTEFLFYDENRKLFRVR  306

Query  1288  VRDCLDNEKLGYTFQDMPIPWKDFKPT-RKRTVKLSITESVPASTDVLPAP-LSKNLTFY  1461
             VRDCLD++K+G+ +  MP PW++FKP+ RK T     T S+P  + V P P L + ++F 
Sbjct  307   VRDCLDSKKMGFDYAPMPTPWRNFKPSIRKTTAGKLNTSSIPPVSKVFPIPKLDRPISFS  366

Query  1462  V-----TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFG  1623
             +     +R+ +    QEEML    + ++D  ++RFDVFLN D+ VN +ELD+ E+AGS+ 
Sbjct  367   INRPASSRTQAEKNEQEEMLTFHKIQHNDRLYVRFDVFLNVDKTVNALELDQPEFAGSYT  426

Query  1624  NLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVG  1761
             +LPHVH        + T +LAI+EL++D +LE ++ ++VTLVPKVG
Sbjct  427   SLPHVHGDDKPHATSATLSLAITELLEDNNLEDEETIVVTLVPKVG  472



>ref|XP_004246032.1| PREDICTED: polyphenol oxidase B, chloroplastic [Solanum lycopersicum]
 sp|Q08304.1|PPOB_SOLLC RecName: Full=Polyphenol oxidase B, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78296.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=596

 Score =   523 bits (1347),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 286/582 (49%), Positives = 362/582 (62%), Gaps = 38/582 (7%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAA-SSEGRDENPDSLSKAKLDRRNVllglgglygaynlga  306
             P PS+     +R    K+ C   ++ G  +  +S+     DRRNVLLGLGGLYG  N   
Sbjct  28    PKPSQLFLHGKRNKTFKVSCKVINNNGNQDETNSV-----DRRNVLLGLGGLYGVANAIP  82

Query  307   ggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI--TDTTKVEYYKIPSFSKLN  480
                   A A P+P PD+  CG ATIS     VPY CCPP   T+   + YYK PS +KL 
Sbjct  83    LA----ASATPIPSPDLKTCGRATISDGPL-VPYSCCPPPMPTNFDTIPYYKFPSMTKLR  137

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQ  651
             +R  AHAVD  Y+ KY  AI +M+DL   +P N   F QQAN+HCAYCNGAY++ G   Q
Sbjct  138   IRTPAHAVDEEYIAKYNLAISRMRDLDKTEPLNPLGFKQQANIHCAYCNGAYIIGGKELQ  197

Query  652   IHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLY  831
             +H +W FFPFHRWYLYF+ERI+  +I+DPTF LPYWNWD+P GM  P +FD E   S LY
Sbjct  198   VHNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWNWDHPKGMRLPPMFDREG--SSLY  255

Query  832   DQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRAD  1011
             D+ RNQ  R G VLDL   GD +       + NNL +MYRQM+TNAPCPLLFFG P    
Sbjct  256   DERRNQQVRNGTVLDLGSFGDKVETTQLQLMSNNLTLMYRQMVTNAPCPLLFFGAPYVLG  315

Query  1012  NTQSSGMGTIENIPHNSVHRWVGDPRSANH--------EDMGNFYSAANDPVFYSLHSNV  1167
             N   +  GTIE IPH  VH W G  R +          EDMGNFYSA  DPVFY  H NV
Sbjct  316   NNVEAP-GTIETIPHIPVHIWAGTVRGSKFPNGDVSYGEDMGNFYSAGLDPVFYCHHGNV  374

Query  1168  DRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIP  1347
             DRMW  WK +GGKR DI++KDWL++EF F+DE K   +VKVRDCLD +K+GY +  MP P
Sbjct  375   DRMWNEWKAIGGKRRDISEKDWLNSEFFFYDEHKNPYRVKVRDCLDTKKMGYDYAPMPTP  434

Query  1348  WKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLN  1509
             W++FKP  K +V    T ++P + +V P A + K ++F + R  S         QEEML 
Sbjct  435   WRNFKPKSKASVGKVNTSTLPPANEVFPLAKMDKTISFAINRPASSRTQQEKNEQEEMLT  494

Query  1510  L-DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP-KTTTFNL  1683
               ++ YD+  +IRFDVFLN D +VN  ELD+ E+AGS+ +LPHVH  G         F L
Sbjct  495   FNNIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRAGENDHIAKVNFQL  554

Query  1684  AISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             AI+EL++D+ LE +D + VTLVPK GG  +++ N  I  +DC
Sbjct  555   AITELLEDIGLEDEDTIAVTLVPKKGGEGISIENVEIKLVDC  596



>ref|XP_009616674.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=595

 Score =   522 bits (1345),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 288/582 (49%), Positives = 370/582 (64%), Gaps = 37/582 (6%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+FLN       +R  + K+ C    +G   N D++ +  +DRRNVLLGLGGLYGA NL 
Sbjct  30    QLFLN------GKRNQSFKVSCTGEHDG---NLDAIKEGVVDRRNVLLGLGGLYGAANLV  80

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
                  P A A PVP P++ +CG ATI+     VPY CCPP   D   V YYKIP  SKL 
Sbjct  81    -----PLASAAPVPPPNLNSCGTATIT-DGPAVPYSCCPPKPDDMDSVPYYKIPRMSKLR  134

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQI  654
              RPAA  V   Y+ KY+ A  KMK+L  D  DP  F QQAN+HCAYCN AY +     Q+
Sbjct  135   KRPAAQNVTEEYIAKYQLATSKMKELDKDQLDPLGFKQQANIHCAYCNDAYTMGDKKLQV  194

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWDNP GM  P +FD E   S LYD
Sbjct  195   HESWLFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDNPSGMRLPYMFDVEG--SSLYD  252

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RN   R G ++DL + GD++   +   + NNL +MYRQMITNAPCPLLFFG+P R  +
Sbjct  253   ARRNPHVRNGTIIDLGFFGDEVKTNELQMITNNLILMYRQMITNAPCPLLFFGEPYRFGS  312

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSAN--------HEDMGNFYSAANDPVFYSLHSNVD  1170
                 GMGTIENIPHN VH W G  R  +         EDMGNFYS A DPVF+  H+NVD
Sbjct  313   NPEPGMGTIENIPHNPVHIWTGTVRGTDLGNGAKSYGEDMGNFYSTALDPVFFCHHANVD  372

Query  1171  RMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW  1350
             R+W  WK LGGKR D+ D DWL++EF F+DE +   +VKVRDCLD++K+GY ++    PW
Sbjct  373   RLWNEWKALGGKRRDLRDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPTATPW  432

Query  1351  KDFKPTRKRTV-KLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQ-----EEMLNL  1512
             ++FKP +K T  K++++   PAS       L + + F + R  +    Q     EE+L  
Sbjct  433   RNFKPGKKSTAGKVNLSSVKPASKVFPLLNLDRAICFSIERPATSRSQQEKDEFEEILTF  492

Query  1513  DLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP--KTTTFNL  1683
               V YDD+K+IRFDVFLN D+ VN  ++++ EYAGS+ +LPHVH   +AT   K   F L
Sbjct  493   KGVKYDDSKYIRFDVFLNADKTVNADDINKREYAGSYTSLPHVHGPNNATHEFKPKEFKL  552

Query  1684  AISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             AI+EL++D  LE +D + VT+VPK GG  V++++  I   DC
Sbjct  553   AITELLEDCGLEDEDIIAVTVVPKKGGEVVSIHSVEIVLKDC  594



>ref|XP_009771442.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=596

 Score =   522 bits (1344),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 283/582 (49%), Positives = 366/582 (63%), Gaps = 36/582 (6%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
              +FLN       +   + K+ C    +G     D++ +  +DRRNVLLGLGGLYGA NL 
Sbjct  30    HLFLN------GKGNQSFKVSCTGEHDGNQL--DAVKEGAVDRRNVLLGLGGLYGATNLA  81

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
                  P A A PVP PD+ +CGPATI+     VPY CCPP   D   V YYKIP  SKL 
Sbjct  82    -----PLASAAPVPPPDLKSCGPATIT-DGPTVPYSCCPPTPDDMDSVPYYKIPRMSKLR  135

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQI  654
              RP A  V   Y+ KY+ A  KM++L  D  DP  F QQAN+HCAYCN AY +     Q+
Sbjct  136   KRPPAQDVSEEYIAKYQLATSKMRELDKDPFDPLGFKQQANIHCAYCNDAYTMGDQKLQV  195

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   S LYD
Sbjct  196   HQSWLFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDHPSGMRLPAMFDVEG--SSLYD  253

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RN   R G ++DL + GD++   +   + NNL +MYRQMITNAPCPLLFFG+P R  +
Sbjct  254   ARRNPHVRNGTIIDLGFFGDEVKTNEIQMITNNLILMYRQMITNAPCPLLFFGEPYRFGS  313

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSAN--------HEDMGNFYSAANDPVFYSLHSNVD  1170
               + G GTIENIPH  VH W G  R  +         EDMGNFYSA  DPVFYS H+NVD
Sbjct  314   KPNPGQGTIENIPHTPVHIWTGTVRCTDLGNCVPSYGEDMGNFYSAGLDPVFYSHHANVD  373

Query  1171  RMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW  1350
             RMW  WK LGGKR D+ D DWL++EF F+DE +   +VKVRDCLD++K+GY ++    PW
Sbjct  374   RMWNEWKALGGKRRDLTDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPKATPW  433

Query  1351  KDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSVPETQ-----EEMLNL  1512
             ++FKP +K T       SV  ++ V P + L + + F + R  +    Q     EE+L  
Sbjct  434   RNFKPGKKTTPGKVNLRSVKPASKVFPLSNLDRAICFSIERPATSRSQQDKDEFEEVLTF  493

Query  1513  -DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVH--EGGSATPKTTTFNL  1683
              +L YDD+K+I+FDVF+N D+ VN  ++D+ EYAGS+ +LPHVH    G+   +   F L
Sbjct  494   KNLKYDDSKYIKFDVFVNADKTVNADDIDKKEYAGSYTSLPHVHGPNSGNHAVEVQEFKL  553

Query  1684  AISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             AI+EL++D  LE +D + VT+VPK GG  V++N+  I   DC
Sbjct  554   AITELLEDCGLEDEDIIAVTVVPKTGGEVVSINSVLIELKDC  595



>gb|ADY18411.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=586

 Score =   520 bits (1339),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 283/561 (50%), Positives = 373/561 (66%), Gaps = 25/561 (4%)
 Frame = +1

Query  163   RGDAVKIRCAASSEGR-DENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             R  + K+ C A++ G  D+N D++     DRRNVLLGLGGLYGA NL    +N   +   
Sbjct  39    RSQSFKVSCNANNVGEHDKNLDAV-----DRRNVLLGLGGLYGAANLAPLAANAAPIP--  91

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAY  516
                PD+ +C  A I+    +V Y C PPI  D   V YYK P  +KL +RP AHAVD  Y
Sbjct  92    --PPDLKSCSKAHIN-PDKEVTYSCRPPIPQDIDSVPYYKFPPMTKLRIRPPAHAVDEEY  148

Query  517   LEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRW  690
             + KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY +     Q+HF+W FFPFH  
Sbjct  149   IAKYQLATSRMRELGKDPFDPLGFKQQANIHCAYCNGAYKVGEKELQVHFSWLFFPFHMV  208

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             ++ F+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S LYD+ RNQ+HR G +
Sbjct  209   FV-FYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDREG--SSLYDEKRNQNHRNGKI  265

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL + G +    +   + NNL  MYRQM+TNAPCPLLFFG P       S GMGTIENI
Sbjct  266   IDLGFFGTETQTTELQTMTNNLTYMYRQMVTNAPCPLLFFGNPYPLGTDPSPGMGTIENI  325

Query  1051  PHNSVHRWVGD-PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADK  1227
             PHN VH W GD PR  N EDMGNFYSA  DPVFY  H+NVDRMW  WK +GGKR D+ADK
Sbjct  326   PHNPVHIWTGDSPRQPNGEDMGNFYSAGLDPVFYCHHANVDRMWNEWKAIGGKRRDLADK  385

Query  1228  DWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESV  1407
             DWL++E  F+DE +   KVKVRDCLD++K+G+ +  MP PW++FKP RK T   +   S+
Sbjct  386   DWLNSESFFYDENRNPFKVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKTTSGKANIGSI  445

Query  1408  PASTDVLP-APLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLNE  1566
             P ++ V P A L + ++F +     +R+ +    QEE+L  + V YDD++++RFDVFLN 
Sbjct  446   PPASKVFPIAKLDRAISFSINRPASSRTQAEKNEQEEILTFNKVKYDDSQYVRFDVFLNV  505

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTL  1746
             D+ VN  ELD+ E+AGS+ +LPHVH   +    + TFNLAI+EL++D+ LE +D + +TL
Sbjct  506   DKTVNADELDKAEFAGSYTSLPHVHGDNNTHVTSVTFNLAITELLEDIGLEDEDTIALTL  565

Query  1747  VPKVGGSFVTVNNAYINTLDC  1809
             VPK GG  ++++NA I  +DC
Sbjct  566   VPKQGGEGISIDNAEIVLVDC  586



>ref|XP_009588337.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=596

 Score =   520 bits (1339),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 284/571 (50%), Positives = 363/571 (64%), Gaps = 30/571 (5%)
 Frame = +1

Query  157   ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALAD  336
              +R    K+ C    +G     D++ +  +DRRNVLLGLGGLYGA NL      P A A 
Sbjct  35    GKRNQCFKVSCTGEHDGN--QLDAIKEGAVDRRNVLLGLGGLYGAANLA-----PLASAA  87

Query  337   PVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAA  513
             PVP PD  +CG ATI+     VPY CCPP   D   V YYKIP  SKL  RPAA  V   
Sbjct  88    PVPPPDQKSCGTATIT-DGPAVPYSCCPPKPDDMDSVPYYKIPRMSKLRKRPAAQNVTEE  146

Query  514   YLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHR  687
             Y+ KY+ A  KMK+L  D  DP  F QQAN+HCAYCN AY +     Q+H +W FFPFHR
Sbjct  147   YIAKYQLATSKMKELDKDQFDPLGFKQQANIHCAYCNDAYTMGDQKLQVHESWLFFPFHR  206

Query  688   WYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGH  867
             WYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   S LYD  RN   R G 
Sbjct  207   WYLYFYERILGSLIDDPTFALPYWNWDHPSGMRLPPMFDVEG--SSLYDARRNPQVRNGT  264

Query  868   VLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIEN  1047
             ++DL + GD++   +   + NNL +MYRQMITNAPCPLLFFG+P R  +  + G GTIEN
Sbjct  265   IIDLGFFGDEVKTNEIQMITNNLLLMYRQMITNAPCPLLFFGEPYRFGSKPNPGQGTIEN  324

Query  1048  IPHNSVHRWVGDPRSAN--------HEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
             IPH  VH W G  R  +         EDMGNFYSA  DPVFY  H+NVDRMW  WK LGG
Sbjct  325   IPHTPVHIWTGTVRDTDLGNGVKSYGEDMGNFYSAGLDPVFYCHHANVDRMWNEWKALGG  384

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTV  1383
             KR D+ D DWL++EF F+DE +   +VKVRDCLD++K+GY ++    PW++FKP +K T 
Sbjct  385   KRRDLTDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPTSTPWRNFKPGKKSTE  444

Query  1384  -KLSITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFI  1542
              K++++   PAS     + L + + F +     +RS    +  EE+L    V YDD+K+I
Sbjct  445   GKVNLSSIKPASKVFPLSNLDRAICFSIERPATSRSQQEKDELEEILTFKGVKYDDSKYI  504

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP--KTTTFNLAISELIKDLDL  1716
             RFDVFLN D+ VN  ++++ EYAGS+ +LPHVH   +AT   K   F LAI+EL++D  L
Sbjct  505   RFDVFLNADKTVNADDINKREYAGSYTSLPHVHGPNNATHEFKPKEFKLAITELLEDCGL  564

Query  1717  EGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             E +D + VT+VPK GG  V+++N  I   DC
Sbjct  565   EDEDIIAVTVVPKKGGEVVSIDNVEIELKDC  595



>gb|AFJ79639.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=594

 Score =   518 bits (1335),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 278/581 (48%), Positives = 366/581 (63%), Gaps = 32/581 (6%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  S+   D+N + + K  +DRRNVLLGLGG+YGA N    
Sbjct  22    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQNQNEVEKNSVDRRNVLLGLGGMYGAANFAPL  81

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVR  486
              ++          PD+++C  A I+ +  +V Y CC P   D  K+ YYK PS +KL +R
Sbjct  82    AASAAPTP----PPDLSSCSIAKITETE-EVSYSCCAPTPDDLNKIPYYKFPSMTKLRIR  136

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIH  657
               AHA D  Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY +     Q+H
Sbjct  137   QPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQVH  196

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   + LYDQ
Sbjct  197   NSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDGEG--TALYDQ  254

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              RNQ HR G V+DL   GD++   +   + NNL +MYRQM+TNAPCP +FFG P    N 
Sbjct  255   VRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQMVTNAPCPRMFFGAPYVLGNN  314

Query  1018  QSSGMGTIENIPHNSVHRWVG--------DPRSANHEDMGNFYSAANDPVFYSLHSNVDR  1173
               +  GTIE IPH  VH W G        + R+++ E+MG+FYSA  DPVF+  HSNVDR
Sbjct  315   VEAP-GTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHSNVDR  373

Query  1174  MWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWK  1353
             MW+ WK +GGKR DI+ KDWL++EF F+DE     +VKVRDCLD +K+GY +  MP PW+
Sbjct  374   MWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMPTPWR  433

Query  1354  DFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-  1512
             +FKP  K +V    T S+P  + V P A L K ++F + R  S         QEEML   
Sbjct  434   NFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEMLTFN  493

Query  1513  DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTTFNLA  1686
             ++ YD+  ++RFDVFLN D +VN  ELD+ E+AGS+ NLPHVH  G  T    T T  LA
Sbjct  494   NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVATATLQLA  553

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             I+EL++D+ LE +D + VTLVPK GG  +++  A I+  DC
Sbjct  554   ITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  594



>gb|AFJ79641.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=594

 Score =   518 bits (1333),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 278/581 (48%), Positives = 366/581 (63%), Gaps = 32/581 (6%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  S+   D+N + + K  +DRRNVLLGLGG+YGA N    
Sbjct  22    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQNQNEVEKNSVDRRNVLLGLGGMYGAANFAPL  81

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVR  486
              ++          PD+++C  A I+ +  +V Y CC P   D  K+ YYK PS +KL +R
Sbjct  82    AASAAPTP----PPDLSSCSIAKITETE-EVSYSCCAPTPDDLNKIPYYKFPSMTKLRIR  136

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIH  657
               AHA D  Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY +     Q+H
Sbjct  137   QPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQVH  196

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   + LYDQ
Sbjct  197   NSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDGEG--TALYDQ  254

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              RNQ HR G V+DL   GD++   +   + NNL +MYRQM+TNAPCP +FFG P    N 
Sbjct  255   VRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQMVTNAPCPRMFFGAPYVLGNN  314

Query  1018  QSSGMGTIENIPHNSVHRWVG--------DPRSANHEDMGNFYSAANDPVFYSLHSNVDR  1173
               +  GTIE IPH  VH W G        + R+++ E+MG+FYSA  DPVF+  HSNVDR
Sbjct  315   VEAP-GTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHSNVDR  373

Query  1174  MWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWK  1353
             MW+ WK +GGKR DI+ KDWL++EF F+DE     +VKVRDCLD +K+GY +  MP PW+
Sbjct  374   MWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMPRPWR  433

Query  1354  DFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-  1512
             +FKP  K +V    T S+P  + V P A L K ++F + R  S         QEEML   
Sbjct  434   NFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEMLTFN  493

Query  1513  DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTTFNLA  1686
             ++ YD+  ++RFDVFLN D +VN  ELD+ E+AGS+ NLPHVH  G  T    T T  LA
Sbjct  494   NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVATATLQLA  553

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             I+EL++D+ LE +D + VTLVPK GG  +++  A I+  DC
Sbjct  554   ITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  594



>gb|AFJ79643.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=595

 Score =   518 bits (1333),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 278/581 (48%), Positives = 366/581 (63%), Gaps = 32/581 (6%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  S+   D+N + + K  +DRRNVLLGLGG+YGA N    
Sbjct  23    PKPSQLFLHGKRKQTFKVSCKVSNSNGDQNQNEVEKNSVDRRNVLLGLGGMYGAANFAPL  82

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVR  486
              ++          PD+++C  A I+ +  +V Y CC P   D  K+ YYK PS +KL +R
Sbjct  83    AASAAPTP----PPDLSSCSIAKITETE-EVSYSCCAPTPDDLNKIPYYKFPSMTKLRIR  137

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIH  657
               AHA D  Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY +     Q+H
Sbjct  138   QPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQVH  197

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   + LYDQ
Sbjct  198   NSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDGEG--TALYDQ  255

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              RNQ HR G V+DL   GD++   +   + NNL +MYRQM+TNAPCP +FFG P    N 
Sbjct  256   VRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQMVTNAPCPRMFFGAPYVLGNN  315

Query  1018  QSSGMGTIENIPHNSVHRWVG--------DPRSANHEDMGNFYSAANDPVFYSLHSNVDR  1173
               +  GTIE IPH  VH W G        + R+++ E+MG+FYSA  DPVF+  HSNVDR
Sbjct  316   VEAP-GTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHSNVDR  374

Query  1174  MWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWK  1353
             MW+ WK +GGKR DI+ KDWL++EF F+DE     +VKVRDCLD +K+GY +  MP PW+
Sbjct  375   MWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMPRPWR  434

Query  1354  DFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-  1512
             +FKP  K +V    T S+P  + V P A L K ++F + R  S         QEEML   
Sbjct  435   NFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEMLTFN  494

Query  1513  DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTTFNLA  1686
             ++ YD+  ++RFDVFLN D +VN  ELD+ E+AGS+ NLPHVH  G  T    T T  LA
Sbjct  495   NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVATATLQLA  554

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             I+EL++D+ LE +D + VTLVPK GG  +++  A I+  DC
Sbjct  555   ITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  595



>gb|AFJ79640.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=595

 Score =   515 bits (1326),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 277/581 (48%), Positives = 364/581 (63%), Gaps = 32/581 (6%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  S+   D+N + + K  +DRRNVLLGLGG+YGA N    
Sbjct  23    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQNQNEVEKNSVDRRNVLLGLGGMYGAANFAPL  82

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVR  486
              ++          PD+++C  A I+ +  +V Y CC P   D  K+ YYK PS +KL +R
Sbjct  83    AASAAPTP----PPDLSSCSIAKITETE-EVSYSCCAPTPDDLNKIPYYKFPSMTKLRIR  137

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIH  657
               AHA D  Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY +     Q+H
Sbjct  138   QPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQVH  197

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   + LYDQ
Sbjct  198   NSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDGEG--TALYDQ  255

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              RNQ HR G V+DL   GD++   +   + NNL +MYRQM+TNAPCP +FFG  L     
Sbjct  256   VRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQMVTNAPCPRMFFGA-LYVLGN  314

Query  1018  QSSGMGTIENIPHNSVHRWVG--------DPRSANHEDMGNFYSAANDPVFYSLHSNVDR  1173
                  GTIE IPH  VH W G        + R+++ E+MG+FYSA  DPVF+  HSNVDR
Sbjct  315   NVEAPGTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHSNVDR  374

Query  1174  MWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWK  1353
             MW+ WK +GGKR DI+ KDWL++EF F+DE     +VKVRDCLD +K+GY +  MP PW+
Sbjct  375   MWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMPRPWR  434

Query  1354  DFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-  1512
             +FKP  K +V    T S+P  + V P A L K ++F + R  S         QEEML   
Sbjct  435   NFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEMLTFN  494

Query  1513  DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTTFNLA  1686
             ++ YD+  ++RFDVFLN D +VN  ELD+ E+AGS+ NLPHVH  G  T    T T  LA
Sbjct  495   NIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVATATLQLA  554

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             I+EL++D+ LE +D + VTLVPK GG  +++  A I+  DC
Sbjct  555   ITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  595



>gb|ACT22523.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=600

 Score =   512 bits (1319),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 275/581 (47%), Positives = 357/581 (61%), Gaps = 31/581 (5%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R  A K+ C  ++   D+N + +    +DRRNVLLGLGGLYG  N    
Sbjct  27    PKPSQLFLHGKRNQAFKVSCKVTNNNGDQNQNVVDTNSVDRRNVLLGLGGLYGVANAIPL  86

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPIT--DTTKVEYYKIPSFSKLNV  483
                  A A P+P P+  +CG ATIS    +VPY CCPP    D  K+ YYK PS +KL +
Sbjct  87    A----ASATPIPAPNAPSCGTATIS-DGPEVPYTCCPPGMPEDIEKILYYKFPSATKLRI  141

Query  484   RPAAHAVDAAYLEKYKTAIQKMKDLPSDD---PRNFYQQANVHCAYCNGAYLLNGNPYQI  654
             R  AHAVD   + KY  AI KM++L + D   P  F QQAN+HCAYCNGAY + G   Q+
Sbjct  142   RQPAHAVDEELIAKYNLAISKMRELDTTDHFSPLAFKQQANIHCAYCNGAYKIGGKELQV  201

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H +W FFPFHRWYLYF+ERI+  +I+DPTF LPYWNWD+P GM  P IFD   Q + LYD
Sbjct  202   HNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWNWDHPKGMRLPPIFD--RQGTALYD  259

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
             + R+   R G V+DL   GD +       + NNL +MYRQM+TNAPCPL    + LR+  
Sbjct  260   ERRSTQVRNGTVMDLGSFGDKVQTTQLQLMSNNLTLMYRQMVTNAPCPLFILWRTLRSWE  319

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANH--------EDMGNFYSAANDPVFYSLHSNVD  1170
                    T+E IPH  VH WVG  R +          EDMGNFYSA  DPVFY  HSNVD
Sbjct  320   ITLKPQETVEVIPHIPVHIWVGTARGSKFPDGSTSYGEDMGNFYSAGLDPVFYCHHSNVD  379

Query  1171  RMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW  1350
             RMW  WK +GGKR DI+ +DWL++EF FFDE K   +V+VRDCLD + +GY +  MP PW
Sbjct  380   RMWNEWKQIGGKRRDISQRDWLNSEFFFFDENKNPYRVRVRDCLDTKTMGYDYAPMPTPW  439

Query  1351  KDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSVPETQ-----EEMLNL  1512
             ++FKP  K +   + T + P ++ V P A + K +TF + R  S    Q     EEML  
Sbjct  440   RNFKPKTKASSGKANTSAFPPASQVFPLAKMDKVITFSIKRPASSRTQQEKNEKEEMLTF  499

Query  1513  -DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP-KTTTFNLA  1686
              ++ YD+ +++RFDVFLN D +VN  ELD+ E+AGS+ +LPHVH         T T  LA
Sbjct  500   NNIKYDNREYVRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRASQTDHVATATLQLA  559

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             I+EL++D+ LE +D + VTLVPK GG  +++    I+  DC
Sbjct  560   ITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGVEISLADC  600



>ref|XP_006365382.1| PREDICTED: polyphenol oxidase B, chloroplastic-like [Solanum 
tuberosum]
Length=598

 Score =   508 bits (1308),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 281/581 (48%), Positives = 359/581 (62%), Gaps = 35/581 (6%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  ++   D+N ++ S   +DRRNVLLGLGGLYG  N    
Sbjct  29    PKPSQLFLHGKRNQMFKVSCKVTNNNGDQNVETNS---VDRRNVLLGLGGLYGVANAIPL  85

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI--TDTTKVEYYKIPSFSKLNV  483
              ++          PD+  CG ATIS     V Y CCPP   T+   + YYK PS +KL +
Sbjct  86    AASAAPTP----PPDLKTCGKATISDGPL-VGYTCCPPPMPTNFDNIPYYKFPSMTKLRI  140

Query  484   RPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQI  654
             R  AHAVD  Y+ KY  AI +MKDL   +P N   F QQAN+HCAYCNGAY+      Q+
Sbjct  141   RSPAHAVDEEYIAKYNLAISRMKDLDKTEPLNPLGFKQQANIHCAYCNGAYVFGDKVLQV  200

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H +W FFPFHRWYLYF+ERI+  +I+DPTF LPYWNWD+P GM  P +FD E   + +YD
Sbjct  201   HNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWNWDHPKGMRLPPMFDREG--TSIYD  258

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
             + RNQ  R G V+DL   GD +       + NNL +MYRQM+TNAPCPLLFFG P    N
Sbjct  259   ERRNQQVRNGTVMDLGSFGDKVETTQLQLMSNNLTLMYRQMVTNAPCPLLFFGAPYVLGN  318

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANH--------EDMGNFYSAANDPVFYSLHSNVD  1170
                +  GTIENIPH  VH W G  R +          EDMGNFYSA  D VFY  H NVD
Sbjct  319   NVEAP-GTIENIPHIPVHIWAGTVRGSTFPNGDTSYGEDMGNFYSAGLDSVFYCHHGNVD  377

Query  1171  RMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW  1350
             RMW  WK +GGKR D+++KDWL++EF F+DE K   +VKVRDCLD +K+GY +  MP PW
Sbjct  378   RMWNEWKAIGGKRRDLSEKDWLNSEFFFYDENKKPYRVKVRDCLDAKKMGYDYAPMPTPW  437

Query  1351  KDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL  1512
             ++FKP  K +     T S+P   +V P A + K ++F + R  S         QEEML  
Sbjct  438   RNFKPKTKVSAGKVNTSSLPPVNEVFPLAKMDKVISFSINRPASSRTQQEKNEQEEMLTF  497

Query  1513  D-LVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHE-GGSATPKTTTFNLA  1686
             D + YD+  +IRFDVFLN D +VN  ELD+ E+AGS+ +LPHVH  G +    T TF LA
Sbjct  498   DNIKYDNRGYIRFDVFLNVDNNVNANELDKVEFAGSYTSLPHVHRVGENDHTATVTFQLA  557

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             I+EL++D+ LE ++ + VTLVPK GG  +++ N  I  LDC
Sbjct  558   ITELLEDIGLEDEETIAVTLVPKKGGEGISIENVEIKLLDC  598



>ref|XP_006365383.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase D, chloroplastic-like 
[Solanum tuberosum]
Length=631

 Score =   506 bits (1304),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 274/567 (48%), Positives = 358/567 (63%), Gaps = 32/567 (6%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             K+ C  ++   D+N  ++    +DRRNVLLGLGGLYG  N         A A P P PD+
Sbjct  43    KVSCKVTNNNGDQN-QNVETNSVDRRNVLLGLGGLYGVANAIPLA----ASASPTPPPDL  97

Query  358   ANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKT  534
             ++C  ATI+ ++  VPY CC P   D  KV YYK PS +KL VR  AH  +  Y+ KY  
Sbjct  98    SSCSKATINETTV-VPYSCCAPKPDDMEKVPYYKFPSMTKLRVRQPAHEANEEYIAKYNL  156

Query  535   AIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLYFF  705
             A+ KM+DL    P N   F QQAN+HCAYCNGAY + G   Q+H +W FFPFHRWYLYF+
Sbjct  157   AVSKMRDLDKTQPLNPIGFKQQANIHCAYCNGAYRIGGKELQVHNSWLFFPFHRWYLYFY  216

Query  706   ERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY  885
             ERI+  +I+DPTF LPYWNWD+P GM FP ++D E   + L+D  R+Q HR G V+D+ +
Sbjct  217   ERIVGKLIDDPTFALPYWNWDHPKGMRFPAMYDREG--TSLFDVTRDQSHRNGAVIDIGF  274

Query  886   SGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSV  1065
              G+++       + NNL +MYRQM+TNAPCP +FFG P     +     GTIENIPH  V
Sbjct  275   FGNEVETTQLQLMSNNLTLMYRQMVTNAPCPRMFFGGPYDL-GSNVELPGTIENIPHGPV  333

Query  1066  HRWVGDPRSA--------NHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIA  1221
             H W G  R +        N E+MG+FYSA  DPVF+  HSNVDRMW+ WK  GGKRTDI 
Sbjct  334   HIWSGTVRGSTLPNGAISNGENMGHFYSAGLDPVFFCHHSNVDRMWSEWKATGGKRTDIT  393

Query  1222  DKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSI-T  1398
              KDWL++EF F+DE+    KVKVRDCLD +K+GY ++ MP PW++FKP  K +    + T
Sbjct  394   HKDWLNSEFFFYDESGNPFKVKVRDCLDTKKMGYDYEPMPTPWRNFKPKTKASAGKKVNT  453

Query  1399  ESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNL-DLVYDDTKFIRFDVF  1557
              S+P  + V P A L K ++F + R  S         QEEML   ++ YD+  +IRFDVF
Sbjct  454   SSIPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEMLTFNEIKYDNRDYIRFDVF  513

Query  1558  LNEDEDVNTVELDRTEYAGSFGNLPHVHE-GGSATPKTTTFNLAISELIKDLDLEGDDKV  1734
             LN D +VN  ELD+ E+AGS+ +LPHVH  G +    T T  LAI+EL++D+ LE D+ +
Sbjct  514   LNVDNNVNANELDKAEFAGSYTSLPHVHRVGDTNHTATATLQLAITELLEDIGLEDDETI  573

Query  1735  LVTLVPKVGGSFVTVNNAYINTLDC*L  1815
              VTLVPK GG  +++    I   DC L
Sbjct  574   AVTLVPKKGG--ISIGGVEIKLADCXL  598



>ref|XP_004246030.1| PREDICTED: polyphenol oxidase D, chloroplastic [Solanum lycopersicum]
Length=591

 Score =   502 bits (1292),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 274/582 (47%), Positives = 360/582 (62%), Gaps = 38/582 (7%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+FL+       +R  A K+ C  ++   +++  +     +DRRNVLLGLGGLYG  N  
Sbjct  28    QLFLH------GKRNKAFKVSCKVTNTNGNQDETN----SVDRRNVLLGLGGLYGVANAI  77

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
                ++          PD+++C  A I  +   V Y CC P   D  KV YYK PS +KL 
Sbjct  78    PLAASAAPTP----PPDLSSCSIARIDENQV-VSYSCCAPKPDDMEKVPYYKFPSMTKLR  132

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQ  651
             VR  AH  D  Y+ KY  A+ KM+DL    P N   F QQAN+HCAYCNGAY + G   Q
Sbjct  133   VRQPAHEADEEYIAKYNLAVSKMRDLDKTQPLNPIGFKQQANIHCAYCNGAYRIGGKELQ  192

Query  652   IHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLY  831
             +H +W FFPFHRWYLYF+ERI+  +I+DPTF LPYWNWD+P GM FP ++D E     L+
Sbjct  193   VHNSWLFFPFHRWYLYFYERIVGKLIDDPTFALPYWNWDHPKGMRFPAMYDREGTF--LF  250

Query  832   DQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRAD  1011
             D+ R+Q HR G V+DL + G+++       + NNL +MYRQM+TNAPCP +FFG P    
Sbjct  251   DETRDQSHRNGTVIDLGFFGNEVETTQLQMMSNNLTLMYRQMVTNAPCPRMFFGGPYDL-  309

Query  1012  NTQSSGMGTIENIPHNSVHRWVGDPRSA--------NHEDMGNFYSAANDPVFYSLHSNV  1167
              T     GTIENIPH  VH W G  R +        N E+MG+FYSA  DPVF+  HSNV
Sbjct  310   GTNVELPGTIENIPHGPVHIWSGTVRGSTLPNGAISNGENMGHFYSAGLDPVFFCHHSNV  369

Query  1168  DRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIP  1347
             DRMW+ WK  GGKRTDI  KDWL++EF F+DE +   +VKVRDCLD +K+GY ++ M  P
Sbjct  370   DRMWSEWKATGGKRTDITHKDWLNSEFFFYDENENPYRVKVRDCLDTKKMGYDYKPMATP  429

Query  1348  WKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTS--VPE---TQEEMLN  1509
             W++FKP  K +     T S+P  +   P A L K ++F + R TS   P+    QEEML 
Sbjct  430   WRNFKPLTKASAGKVNTSSIPPVSQAFPLAKLDKAVSFSINRPTSSRTPQEKNAQEEMLT  489

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP-KTTTFNL  1683
              + + YD+  +IRFDVFLN D +VN  ELD+ E+AGS+ +LPHVH  G      T  F L
Sbjct  490   FNSIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRAGETNHIATVDFQL  549

Query  1684  AISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             AI+EL++D+ LE +D + VTLVPK GG  +++ NA I+  DC
Sbjct  550   AITELLEDIGLEDEDTIAVTLVPKRGGEGISIENATISLADC  591



>pir||S34786 catechol oxidase (EC 1.10.3.1) precursor - potato (fragment)
Length=588

 Score =   497 bits (1280),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 285/618 (46%), Positives = 380/618 (61%), Gaps = 56/618 (9%)
 Frame = +1

Query  31    ATSTHPIVSCTNInsfstnsssprnfsrppsQIFLNPNPSRAARRGDAVKIRCAASSE--  204
             ++ST  I  CTN +  S+ +++  +F   PSQ+FL+       RR  + K+ C A++   
Sbjct  2     SSSTTTIPLCTNKSLSSSFTTNNSSFLSKPSQLFLH------GRRNQSFKVSCNANNNVG  55

Query  205   GRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATIS  384
               D+N D++     DRRNVLLGLGGLYGA NL      P A A P+P PD+ +CG A ++
Sbjct  56    EHDKNLDTV-----DRRNVLLGLGGLYGAANLA-----PLASASPIPPPDLKSCGVAHVT  105

Query  385   FSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLP  561
                  V Y CCPP+  D   V YYK P  +KL +RP AHA D  Y+ KY+ A  +M++L 
Sbjct  106   -EGVDVTYSCCPPVPDDIDSVPYYKFPPMTKLRIRPPAHAADEEYVAKYQLATSRMRELD  164

Query  562   SD--DPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLYFFERIMQSMIND  735
              D  DP  F QQAN+HCAYCNGAY + G   Q+HF+W FFPFHRWYLYF+ERI+ S+IND
Sbjct  165   KDSFDPLGFKQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLIND  224

Query  736   PTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDP  915
             PTF LPYWNWD+P GM  P +FD E   S LYD  RNQ+HR G ++DL + G ++  P  
Sbjct  225   PTFALPYWNWDHPKGMRIPPMFDREG--SSLYDDKRNQNHRNGTIIDLGHFGQEVDTPQL  282

Query  916   TKVKNNLAIMYRQMITNAPCPLLFFGKP-------------LRADNTQSSGMGTIENIPH  1056
               + NNL +MYRQM+TNAPCP  FFG               LR      +  G +  +  
Sbjct  283   QIMTNNLTLMYRQMVTNAPCPSQFFGAAYLWGLNQVQEWVLLRTSLIPRAISGLVIVLDK  342

Query  1057  NSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWL  1236
              +V  WV    S  H           DP+FY  H+NVDRMW  WK +GGKR D+++KDWL
Sbjct  343   KTVKTWV---ISIQH---------GLDPIFYCHHANVDRMWDEWKLIGGKRRDLSNKDWL  390

Query  1237  DTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAS  1416
             ++EF F+DE +   +VKVRDCLD++K+G+++  MP PW++FKP RK T     T S+   
Sbjct  391   NSEFFFYDENRNPYRVKVRDCLDSKKMGFSYAPMPTPWRNFKPIRKTTAGKVNTASIAPV  450

Query  1417  TDVLP-APLSKNLTFYVTRSTSVPET-----QEEMLNLDLV-YDDTKFIRFDVFLNEDED  1575
             T V P A L + ++F +TR  S   T     QEE+L  + V YDDTK++RFDVFLN D+ 
Sbjct  451   TKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKVAYDDTKYVRFDVFLNVDKT  510

Query  1576  VNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPK  1755
             VN  ELD+ E+AGS+ +LPHVH   +    + TF LAI+EL++D  LE +D + VTLVPK
Sbjct  511   VNADELDKAEFAGSYTSLPHVHGNNTNHVTSVTFKLAITELLEDNGLEDEDTIAVTLVPK  570

Query  1756  VGGSFVTVNNAYINTLDC  1809
             VGG  V++ +  I   DC
Sbjct  571   VGGEGVSIESVEIKLEDC  588



>gb|AAA85121.1| polyphenol oxidase [Solanum tuberosum]
Length=597

 Score =   498 bits (1281),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 272/580 (47%), Positives = 357/580 (62%), Gaps = 32/580 (6%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  ++   D+N  ++    +DRRNVLLGLGGLYG  N    
Sbjct  27    PKPSQLFIHGKRNQMFKVSCKVTNNNGDQN-QNVETNSVDRRNVLLGLGGLYGVANAIPL  85

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVR  486
              ++          PD+++C  A I+ +   VPY CC P   D  KV YYK PS +KL VR
Sbjct  86    AASAAPAP----PPDLSSCSIARINENQV-VPYSCCAPKPDDMEKVPYYKFPSMTKLRVR  140

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIH  657
               AH  +  Y+ KY  AI +MKDL    P N   F QQAN+HCAYCNGAY + G   Q+H
Sbjct  141   QPAHEANEEYIAKYNLAISRMKDLDKTQPLNPIGFKQQANIHCAYCNGAYRIGGKELQVH  200

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF ERI+   I+DPTF LPYWNWD+P GM FP ++D E   + L+D 
Sbjct  201   NSWLFFPFHRWYLYFHERIVGKFIDDPTFALPYWNWDHPKGMRFPAMYDREG--TSLFDV  258

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              R+Q HR G V+DL + G+++       + NNL +MYRQM+TNAPCP +FFG P      
Sbjct  259   TRDQSHRNGAVIDLGFFGNEVETTQLQLMSNNLTLMYRQMVTNAPCPRMFFGGPYDL-GV  317

Query  1018  QSSGMGTIENIPHNSVHRWVGDPRSA--------NHEDMGNFYSAANDPVFYSLHSNVDR  1173
              +   GTIENIPH  VH W G  R +        N E+MG+FYSA  DPVF+  HSNVDR
Sbjct  318   NTELPGTIENIPHGPVHIWSGTVRGSTLPNGAISNGENMGHFYSAGLDPVFFCHHSNVDR  377

Query  1174  MWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWK  1353
             MW+ WK  GGKRTDI  KDWL++EF F+DE +   +VKVRDCLD +K+GY ++ +  PW+
Sbjct  378   MWSEWKATGGKRTDITHKDWLNSEFFFYDENENPYRVKVRDCLDTKKMGYDYKPIATPWR  437

Query  1354  DFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNLD  1515
             +FKP  K +     T S+P +++V P A L K ++F + R TS         QEEML   
Sbjct  438   NFKPLTKASAGKVNTASLPPASNVFPLAKLDKAISFSINRPTSSRTQQEKNAQEEMLTFS  497

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP-KTTTFNLAI  1689
              + YD+  +IRFDVF N D +VN  ELD+ E+AGS+ +LPHVH  G      T  F LAI
Sbjct  498   SIRYDNRGYIRFDVFSNVDNNVNANELDKAEFAGSYTSLPHVHRAGETNHIATVDFQLAI  557

Query  1690  SELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             +EL++D+ LE +D + VTLVPK GG  +++  A I+  DC
Sbjct  558   TELLEDIGLEDEDTIAVTLVPKRGGEGISIEGATISLADC  597



>gb|ADG56700.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=601

 Score =   494 bits (1271),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 274/585 (47%), Positives = 363/585 (62%), Gaps = 38/585 (6%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  S+   D+N + + K  +DRRNVLLGLGG+YGA N    
Sbjct  27    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQNQNEVEKNSVDRRNVLLGLGGMYGAANFAPL  86

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVR  486
              ++          PD+++C  A I+ +  +V Y CC P   D  K+ YYK PS +KL +R
Sbjct  87    AASAAPTP----PPDLSSCSIAKITETE-EVSYSCCAPTPDDLNKIPYYKFPSMTKLRIR  141

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIH  657
               AHA D  Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY +     Q+H
Sbjct  142   QPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQVH  201

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   + LYDQ
Sbjct  202   NSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDREG--TALYDQ  259

Query  838   YRNQDHR-YGHVLDLAYSGDDIIAPDPTKVK---NNLAIMYRQMITNAPCPLLFFGKPLR  1005
              RNQ HR    V+D  +    ++    TK++   N L +MYRQM+TNAPCP +FFG P  
Sbjct  260   VRNQSHRPREGVMDFWFL--LVMKVQTTKLQLMSNTLTLMYRQMVTNAPCPRMFFGAPYV  317

Query  1006  ADNTQSSGMGTIENIPHNSVHRWVG--------DPRSANHEDMGNFYSAANDPVFYSLHS  1161
               N   +  GTIE IPH  VH W G        + R+++ E+MG+FYSA  DPVF+  HS
Sbjct  318   LGNNVEAP-GTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHS  376

Query  1162  NVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMP  1341
             NVDRMW+ WK +GGKR DI+ KDWL++EF F+DE     +VKVRDCLD +K+GY +  MP
Sbjct  377   NVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMP  436

Query  1342  IPWKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEM  1503
              PW++FKP  K +V    T S+P  + V P A L K ++F + R  S         QEEM
Sbjct  437   TPWRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEM  496

Query  1504  LNL-DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTT  1674
             L   ++ YD+  ++RFDVFLN D +VN  ELD+ E+AGS+ NLPHVH  G  T    T T
Sbjct  497   LTFNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVATAT  556

Query  1675  FNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
               LAI+EL++D+ LE +D + VTLVPK GG  +++    I+  DC
Sbjct  557   LQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGVEISLADC  601



>ref|XP_004246029.2| PREDICTED: polyphenol oxidase A, chloroplastic-like [Solanum 
lycopersicum]
Length=606

 Score =   489 bits (1260),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 249/508 (49%), Positives = 328/508 (65%), Gaps = 30/508 (6%)
 Frame = +1

Query  352   DVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKY  528
             D+++C    I+ ++ +VPY CC P   D +KV YYK PS +KL +RP AHA+D AY+ KY
Sbjct  107   DLSSCNKPKIN-ATTEVPYFCCAPKPDDMSKVPYYKFPSVTKLRIRPPAHALDEAYIAKY  165

Query  529   KTAIQKMKDLPS---DDPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLY  699
               AI +MKDL     D+P  F QQAN+HCAYCNG Y ++G   Q+H +W FFPFHRWYLY
Sbjct  166   NLAISRMKDLDKTQPDNPIGFKQQANIHCAYCNGGYSIDGKVLQVHNSWLFFPFHRWYLY  225

Query  700   FFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDL  879
             F+ERI+ S+I+DPTF LP+WNWD+P GM FP +FD     + LYD+ R      G+ +DL
Sbjct  226   FYERILGSLIDDPTFGLPFWNWDHPKGMRFPPMFDVPG--TALYDERRGDQIHNGNFIDL  283

Query  880   AYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHN  1059
                GD +       + NNL +MYRQ++TN+PCPL+FFG P    +T  +  GT+ENIPH+
Sbjct  284   GSFGDQVETTQLQLMTNNLTLMYRQLVTNSPCPLMFFGGPYTLGSTVEAA-GTVENIPHS  342

Query  1060  SVHRWVG--------DPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTD  1215
              VH WVG        D + +N EDMGNFYSA  DP+FY  HSNVDRMW  WK  GGKRTD
Sbjct  343   PVHIWVGTRRGSVLPDGKISNGEDMGNFYSAGLDPLFYCHHSNVDRMWNEWKATGGKRTD  402

Query  1216  IADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSI  1395
             I +KDWL++EF F+DE     KV+VRDCLD +K+GY +Q    PW++FKP  K +     
Sbjct  403   IQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYQPTATPWRNFKPKTKASAGKVN  462

Query  1396  TESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNLDLV-YDDTKFIRFDV  1554
             T S+P  + V P A L K ++F + R  S         QEE+L  + + YD+  +IRFDV
Sbjct  463   TGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEVLTFNAIKYDNRDYIRFDV  522

Query  1555  FLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK---TTTFNLAISELIKDLDLEGD  1725
             FLN D +VN  ELD+ E+AGS+ +LPHVH  G   PK   T T  LAI+EL++D+ LE +
Sbjct  523   FLNVDNNVNANELDKAEFAGSYTSLPHVHRVGD--PKHTATATLRLAITELLEDIGLEDE  580

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             D + VTLVPK G   +++    I   DC
Sbjct  581   DTIAVTLVPKKGD--ISIGGVEIKLADC  606



>gb|ADY18409.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=590

 Score =   489 bits (1258),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 271/581 (47%), Positives = 351/581 (60%), Gaps = 38/581 (7%)
 Frame = +1

Query  139   PNPSR---AARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     R     K+ C A+   +D N D +     DRRNVLLGLGGL  A      
Sbjct  24    PKPSQLFLQRRHNQRFKVSCNANKHEKD-NLDVV-----DRRNVLLGLGGLGAANLAPLT  77

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCC--PPITDTTKVEYYKIPSFSKLNV  483
                  A A P P PD   CG ATI+     VPY CC  P  ++   + YYK+PS +K+ +
Sbjct  78    -----ANAAPSPPPDFKTCGIATITADGPPVPYTCCHLPMPSNVNTIPYYKLPSMTKVRI  132

Query  484   RPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQI  654
             R  AH VD  ++ KY  AI +MK+L   +P N   F QQAN+HCAYCNGAY +     Q+
Sbjct  133   RQPAHTVDEEFIAKYNLAISRMKELDEKEPLNPLGFKQQANIHCAYCNGAYKIGEKVLQV  192

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H +W FFPFHRWYLYF+ER++  +I+DPTF LPYWNWD P GM  P +FD E   SPLYD
Sbjct  193   HQSWLFFPFHRWYLYFYERMLGKLIDDPTFALPYWNWDLPKGMRLPPMFDREG--SPLYD  250

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
             + RN   R G V+DL   GD +   +   + NNL +MYR M+TNA CPLLFFG      +
Sbjct  251   ERRNPQVRNGTVMDLGSFGDQVQTTELQLMSNNLTLMYRHMVTNASCPLLFFGGRYVLGS  310

Query  1015  TQSSGMGTIENIPHNSVHRWVG--------DPRSANHEDMGNFYSAANDPVFYSLHSNVD  1170
             TQ    GTIE IPH  VH WVG        + + +  EDMGNFYSAA DPVFY  HSNVD
Sbjct  311   TQGV-QGTIEKIPHTPVHIWVGTKKDSILPNGKKSYGEDMGNFYSAALDPVFYCHHSNVD  369

Query  1171  RMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW  1350
             RMW  WK +GGKR D++ KDWLD+EF F+DE K    VKVRDCLD +K+GY +      W
Sbjct  370   RMWNEWKQIGGKRRDLSQKDWLDSEFFFYDENKNPYLVKVRDCLDTKKMGYDYAPSSTVW  429

Query  1351  KDFKPTRKRTVKLSITESVPASTDVLPA-PLSKNLTFYVTRSTSV-----PETQEEMLNL  1512
             ++FKP +K T     T S+P++T + P   L K ++F + R  S         QEE+L  
Sbjct  430   RNFKPNKKNTDGKVNTGSLPSATKIFPIFKLDKAISFSINRPASSRTQQEKNEQEELLTF  489

Query  1513  DLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP-KTTTFNLA  1686
               + YD+ ++IRFDVF+N D++V   ELD+ EYAGS+ +LPHVH+ G      T T  LA
Sbjct  490   SYIKYDNREYIRFDVFVNVDKNVKADELDKIEYAGSYTSLPHVHKDGDKDHIATATLQLA  549

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             ++EL++D+ LE ++ + VTLVPK GG  +++    I   DC
Sbjct  550   LTELLEDIGLENEETIAVTLVPKKGGEGLSIGCVEIKLEDC  590



>ref|XP_004293528.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=607

 Score =   488 bits (1256),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 268/575 (47%), Positives = 359/575 (62%), Gaps = 46/575 (8%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSK------AKLDRRNVllglgglygaynlgaggSNPFALADP  339
             ++ C A++   D+NP + S         LDRRNVLLGLGGLYG   LG   ++PFA A P
Sbjct  47    RVSCKATNS--DQNPSNNSNDAQPLGRTLDRRNVLLGLGGLYGVAGLG---TDPFAFAKP  101

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             V  PDV+ CG A +   + K    CCPP+    K+  +++P  SKL VRPAAHAVD AY+
Sbjct  102   VAPPDVSKCGAADLPTGAQKT--DCCPPVA--KKIFDFQLPPQSKLRVRPAAHAVDKAYI  157

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             EKY  AI+ MK LP DDPR+F QQAN+HCAYC+GAY   G P    QIH +W FFPFHR+
Sbjct  158   EKYSKAIELMKALPDDDPRSFKQQANIHCAYCDGAYDQAGFPDLELQIHGSWLFFPFHRY  217

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYF+ERI+  +INDP+F LP+WNWD P GM  PG+F   N  SPLYD++RN +H+   +
Sbjct  218   YLYFYERILGKLINDPSFALPFWNWDAPAGMQLPGMF--ANPKSPLYDKFRNANHQPPKL  275

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+  D    D T++  NL IMYRQM++NA  P LFFG P RA +  S G G IE  
Sbjct  276   IDLNYNLKDANVSDETQINTNLKIMYRQMVSNAKNPKLFFGNPYRAGDEPSPGGGAIETT  335

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+F+S HSNVDR+WT+WKTLGGKR D  D D
Sbjct  336   PHGPVHIWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWTVWKTLGGKREDFTDSD  395

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKL-------  1389
             WLD+ FLF+DE    V+VKVRDCLD++KLGY +QD+ IPW   KPT +R   +       
Sbjct  396   WLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDVDIPWTSHKPTPRRVKDVIKKFGHK  455

Query  1390  ----SITESVPASTDVL-----PAPLSKNLTFYVTRSTSVPETQ------EEMLNLDLV-  1521
                  +  +   ST V+     P  L+  ++  V R      +Q      EE+L +  + 
Sbjct  456   LHGHGVAHAAETSTKVVAGAHFPISLASKISIAVARPQQKKRSQKEKDHEEEVLVIQGIE  515

Query  1522  YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELI  1701
             +D    ++FDV++N+++D+ +   D++E+AGSF ++PH H+        T   L +++L+
Sbjct  516   FDRDVGVKFDVYVNDEDDLPSGP-DKSEFAGSFVSVPHRHKHTKKI--NTVLRLGLTDLL  572

Query  1702  KDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
             +DLD E D+ ++VTL+P+ G   V +    I   D
Sbjct  573   EDLDAEDDETIVVTLIPRYGAEHVKIGGIKIEFAD  607



>sp|Q08306.2|PPOD_SOLLC RecName: Full=Polyphenol oxidase D, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78298.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=591

 Score =   487 bits (1254),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 268/582 (46%), Positives = 357/582 (61%), Gaps = 38/582 (7%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+FL+       +R  A K+ C  ++   +++  +     +DRRNVLLGLGGLYG  N  
Sbjct  28    QLFLH------GKRNKAFKVSCKVTNTNGNQDETN----SVDRRNVLLGLGGLYGVANAI  77

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
                ++          PD+++C  A I  +   V Y CC P   D  KV YYK PS +KL 
Sbjct  78    PLAASAAPTP----PPDLSSCSIARIDENQV-VSYSCCAPKPDDMEKVPYYKFPSMTKLR  132

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQ  651
             VR  AH  D  Y+ KY  ++ KM+DL    P N   F QQAN+HCAYCNGAY + G   Q
Sbjct  133   VRQPAHEADEEYIAKYNVSVTKMRDLDKTQPLNPIGFKQQANIHCAYCNGAYRIGGKELQ  192

Query  652   IHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLY  831
             +H +W FFPFHRWYLYF+E     +I+DPTF LPYWNWD+P GM FP ++D E     L+
Sbjct  193   VHNSWLFFPFHRWYLYFYESNAGKLIDDPTFALPYWNWDHPKGMRFPAMYDREGTF--LF  250

Query  832   DQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRAD  1011
             D+ R+Q HR G V+DL + G+++       + NNL +MYRQM+TNAPCP +FFG  + + 
Sbjct  251   DETRDQSHRNGTVIDLGFFGNEVETTQLQMMSNNLTLMYRQMVTNAPCPRMFFGDLMISG  310

Query  1012  NTQSSGMGTIENIPHNSVHRWVGDPRSA--------NHEDMGNFYSAANDPVFYSLHSNV  1167
              T +S  GTIENIPH  VH W G  R +           + G+FYSA  DPVF+  HSNV
Sbjct  311   ITLNSP-GTIENIPHGPVHIWSGTVRGSTLPNGAISKRGEYGHFYSAGLDPVFFCHHSNV  369

Query  1168  DRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIP  1347
             DRMW+ WK  GGKRTDI  KDWL++EF F+DE +   +VKVRDCLD +K+GY ++ M  P
Sbjct  370   DRMWSEWKATGGKRTDITHKDWLNSEFFFYDENENPYRVKVRDCLDTKKMGYDYKPMRTP  429

Query  1348  WKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTS--VPE---TQEEMLN  1509
             W++FKP  K +     T S+P  +   P A L K ++F + R TS   P+    QEEML 
Sbjct  430   WRNFKPLTKASAGKVNTSSIPPVSQAFPLAKLDKAVSFSINRPTSSRTPQEKNAQEEMLT  489

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP-KTTTFNL  1683
              + + YD+  +IRFDVFLN D +VN  ELD+ E+AGS+ +LPHVH  G      T  F L
Sbjct  490   FNSIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRAGETNHIATVDFQL  549

Query  1684  AISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
             AI+EL++D+ LE +D + VTLVPK GG  +++ NA I+  DC
Sbjct  550   AITELLEDIGLEDEDTIAVTLVPKRGGEGISIENATISLADC  591



>gb|AFJ79642.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=590

 Score =   479 bits (1234),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 265/585 (45%), Positives = 357/585 (61%), Gaps = 41/585 (7%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  S+   D+N + + K  +DRRNVLLGLGG+YGA N    
Sbjct  19    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQNQNEVEKNSVDRRNVLLGLGGMYGAANFAPL  78

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVR  486
              ++          PD+++C  A I+ +  +V Y CC P   D  K+ YYK PS +KL +R
Sbjct  79    AASAAPTP----PPDLSSCSIAKITETE-EVSYSCCAPTPDDLNKIPYYKFPSMTKLRIR  133

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIH  657
               AHA D  Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY +     Q+H
Sbjct  134   QPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQVH  193

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   + LYDQ
Sbjct  194   NSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDREG--TALYDQ  251

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGK-------  996
              RNQ HR G V+DL   GD++   +   + NNL +MYRQ    APCP +F  +       
Sbjct  252   VRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQWYY-APCPRMFLARLTFLGIT  310

Query  997   -----PLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHS  1161
                  PL++  T  S  G ++      +     + R+++ E+MG+FYSA  DPVF+  HS
Sbjct  311   LKPQEPLKSSLTVLSTFGLVQCQVQPCL-----NGRTSHGENMGHFYSAGLDPVFFCHHS  365

Query  1162  NVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMP  1341
             NVDRMW+ WK +GGKR DI+ KDWL++EF F+DE     +VKVRDCLD +K+GY +  MP
Sbjct  366   NVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMP  425

Query  1342  IPWKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEM  1503
              PW++FKP  K +V    T S+P  + V P A L K ++F + R  S         QEEM
Sbjct  426   TPWRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEM  485

Query  1504  LNL-DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTT  1674
             L   ++ YD+  ++RFDVFLN D +VN  ELD+ E+AGS+ NLPHVH  G  T    T T
Sbjct  486   LTFNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVATAT  545

Query  1675  FNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
               LAI+EL++D+ LE +D + VTLVPK GG  +++  A I+  DC
Sbjct  546   LQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  590



>gb|ACR61398.1| polyphenol oxidase [Solanum melongena]
Length=593

 Score =   479 bits (1233),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 265/585 (45%), Positives = 357/585 (61%), Gaps = 41/585 (7%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  S+   D+N + + K  +DRRNVLLGLGG+YGA N    
Sbjct  22    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQNQNEVEKNSVDRRNVLLGLGGMYGAANFAPL  81

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVR  486
              ++          PD+++C  A I+ +  +V Y CC P   D  K+ YYK PS +KL +R
Sbjct  82    AASAAPTP----PPDLSSCSIAKITETE-EVSYSCCAPTPDDLNKIPYYKFPSMTKLRIR  136

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIH  657
               AHA D  Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY +     Q+H
Sbjct  137   QPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQVH  196

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   + LYDQ
Sbjct  197   NSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDGEG--TALYDQ  254

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGK-------  996
              RNQ HR G V+DL   GD++   +   + NNL +MYRQ    APCP +F  +       
Sbjct  255   VRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQWYY-APCPRMFLARLTFLGIT  313

Query  997   -----PLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHS  1161
                  PL++  T  S  G ++      +     + R+++ E+MG+FYSA  DPVF+  HS
Sbjct  314   LKPQEPLKSSLTVLSTFGLVQCQVQPCL-----NGRTSHGENMGHFYSAGLDPVFFCHHS  368

Query  1162  NVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMP  1341
             NVDRMW+ WK +GGKR DI+ KDWL++EF F+DE     +VKVRDCLD +K+GY +  MP
Sbjct  369   NVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMP  428

Query  1342  IPWKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEM  1503
              PW++FKP  K +V    T S+P  + V P A L K ++F + R  S         QEEM
Sbjct  429   RPWRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEM  488

Query  1504  LNL-DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTT  1674
             L   ++ YD+  ++RFDVFLN D +VN  ELD+ E+AGS+ NLPHVH  G  T    T T
Sbjct  489   LTFNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVATAT  548

Query  1675  FNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
               LAI+EL++D+ LE +D + VTLVPK GG  +++  A I+  DC
Sbjct  549   LQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  593



>ref|XP_010100570.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82813.1| Polyphenol oxidase [Morus notabilis]
Length=592

 Score =   479 bits (1232),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 270/579 (47%), Positives = 363/579 (63%), Gaps = 42/579 (7%)
 Frame = +1

Query  145   PSRAARRGDAVKIRCAASS---EGRDENPDSLSKAKLDRRNVllglgglygaynlgaggS  315
             PS A ++  A   R    S   +G  E+ D     KLDRRN+L+GLGGLYG        S
Sbjct  25    PSFAGKKSHAPNHRYKGQSTTCKGSRED-DQSPLGKLDRRNLLIGLGGLYGTAAGLG--S  81

Query  316   NPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAA  495
             +P ALA+PV  PD++ CGPA   F     P  CCPPI+  +K+  YK+P  SKL VRPA 
Sbjct  82    DPLALANPVAPPDLSKCGPA--DFPPGATPTNCCPPIS--SKIIDYKLPPVSKLRVRPAT  137

Query  496   HAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNW  666
             H VD AY+ KY  A+Q MKDLP  DPR+F QQ+++HCAYC+G+Y   G P    Q+H +W
Sbjct  138   HTVDEAYIAKYNRAVQLMKDLPDSDPRSFSQQSDIHCAYCDGSYDQVGFPNLELQVHESW  197

Query  667   FFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRN  846
              FFPFHRWYLYF+ERI+  +I+DPTF LP+WNWD+PPGM FP ++   N  SPLYD+ R+
Sbjct  198   LFFPFHRWYLYFYERILGKLIDDPTFALPFWNWDSPPGMQFPALY--ANAKSPLYDKLRD  255

Query  847   QDHRYGHVLDLAYSGDDIIAPDPTK---VKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              +H+    +DL YS  D   P  +K   V  NL IMYRQ+I N     LF G+P R  + 
Sbjct  256   ANHQPPVTVDLDYSKADAGVPTTSKDVQVSANLKIMYRQIIANGKNARLFLGEPYREGDD  315

Query  1018  QSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL  1197
              S G G++EN+PH  VH W GD    N E+MGNFYSAA DP+F+S HSN+DR+W++WKTL
Sbjct  316   PSPGPGSLENVPHGPVHLWTGDSTQPNFENMGNFYSAARDPIFFSHHSNIDRLWSVWKTL  375

Query  1198  GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT---  1368
             GGKR D  D DWL++ FLF+DE K  V+V+V DCLD++KLGY +QD+ IPW   KPT   
Sbjct  376   GGKRNDFTDPDWLNSGFLFYDENKQLVRVRVGDCLDSKKLGYVYQDVDIPWLQTKPTPLR  435

Query  1369  RKRTVKLSITESVPASTDV----------LPAPLSKNLTFYV-----TRSTSVPETQEEM  1503
              KR V  S +  V A+              P  L K ++  V     +RS +  + +EE+
Sbjct  436   TKRAVARSSSTLVGAALAADTKKTTTRVKFPIKLDKVISTVVSRPKKSRSKNEKDDEEEV  495

Query  1504  LNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFN  1680
             L ++ + +D    ++FDV++N DED +  E   +E+AGSF N+PH  +G + T   T   
Sbjct  496   LVIEGIEFDRNNPVKFDVYVN-DEDESGPE--NSEFAGSFVNVPHKKKGDNKT--RTNLR  550

Query  1681  LAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
             L I++L+++L+ E DD V+VTLVPK G   VT++   I+
Sbjct  551   LGITDLLEELEAEDDDSVVVTLVPKFGKGLVTISGIKID  589



>ref|XP_002316632.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
 gb|EEE97244.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
Length=590

 Score =   478 bits (1230),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 242/518 (47%), Positives = 327/518 (63%), Gaps = 31/518 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             S+PFA A PV  PD++ CG A +   + +    CCPP+  T  +++ + PS + L VRPA
Sbjct  75    SDPFAFAAPVSAPDISKCGRADLPTGANET--NCCPPVPSTKILDFKRPPSNAPLRVRPA  132

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH  D  Y+ KYK AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H +
Sbjct  133   AHLADKDYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVHNS  192

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W FFPFHR+YLYF+E+I+  +I+DPTF LP+WNWD+P GM  P ++ D N  SPLYD  R
Sbjct  193   WLFFPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPN--SPLYDSLR  250

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
             N++H+   +LDL +SG D    +  ++ +NL IMYRQM++N   P LFFG   RA +   
Sbjct  251   NKNHQPPTLLDLDWSGTDTPTSNEEQLSSNLTIMYRQMVSNGKTPRLFFGGAYRAGDEPG  310

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
                G IENIPH  VH W GD    N EDMGNFYSAA DP+F+  HSNVDRMW++WKTLGG
Sbjct  311   PEPGPIENIPHGPVHIWTGDNTQPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLGG  370

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTV  1383
             +RTD+ D DWL+  F F+DE    V+VKVRDCLD+  LGY +QD+ IPW   +PT +R+ 
Sbjct  371   RRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDVEIPWLQSRPTPRRSA  430

Query  1384  KLSIT-------ESVPASTD--------VLPAPLSKNLTFYVTRSTSVPETQEEMLNLDL  1518
             K   +       E++ A             P  L+K ++  V R       +E+    +L
Sbjct  431   KKVASNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARPKKSRSKKEKEDEEEL  490

Query  1519  V------YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFN  1680
             +      +D TK ++FDV++N DED +    D+TE+AGSF N+PH H+ G     TT F 
Sbjct  491   LVIQGLEFDKTKALKFDVYIN-DEDDSLSAPDKTEFAGSFVNVPHKHKHGKKM--TTCFR  547

Query  1681  LAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             LA+++L++DLD+EGDD ++VTLVP+ G     +    I
Sbjct  548   LALTDLLEDLDVEGDDSLIVTLVPRYGKGLAKIGGIKI  585



>gb|AAU12257.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=590

 Score =   476 bits (1225),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 241/518 (47%), Positives = 327/518 (63%), Gaps = 31/518 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             S+PFA A PV  PD++ CG A +   + +    CCPP+  T  +++ + PS + L VRPA
Sbjct  75    SDPFAFAAPVSAPDISKCGRADLPTGANET--NCCPPVPSTKILDFKRPPSNAPLRVRPA  132

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH  D  Y+ KYK AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H +
Sbjct  133   AHLADKDYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVHNS  192

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W FFPFHR+YLYF+E+I+  +I+DPTF LP+WNWD+P GM  P ++ D +  SPLYD  R
Sbjct  193   WLFFPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPH--SPLYDSLR  250

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
             N++H+   +LDL +SG D    +  ++ +NL IMYRQM++N   P LFFG   RA +   
Sbjct  251   NKNHQPPTLLDLDWSGTDTPTSNEEQLSSNLTIMYRQMVSNGKTPRLFFGGAYRAGDEPG  310

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
                G IENIPH  VH W GD    N EDMGNFYSAA DP+F+  HSNVDRMW++WKTLGG
Sbjct  311   PEPGPIENIPHGPVHIWTGDNTQPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLGG  370

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTV  1383
             +RTD+ D DWL+  F F+DE    V+VKVRDCLD+  LGY +QD+ IPW   +PT +R+ 
Sbjct  371   RRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDVEIPWLQSRPTPRRSA  430

Query  1384  KLSIT-------ESVPASTD--------VLPAPLSKNLTFYVTRSTSVPETQEEMLNLDL  1518
             K   +       E++ A             P  L+K ++  V R       +E+    +L
Sbjct  431   KKVASNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARPKKSRSKKEKEDEEEL  490

Query  1519  V------YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFN  1680
             +      +D TK ++FDV++N DED +    D+TE+AGSF N+PH H+ G     TT F 
Sbjct  491   LVIQGLEFDKTKALKFDVYIN-DEDDSLSAPDKTEFAGSFVNVPHKHKHGKKM--TTCFR  547

Query  1681  LAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             LA+++L++DLD+EGDD ++VTLVP+ G     +    I
Sbjct  548   LALTDLLEDLDVEGDDSLIVTLVPRYGKGLAKIGGIKI  585



>ref|XP_008224998.1| PREDICTED: polyphenol oxidase, chloroplastic [Prunus mume]
Length=589

 Score =   475 bits (1223),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 264/558 (47%), Positives = 356/558 (64%), Gaps = 38/558 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  + ++ C A +    +N +  ++ KLDRRNVLLGLGGLYG   LG   ++PFA A P
Sbjct  35    KRSFSPRVSCKAKNS---DNQNDQAQTKLDRRNVLLGLGGLYGVAGLG---TDPFAFAKP  88

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             V  PD++ CG A +   +   P  CCPP    TK+  +K+P+  KL VRPAAHAVD AY+
Sbjct  89    VTPPDLSKCGAADLP--TGATPTNCCPP--PATKIIDFKLPAPGKLRVRPAAHAVDQAYI  144

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH +W FFPFHR+
Sbjct  145   EKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRY  204

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYF+E+I+  +INDPTF LP+WNWD+P GM  P +F   N  SPLYD++R   H+   +
Sbjct  205   YLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALF--ANPKSPLYDKFRAASHQPPTL  262

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+G D    + T++  NL IMYRQM++NA  P LFFG P RA +    G G+IE  
Sbjct  263   IDLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYRAGDEPDPGGGSIEGT  322

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSAA DP+F+S HSNVDRMW+IWKTLGGKRTDI+  D
Sbjct  323   PHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGGKRTDISQSD  382

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT--------VK  1386
             WLD+ FLF++E    V+VKVRD L+++ LGY +Q++ IPW   KPT +R          K
Sbjct  383   WLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVEIPWLQSKPTPRRAKLALSKIKKK  442

Query  1387  LSITESVPASTDVL-----PAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF--  1539
             L +  +  +ST ++     P  L   ++  V R       ++E    +  LV +  +F  
Sbjct  443   LGVAHAAESSTQIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIEGIEFDR  502

Query  1540  ---IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDL  1710
                ++FDV++N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L++DL
Sbjct  503   DVAVKFDVYVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLEDL  559

Query  1711  DLEGDDKVLVTLVPKVGG  1764
             D E D+ V+VTLVPK G 
Sbjct  560   DAEDDESVVVTLVPKYGA  577



>ref|XP_010100574.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82817.1| Polyphenol oxidase [Morus notabilis]
Length=601

 Score =   474 bits (1221),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 262/562 (47%), Positives = 354/562 (63%), Gaps = 35/562 (6%)
 Frame = +1

Query  178   KIRCAASSEGRDENP--DSLSKA---KLDRRNVllglgglygaynlgaggSNPFALADPV  342
             K+ C A++   D +P  D  SK    KLDRRNVLLGLG L G   L    ++PFA A P+
Sbjct  48    KLSCKANNNDHDLSPTNDVASKTSNPKLDRRNVLLGLGSLGGLAGLR---ADPFAFAAPI  104

Query  343   PLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP-SFSKLNVRPAAHAVDAAYL  519
               PD++ CG A   F S   P  CCPP++   ++  +K+P S  KL VRP AHAVD+AY 
Sbjct  105   SAPDISQCGAA--DFPSGVDPVNCCPPVS--AQIVDFKLPASPGKLRVRPPAHAVDSAYT  160

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
              K+K A + MK LP  DPR+F QQA++HCAYC+GAY   G P    Q+H +W FFPFHRW
Sbjct  161   AKFKRAFELMKALPDSDPRSFKQQASIHCAYCDGAYEQIGFPDLDIQVHNSWLFFPFHRW  220

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYFFERI+  +I+DP+F +P+WNWD P GM  P I+ D    SPLYDQ+RN+ H+   +
Sbjct  221   YLYFFERILGKLIDDPSFAMPFWNWDAPAGMQIPAIYADRR--SPLYDQFRNKSHQPPSL  278

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL ++G D    +  ++++NL IMYRQM++N+    +F G+  RA +    G G+ ENI
Sbjct  279   VDLDFNGRDESISNQAQIQSNLTIMYRQMVSNSRSARIFMGESYRAGDETDPGPGSFENI  338

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH SVH W GD      EDMGNFYSA  DP+F++ HSN+DRMW +WKTLGGKR D  D D
Sbjct  339   PHGSVHTWTGDNTQPYGEDMGNFYSAGRDPIFFAHHSNIDRMWNVWKTLGGKRQDFTDPD  398

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTV--------K  1386
             WLD  FLF+DE    V+VKVRD LD+ KLGYT+QD+ +PW + +P  +R V        +
Sbjct  399   WLDASFLFYDENSQLVRVKVRDSLDSRKLGYTYQDIELPWLNTRPRPRRVVDKVKRAFAR  458

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTR---STSVPETQE--EMLNLDLV-YDDTKFIRF  1548
             + +  +    T   P  L K +   V+R   S S  E  E  E+L +  + +D    I+F
Sbjct  459   IGVARADEYPTANFPLTLDKPVKTLVSRPKKSRSKKEKDEADEVLVIQGIEFDRNVPIKF  518

Query  1549  DVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDD  1728
             DVF+N+++D  T   D++E+AGSF ++PH H+  S T   T   L I+EL++DLD E D+
Sbjct  519   DVFINDEDDALTGP-DKSEFAGSFVSVPHRHK--SKTKMNTGLRLDITELLEDLDAEEDE  575

Query  1729  KVLVTLVPKVGGSFVTVNNAYI  1794
              V+VTLVPKVG   V++    I
Sbjct  576   NVVVTLVPKVGIGHVSIGGLKI  597



>gb|AAW65103.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=589

 Score =   473 bits (1216),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 261/558 (47%), Positives = 358/558 (64%), Gaps = 38/558 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  + ++ C A +    +N +  ++ KLDRRNVLLGLGGLYG   LG   ++PFA A P
Sbjct  35    KRSFSPRVSCKAKNS---DNQNDQAQTKLDRRNVLLGLGGLYGVAGLG---TDPFAFAKP  88

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             V  PD++ CG A +   +   P  CCPP+   TK+  +K+P+  KL VRPAAHAVD AY+
Sbjct  89    VNPPDLSKCGAADLP--TGATPTNCCPPLA--TKIIDFKLPAPGKLRVRPAAHAVDQAYI  144

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH +W FFPFHR+
Sbjct  145   EKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRY  204

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
              LYF+E+I+  +INDPTF LP+WNWD+P GM  P +F   N  SPLYD++R   H+   +
Sbjct  205   CLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALF--ANPKSPLYDKFRAASHQPPTL  262

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+G D    + T++  NL IMYRQM++NA  P LFFG P RA +    G G+IE  
Sbjct  263   IDLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYRAGDEPDPGGGSIEGT  322

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD   +N EDMGNFYSAA DP+F+S HSNVDRMW+IWKTLGGKRTDI+  D
Sbjct  323   PHGPVHLWTGDNTQSNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGGKRTDISQSD  382

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT--------VK  1386
             WLD+ FLF++E    V+VKVRD L+++ LGY +Q++ IPW   KPT +R          K
Sbjct  383   WLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPTPRRAKLELSKIKKK  442

Query  1387  LSITESVPASTDVL-----PAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF--  1539
             L + ++  +ST ++     P  L   ++  V R       ++E    +  LV +  +F  
Sbjct  443   LGVAQAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIEGIEFDR  502

Query  1540  ---IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDL  1710
                ++FDV++N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L++D+
Sbjct  503   DVAVKFDVYVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLEDI  559

Query  1711  DLEGDDKVLVTLVPKVGG  1764
             + E D+ V+VTLVPK G 
Sbjct  560   EAEDDESVVVTLVPKYGA  577



>ref|XP_011002749.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   472 bits (1214),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 247/517 (48%), Positives = 329/517 (64%), Gaps = 32/517 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             S+PFA A+P+  PD+  C    ++  S   P  CCPP +  TK++ ++ PS S  + +RP
Sbjct  75    SDPFAYANPIAAPDITQC--ELVTLPSESDPSNCCPPTS--TKIKNFEFPSASSPMRIRP  130

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH VD AY+ KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY   G P    QIHF
Sbjct  131   AAHLVDKAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHF  190

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFP+HR YLY+FERI+  +I+DPTF LP+WNWD P GM  P IF D    SPLYD  
Sbjct  191   SWLFFPWHRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPQ--SPLYDPL  248

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVK----NNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             R+ +H+   +LDL Y+  D   PDP K +    +NL +MYRQM++ A  P LFFGKP RA
Sbjct  249   RDANHQPPTLLDLNYAKGDA-NPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +  S GMGTIE  PH  +H W GDP   N E+MGNFYSA  DP+FY  HSNVDRMW +W
Sbjct  308   GDDPSPGMGTIETTPHTEIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLW  367

Query  1189  KTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP  1365
             K + GGKR DI D DWL++EFLF++E K  V+VKV+D LD +KL Y FQD+PIPW   +P
Sbjct  368   KKIPGGKRKDIEDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRP  427

Query  1366  TRKRTVKLSITESVPAST-----DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLD  1515
             T K T +  +  +   S         P  L K ++  V     +RS +  E ++E+L ++
Sbjct  428   TPKLTRQEKLRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKENEDEVLVIE  487

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + Y++ + I+FDV +N++ D +    D++E+AGSF N+PH H    A    TT  L I+
Sbjct  488   GIEYEENQLIKFDVLVNDEPD-SPGGPDKSEFAGSFVNVPHKH----AKKSKTTMVLGIT  542

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
              L++DL+ EGDD ++VT VP+ GG  VTV N  I  +
Sbjct  543   GLLEDLEAEGDDTLVVTFVPRSGGDSVTVANVKIELV  579



>ref|XP_007211392.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
 gb|EMJ12591.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
Length=589

 Score =   472 bits (1215),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 262/558 (47%), Positives = 356/558 (64%), Gaps = 38/558 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  + ++ C A +    +N +  ++ KLDRRNVLLGLGGLYG   LG   ++PFA A P
Sbjct  35    KRSFSPRVSCKAKNS---DNQNDQAQTKLDRRNVLLGLGGLYGVAGLG---TDPFAFAKP  88

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             V  PD++ CG A +   +   P  CCPP    TK+  +K+P+  KL +RPAAHAVD AY+
Sbjct  89    VNPPDLSKCGAADLP--TGATPTNCCPP--PATKIIDFKLPAPGKLRIRPAAHAVDQAYI  144

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH +W FFPFHR+
Sbjct  145   EKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRY  204

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYF+E+I+  +INDPTF LP+WNWD+P GM  P +F   N  SPLYD++R   H+   +
Sbjct  205   YLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALF--ANPKSPLYDKFRAASHQPPTL  262

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+G D    + T++  NL IMYRQM++NA  P LFFG P RA +    G G+IE  
Sbjct  263   IDLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYRAGDEPDPGGGSIEGT  322

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSAA DP+F+S HSNVDRMW+IWKTLGGKRTDI+  D
Sbjct  323   PHGPVHLWTGDNTQPNLEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGGKRTDISHSD  382

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--------TVK  1386
             WLD+ FLF++E    V+VKVRD L+++ LGY +Q++ IPW   KPT +R          K
Sbjct  383   WLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPTPRRAKLAVSKIAKK  442

Query  1387  LSITESVPASTDVL-----PAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF--  1539
             L +  +  +ST ++     P  L   ++  V R       ++E    +  LV +  +F  
Sbjct  443   LGVAHAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIEGIEFDR  502

Query  1540  ---IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDL  1710
                ++FDV++N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L++D+
Sbjct  503   DVAVKFDVYVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLEDI  559

Query  1711  DLEGDDKVLVTLVPKVGG  1764
             D E D+ V+VTLVPK G 
Sbjct  560   DAEDDESVVVTLVPKYGA  577



>sp|Q08303.2|PPOA_SOLLC RecName: Full=Polyphenol oxidase A, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78295.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=630

 Score =   473 bits (1217),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 242/492 (49%), Positives = 316/492 (64%), Gaps = 28/492 (6%)
 Frame = +1

Query  352   DVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKY  528
             D+++C    I+ ++ +VPY CC P   D +KV YYK PS +KL +RP AHA+D AY+ KY
Sbjct  94    DLSSCNKPKIN-ATTEVPYFCCAPKPDDMSKVPYYKFPSVTKLRIRPPAHALDEAYIAKY  152

Query  529   KTAIQKMKDLPS---DDPRNFYQQANVHCAYCNGAYLLNGNPYQIHFNWFFFPFHRWYLY  699
               AI +MKDL     D+P  F QQAN+HCAYCNG Y ++G   Q+H +W FFPFHRWYLY
Sbjct  153   NLAISRMKDLDKTQPDNPIGFKQQANIHCAYCNGGYSIDGKVLQVHNSWLFFPFHRWYLY  212

Query  700   FFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDL  879
             F+ERI+ S+I+DPTF LP+WNWD+P GM FP +FD     + LYD+ R      G+ +DL
Sbjct  213   FYERILGSLIDDPTFGLPFWNWDHPKGMRFPPMFDVPG--TALYDERRGDQIHNGNGIDL  270

Query  880   AYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHN  1059
              Y GD +       + NNL +MYRQ++TN+PCPL+     L    +     GT+ENIPH+
Sbjct  271   GYFGDQVETTQLQLMTNNLTLMYRQLVTNSPCPLMSL-VDLTLFGSTVEDAGTVENIPHS  329

Query  1060  SVHRWVGDPRSA--------NHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTD  1215
              VH WVG  R +        N EDMGNFYSA  DP+FY  HSNVDRMW  WK  GGKRTD
Sbjct  330   PVHIWVGTRRGSVLPVGKISNGEDMGNFYSAGLDPLFYCHHSNVDRMWNEWKATGGKRTD  389

Query  1216  IADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSI  1395
             I +KDWL++EF F+DE     KV+VRDCLD +K+GY +     PW++FKP  K +     
Sbjct  390   IQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYHATATPWRNFKPKTKASAGKVN  449

Query  1396  TESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLNLDLV-YDDTKFIRFDV  1554
             T S+P  + V P A L K ++F + R  S         QEE+L  + + YD+  +IRFDV
Sbjct  450   TGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEVLTFNAIKYDNRDYIRFDV  509

Query  1555  FLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK---TTTFNLAISELIKDLDLEGD  1725
             FLN D +VN  ELD+ E+AGS+ +LPHVH  G   PK   T T  LAI+EL++D+ LE +
Sbjct  510   FLNVDNNVNANELDKAEFAGSYTSLPHVHRVGD--PKHTATATLRLAITELLEDIGLEDE  567

Query  1726  DKVLVTLVPKVG  1761
             D + VTLVPK G
Sbjct  568   DTIAVTLVPKKG  579



>ref|XP_008383785.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
 sp|P43309.1|PPO_MALDO RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Malus domestica]
 gb|AAA69902.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   472 bits (1214),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 259/559 (46%), Positives = 358/559 (64%), Gaps = 40/559 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  A K+ C A++  +++     +++KLDRRNVLLGLGGLYG   +G   ++PFA A P
Sbjct  39    KRSFARKVSCKATNNDQNDQ----AQSKLDRRNVLLGLGGLYGVAGMG---TDPFAFAKP  91

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             +  PDV+ CGPA +   +  VP  CCPP   +TK+  +K+P+ +KL +RP AHAVD AY 
Sbjct  92    IAPPDVSKCGPADLPQGA--VPTNCCPP--PSTKIIDFKLPAPAKLRIRPPAHAVDQAYR  147

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             +KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QIH +W FFPFHR+
Sbjct  148   DKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPELELQIHNSWLFFPFHRY  207

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYFFE+I+  +INDPTF LP+WNWD+P GM  P I+ D    SPLYD+ R+ +H+   +
Sbjct  208   YLYFFEKILGKLINDPTFALPFWNWDSPAGMPLPAIYADPK--SPLYDKLRSANHQPPTL  265

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G G+IE  
Sbjct  266   VDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGNPYRAGDEPDPGGGSIEGT  325

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+F++ HSNVDRMW+IWKTLGGKRTD+ D D
Sbjct  326   PHAPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIWKTLGGKRTDLTDSD  385

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--------TVK  1386
             WLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R          K
Sbjct  386   WLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALSKVAKK  445

Query  1387  LSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLNLDLV-YD  1527
             L +  +  AS+  +      P  L   ++  V R      S    E +EE+L ++ + +D
Sbjct  446   LGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFD  505

Query  1528  DTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
                 ++FDV++N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L+++
Sbjct  506   RDVAVKFDVYVNDVDDLPSGP-DKTEFAGSFVSVPHSHKHKKKM--NTILRLGLTDLLEE  562

Query  1708  LDLEGDDKVLVTLVPKVGG  1764
             ++ E DD V+VTLVPK G 
Sbjct  563   IEAEDDDSVVVTLVPKFGA  581



>sp|Q9MB14.2|PPO2_IPOBA RecName: Full=Polyphenol oxidase II, chloroplastic; Short=PPO-II; 
AltName: Full=Catechol oxidase II; Flags: Precursor [Ipomoea 
batatas]
Length=588

 Score =   471 bits (1213),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 276/576 (48%), Positives = 353/576 (61%), Gaps = 46/576 (8%)
 Frame = +1

Query  139   PNPSR----AARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlga  306
             P PS+     A+R    K+ C A        P+  S+ KLDRR+VLLGLGGL GA +L  
Sbjct  31    PKPSQIHIATAKRTHHFKVSCNA--------PNGDSQPKLDRRDVLLGLGGLAGAASLI-  81

Query  307   ggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP--SFSKLN  480
               +NP A A+P+  P+++ C           +   CCPP+   T V  YK+P  S S + 
Sbjct  82    --NNPLAFAEPIHAPEISKCVVPPKDLPPDAIVDNCCPPLA--TNVIPYKVPKTSPSAMK  137

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQ  651
             +RPA H +D  Y+ K++ AI+ MK+LP+DDPRNFYQQA VHCAYCNG Y+    P    Q
Sbjct  138   IRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQ  197

Query  652   IHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLY  831
             +H +W FFPFHRWYLYF+ERI+  +I DPTF LP+WNWD P GM  P  F   NQ SPLY
Sbjct  198   VHNSWLFFPFHRWYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYF--RNQNSPLY  255

Query  832   DQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA-  1008
             D+ RNQ H    V+DL Y+G D    D  ++ NNLA+MY+ M+TNA    LF GKP +A 
Sbjct  256   DENRNQSH-LPLVMDLGYAGTDTDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAG  314

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGD--PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             D+  + G G+IENIPH  VHRWVGD  PR+ N EDMGNFYSA  D +FY  HSNVDRMWT
Sbjct  315   DDPVNKGGGSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWT  374

Query  1183  IWKTLGGK--RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKD  1356
             IW+ LGGK  R D  D DWLD  F+F+DE K AV+V+V D LDN+KLGY ++   +PW +
Sbjct  375   IWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLN  434

Query  1357  FK--PTRKRTVKLSITESVPASTDVLPAPLSKNLTFYVTR--------STSVPETQEEML  1506
              K  PT+K+T  L+     P  TDV P  L K +   V R             E   E+ 
Sbjct  435   SKPLPTKKKT-GLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIQ  493

Query  1507  NLDLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLA  1686
              +++  D  ++ +FDV+LN DED      ++ EYAGSF +LPH H G       T+ +L 
Sbjct  494   GIEVAID--QYAKFDVYLN-DEDEPEAGKEKAEYAGSFAHLPHKHTGSKKI--RTSLSLG  548

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             ++E ++DL  E DD VLVTL PKVGG  VTV N  I
Sbjct  549   LNEPLEDLGAEDDDAVLVTLAPKVGGGVVTVENIKI  584



>ref|XP_006370115.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
 gb|ERP66684.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
Length=581

 Score =   471 bits (1211),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 251/515 (49%), Positives = 326/515 (63%), Gaps = 32/515 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             S+PFA A+P+  PD+  C   T+   S   P  CCPP +  TK++ ++ PS S  + +RP
Sbjct  75    SDPFAYANPIAPPDITQCELVTLPTESD--PSNCCPPTS--TKIKNFEFPSASSPMRIRP  130

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH VD AYL KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY   G P    QIHF
Sbjct  131   AAHLVDKAYLAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHF  190

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFP+HR YLY+FERI+  +I+DPTF LP+WNWD P GM  P IF D    SPLYD  
Sbjct  191   SWLFFPWHRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPK--SPLYDPL  248

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKV----KNNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             R+ +H+   +LDL Y+  D   PDP K      +NL +MYRQM++ A  P LFFGKP RA
Sbjct  249   RDANHQPPTLLDLNYAKGDA-NPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +  S GMGTIE  PH  +H W GDP   N E+MGNFYSA  DP+FY  HSNVDRMW +W
Sbjct  308   GDDPSPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLW  367

Query  1189  KTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP  1365
             K + GGKR DI D DWL++EFLF+DE K  V+VKV+D LD +KL Y FQD+PIPW   + 
Sbjct  368   KKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKARA  427

Query  1366  TRKRTVKLSITESVPAST-----DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLD  1515
             T K T +     S   S         P  L K ++  V     +RS +  E ++E+L ++
Sbjct  428   TPKFTRQEKSRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIE  487

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + Y++ + I+FDV +N++ D +    D++E+AGSF N+PH H    A    TT  L I+
Sbjct  488   GIEYEENQLIKFDVLVNDEPD-SPGGPDKSEFAGSFINVPHKH----AKKSKTTMVLGIT  542

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
              L++DL+ EGDD ++VTLVP+ GG  VTV N  I 
Sbjct  543   GLLEDLEAEGDDTLVVTLVPRTGGDSVTVANVKIE  577



>ref|XP_006370120.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
 gb|ERP66689.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
Length=581

 Score =   470 bits (1210),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 250/515 (49%), Positives = 327/515 (63%), Gaps = 32/515 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             S+PFA A+P+  PD+  C   T+   S   P  CCPP +  TK++ ++ PS S  + +RP
Sbjct  75    SDPFAYANPIAPPDITQCELVTLPTES--DPSNCCPPTS--TKIKNFEFPSASSPMRIRP  130

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH VD AY+ KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY   G P    QIHF
Sbjct  131   AAHLVDKAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHF  190

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFP+HR YLY+FERI+  +I+DPTF LP+WNWD P GM  P IF D    SPLYD  
Sbjct  191   SWLFFPWHRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPE--SPLYDPL  248

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKV----KNNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             R+ +H+   +LDL Y+  D   PDP K      +NL +MYRQM++ A  P LFFGKP RA
Sbjct  249   RDANHQPPTLLDLNYAKGDA-NPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +  S GMGTIE  PH  +H W GDP   N E+MGNFYSA  DP+FY  HSNVDRMW +W
Sbjct  308   GDDPSPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLW  367

Query  1189  KTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP  1365
             K + GGKR DI D DWL++EFLF+DE K  V+VKV+D LD +KL Y FQD+PIPW   + 
Sbjct  368   KKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRA  427

Query  1366  TRKRTVKLSITESVPAST-----DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLD  1515
             T K T +     +   S         P  L K ++  V     +RS +  E ++E+L ++
Sbjct  428   TPKLTRQEKSRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIE  487

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + Y++ + I+FDV +N++ D +    D++E+AGSF N+PH H    A    TT  L I+
Sbjct  488   GIEYEENQSIKFDVLVNDEPD-SPGGPDKSEFAGSFVNVPHKH----AKKSKTTMVLGIT  542

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
              L++DL+ EGDD ++VTLVP+ GG FVTV N  I 
Sbjct  543   GLLEDLEAEGDDTLVVTLVPRTGGDFVTVANVKIE  577



>gb|AEL95440.1| polyphenol oxidase [Populus euphratica]
Length=590

 Score =   470 bits (1209),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 241/518 (47%), Positives = 322/518 (62%), Gaps = 31/518 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             S+PFA A PV  PD++ C  A +     +    CCPP+  T  +++ +  S + L VRPA
Sbjct  75    SDPFAFAAPVSAPDISKCSRADLPTGVNET--NCCPPVPSTKILDFKRPSSNAPLRVRPA  132

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH  D  Y+ KY  AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H +
Sbjct  133   AHLADKDYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVHNS  192

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W FFPFHR+YLYF+E+I+  +I+DPTF LP+WNWD+P GM  P ++ D N  SPLYD  R
Sbjct  193   WLFFPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPN--SPLYDSLR  250

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
             N++H+   +LDL +SG D    +  ++ +NL IMYRQM++N   P LFFG   RA +   
Sbjct  251   NKNHQPPTLLDLDWSGTDTPTSNREQISSNLTIMYRQMVSNGKTPRLFFGGSYRAGDEPG  310

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
                G IENIPH  VH W GD    N EDMGNFYSAA DP+F+  HSNVDRMW++WKTLGG
Sbjct  311   PEAGPIENIPHGPVHIWTGDNTQPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLGG  370

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTV  1383
             +RTD+ D DWL+  F F+DE    V+VKVRDCLD  KLGY +QD+ IPW   +PT +R+ 
Sbjct  371   RRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDVEIPWLRSRPTPRRSA  430

Query  1384  K-------------LSITESVPASTDVLPAPLSKN--LTFYVTRSTSVPETQEEMLNLDL  1518
             K             L+  +   A T +   PL  N  ++  V R       +E+    +L
Sbjct  431   KKVASNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARPKKSRSKKEKEDEEEL  490

Query  1519  V------YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFN  1680
             +      +D TK ++FDV++N DED +    D+TE+AGSF N+PH H+ G      T F 
Sbjct  491   LVIQGLEFDKTKALKFDVYIN-DEDDSLSAPDKTEFAGSFVNVPHKHKHGKKI--NTCFR  547

Query  1681  LAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             LA+++L++DLD+EGDD V+VTLVP+ G     +    I
Sbjct  548   LALTDLLEDLDVEGDDSVIVTLVPRYGEGLAKIGGIKI  585



>ref|XP_006370118.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
 gb|ERP66687.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
Length=581

 Score =   469 bits (1208),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 248/514 (48%), Positives = 326/514 (63%), Gaps = 32/514 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             S+PFA A+P+  PD+  C    +   S   P  CCPP +  T+++ ++ PS S  + +RP
Sbjct  75    SDPFAYANPIAPPDITQC--ELVPLPSESDPSNCCPPTS--TEIKNFEFPSASSPMRIRP  130

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH VD AY+ KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY   G P    QIHF
Sbjct  131   AAHLVDQAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLELQIHF  190

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFP+HR YLY+FERI+  +I+DPTF LP+WNWD P GM  P IF D    SPLYD  
Sbjct  191   SWLFFPWHRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPE--SPLYDPL  248

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVK----NNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             R+ +H+   +LDL Y+  D   PDP K +    +NL +MYRQM++ A  P LFFGKP RA
Sbjct  249   RDANHQPPTLLDLNYAKGDA-NPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +  S GMGTIE  PH  +H W GDP   N E+MGNFYSA  DP+FY  HSNVDRMW +W
Sbjct  308   GDDPSPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLW  367

Query  1189  KTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP  1365
             K + GGKR DI D DWL++EFLF+DE K  V+VKV+D LD +KLGY FQD+PIPW   + 
Sbjct  368   KKIPGGKREDIEDSDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQDVPIPWLTTRA  427

Query  1366  TRKRTVKLSITESVPAST-----DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLD  1515
             T K T +     +   S         P  L K ++  V     +RS +  E ++E+L ++
Sbjct  428   TPKLTRQEKSRRAAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIE  487

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + Y++ + I+FDV +N++ D +    D +E+AGSF N+PH H    A    TT  L I+
Sbjct  488   GIEYEENQLIKFDVLVNDEPD-SPGGPDNSEFAGSFVNVPHKH----AKKSKTTMVLGIT  542

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
              L++DL+ EGDD ++VTLVP+ GG  VTV N  I
Sbjct  543   GLLEDLEAEGDDTLVVTLVPRSGGDSVTVANVKI  576



>dbj|BAA92317.1| polyphenol oxidase I [Ipomoea batatas]
Length=588

 Score =   469 bits (1208),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 274/574 (48%), Positives = 353/574 (61%), Gaps = 42/574 (7%)
 Frame = +1

Query  139   PNPSR----AARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlga  306
             P PS+     A+R    K+ C A        P+  S+ KLDRR+VLLGLGGL GA +L  
Sbjct  31    PKPSQIHIATAKRTHHFKVSCNA--------PNGDSQPKLDRRDVLLGLGGLAGAASLI-  81

Query  307   ggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP--SFSKLN  480
               +NP A A+P+  P+++ C           +   CCPP+   T V  YK+P  S S + 
Sbjct  82    --NNPLAFAEPIHAPEISKCVVPPKDLPPDAIVDNCCPPLA--TNVIPYKVPKTSPSAMK  137

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQ  651
             +RPA H +D  Y+ K++ AI+ MK+LP+DDPRNFYQQA VHCAYCNG Y+    P    Q
Sbjct  138   IRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQ  197

Query  652   IHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLY  831
             +H +W FFPFHRWYLYF+ERI+  +I DPTF LP+WNWD P GM  P  F   NQ SPLY
Sbjct  198   VHNSWLFFPFHRWYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYF--RNQNSPLY  255

Query  832   DQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA-  1008
             D+ RNQ H    V+DL Y+G D    D  ++ NNLA+MY+ M+TNA    LF GKP +A 
Sbjct  256   DENRNQSH-LPLVMDLGYAGTDTDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAG  314

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGD--PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             D+  + G G+IENIPH  VHRWVGD  PR+ N EDMGNFYSA  D +FY  HSNVDRMWT
Sbjct  315   DDPVNKGGGSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWT  374

Query  1183  IWKTLGGK--RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKD  1356
             IW+ LGGK  R D  D DWLD  F+F+DE K AV+V+V D LDN+KLGY ++   +PW +
Sbjct  375   IWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLN  434

Query  1357  FK--PTRKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDD  1530
              K  PT+K+T  L+     P  TDV P  L K +   V R       +E+    +++  +
Sbjct  435   SKPLPTKKKT-GLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIE  493

Query  1531  T------KFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
                    ++ +FDV+LN DED      ++ EYAGSF +LPH H G       T+ +L ++
Sbjct  494   GIEVAIDQYAKFDVYLN-DEDEPEAGKEKAEYAGSFAHLPHKHTGSKKI--RTSLSLGLN  550

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             E ++DL  E DD VLVTL PKVGG  VTV N  I
Sbjct  551   EPLEDLGAEDDDAVLVTLAPKVGGGVVTVENIKI  584



>ref|XP_011014565.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   469 bits (1206),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 247/514 (48%), Positives = 326/514 (63%), Gaps = 32/514 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             S+PFA A+P+  PD+  C    ++  S   P  CCP    +TK++ ++ PS S  + +RP
Sbjct  75    SDPFAYANPIAPPDLTQC--ELVTLPSESNPTNCCP--QTSTKIKNFEFPSASSPMRIRP  130

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH VD AY+ KY  AI  MK LP DDPR+F  QANVHCAYC+GAY   G P    QIHF
Sbjct  131   AAHLVDKAYVAKYAKAIALMKSLPDDDPRSFKNQANVHCAYCDGAYHQAGFPDLDLQIHF  190

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFP+HR YLY+FERI+  +I+DPTF LP+WNWD P GM  P IF D    SPLYD  
Sbjct  191   SWLFFPWHRAYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPQ--SPLYDPL  248

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVK----NNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             R+ +H+   +LDL Y+  D   PDP K +    +NL +MYRQM++ A  P LFFGKP RA
Sbjct  249   RDANHQPPTLLDLNYAKGDA-NPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +  S GMGTIE  PH  +H W GDP     E+MGNFYSA  DP+FY  HSNVDRMW +W
Sbjct  308   GDDPSPGMGTIETTPHTEIHIWTGDPNQTKGENMGNFYSAGRDPIFYCHHSNVDRMWDLW  367

Query  1189  KTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP  1365
             K + GGKR DI D DWL++EFLF++E K  V+VKV+D LD +KL Y FQD+PIPW   +P
Sbjct  368   KKIPGGKRKDIEDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRP  427

Query  1366  TRKRTVKLSITESVPAST-----DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLD  1515
             T K T +  +  +   S         P  L K ++  V     +RS +  E + E+L ++
Sbjct  428   TPKLTRQEKLRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEAEVLVIE  487

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + Y++ + I+FDV +N++ D +    D++E+AGSF N+PH H    A    T   L I+
Sbjct  488   GIEYEENQLIKFDVLVNDEPD-SPGGPDKSEFAGSFVNVPHKH----AKKSKTNLVLGIT  542

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
              L++DL+ EGDD ++VTLVP+ GG FVTV N  I
Sbjct  543   GLLEDLEAEGDDTLVVTLVPRTGGDFVTVANVKI  576



>gb|AAU12256.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=581

 Score =   468 bits (1205),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 250/515 (49%), Positives = 326/515 (63%), Gaps = 32/515 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             S+PFA A+P+  PD+  C   T+   S   P  CCPP +  TK++ ++ PS S  + +RP
Sbjct  75    SDPFAYANPIAPPDITQCELVTLPTESD--PSNCCPPTS--TKIKNFEFPSASSPMRIRP  130

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH VD AYL KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY   G P    QIHF
Sbjct  131   AAHLVDKAYLAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHF  190

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFP+HR YLY+FERI+  +I+DPTF LP+W+WD P GM  P IF D    SPLYD  
Sbjct  191   SWLFFPWHRLYLYYFERILGKLIDDPTFALPFWSWDAPAGMQMPAIFTDPK--SPLYDPL  248

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKV----KNNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             R+ +H+   +LDL Y+  D   PDP K      +NL +MYRQM++ A  P LFFGKP RA
Sbjct  249   RDANHQPPTLLDLNYAKGDA-NPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +  S GMGTIE  PH  +H W GDP   N E+MGNFYSA  DP+FY  HSNVDRMW +W
Sbjct  308   GDDPSPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLW  367

Query  1189  KTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP  1365
             K + GGKR DI D DWL++EFLF+DE K  V+VKV+D LD +KL Y FQD+PIPW   + 
Sbjct  368   KKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKARA  427

Query  1366  TRKRTVKLSITESVPAST-----DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLD  1515
             T K T +     S   S         P  L K ++  V     +RS +  E ++E+L ++
Sbjct  428   TPKFTRQEKSRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIE  487

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + Y++ + I+FDV +N++ D +    D++E+AGSF N+PH H    A    TT  L I+
Sbjct  488   GIEYEENQLIKFDVLVNDEPD-SPGGPDKSEFAGSFINVPHKH----AKKSKTTMVLGIT  542

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
              L++DL+ EGDD ++VTLVP+ GG  VTV N  I 
Sbjct  543   GLLEDLEAEGDDTLVVTLVPRTGGDSVTVANVKIE  577



>dbj|BAB64530.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   469 bits (1206),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 258/559 (46%), Positives = 356/559 (64%), Gaps = 40/559 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  A K+ C A++  +++     +++KLDRRNVLLGLGGLYG   +G   ++PFA A P
Sbjct  39    KRSFARKVSCKATNNDQNDQ----AQSKLDRRNVLLGLGGLYGVAGMG---TDPFAFAKP  91

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             +  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AHAVD AY 
Sbjct  92    IAPPDVSKCGSADLPQGAEAT--NCCPP--PATKIIDFKLPAPAKLRIRPPAHAVDKAYR  147

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W FFPFHR+
Sbjct  148   DKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHRY  207

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+ D    SPLYD++R+  H+   +
Sbjct  208   YLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPK--SPLYDKFRSAKHQPPTL  265

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G G+IE  
Sbjct  266   IDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEGT  325

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKRTD+ADKD
Sbjct  326   PHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKRTDLADKD  385

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--------TVK  1386
             WLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R          K
Sbjct  386   WLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALGKIAKK  445

Query  1387  LSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLNLDLV-YD  1527
             L +  +  AS+  +      P  L   ++  V R      S    E +EE+L ++ + +D
Sbjct  446   LGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFD  505

Query  1528  DTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
                 ++FDVF+N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L+++
Sbjct  506   RDVAVKFDVFVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLEE  562

Query  1708  LDLEGDDKVLVTLVPKVGG  1764
             ++ E DD V+VTLVPK G 
Sbjct  563   IEAEDDDSVVVTLVPKYGA  581



>ref|XP_011047843.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=590

 Score =   468 bits (1205),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 240/518 (46%), Positives = 322/518 (62%), Gaps = 31/518 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             S+PFA A PV  PD++ C  A +     +    CCPP+  T  +++ +  S + L VRPA
Sbjct  75    SDPFAFAAPVSAPDISKCSRADLPTGVNET--NCCPPVPSTKILDFKRPSSNAPLRVRPA  132

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH  +  Y+ KY  AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H +
Sbjct  133   AHLANKDYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVHNS  192

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W FFPFHR+YLYF+E+I+  +I+DPTF LP+WNWD+P GM  P ++ D N  SPLYD  R
Sbjct  193   WLFFPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYADPN--SPLYDSLR  250

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
             N++H+   +LDL +SG D    +  ++ +NL IMYRQM++N   P LFFG   RA +   
Sbjct  251   NKNHQPPTLLDLDWSGTDTPTSNREQISSNLTIMYRQMVSNGKTPRLFFGGSYRAGDEPG  310

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
                G IENIPH  VH W GD    N EDMGNFYSAA DP+F+  HSNVDRMW++WKTLGG
Sbjct  311   PEAGPIENIPHGPVHIWTGDNTQPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVWKTLGG  370

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTV  1383
             +RTD+ D DWL+  F F+DE    V+VKVRDCLD  KLGY +QD+ IPW   +PT +R+ 
Sbjct  371   RRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDVEIPWLRSRPTPRRSA  430

Query  1384  K-------------LSITESVPASTDVLPAPLSKN--LTFYVTRSTSVPETQEEMLNLDL  1518
             K             L+  +   A T +   PL  N  ++  V R       +E+    +L
Sbjct  431   KKVASNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARPKKSRSKKEKEDEEEL  490

Query  1519  V------YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFN  1680
             +      +D TK ++FDV++N DED +    D+TE+AGSF N+PH H+ G      T F 
Sbjct  491   LVIQGLEFDKTKALKFDVYIN-DEDDSLSAPDKTEFAGSFVNVPHKHKHGKKI--NTCFR  547

Query  1681  LAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             LA+++L++DLD+EGDD V+VTLVP+ G     +    I
Sbjct  548   LALTDLLEDLDVEGDDSVIVTLVPRYGEGLAKIGGIKI  585



>ref|XP_006370127.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
 gb|ERP66696.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
Length=575

 Score =   468 bits (1203),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 248/514 (48%), Positives = 327/514 (64%), Gaps = 32/514 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             S+PFA A+P+  PD+  C   T+   S   P  CCPP +  TK++ ++ PS S  + +RP
Sbjct  69    SDPFAYANPIAPPDITQCELVTLPTESD--PSNCCPPTS--TKIKNFEFPSASSPMRIRP  124

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH VD AY+ KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY   G P    QIHF
Sbjct  125   AAHLVDKAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHF  184

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFP+HR YLY+FERI+  +I+DPTF LP+WNWD P GM  P IF D    SPLYD  
Sbjct  185   SWLFFPWHRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTDPK--SPLYDPL  242

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVK----NNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             R+ +H+   +LDL Y+  D   PDP K +    +NL +MYRQM++ A  P LFFGKP RA
Sbjct  243   RDANHQPPILLDLNYATGDA-NPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRA  301

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +  S GMGTIE  PH  +H W GDP   N E+MGNFYSA  DP+F+  HSNVDRMW +W
Sbjct  302   GDDPSPGMGTIETTPHTEIHFWTGDPNQTNGENMGNFYSAGRDPIFFCHHSNVDRMWDLW  361

Query  1189  KTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP  1365
             K + GGKR D  D DWL++EFLF++E K  V+VKV+D LD +KL Y FQD+PIPW   +P
Sbjct  362   KKIPGGKRKDFKDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTRP  421

Query  1366  TRKRTVKLSITESVPAST-----DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLD  1515
             T K T +     S   S         P  L K ++  V     +RS +  E ++E+L ++
Sbjct  422   TPKLTRQEKSRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIE  481

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + Y++ + I+FDV +N++ D +    D++E+AGSF N+PH H    A    TT  L I+
Sbjct  482   GIEYEENQLIKFDVLVNDEPD-SPGGPDKSEFAGSFVNVPHKH----AKKSKTTMVLGIT  536

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
              L++DL+ EGDD ++VTLVP+ GG  VTV N  I
Sbjct  537   GLLEDLEAEGDDTLVVTLVPRTGGDSVTVANVKI  570



>gb|AEG78292.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   468 bits (1203),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 256/559 (46%), Positives = 355/559 (64%), Gaps = 40/559 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  A K+ C A++  +++     +++KLDRRNVLLGLGGLYG   +G   ++PFA A P
Sbjct  39    KRSFARKVSCKATNNDQNDQ----AQSKLDRRNVLLGLGGLYGVAGMG---TDPFAFAKP  91

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             +  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AHAVD AY 
Sbjct  92    IAPPDVSKCGSADLPQGAEAT--NCCPP--PATKIIDFKLPAPAKLRIRPPAHAVDKAYR  147

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W FFPFHR+
Sbjct  148   DKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHRY  207

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYFFE+++  +INDPTF +P+WNWD+P GM  P I+ D    SPLYD++R+  H+   +
Sbjct  208   YLYFFEKMLGKLINDPTFAMPFWNWDSPAGMPLPAIYADPK--SPLYDKFRSAKHQPPTL  265

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G G+IE  
Sbjct  266   IDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEGT  325

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKRTD+ADKD
Sbjct  326   PHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKRTDLADKD  385

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--------TVK  1386
             WLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R          K
Sbjct  386   WLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALGKIAKK  445

Query  1387  LSITESVPASTDVL------PAPLSKNLTFYV------TRSTSVPETQEEMLNLDLV-YD  1527
             L +  +  AS+  +      P  L   ++  V       RS      +EE+L ++ + +D
Sbjct  446   LGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKGQRDEEEILVIEGIEFD  505

Query  1528  DTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
                 ++FDVF+N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L+++
Sbjct  506   RDVAVKFDVFVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLEE  562

Query  1708  LDLEGDDKVLVTLVPKVGG  1764
             ++ E DD V+VTLVPK G 
Sbjct  563   IEAEDDDSVVVTLVPKYGA  581



>gb|AEE61322.1| polyphenol oxidase I [Pyrus x bretschneideri]
 gb|AEE61323.1| polyphenol oxidase I precursor [Pyrus x bretschneideri]
Length=593

 Score =   468 bits (1203),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 258/559 (46%), Positives = 355/559 (64%), Gaps = 40/559 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  A K+ C A++  +++     +++KLDRRNVLLGLGGLYG   +G   ++PFA A P
Sbjct  39    KRSFARKVSCKATNNDQNDQ----AQSKLDRRNVLLGLGGLYGVAGMG---TDPFAFAKP  91

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             +  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AHAVD AY 
Sbjct  92    IAPPDVSKCGSADLPQGAEAT--NCCPP--PATKIIDFKLPAPAKLRIRPPAHAVDKAYR  147

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             +K+  A+  MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W FFPFHR+
Sbjct  148   DKFYKAMGLMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHRY  207

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+ D    SPLYD++R+  H+   +
Sbjct  208   YLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPK--SPLYDKFRSAKHQPPTL  265

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G G+IE  
Sbjct  266   IDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEGT  325

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKRTD+ADKD
Sbjct  326   PHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKRTDLADKD  385

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--------TVK  1386
             WLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R          K
Sbjct  386   WLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALGKIAKK  445

Query  1387  LSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLNLDLV-YD  1527
             L +  +  AS+  +      P  L   ++  V R      S    E +EE+L ++ + +D
Sbjct  446   LGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFD  505

Query  1528  DTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
                 ++FDVF+N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L+++
Sbjct  506   RDVAVKFDVFVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLEE  562

Query  1708  LDLEGDDKVLVTLVPKVGG  1764
             ++ E DD V+VTLVPK G 
Sbjct  563   IEAEDDDSVVVTLVPKYGA  581



>ref|XP_004246037.1| PREDICTED: polyphenol oxidase B, chloroplastic-like [Solanum 
lycopersicum]
Length=599

 Score =   467 bits (1201),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 271/587 (46%), Positives = 346/587 (59%), Gaps = 44/587 (7%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAA---SSEGRDENPDSLSKAKLDRRNVllglgglygay  294
             Q+FL+       RR  +  + C A   SSE    N D +    +DRRNVLLGLGGLY A 
Sbjct  32    QVFLH------GRRSQSFNVSCNANNNSSEHEKNNVDDV----VDRRNVLLGLGGLYSAT  81

Query  295   nlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI--TDTTKVEYYKIPSF  468
             NL      P A A P P PD  +C   TI+     V Y CCPP    DT+ + +Y+ P  
Sbjct  82    NLA-----PLATAAPSPSPDFKSCSTTTIT-GGPAVKYTCCPPPLPKDTSTIPFYEFPPM  135

Query  469   SKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPS---DDPRNFYQQANVHCAYCNGAYLLNG  639
             +KL +R  AH VD  Y+ KY  AI +MK L     D P  F QQAN+HCAYCNGAY + G
Sbjct  136   NKLRMRSPAHLVDEEYIAKYNLAISRMKALDKTEPDKPLGFKQQANIHCAYCNGAYNIGG  195

Query  640   NPYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQL  819
                Q+H +W FFPFHRWYLYF+ERI+  +I+ PTF LPYWNWDNP GM  P +FD E   
Sbjct  196   KELQVHNSWLFFPFHRWYLYFYERILGKLIDHPTFALPYWNWDNPKGMRLPPMFDREG--  253

Query  820   SPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKP  999
             + LYD+ RN   R G V+DL   GD +         NNL +MY QM++NAPCPLLFFG  
Sbjct  254   TSLYDERRNPQVRNGTVMDLGTFGDTVDTTQLLLQTNNLILMYHQMVSNAPCPLLFFGG-  312

Query  1000  LRADNTQSSGMGTIENIPHNSVHRWVGDPRSAN--------HEDMGNFYSAANDPVFYSL  1155
                  T     GTIE IPH  VH W G  R  N         EDMGNFYSA  DPVFY  
Sbjct  313   RYVLGTNIEAPGTIEKIPHIPVHIWTGTVRDVNAPKGKPKYGEDMGNFYSAGLDPVFYCH  372

Query  1156  HSNVDRMWTIWKTLGGKRTD-IADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQ  1332
             H NVDRMW  WKTLGGKRTD + + D +++EF F+DE K    VKV DCLD +K+GY + 
Sbjct  373   HGNVDRMWNEWKTLGGKRTDLVTEPDLMNSEFFFYDENKKPYLVKVGDCLDTKKMGYDYV  432

Query  1333  DMPIPWKDFKPTRKRTVKLSITESVPASTDVLPA-PLSKNLTFYVTRSTSV-----PETQ  1494
               P PW+DFKP +  +     T SVP ++ + P   L  N +F + R  S+      + +
Sbjct  433   KSPTPWRDFKPNKNYSSGKLDTSSVPPASKIFPIFKLDVNTSFSLDRPASLRTQVEKDNK  492

Query  1495  EEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHE-GGSATPKT  1668
             EE+L    + YD  ++IRFDV+LN D++V   +L++TEYA S+ +LPH H+ G      T
Sbjct  493   EEILTFSYIKYDSREYIRFDVYLNADKNVKPEDLNQTEYAESYTSLPHTHKPGDDDYVST  552

Query  1669  TTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLDC  1809
              T  LAI+EL+K+  LE +DK++VTLVP+ GG  + +    I  +DC
Sbjct  553   ATLQLAITELLKENGLEKEDKIVVTLVPRKGGEGLAIGCVEIALVDC  599



>gb|ABS88291.1| polyphenol oxidase [Pyrus x bretschneideri]
 gb|ACI15854.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   466 bits (1198),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 257/559 (46%), Positives = 357/559 (64%), Gaps = 40/559 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  A K+ C A++  +++     +++KLDRRNVLLGLGGLYG   +G   ++PFA A P
Sbjct  39    KRSFARKVSCKATNNDQNDQ----AQSKLDRRNVLLGLGGLYGVAGMG---TDPFAFAKP  91

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             +  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AHAVD AY 
Sbjct  92    IAPPDVSKCGSADLPPGAEAT--NCCPP--PATKIIDFKLPAPAKLRIRPPAHAVDKAYR  147

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W FFPFHR+
Sbjct  148   DKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHDSWLFFPFHRY  207

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+ D    +PLYD++R+  H+   +
Sbjct  208   YLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPK--TPLYDKFRSAKHQPPTL  265

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+  +      T +  NL IMYRQM++N+    LFFG P RA +  + G G+IE  
Sbjct  266   IDLDYNRTEDNVSTETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDGPNPGGGSIEGT  325

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH SVH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKRTD+ADKD
Sbjct  326   PHGSVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKRTDLADKD  385

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--------TVK  1386
             WLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R          K
Sbjct  386   WLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPTPRRAKVALGKIAKK  445

Query  1387  LSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLNLDLV-YD  1527
             L +  +  AS+  +      P  L   ++  V R      S    E +EE+L ++ + +D
Sbjct  446   LGVAHATVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFD  505

Query  1528  DTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
                 ++FDVF+N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L+++
Sbjct  506   RDVAVKFDVFVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLEE  562

Query  1708  LDLEGDDKVLVTLVPKVGG  1764
             ++ E DD V+VTLVPK G 
Sbjct  563   IEAEDDDSVVVTLVPKYGA  581



>gb|AFO55217.1| chloroplast polyphenol oxidase I [Eriobotrya japonica]
Length=593

 Score =   465 bits (1196),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 255/559 (46%), Positives = 352/559 (63%), Gaps = 40/559 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  A K+ C A++  +++     +++KLDRRNVLLGLGG+YG   +G   ++PFA A P
Sbjct  39    KRSFARKVSCKATNNDQNDQ----AQSKLDRRNVLLGLGGIYGVAGMG---TDPFAFAKP  91

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             +  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AHAVD AY 
Sbjct  92    IAPPDVSKCGSADLPPGAEAT--NCCPP--PATKIIDFKLPAPAKLRIRPPAHAVDQAYR  147

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W FFPFHR+
Sbjct  148   DKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHRY  207

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+   N  SPLYD++R+  H+   +
Sbjct  208   YLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIY--ANPKSPLYDKFRSAKHQPPTL  265

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G G+IE  
Sbjct  266   VDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNARLFFGNPYRAGDEPDPGGGSIEGT  325

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW IWKTLGGKRTD+ D D
Sbjct  326   PHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWNIWKTLGGKRTDLTDSD  385

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--------TVK  1386
             WLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R          K
Sbjct  386   WLDSGFLFYNENAELVRVKVRDCLETKNLGYGYQDVDIPWLSSKPTPRRAKVALSKIAKK  445

Query  1387  LSITESVPASTDVL------PAPLSKNLTFYV------TRSTSVPETQEEMLNLDLV-YD  1527
             L +  +  AS+  +      P  L   ++  V       RS    E +EE+L ++ + +D
Sbjct  446   LGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPQQKKRSKKAKEDEEEILVIEGIEFD  505

Query  1528  DTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
                 ++FDVF+N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L+ +
Sbjct  506   RDVAVKFDVFVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLGE  562

Query  1708  LDLEGDDKVLVTLVPKVGG  1764
             ++ E DD V+VTLVPK G 
Sbjct  563   IEAEDDDSVVVTLVPKYGA  581



>ref|XP_006370125.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
 gb|ERP66694.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
Length=581

 Score =   464 bits (1194),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 246/514 (48%), Positives = 323/514 (63%), Gaps = 32/514 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             S+PFA A+P+  PD+  C    ++  S   P  CCP    +TK++ ++ PS S  + +RP
Sbjct  75    SDPFAYANPIAPPDITQC--ELVTLPSESNPTNCCP--QTSTKIKNFEFPSASSPMRIRP  130

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH VD A L KY  AI  MK LP DDPR+F  QANVHCAYC+GAY   G P    QIHF
Sbjct  131   AAHLVDKASLAKYAKAIALMKSLPDDDPRSFKSQANVHCAYCDGAYHQAGFPDLELQIHF  190

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFP+HR YLY+FERI+  +I+DPTF LP+WNWD P GM  P IF D    SPLYD  
Sbjct  191   SWLFFPWHRAYLYYFERILGKLIDDPTFALPFWNWDAPAGMQIPAIFTDPK--SPLYDPL  248

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVK----NNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             R+ +H+   + DL Y+  D   PDP K +    +NL +MYRQM++ A  P LFFGKP RA
Sbjct  249   RDANHQPPTLFDLNYATGDA-NPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +  S GMGTIE  PH  +H W GDP     E+MGNFYSA  DP+FY  HSNVDRMW +W
Sbjct  308   GDDPSPGMGTIETTPHTQIHIWTGDPNQTKGENMGNFYSAGRDPIFYCHHSNVDRMWDLW  367

Query  1189  KTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP  1365
             K + GGKR DI D DWL++EFLF+DE K  V+VKV+D LD +KLGY FQD+PIPW   + 
Sbjct  368   KKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQDVPIPWLTTRA  427

Query  1366  TRKRTVKLSITESVPAST-----DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLD  1515
             T K T +   + +   S         P  L K ++  V     +RS +  E ++E+L ++
Sbjct  428   TPKLTRQEKSSRAAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIE  487

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + Y++ + I+FDV +N++ D +    D +E+AGSF N+PH H    A    TT  L I+
Sbjct  488   GIEYEENQLIKFDVLVNDEPD-SPGGPDMSEFAGSFVNVPHKH----AKKSKTTMVLGIT  542

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
              L++DL+ EGDD ++VT VP+ GG  VTV N  I
Sbjct  543   GLLEDLEAEGDDTLVVTFVPRTGGDSVTVANVKI  576



>gb|AFL03159.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   464 bits (1195),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 256/559 (46%), Positives = 357/559 (64%), Gaps = 40/559 (7%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             +R  A K+ C A++  +++     +++KLDRRNVLLGLGGLYG   +G   ++PFA A P
Sbjct  39    KRSFARKVSCKATNNDQNDQ----AQSKLDRRNVLLGLGGLYGVAGMG---TDPFAFAKP  91

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             +  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AHAVD AY 
Sbjct  92    IAPPDVSKCGSADLPPGAEAT--NCCPP--PATKIIDFKLPAPAKLRIRPPAHAVDKAYR  147

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W FFPFHR+
Sbjct  148   DKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHDSWLFFPFHRY  207

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+ D    +PLYD++R+  H+   +
Sbjct  208   YLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPK--TPLYDKFRSAKHQPPTL  265

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+  +      T +  NL IMYRQM++N+    LFFG P RA +  + G G+IE  
Sbjct  266   IDLDYNRTEDNVSTETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDGPNPGGGSIEGT  325

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH SVH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IW+TLGGKRTD+ADKD
Sbjct  326   PHGSVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWRTLGGKRTDLADKD  385

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--------TVK  1386
             WLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R          K
Sbjct  386   WLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPTPRRAKVALGKIAKK  445

Query  1387  LSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLNLDLV-YD  1527
             L +  +  AS+  +      P  L   ++  V R      S    E +EE+L ++ + +D
Sbjct  446   LGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFD  505

Query  1528  DTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
                 ++FDVF+N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L+++
Sbjct  506   RDVAVKFDVFVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLEE  562

Query  1708  LDLEGDDKVLVTLVPKVGG  1764
             ++ E DD V+VTLVPK G 
Sbjct  563   IEAEDDDSVVVTLVPKYGA  581



>gb|ADF59058.2| polyphenol oxidase IV [Pyrus x bretschneideri]
Length=587

 Score =   463 bits (1192),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 261/567 (46%), Positives = 344/567 (61%), Gaps = 35/567 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R  ++  A ++RC A+    D     L  A+LDRRN+L+GLG             NPFA 
Sbjct  39    RKPKQCLAGRVRCKATKGDNDSLDQGL--ARLDRRNMLIGLGAGGLYGAA----GNPFAF  92

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH--AV  504
             A P+  PD+  CGPA     S      CCPP T  T +  +K+P    L  RPAA   A 
Sbjct  93    AAPISAPDLTTCGPADKPDGST---IDCCPPTT--TTIIDFKLPDKGPLRTRPAAQDVAK  147

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             D AYL KYK A++ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+H+ W FF
Sbjct  148   DPAYLAKYKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLFF  207

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+E+I+  +I DPTF LP+WNWD P GM  P IF D +  S LYDQYRN  H
Sbjct  208   PFHRWYLYFYEKILGELIGDPTFALPFWNWDAPAGMYIPEIFTDTS--SSLYDQYRNAAH  265

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   +LDL YSG D    DPT++K NL  MY+QM++ A    LF+G+P  A +  S G G
Sbjct  266   QPPKLLDLNYSGTDDDVDDPTRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDPSPGAG  325

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-TLGGKRT  1212
              IE+IPHN++H W GDP   N EDMG FYS+  DP+FYS HSNVDRMW+I+K  LGG  T
Sbjct  326   NIESIPHNNIHFWTGDPTQTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGG--T  383

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTF-QDMPIPWKDFKPT-RKRTVK  1386
             DI   DWLDTEFLF+DE K  V+VKVRD LD +KLGY + Q +PIPW  +KPT RK T K
Sbjct  384   DIEKTDWLDTEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDQKVPIPWLKYKPTARKSTNK  443

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-YDDTKFIR  1545
                + S    T   PA LS  ++  VTR ++   T      Q+E+L +  + +   + ++
Sbjct  444   RKASVSSSDLTTTFPAVLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVK  503

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDVF+N+D D +    D++E+AGSF ++PH H+        T   L+I+ L+++L  E D
Sbjct  504   FDVFVNDDAD-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSIASLLEELAAETD  558

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTLD  1806
               ++VTLVPKVG   +T+    I  ++
Sbjct  559   SSLVVTLVPKVGKGPITIGGFSIELIN  585



>gb|ADI44162.1| polyphenol oxidase 1 [Fragaria pentaphylla]
Length=607

 Score =   464 bits (1193),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 264/570 (46%), Positives = 355/570 (62%), Gaps = 39/570 (7%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSK------AKLDRRNVllglgglygaynlgaggSNPFALADP  339
             ++ C A++   D+NP + S         LDRRNVLLGLGGLYG   LG   ++PFA A P
Sbjct  47    RVSCKATNS--DQNPSNNSNDAQPLGRTLDRRNVLLGLGGLYGVAGLG---TDPFAFAKP  101

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             V  PDV+ CG A +   + K    CCPP+    K+  +++P  SKL VRPAAHAVD AY+
Sbjct  102   VAPPDVSKCGAADLPTGAQKT--DCCPPVA--QKIFDFQLPPQSKLRVRPAAHAVDKAYI  157

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
             EKY  AI+ MK LP DDPR+F QQAN+HCAYC+GAY   G P    QIH +W FFPFHR+
Sbjct  158   EKYSKAIELMKALPDDDPRSFKQQANIHCAYCDGAYDQAGFPDLELQIHDSWLFFPFHRY  217

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYF+ERI+  +INDP+F  P+WNWD P GM  PG+F   N  SPLYD++RN +H+   +
Sbjct  218   YLYFYERILGKLINDPSFASPFWNWDAPAGMQLPGMF--ANPKSPLYDKFRNANHQPPKL  275

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL Y+  D    D T++  NL IMYRQM++NA  P LFFG P RA +  S G G IE  
Sbjct  276   IDLNYNLKDANVSDETQINTNLKIMYRQMVSNAKNPKLFFGNPYRAGDEPSPGGGAIETT  335

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+F+S HSNVDR+W++WKTLGGKR D  D D
Sbjct  336   PHGPVHIWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSVWKTLGGKREDFTDSD  395

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT------VKLS  1392
             WLD+ FLF+DE    V+VKVRDCLD++KLGY +QD+ IPW   KPT +R+        + 
Sbjct  396   WLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPTPRRSKLAKAAKAIG  455

Query  1393  ITESVPASTDVL-----PAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF----  1539
             +  +  +   V+     P  L   ++  V R      +++E  + +  LV    +F    
Sbjct  456   VARAASSGPKVVGRSDFPIKLDSKISTVVKRPKQKKRSKKEKEDEEEILVIGGIEFEKDM  515

Query  1540  -IRFDVFLNEDEDVNT-VELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLD  1713
              ++FDV++N+ ED +   + D +E+AGSF N+PH H+        +   L +++L++DL 
Sbjct  516   AVKFDVYVNDLEDDDEPGKPDDSEFAGSFVNVPHKHKDKKKKKTKSCLRLGLTDLLEDLG  575

Query  1714  LEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
              E D+ V+VTLVP+ G   + ++   I  L
Sbjct  576   AEDDESVVVTLVPRYGTKSLKIDTIKIEFL  605



>sp|Q08305.1|PPOC_SOLLC RecName: Full=Polyphenol oxidase C, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78297.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=626

 Score =   464 bits (1195),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 263/568 (46%), Positives = 344/568 (61%), Gaps = 42/568 (7%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+FL+       +R  A K+ C  ++   +++  +     +DRRNVLLGLGGLYG  N  
Sbjct  28    QLFLH------GKRNKAFKVSCKVTNTNGNQDETN----SVDRRNVLLGLGGLYGVANAI  77

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLN  480
                ++          PD+++C  A I  +   V Y CC P   D  KV YYK PS +KL 
Sbjct  78    PLAASAAPTP----PPDLSSCSIARIDENQV-VSYSCCAPKPDDMEKVPYYKFPSMTKLR  132

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPS---DDPRNFYQQANVHCAYCNGAYLLNGNPYQ  651
             VR  AH  D  Y+ KY  A+ KMKDL     D+P  F QQAN+HCAYCNG Y ++G   Q
Sbjct  133   VRQPAHEADEEYIAKYNCAVTKMKDLDKTQPDNPIGFKQQANIHCAYCNGGYSIDGKVLQ  192

Query  652   IHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLY  831
             +H +W FFPFHRWYLYF+ERI+ S+I+DPTF LP+WNWD+P GM FP +FD     + LY
Sbjct  193   VHNSWLFFPFHRWYLYFYERILGSLIDDPTFGLPFWNWDHPKGMRFPPMFDVPG--TALY  250

Query  832   DQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRAD  1011
             D+ R      G+ +DL Y GD +       + NNL +MYRQ++TN+PCPL+     L   
Sbjct  251   DERRGDQIHNGNGIDLGYFGDQVETTQLQLMTNNLTLMYRQLVTNSPCPLMSL-VDLTLF  309

Query  1012  NTQSSGMGTIENIPHNSVHRWVGDPRSA--------NHEDMGNFYSAANDPVFYSLHSNV  1167
              +     GT+ENIPH+ VH WVG  R +        N EDMGNFYSA  DP+FY  HSNV
Sbjct  310   GSTVEDAGTVENIPHSPVHIWVGTRRGSVLPVGKISNGEDMGNFYSAGLDPLFYCHHSNV  369

Query  1168  DRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIP  1347
             DRMW  WK  GGKRTDI +KDWL++EF F+DE     KV+VRDCLD +K+GY +     P
Sbjct  370   DRMWNEWKATGGKRTDIQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYHATATP  429

Query  1348  WKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEMLN  1509
             W++FKP  K +     T S+P  + V P A L K ++F + R  S         QEE+L 
Sbjct  430   WRNFKPKTKASAGKVNTGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEVLT  489

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK---TTTF  1677
              + + YD+  +IRFDVFLN D +VN  ELD+ E+AGS+ +LPHVH  G   PK   T T 
Sbjct  490   FNAIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGD--PKHTATATL  547

Query  1678  NLAISELIKDLDLEGDDKVLVTLVPKVG  1761
              LAI+EL++D+ LE +D + VTLVPK G
Sbjct  548   RLAITELLEDIGLEDEDTIAVTLVPKKG  575



>ref|XP_009334438.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=586

 Score =   462 bits (1189),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 261/567 (46%), Positives = 348/567 (61%), Gaps = 35/567 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R  ++  A ++RC A+ +G ++N D    A+LDRRN+L+GLG             NPFA 
Sbjct  38    RKPKQCLAGRVRCKAT-KGDNDNLDQ-GLARLDRRNMLIGLGAGGLYGAA----GNPFAF  91

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH--AV  504
             A P+  PD+  CGPA     S      CCPP   TT +  +++P    L  RPAA   A 
Sbjct  92    AAPISAPDLTTCGPADKPDGST---IDCCPP--STTTIIDFELPDSGPLRTRPAAQDVAK  146

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             D AYL KYK A++ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+H+ W FF
Sbjct  147   DPAYLAKYKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLFF  206

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+E+I+  +I DPTF LP+WNWD P GM  P IF D +  S LYDQYRN  H
Sbjct  207   PFHRWYLYFYEKILGELIGDPTFALPFWNWDAPAGMYIPEIFTDTS--SSLYDQYRNAAH  264

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   +LDL YSG D    DPT++K NL  MY+QM++ A    LF+G+P  A +  S G G
Sbjct  265   QPPKLLDLNYSGTDDDVDDPTRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDPSPGAG  324

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-TLGGKRT  1212
              IE+IPHN++H W GDP   N EDMG FYS+  DP+FYS HSNVDRMW+I+K  LGG  T
Sbjct  325   NIESIPHNNIHFWTGDPTQTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGG--T  382

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTF-QDMPIPWKDFKPT-RKRTVK  1386
             DI   DWLDTEFLF+DE K  V+VKVRD LD +KLGY + Q +PIPW  +KPT RK T K
Sbjct  383   DIEKTDWLDTEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDQKVPIPWLKYKPTARKSTNK  442

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-YDDTKFIR  1545
                + S    T   PA LS  ++  VTR ++   T      Q+E+L +  + +   + ++
Sbjct  443   RKASVSSSDLTTTFPAVLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVK  502

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDVF+N+D D +    D++E+AGSF ++PH H+        T   L+I+ L+++L  E D
Sbjct  503   FDVFVNDDAD-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSIASLLEELAAETD  557

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTLD  1806
               ++VTLVPKVG   +T+    I  ++
Sbjct  558   SSLVVTLVPKVGKGPITIGGFSIELIN  584



>ref|XP_010686568.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   462 bits (1190),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 256/574 (45%), Positives = 355/574 (62%), Gaps = 35/574 (6%)
 Frame = +1

Query  148   SRAARRGDAVKIRCAASSEGRDENPDS---LSKAKLDRRNVllglgglygaynlgaggSN  318
             SR   R    KI C  + +  D+NP +    S   LDRRN+L+GLGGLYGA         
Sbjct  36    SRRLARRPTRKISCNVA-KNDDQNPKTNHERSNNMLDRRNMLIGLGGLYGAATTLG--GG  92

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             P +LA PV  P+   CG A +  ++  +   CCPP   T  V++   P+ + L VRP AH
Sbjct  93    PASLAAPVQTPNPTACGAADLPSNAQGL--NCCPPRA-TNIVDFVLPPTPNTLRVRPPAH  149

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
              VD  Y +K+  AI  MK LPS DPR+F QQANVHCAYCNG+Y   G P    Q+H +W 
Sbjct  150   LVDDQYRQKFNRAISLMKALPSTDPRSFTQQANVHCAYCNGSYSPVGFPNLDLQVHNSWL  209

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             F+PFHRWYLYFFERI+ ++INDPTF +P+WNWD P GM  P ++ D N  SPLYD  R++
Sbjct  210   FYPFHRWYLYFFERILGTLINDPTFAIPFWNWDTPAGMVMPALYTDPN--SPLYDSVRDR  267

Query  850   DHRYGHVLDLAYSGDDII-APDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSS  1026
              H+   VLDL Y   D     +   +  NL +MYRQM+TN+    LF G+P RA    + 
Sbjct  268   AHQPPKVLDLNYDLTDANDLSNQQMISANLTLMYRQMVTNSSTARLFLGQPYRAGTRPNP  327

Query  1027  GMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGK  1206
             G G++EN+PH +VH W GD    N EDMGNFYSAA DP+FY+ H+N+DRMW+IWKTLGG 
Sbjct  328   GGGSVENVPHGTVHVWTGDRNQPNFEDMGNFYSAARDPLFYAHHANIDRMWSIWKTLGGN  387

Query  1207  RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVK  1386
             R D  + DWLD  F+F+DE   AV+V+VRDCL+  +LGY +Q++ +PW++ +P   RT +
Sbjct  388   RQDFTETDWLDASFIFYDENAQAVRVRVRDCLNTARLGYNYQNVDLPWRNAQPL--RTSR  445

Query  1387  LSITESVPASTDVL----------PAPLSKNLTFYV-----TRSTSVPETQEEMLNLDL-  1518
             +S   S P + + +          P PL+K++   V     +RS S  + +EE L +++ 
Sbjct  446   VSSISSTPQAANAMESKTTTTVKFPRPLNKSIRTNVARPKKSRSKSEKDREEEELVIEVD  505

Query  1519  VYDDTKFIRFDVFLNEDEDVNTVELD-RTEYAGSFGNLPHVHEGGSATPK-TTTFNLAIS  1692
             V    K+ +FDV++N+++DV + ++  + EYAGSF N+PH H+ G    K TTTF + ++
Sbjct  506   VLRHDKYAKFDVYINDEDDVPSKKMQVKAEYAGSFVNVPHRHKQGEDKHKLTTTFRVGLT  565

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             ELI++L  + DD + V LVP+ G   V + N  I
Sbjct  566   ELIQELGADDDDGITVNLVPRAGKDNVVIKNVKI  599



>gb|AED02598.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=584

 Score =   462 bits (1188),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 264/552 (48%), Positives = 338/552 (61%), Gaps = 36/552 (7%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             ++RC A++ G D     LS+  LDRRN+L+GLG        G   +NPFA A PV  PD+
Sbjct  44    RVRCKATNGGNDHLEQGLSR--LDRRNMLIGLGAGGLYGATGLE-NNPFASAAPVSAPDL  100

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV--DAAYLEKYK  531
               CGPA     +      CCPP T  T +  +K+P    L  R AA  V  D  YL KYK
Sbjct  101   TQCGPADKPDGTT---IDCCPPTT--TTIIDFKLPDKGPLRTRLAAQDVAKDPVYLAKYK  155

Query  532   TAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYF  702
              AI  M+ LP DDPR+F QQA VHC+YC+G Y   G P    Q+HF W FFPFHRWYLYF
Sbjct  156   KAIALMRALPDDDPRSFTQQAMVHCSYCDGGYPQVGYPNLEIQVHFCWLFFPFHRWYLYF  215

Query  703   FERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLA  882
             FE+IM  +I DPTF LP+WNWD P GM  P IF D    SPLYDQYRN  H+   +LDL 
Sbjct  216   FEKIMGELIGDPTFALPFWNWDAPVGMYLPEIFTDTT--SPLYDQYRNAAHQPPKLLDLN  273

Query  883   YSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNS  1062
             Y G D    D T++K NL  MY+QM++ A    LF+G+P  A +  S G G IEN PHN+
Sbjct  274   YGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDASSPGAGNIENTPHNN  333

Query  1063  VHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKT-LGGKRTDIADKDWLD  1239
             +H W GDP   N EDMG FYSA  DPVF++ HSNVDRMW+I+K+ LGG  TDI   DWLD
Sbjct  334   IHLWTGDPTQTNGEDMGAFYSAGRDPVFFAHHSNVDRMWSIYKSKLGG--TDIKKTDWLD  391

Query  1240  TEFLFFDETKTAVKVKVRDCLDNEKLGYTFQD-MPIPWKDFKPT-RKRTVKLSITESVPA  1413
              EFLF+DE K  ++VKVRD LD  KLGY + D + IPW  +KPT RK + K   T S   
Sbjct  392   AEFLFYDEKKNLMRVKVRDSLDTTKLGYVYGDKVEIPWLTYKPTARKSSNKRKATVSSAD  451

Query  1414  STDVLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-YDDTKFIRFDVFLNEDE  1572
              T   PA L+  +T  V R+++   T      Q+E+L +  + Y   K ++FDV++N+D 
Sbjct  452   LTTNFPATLTDTITVEVARTSTKKRTSAQKKAQDEVLVISGIKYAMNKAVKFDVYVNDDA  511

Query  1573  DVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVP  1752
             D +    D++E+AGSF ++PH      +   TTT  L+I++L+++LD E D  V+VTLVP
Sbjct  512   D-SLAGKDKSEFAGSFVHVPH----KGSKDITTTLRLSITKLLEELDAETDSSVVVTLVP  566

Query  1753  KVG----GSFVT  1776
             K+G    G F T
Sbjct  567   KIGTVTIGGFST  578



>gb|AAW78869.1| polyphenol oxidase [Ipomoea batatas]
Length=588

 Score =   462 bits (1188),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 272/574 (47%), Positives = 351/574 (61%), Gaps = 42/574 (7%)
 Frame = +1

Query  139   PNPSR----AARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlga  306
             P PS+     A+R    K+ C A        P+  S+ KLDRR+VLLGLGGL GA +L  
Sbjct  31    PKPSQIHIATAKRTHHFKVSCNA--------PNGDSQPKLDRRDVLLGLGGLAGAASLI-  81

Query  307   ggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP--SFSKLN  480
               +NP A A+P+  P+++ C           +   CCPP+   T V   K+P  S S + 
Sbjct  82    --NNPLAFAEPIHAPEISKCVVPPKDLPPDAIVDSCCPPLA--TNVIPSKVPKTSPSAMK  137

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQ  651
             +RPA H +D  Y+ K++ AI+ MK+LP+DDPRNFYQQA VHCAYCNG Y+    P    Q
Sbjct  138   IRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQ  197

Query  652   IHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLY  831
             +H +W FFPFHRWYLYF+ERI+  +INDPTF LP+WNWD P GM  P  F   NQ SPLY
Sbjct  198   VHNSWLFFPFHRWYLYFYERILGKLINDPTFGLPFWNWDTPAGMLIPQYF--RNQNSPLY  255

Query  832   DQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA-  1008
             D+ R Q H    V+DL Y+G D    D  ++ NNLA+MY+ M+TNA    LF GKP +A 
Sbjct  256   DENRLQSH-LPLVMDLGYAGTDTDVTDDERISNNLALMYKSMVTNAGTAELFLGKPYKAG  314

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGD--PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             D+  + G G+IENIPH  VHRWVGD  PR+ N EDMGNFYSA  D +FY  HSNVDRMWT
Sbjct  315   DDPVNKGGGSIENIPHTPVHRWVGDVQPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWT  374

Query  1183  IWKTLGGK--RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKD  1356
             IW+ LGGK  R D  D DWLD  F+F+DE K A +V+V D LDN+KLGY ++   +PW +
Sbjct  375   IWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAYRVRVGDALDNQKLGYKYEFTNLPWLN  434

Query  1357  FK--PTRKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDD  1530
              K  PT+K+T  L+     P  TDV P  L K +   V R       +E+    +++  +
Sbjct  435   SKPLPTKKKT-GLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIE  493

Query  1531  T------KFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
                    ++ +FDV+LN DED      ++ EYAGSF +LPH H G       T+ +L ++
Sbjct  494   GIEVAIDQYAKFDVYLN-DEDEPEAGKEKAEYAGSFAHLPHKHTGSKKI--RTSLSLGLN  550

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             E ++DL  E DD VLVTL PKVGG  VTV N  I
Sbjct  551   EPLEDLGAEDDDAVLVTLAPKVGGGDVTVENIKI  584



>gb|ACM43505.1| polyphenoloxidase [Camellia nitidissima]
Length=595

 Score =   462 bits (1188),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 258/566 (46%), Positives = 346/566 (61%), Gaps = 40/566 (7%)
 Frame = +1

Query  172   AVKIRCAASSEGRDENPDSLSK------AKLDRRNVllglgglygaynlgaggSNPFALA  333
             + KI C  S++  ++NP++ SK       KLDRRNVLLGLGG   A  L    +NP A A
Sbjct  41    SFKISCK-STDNDNQNPNTTSKNEETFLGKLDRRNVLLGLGGYSAATIL----ANPLAFA  95

Query  334   DPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAA  513
              PV  PD+A CG A +   +   P  CCPP    TK+  +K P  + + VRPAAH  DA 
Sbjct  96    APVTAPDLAKCGAADLPAGA--KPTNCCPP--KATKIIDFKFPQSNSMRVRPAAHLADAE  151

Query  514   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFH  684
             Y+ K+  A+  MK LP DDPR+F QQANVHCAYC+GAY   G P    Q+H +W FFPFH
Sbjct  152   YIAKFSKALALMKALPEDDPRSFKQQANVHCAYCDGAYHQVGFPELDLQVHNSWLFFPFH  211

Query  685   RWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYG  864
             R+YL+FFERI+ S+I DP+F +P+WNWD+P GM  P ++ D N  SPLYD  R+  H+  
Sbjct  212   RYYLHFFERILGSLIGDPSFAIPFWNWDSPNGMQMPAMYADPN--SPLYDVLRDAKHQPP  269

Query  865   HVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIE  1044
              ++DL Y+G D    D  +  +NL +MYRQM++++    LF G P RA +    G G++E
Sbjct  270   TLVDLDYNGSDPTTTDAQQKSSNLNVMYRQMVSSSKSARLFLGSPYRAGDEPDPGAGSLE  329

Query  1045  NIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIAD  1224
             NIPH  VH W GD    N EDMGNFYSA  D +FY  H+NVDRMW+IWKTLGGKR D  D
Sbjct  330   NIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDSIFYGHHANVDRMWSIWKTLGGKRQDFTD  389

Query  1225  KDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLS----  1392
              DWL+  F+F+DE    V+VKV+DCLD+ KLGY +QD+ IPW + +P   R  KLS    
Sbjct  390   PDWLNAGFVFYDENAQLVRVKVKDCLDSRKLGYVYQDVDIPWLNTRPA-PRVSKLSRKIN  448

Query  1393  ------ITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTK  1536
                     ++   + +V P  L K +   V     +RS    + +EE+L ++ +  D   
Sbjct  449   KAGVAMAADTPSTAAEVFPKKLDKAVRVMVPRPKKSRSKKEKDDEEEILVIEGIEVDRDV  508

Query  1537  FIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDL  1716
             F++FDVF+N++ +V  +  + TE+AGSF N+PH H+        T   L I+EL+++L  
Sbjct  509   FVKFDVFINDEHEV-VIGPNDTEFAGSFVNVPHKHK--HGKKIKTILRLGITELLEELGA  565

Query  1717  EGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             E DD VLVTLVPK G   VT+    I
Sbjct  566   EDDDGVLVTLVPKNGAGAVTIGGVKI  591



>gb|AAC69365.1| polyphenol oxidase [Diospyros kaki]
Length=393

 Score =   454 bits (1167),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 217/394 (55%), Positives = 275/394 (70%), Gaps = 12/394 (3%)
 Frame = +1

Query  469   SKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYLLNGN  642
             +KL +RP AHA D  Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY + G 
Sbjct  2     TKLRIRPPAHAADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGGK  61

Query  643   PYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLS  822
               Q+HF+W FFPFHRWYLYF+ERI+ S+INDPTF LPYWNWD+P GM  P +FD E   S
Sbjct  62    ELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRMPPMFDREG--S  119

Query  823   PLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPL  1002
              LYD  RNQ+HR G ++DL Y G ++  P    + NNL +MYRQM+TNAPCP  FFG   
Sbjct  120   SLYDDKRNQNHRNGTIIDLGYFGQEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAY  179

Query  1003  RADNTQSSGMGTIENIPHNSVHRWVGD-PRSANHEDMGNFYSAANDPVFYSLHSNVDRMW  1179
                   S GMGTIENIPH  VH W GD PR  N E+MGNFYSA  DP+FY  H+NVDRMW
Sbjct  180   PLGTEPSPGMGTIENIPHTPVHIWTGDSPRQKNGENMGNFYSAGLDPIFYCHHANVDRMW  239

Query  1180  TIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDF  1359
               WK +GGKR D+++KDWL++EF F+DE +   +VKVRDCLD++K+G+++  MP PW++F
Sbjct  240   DEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFSYAPMPTPWRNF  299

Query  1360  KPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTR---STSVPET--QEEMLNLDLV  1521
             KP RK T     T S+   T V P A L + ++F +TR   S + PE   QEE+L  + V
Sbjct  300   KPIRKTTAGKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTPEKNEQEEILTFNKV  359

Query  1522  -YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
              YDDTK++RFDVFLN D+ VN  ELD+ E+AGS+
Sbjct  360   AYDDTKYVRFDVFLNVDKTVNADELDKAEFAGSY  393



>ref|XP_010052352.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW76288.1| hypothetical protein EUGRSUZ_D00657 [Eucalyptus grandis]
Length=601

 Score =   461 bits (1187),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 272/571 (48%), Positives = 355/571 (62%), Gaps = 38/571 (7%)
 Frame = +1

Query  154   AARRGDAVKIRCAA-SSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             +ARR     I C A S++  ++NP S   AK DRRNVL+GLGG YGA  L    S+PFAL
Sbjct  49    SARRS---TISCKAPSNDDSEQNPLS---AKFDRRNVLIGLGGFYGAVGLR---SDPFAL  99

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAAHAVD  507
             ADP+  PD+  CG A +   +      CCPP   TTK+  +K+PS  S L VRPAAH  D
Sbjct  100   ADPISAPDLTKCGKADLPAGAKAT--NCCPP--PTTKILDFKLPSSNSPLRVRPAAHLAD  155

Query  508   AAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFP  678
               Y+ KY  AI+ MK LP+DDPR+F QQANVHCAYC+GA+   G P    Q+H +W FFP
Sbjct  156   KDYIAKYAKAIELMKALPADDPRSFMQQANVHCAYCDGAHHQVGFPNLELQVHNSWLFFP  215

Query  679   FHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHR  858
             FHR+YLYF+E+I+ S+I DPTF LPYWNWD P GM  P +F D    SPLYD  RN  H 
Sbjct  216   FHRYYLYFYEKILGSLIGDPTFALPYWNWDAPDGMKMPALFADPK--SPLYDANRNPKHA  273

Query  859   YGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGT  1038
                ++DL Y+G+D    +  ++ +NL IMYRQM++N     LF G   RA +    G G+
Sbjct  274   PPMLVDLDYNGEDPTTSNQDQLSSNLTIMYRQMVSNGKSAKLFLGSDYRAGDDADPGAGS  333

Query  1039  IENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG-KRTD  1215
             +ENIPH  VH W GD R  N EDMGNFYSAA DP+F+S HSNVDRMWT+WKTLGG +R D
Sbjct  334   LENIPHGPVHVWCGDNRQPNLEDMGNFYSAARDPIFFSHHSNVDRMWTVWKTLGGSRRID  393

Query  1216  IADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTV----  1383
               D DWL+  FLF+DE   AV+VKV+DCL+   LGY +QD+ IPW   KPT ++T     
Sbjct  394   FTDPDWLNAAFLFYDENAQAVRVKVKDCLETTNLGYVYQDVDIPWLKSKPTPRKTAKKVA  453

Query  1384  ----KLSITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDT  1533
                 K++    +P      P  L K +   V      RS    E +EE+L ++ + ++  
Sbjct  454   KAFGKVAHAAEIPRPIVQFPVKLDKVVRTLVKRPKQKRSKKEKEEEEEVLVIEGIEFERD  513

Query  1534  KFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLD  1713
              F++FDV++N++ D +    D+TE+AGSF N+PH H+        T   L I++L++DL 
Sbjct  514   AFVKFDVYINDEHD-SLSSPDQTEFAGSFVNVPHKHKHHKKM--KTRLRLGITDLLEDLV  570

Query  1714  LEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
              E DD++LVTL PK  G  VTV N  I  +D
Sbjct  571   CEDDDEILVTLAPKYAGEQVTVGNIKIEFVD  601



>emb|CBZ41490.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=601

 Score =   461 bits (1186),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 260/557 (47%), Positives = 343/557 (62%), Gaps = 34/557 (6%)
 Frame = +1

Query  190   AASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCG  369
             A  + G D++ + +   K+DRRN+LLGLGGLYGA       SN  A ADP+  PDV  CG
Sbjct  53    ACKTRGVDDHHE-IDSDKVDRRNILLGLGGLYGAAASFG--SNSLAFADPIMAPDVTKCG  109

Query  370   PATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLEKYKTAIQK  546
             P  +   + +    CCPP   TTK+  +K+PS S  L +RPAAH VD  Y+ K+  AI+ 
Sbjct  110   PPDLPKGAIRT--NCCPP--STTKILDFKLPSPSNTLRIRPAAHLVDKDYITKFNKAIKL  165

Query  547   MKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIM  717
             MK LP+DDPR+F  QA+VHCAYC+GAY   G      Q+H +W F PFHR+Y+YFFE+I 
Sbjct  166   MKALPNDDPRSFKNQADVHCAYCDGAYDHFGFQDLDLQVHASWLFLPFHRYYIYFFEKIC  225

Query  718   QSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDD  897
               +INDPTF +P+WNWD P GMT P I+   N+ S LYD  R+  H+   ++DL Y+G D
Sbjct  226   GKLINDPTFAIPFWNWDAPDGMTIPDIY--TNKKSSLYDALRDAKHQPPSLVDLDYNGID  283

Query  898   IIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWV  1077
                    +   NL I+YRQM++++    LF G P RA +  + G G+IENIPH+ VH W 
Sbjct  284   ENLNPSKQTSTNLKILYRQMVSSSKTASLFMGNPYRAGDEANPGAGSIENIPHDPVHIWT  343

Query  1078  GDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFF  1257
             GD    N E MGNFYSAA DP+FY+ H+N+DRMW+IWKTLGG+R D  DKDWLD+ F F+
Sbjct  344   GDRSQRNGEHMGNFYSAARDPIFYAHHANIDRMWSIWKTLGGRRKDFTDKDWLDSSFSFY  403

Query  1258  DETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT------------RKRTVKLSITE  1401
             DE    V+VKVRDCLD++ LGY +QD+ IPW   KP+             KR V  +  E
Sbjct  404   DENADLVRVKVRDCLDSKNLGYVYQDVKIPWLKTKPSSKSEKSRRKAEHHKRDVARA-DE  462

Query  1402  SVPASTDVLPAPLSKNLTFYVTR-STSVPETQEEMLNLDLVYDDTK-----FIRFDVFLN  1563
              +P + DV PA L K +   V R   S  + Q+E     LV +  +     F++FDVF+N
Sbjct  463   HIPFAKDVFPASLDKVIKVLVPRPKKSRNKKQKEEEEEILVVEGIEVKSDLFVKFDVFVN  522

Query  1564  EDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVT  1743
             +++D      D+TE+AGSF N+PH H+ G      T   L ISEL++DL  E DD VLVT
Sbjct  523   DEDDGVRATADKTEFAGSFVNVPHNHKHGKNV--KTRLRLGISELLEDLGAEDDDNVLVT  580

Query  1744  LVPKVGGSFVTVNNAYI  1794
             LVPK  G  V++    I
Sbjct  581   LVPKTKGGEVSIKRIKI  597



>gb|KHN08551.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   461 bits (1185),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 266/576 (46%), Positives = 352/576 (61%), Gaps = 39/576 (7%)
 Frame = +1

Query  148   SRAARRGDAVKIRCAASSEGRDENPDS--LSKAKLDRRNVllglgglygaynlgaggSNP  321
             +R  +R    +  C+ +      NP    LS     RRNVLLGLGGL GA  L    +NP
Sbjct  39    NRKPKRHHIPRTTCSENQNNPTPNPSEGELSHIVGHRRNVLLGLGGLCGAVTLN---NNP  95

Query  322   FALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP-SFSKLNVRPAAH  498
             FA A P+  PD+  CGP      +   P  CCPP   ++K+  +K P S   L VRPAAH
Sbjct  96    FAFAAPISPPDLNTCGPPDTPAGAN--PTNCCPP---SSKIIDFKFPPSNQPLRVRPAAH  150

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
              V+  YL KYK A+  MK LPSDDPRNF QQANVHCAYC+GAY   G P    QIH +W 
Sbjct  151   LVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQIHNSWL  210

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHRWYLYF+E+I+ S+INDPTF LP+WNWD P GM  P I+ D    SPLYD  RN 
Sbjct  211   FFPFHRWYLYFYEKILGSLINDPTFALPFWNWDAPDGMQLPSIYADPK--SPLYDTLRNA  268

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
             +H+   ++DL ++ +D I+    K+ NNL IMYRQ+++N   P LF G P RA +    G
Sbjct  269   NHQPPTLVDLDFNLEDPISN--GKISNNLTIMYRQVVSNGKTPTLFLGNPYRAGDEPDPG  326

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G++EN+PH SVH W GD    N EDMG FYSAA DP+F+S HSN+DRMW+IWKTLGGKR
Sbjct  327   FGSVENVPHGSVHLWTGDINQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIWKTLGGKR  386

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT--RKRTV  1383
              D  D DWL++ FLF+DE K  V+VKV+DCLD  KLGY +QD+ IPW + +PT  R R  
Sbjct  387   KDFTDSDWLESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDVDIPWLNSRPTPRRSRVQ  446

Query  1384  KLSITESVPASTDVLPAPLSKNLTFYV---------------TRSTSVPETQEEMLNLDL  1518
             K+++ ++         A  S+N+ F +               +RS    E +EE+L ++ 
Sbjct  447   KVALAQNFGVGA-ARAAETSRNVKFPLVLDSVVSTMVKRPNKSRSKKEKEEEEEVLVIEG  505

Query  1519  V-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISE  1695
             + ++    ++FDVF+N DED   +  D TE+AGSF ++PH H+  +     T   L +++
Sbjct  506   IEFERNTPVKFDVFIN-DEDDKQIRPDNTEFAGSFVSVPHSHKHKNKD-IITCLRLGLTD  563

Query  1696  LIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             L+++L+ E DD V VTLVP+ G   V +    I  L
Sbjct  564   LLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKIKLL  599



>ref|XP_003541740.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=601

 Score =   460 bits (1183),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 267/577 (46%), Positives = 348/577 (60%), Gaps = 41/577 (7%)
 Frame = +1

Query  148   SRAARRGDAVKIRCAASSEGRDENPDS--LSKAKLDRRNVllglgglygaynlgaggSNP  321
             +R  +R    +  C+ +      NP    LS     RRNVLLGLGGL GA  L    +NP
Sbjct  39    NRKPKRHHIPRTTCSENQNNPTPNPSEGELSHIVGHRRNVLLGLGGLCGAVTLN---NNP  95

Query  322   FALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP-SFSKLNVRPAAH  498
             FA A P+  PD+  CGP      +   P  CCPP   ++K+  +K P S   L VRPAAH
Sbjct  96    FAFAAPISPPDLNTCGPPDTPAGAN--PTNCCPP---SSKIIDFKFPPSNQPLRVRPAAH  150

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
              V+  YL KYK A+  MK LPSDDPRNF QQANVHCAYC+GAY   G P    QIH +W 
Sbjct  151   LVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQIHNSWL  210

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHRWYLYF+E+I+ S+INDPTF LP+WNWD P GM  P I+ D    SPLYD  RN 
Sbjct  211   FFPFHRWYLYFYEKILGSLINDPTFALPFWNWDAPDGMQLPSIYADPK--SPLYDTLRNA  268

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
             +H+   ++DL ++ +D I+    K+ NNL IMYRQ+++N   P LF G P RA +    G
Sbjct  269   NHQPPTLVDLDFNLEDPISN--GKISNNLTIMYRQVVSNGKTPTLFLGNPYRAGDEPDPG  326

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G++EN+PH SVH W GD    N EDMG FYSAA DP+F+S HSN+DRMW+IWKTLGGKR
Sbjct  327   FGSVENVPHGSVHLWTGDINQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIWKTLGGKR  386

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT--RKRTV  1383
              D  D DWL++ FLF+DE K  V+VKV+DCLD  KLGY +QD+ IPW + +PT  R R  
Sbjct  387   KDFTDSDWLESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDVDIPWLNSRPTPRRSRVQ  446

Query  1384  KLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD------------LVYD  1527
             K+++ ++         A  S+N+ F +    SV  T  +  N              LV +
Sbjct  447   KVALAQNFGVGA-ARAAETSRNVKFPLVLD-SVVSTMVKRPNKSRSRKEKEEEEEVLVIE  504

Query  1528  DTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
               +F     ++FDVF+N DED   +  D TE+AGSF ++PH H+  +     T   L ++
Sbjct  505   GIEFERNTPVKFDVFIN-DEDDKQIRPDNTEFAGSFVSVPHSHKHKNKD-IITCLRLGLT  562

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             +L+++L+ E DD V VTLVP+ G   V +    I  L
Sbjct  563   DLLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKIKLL  599



>ref|XP_006449291.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
 gb|ESR62531.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
Length=591

 Score =   459 bits (1182),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 253/562 (45%), Positives = 345/562 (61%), Gaps = 36/562 (6%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             K+ C A++E    + DSL+K  LDRR+VLL   G     +  +  S+PFA A PV  PD+
Sbjct  40    KVTCKATNEQNPSSKDSLNK--LDRRDVLLVGLGGLYGVSNLSS-SDPFAFAAPVSAPDI  96

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTA  537
             + CG A  +  +C      CPP + T  + +   PS S L VRPAAH  D AY+ KY  A
Sbjct  97    SKCGKADTTTDNC------CPPKS-TNIINFKLPPSNSSLRVRPAAHLADDAYIAKYSKA  149

Query  538   IQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFE  708
             I+ MK LP+DDPR+F  QANVHCAYC+GAY   G P    QIH +W FFPFHR+YLYF+E
Sbjct  150   IELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRYYLYFYE  209

Query  709   RIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY-  885
             +I+  +I+DPTF LP+WNWD+PPGM  P +F   N  SPLYD+ RN +H+   +LDL Y 
Sbjct  210   KILGKLIDDPTFALPFWNWDSPPGMQMPPMFAKPN--SPLYDKLRNANHQPPTLLDLDYN  267

Query  886   -SGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNS  1062
              + DD       ++ +NL IMYRQM++N     LF G P RA +    G G+IEN PHN 
Sbjct  268   ETDDDQTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRAGDEPEPGSGSIENTPHNP  327

Query  1063  VHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDT  1242
             VH W GD    N E+MGNFYSA  DP+F++ HSN+DRMWTIW+TLGGKRT+  + DWLD+
Sbjct  328   VHLWCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLGGKRTNFTEPDWLDS  387

Query  1243  EFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAST-  1419
              FLF+DE    V+VKVRDCLD + LGY +QD+ IPW++ KP+ +   K  + ++   +  
Sbjct  388   AFLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKAFGVAQA  447

Query  1420  ----------DVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD-LVYDDTKF-----IRFD  1551
                       +V P  L + ++  V R       +E+    + LV D+ +F     ++FD
Sbjct  448   AELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERDARVKFD  507

Query  1552  VFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDK  1731
             V++NEDED   +  D +E+AGSF N+PH H+ G      T+  L +++L++DL  E DD 
Sbjct  508   VYINEDEDGMPIGPDNSEFAGSFVNVPHKHKHGKKM--KTSLRLGLTDLLEDLGAEDDDS  565

Query  1732  VLVTLVPKVGGSFVTVNNAYIN  1797
             V+VTLVPK G     +    I+
Sbjct  566   VVVTLVPKFGKGLARIGGIKID  587



>ref|XP_006468218.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Citrus sinensis]
Length=591

 Score =   459 bits (1181),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 253/562 (45%), Positives = 346/562 (62%), Gaps = 36/562 (6%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             K+ C A++E    + DSL+K  LDRR+VLL   G     +  +  S+PFA A PV  PD+
Sbjct  40    KVTCKATNEQNPSSKDSLNK--LDRRDVLLVGLGGLYGVSNLSS-SDPFAFAAPVSTPDI  96

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTA  537
             + CG A  +  +C      CPP + T  + +   PS S L VRPAAH  D AY+ KY  A
Sbjct  97    SKCGKADTTTDNC------CPPKS-TNIINFKLPPSNSSLRVRPAAHLSDDAYIAKYSKA  149

Query  538   IQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFE  708
             I+ MK LP+DDPR+F  QANVHCAYC+GAY   G P    QIH +W FFPFHR+YLYF+E
Sbjct  150   IELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRYYLYFYE  209

Query  709   RIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY-  885
             +I+  +I+DPTF LP+WNWD+PPGM  P +F + N  SPLYD+ RN +H+   +LDL Y 
Sbjct  210   KILGKLIDDPTFALPFWNWDSPPGMQMPPMFANPN--SPLYDKLRNANHQPPTLLDLDYN  267

Query  886   -SGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNS  1062
              + DD       ++ +NL IMYRQM++N     LF G P RA +    G G+IEN PHN 
Sbjct  268   ETDDDQTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRAGDDPEPGSGSIENAPHNP  327

Query  1063  VHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDT  1242
             VH W GD    N E+MGNFYSA  DP+F++ HSN+DRMWTIW+TLGGKRT+  + DWLD+
Sbjct  328   VHLWCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLGGKRTNFTEPDWLDS  387

Query  1243  EFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAST-  1419
              FLF+DE    V+VKVRDCLD + LGY +QD+ IPW++ KP+ +   K  + ++   +  
Sbjct  388   AFLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKAFGVAQA  447

Query  1420  ----------DVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD-LVYDDTKF-----IRFD  1551
                       +V P  L + ++  V R       +E+    + LV D+ +F     ++FD
Sbjct  448   AELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERDARVKFD  507

Query  1552  VFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDK  1731
             V++NEDED   +  D +E+AGSF N+PH H+ G      T+  L +++L++DL  E DD 
Sbjct  508   VYINEDEDEMPIGPDNSEFAGSFVNVPHKHKHGKKM--KTSLRLGLTDLLEDLGAEDDDS  565

Query  1732  VLVTLVPKVGGSFVTVNNAYIN  1797
             V+VTLVPK G     +    I+
Sbjct  566   VIVTLVPKFGKGLARIGGIKID  587



>gb|AFO55218.1| chloroplast polyphenol oxidase II [Eriobotrya japonica]
Length=576

 Score =   459 bits (1180),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 262/567 (46%), Positives = 345/567 (61%), Gaps = 35/567 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R  ++  A ++RC A+ +G ++N D    A+LDRRN+L+GLG             NPFA 
Sbjct  28    RKPKQCLAGRVRCKAT-KGDNDNLDQ-GPARLDRRNMLIGLGAGGLYGAA----GNPFAF  81

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV--  504
             A PV  PD+  CGPA     S      CCPP T  T +  +K+P    L  RPAA  V  
Sbjct  82    AAPVSAPDLTTCGPADKPDGST---IDCCPPTT--TTIIDFKLPDSGPLRTRPAAQNVAK  136

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGN---PYQIHFNWFFF  675
             D AYL KYK AIQ M++LP DDPR+  QQA VHC+YC+G Y   G      Q+H+ W FF
Sbjct  137   DPAYLAKYKKAIQLMRELPDDDPRSHAQQAMVHCSYCDGGYPQVGYTDLEIQVHYCWLFF  196

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+E+IM  +I DPTF LP+WNWD P GM  P IF D +  S LYDQYRN  H
Sbjct  197   PFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDTS--SSLYDQYRNAAH  254

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   +LDL YSG D    D T++  NL  MY+QM++ A    LF+G+P  A +  S G G
Sbjct  255   QPPKLLDLNYSGTDDDVDDATRITENLTTMYQQMVSKAASHRLFYGEPYSAGDDPSPGAG  314

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-TLGGKRT  1212
              IE+IPHN++H W GDP   N EDMG FYSA  DP+FYS HSNVDRMW+I+K  LGG  T
Sbjct  315   NIESIPHNNIHFWTGDPTQTNGEDMGAFYSAGRDPLFYSHHSNVDRMWSIYKDKLGG--T  372

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTF-QDMPIPWKDFKPT-RKRTVK  1386
             DI   DWLDTEFLF+DE K  V+VKVRD LD  KLGY + +++ IPW + KPT RK T K
Sbjct  373   DIEKTDWLDTEFLFYDEKKNLVRVKVRDSLDTTKLGYVYDENVSIPWLESKPTARKSTNK  432

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-YDDTKFIR  1545
                  S    T   PA LS  ++  VTR ++   T      Q+E+L +  + +   + ++
Sbjct  433   RKAAVSSSDLTTTFPATLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVK  492

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDV++N+D D +    D++E+AGSF ++PH H+        T   L+I+ L+++L  E D
Sbjct  493   FDVYVNDDAD-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSITSLLEELGAETD  547

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTLD  1806
               ++VTLVPKVG   +T+    I  ++
Sbjct  548   SSLVVTLVPKVGKGPITIGGFSIELIN  574



>gb|KDO75857.1| hypothetical protein CISIN_1g042556mg [Citrus sinensis]
Length=591

 Score =   459 bits (1181),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 253/562 (45%), Positives = 346/562 (62%), Gaps = 36/562 (6%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             K+ C A++E    + DSL+K  LDRR+VLL   G     +  +  S+PFA A PV  PD+
Sbjct  40    KVTCKATNEQNPSSKDSLNK--LDRRDVLLVGLGGLYGVSNLSS-SDPFAFAAPVSAPDI  96

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTA  537
             + CG A  +  +C      CPP + T  + +   PS S L VRPAAH  D AY+ KY  A
Sbjct  97    SKCGKADTTTDNC------CPPKS-TNIINFKLPPSNSSLRVRPAAHLSDDAYIAKYSKA  149

Query  538   IQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFE  708
             I+ MK LP+DDPR+F  QANVHCAYC+GAY   G P    QIH +W FFPFHR+YLYF+E
Sbjct  150   IELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRYYLYFYE  209

Query  709   RIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY-  885
             +I+  +I+DPTF LP+WNWD+PPGM  P +F + N  SPLYD+ RN +H+   +LDL Y 
Sbjct  210   KILGKLIDDPTFALPFWNWDSPPGMQMPPMFANPN--SPLYDKLRNANHQPPTLLDLDYN  267

Query  886   -SGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNS  1062
              + DD       ++ +NL IMYRQM++N     LF G P RA +    G G+IEN PHN 
Sbjct  268   ETDDDQTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRAGDDPEPGSGSIENAPHNP  327

Query  1063  VHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDT  1242
             VH W GD    N E+MGNFYSA  DP+F++ HSN+DRMWTIW+TLGGKRT+  + DWLD+
Sbjct  328   VHLWCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLGGKRTNFTEPDWLDS  387

Query  1243  EFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAST-  1419
              FLF+DE    V+VKVRDCLD + LGY +QD+ IPW++ KP+ +   K  + ++   +  
Sbjct  388   AFLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKAFGVAQA  447

Query  1420  ----------DVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD-LVYDDTKF-----IRFD  1551
                       +V P  L + ++  V R       +E+    + LV D+ +F     ++FD
Sbjct  448   AELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERDARVKFD  507

Query  1552  VFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDK  1731
             V++NEDED   +  D +E+AGSF N+PH H+ G      T+  L +++L++DL  E DD 
Sbjct  508   VYINEDEDEMPIGPDNSEFAGSFVNVPHKHKHGKKM--KTSLRLGLTDLLEDLGAEDDDS  565

Query  1732  VLVTLVPKVGGSFVTVNNAYIN  1797
             V+VTLVPK G     +    I+
Sbjct  566   VIVTLVPKFGKGLARIGGIKID  587



>gb|AFC36521.1| polyphenol oxidase [Gossypium hirsutum]
Length=598

 Score =   458 bits (1179),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 267/563 (47%), Positives = 356/563 (63%), Gaps = 34/563 (6%)
 Frame = +1

Query  181   IRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVA  360
             + C AS+ G   N  S S    DRR++LLGLG LYGA NL    S+PFALA  +  PD++
Sbjct  46    VSCKASN-GNQNNEGSSSLNSFDRRDILLGLGSLYGATNLV---SDPFALAALIAAPDLS  101

Query  361   NC----GPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKY  528
              C      ++ S +S  VP  CCPP   TT +  +K P FS + +RPAAH VDA YLEK+
Sbjct  102   LCENSTVTSSSSGTSISVP--CCPP--KTTNILDFKPPRFSTIRLRPAAHLVDANYLEKF  157

Query  529   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLY  699
               AI+ MK LP DDPR+F QQANVHCAYCNGAY   G P    Q+HF+W FFPFHR YLY
Sbjct  158   TKAIELMKALPDDDPRSFKQQANVHCAYCNGAYDQVGFPDQQLQVHFSWLFFPFHRLYLY  217

Query  700   FFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDL  879
             F+ERI+  +I DP F +P+WNWD+PPGM  P I+ D N  SPLYD+ RN +H+  ++LDL
Sbjct  218   FYERILGKLIGDPNFAMPFWNWDSPPGMAIPKIYVDPN--SPLYDEKRNVNHQPPNMLDL  275

Query  880   AYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHN  1059
              Y+G +       ++K+NL++MYRQM+T     L FFG   RA +  S GMG+IEN PH 
Sbjct  276   DYAGTEEELSKRDQIKSNLSVMYRQMVTYKTASL-FFGAAYRAGDDPSPGMGSIENNPHT  334

Query  1060  SVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-GGKRTDIADKDWL  1236
             +VHRWVGD R    EDMGNFYSA  DP+F++ HSNVDR+W+IW+TL G KRTD  D DWL
Sbjct  335   AVHRWVGDKRQPFSEDMGNFYSAGRDPLFFAHHSNVDRLWSIWRTLPGKKRTDFTDTDWL  394

Query  1237  DTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RKRTVKLSITESVPA  1413
             D+ FLF+DE    V+VKVRD L+ +  GY +Q   IPW   KP  RK     S  ++V A
Sbjct  395   DSSFLFYDENANLVRVKVRDSLNMKTFGYDYQKANIPWLKNKPNPRKSGRGKSGGQAVAA  454

Query  1414  ST-------DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNL-DLVYDDTKFIRFDV  1554
              T       +  P  L K +   V     +R+    E +EE+L L ++  D    ++FDV
Sbjct  455   ETKNITPISNAFPIALDKLVRVEVPRPKKSRTKLEKEDEEEVLVLQNIQLDRDAAVKFDV  514

Query  1555  FLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKV  1734
             ++N+++D    E + +E+AGSF NLPH H   +     T   L +++L++DL++EGD+ +
Sbjct  515   YINDEDDETPTEPEDSEFAGSFTNLPHNHH-KTGMKLNTNLTLPLTDLLEDLNVEGDESI  573

Query  1735  LVTLVPKVGGSFVTVNNAYINTL  1803
             LVTLVPK G   V++ N  I+ +
Sbjct  574   LVTLVPKEGKGLVSIGNIKIDYI  596



>ref|XP_004293526.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=594

 Score =   458 bits (1178),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 257/563 (46%), Positives = 352/563 (63%), Gaps = 35/563 (6%)
 Frame = +1

Query  175   VKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPD  354
             ++ R +  +   D+N       K DRRNVLLGLGGLYG   LG   S+PFA A PV  PD
Sbjct  40    IRTRVSCKATNSDQNDAQPPVPKFDRRNVLLGLGGLYGVVGLG---SDPFAFAKPVAPPD  96

Query  355   VANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKT  534
             V+ CG A +   +   P  CCPP    +K+  +K+PS + L VRPAAHAVD AY+ KY  
Sbjct  97    VSKCGAADLP--NGVAPTDCCPPTP--SKIIDFKLPSPTPLRVRPAAHAVDDAYIAKYTK  152

Query  535   AIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFF  705
             A++ MK LP DDPR+F  QANVHCAYC+GAY   G P    QIH +W FFPFHR+YLYF+
Sbjct  153   AMELMKALPDDDPRSFKNQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRYYLYFY  212

Query  706   ERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY  885
             ERI+  +INDPTF LP+WNWDNP GM  P +F   N  SPLYDQ+R   H+   ++DL +
Sbjct  213   ERILGKLINDPTFALPFWNWDNPAGMQLPALF--ANPKSPLYDQFRAAAHQPPTLIDLDF  270

Query  886   SGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSV  1065
             +G +    + T++ +NL+IMYRQM++NA    LFFG P RA +    G G+IE  PH  V
Sbjct  271   NGTEDNTSNTTQINSNLSIMYRQMVSNAKNAQLFFGNPYRAGDEPDPGGGSIEGTPHGPV  330

Query  1066  HRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTE  1245
             H W GD    N EDMGNFYSA  DP+F+S HSNVDRMW+IWKTL  K  DI D DWLD+ 
Sbjct  331   HLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNVDRMWSIWKTLAPKNKDITDSDWLDSG  390

Query  1246  FLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT--------VKLSITE  1401
             FLF+DE    V+VKVRDCL+++ LGY +QD+ IPW + KPT +R+         KL +  
Sbjct  391   FLFYDENANMVRVKVRDCLESKNLGYVYQDVDIPWLNSKPTPRRSKVAFSNIAKKLGVAN  450

Query  1402  SVPASTDVL-----PAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF-----IR  1545
             +  +   V+     P  LS+ ++  V R      +++E  + +  LV +  +F     ++
Sbjct  451   AAGSKAKVVKITDFPLTLSRKISVAVPRPKQKKRSKKEKEDEEEILVIEGIEFDRDVAVK  510

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDV++N+++D+ +   D++E+AGSF ++PH H+        T   L +++L++DLD E D
Sbjct  511   FDVYINDEDDLPSGP-DKSEFAGSFVSVPHRHKHTKKI--NTVLRLGLTDLLEDLDAEDD  567

Query  1726  DKVLVTLVPKVGGSFVTVNNAYI  1794
             + V+VTL+P+     V +    I
Sbjct  568   ETVVVTLIPRYAADKVKIGGIKI  590



>ref|XP_007025702.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
 gb|EOY28324.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
Length=600

 Score =   458 bits (1179),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 259/575 (45%), Positives = 352/575 (61%), Gaps = 40/575 (7%)
 Frame = +1

Query  154   AARRGDAVKIRCAASSEGRDENP-------DSLSKAKLDRRNVllglgglygaynlgagg  312
               RR + V    +  +   D+NP       +  S  K DRR+VL+GLGGLYGA +L    
Sbjct  35    GKRRRNFVSRAVSCKATNGDQNPSPSTKNVEECSLNKFDRRDVLVGLGGLYGATSL----  90

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKI-PSFSKLNVRP  489
             + P A A PV  PDV  CG A +   +   P  CCPP   +TK+  +K+ PS S   +RP
Sbjct  91    NGPLAFAAPVSPPDVTKCGKADLPAGA--KPVNCCPP--PSTKILDFKLRPSNSPPRIRP  146

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             A H VD  YL K+  A++ MK LP DDPR+F QQANVHCAYC+GAY   G P    Q+H 
Sbjct  147   AVHLVDKEYLAKFSRALELMKALPEDDPRSFTQQANVHCAYCDGAYHQIGFPDLDLQVHN  206

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFPFHR+YLYFFE+I+  +I+DPTF +P+WNWD+P GM  P I+ + N  SPLYD+ 
Sbjct  207   SWLFFPFHRYYLYFFEKILGKLIDDPTFAIPFWNWDSPAGMQMPAIYANPN--SPLYDEN  264

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             RN +H+   +LDL ++G +  +    ++ +NL +MYRQM++N     LF G   RA +  
Sbjct  265   RNPNHQPPTLLDLDFNGTEESSSTRDQISSNLNVMYRQMVSNGKTAKLFLGNAYRAGDQP  324

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G++ENIPH  +H W GD R  N EDMGNFYSA  DP+FY+ HSNVDRMW++WKTLG
Sbjct  325   DPGAGSLENIPHGPIHIWCGDNRQPNLEDMGNFYSAGRDPIFYAHHSNVDRMWSVWKTLG  384

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT  1380
             GKRTD  D DWLD+ FLF+DE    V+VKVRDCLD  K+GY +Q + IPW   KPT +R 
Sbjct  385   GKRTDFTDSDWLDSGFLFYDENANLVRVKVRDCLDTRKMGYDYQKVDIPWLRAKPTPRRI  444

Query  1381  VK-----LSITESVPASTDVL-----PAPLSKNLTFYV-----TRSTSVPETQEEMLNLD  1515
                    L +  +      VL     P  L+  ++  V     +RS +  E +EE+L ++
Sbjct  445   ASKVARALGVAHAAETKKKVLSDVQFPLVLNNVVSLEVSRPKKSRSKAEKEEEEEVLVIE  504

Query  1516  -LVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + +D  + ++FDV++N DED  T+  D TE+AGSF N+PH H  G+    TT   L ++
Sbjct  505   NIEFDRDQLVKFDVYIN-DEDDTTIGPDNTEFAGSFINVPHKHRHGNKM--TTCLRLGLT  561

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
             +L+++L  E DD V+VTLVPK G     +    I+
Sbjct  562   DLLEELGAEDDDGVVVTLVPKSGKGLAKIGGVKID  596



>emb|CAQ76694.1| polyphenol oxidase (chloroplast) (chloroplast) [Taraxacum officinale]
Length=594

 Score =   457 bits (1176),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 254/560 (45%), Positives = 345/560 (62%), Gaps = 28/560 (5%)
 Frame = +1

Query  184   RCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVAN  363
             R A S + ++++    +  K+DRRN+LLGLGGLYGA       SNP A ADP+  PD+  
Sbjct  44    RHAVSCKTQNDDQHHENSGKVDRRNMLLGLGGLYGAAATFG--SNPLAFADPIMAPDLTK  101

Query  364   CGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQ  543
             CGPA +   +  V   CCPP T    +++   P  + L VRPAAH  +  Y+ K+  AI+
Sbjct  102   CGPADLPQGA--VATNCCPPFTKNI-IDFKLPPPSTNLRVRPAAHLANKDYIAKFNKAIE  158

Query  544   KMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERI  714
              MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W F PFHR YLYFFE+I
Sbjct  159   LMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLDLQVHNSWLFLPFHRHYLYFFEKI  218

Query  715   MQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGD  894
                +INDP F +P+WNWD P GMT P I+ ++N  S LYD  R+  H+   ++DL ++G+
Sbjct  219   CGKLINDPNFAIPFWNWDTPDGMTIPAIYANKN--SQLYDALRDGKHQPPSLVDLDFNGE  276

Query  895   DIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRW  1074
             D       +   NL IMYRQM++++    LF G P RA +  + G G++E+IPH  VH W
Sbjct  277   DENLSKSKQTSTNLTIMYRQMVSSSKTASLFMGSPYRAGDEANPGGGSLESIPHGPVHIW  336

Query  1075  VGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLF  1254
              GD    N EDMGNFYSAA DP+FY+ H+N+DRMW++WKTLGG+R D  DKDWLD+ FLF
Sbjct  337   TGDRNQPNGEDMGNFYSAARDPIFYAHHANIDRMWSVWKTLGGRRNDFTDKDWLDSAFLF  396

Query  1255  FDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP----------TRKRTVKLSITES  1404
             +DE    V+VKVRD LD++KLGY +QD+ IPW + KP           +K+       E 
Sbjct  397   YDENAELVRVKVRDALDSKKLGYVYQDVGIPWLETKPEPRLKRALSKIKKKLAVARADEH  456

Query  1405  VPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLNE  1566
             +P + DV PA L K +   V     +RS    + +EE+L ++ +     +F++FDVF+N+
Sbjct  457   IPFAKDVFPATLDKVIKVLVPRPKKSRSKKQKDAEEEILVIEGIEVKRDEFVKFDVFVND  516

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTL  1746
             ++D      D+TE+AGSF N+PH H+ G +    T   L ISEL+ DL  + DD VLVTL
Sbjct  517   EDDGMRATADKTEFAGSFVNVPHKHKHGKSV--KTRLRLGISELLDDLGADDDDNVLVTL  574

Query  1747  VPKVGGSFVTVNNAYINTLD  1806
             VPK  G  V++    I   D
Sbjct  575   VPKNKGDEVSIKGMKIEYED  594



>emb|CAC83610.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   454 bits (1167),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 246/507 (49%), Positives = 315/507 (62%), Gaps = 31/507 (6%)
 Frame = +1

Query  334   DPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP--SFSKLNVRPAAHAVD  507
             +P+  P+++ C           +   CCPP+   T V  YK+P  S S + +RPA H +D
Sbjct  1     EPIHAPEISKCVVPPKDLPPDAIVDNCCPPLA--TNVIPYKVPKTSPSAMKIRPAIHRMD  58

Query  508   AAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFP  678
               Y+ K++ AI+ MK+LP+DDPRNFYQQA VHCAYCNG Y+    P    Q+H +W FFP
Sbjct  59    KEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFP  118

Query  679   FHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHR  858
             FHRWYLYF+ERI+  +I DPTF LP+WNWD P GM  P  F   NQ SPLYD+ RNQ H 
Sbjct  119   FHRWYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYF--RNQNSPLYDENRNQSH-  175

Query  859   YGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA-DNTQSSGMG  1035
                V+DL Y+G D    D  ++ NNLA+MY+ M+TNA    LF GKP +A D+  + G G
Sbjct  176   LPLVMDLGYAGTDTDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGG  235

Query  1036  TIENIPHNSVHRWVGD--PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGK-  1206
             +IENIPH  VHRWVGD  PR+ N EDMGNFYSA  D +FY  HSNVDRMWTIW+ LGGK 
Sbjct  236   SIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKG  295

Query  1207  -RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK--PTRKR  1377
              R D  D DWLD  F+F+DE K AV+V+V D LDN+KLGY ++   +PW + K  PT+K+
Sbjct  296   RRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKK  355

Query  1378  TVKLSITESVPASTDVLPAPLSKNLTFYVTR--------STSVPETQEEMLNLDLVYDDT  1533
             T  L+     P  TDV P  L K +   V R             E   E+  +++  D  
Sbjct  356   T-GLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIQGIEVAID--  412

Query  1534  KFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLD  1713
             ++ +FDV+LN DED      ++ EYAGSF +LPH H G       T+ +L ++E ++DL 
Sbjct  413   QYAKFDVYLN-DEDEPEAGKEKAEYAGSFAHLPHKHTGSKKI--RTSLSLGLNEPLEDLG  469

Query  1714  LEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
              E DD VLVTL PKVGG  VTV N  I
Sbjct  470   AEDDDPVLVTLAPKVGGGVVTVENIKI  496



>ref|XP_008225003.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=597

 Score =   457 bits (1175),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 262/535 (49%), Positives = 335/535 (63%), Gaps = 28/535 (5%)
 Frame = +1

Query  238   AKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATIS-FSSCKVPYRC  414
              KLDRRN+L+GLGGLYGA  L      PFA ADP+  PD++ C PA I+   S  VP  C
Sbjct  73    GKLDRRNILVGLGGLYGATALD---PKPFAFADPIAPPDLSTCKPAEITPGGSETVP--C  127

Query  415   CPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQA  594
             CPP+T  TK++ +K      L  RPAAH V   YL K+K A   M+ LP DDPR+  QQA
Sbjct  128   CPPVT--TKIKTFKPDLSIPLRTRPAAHQVTDEYLAKFKKAQAAMRALPDDDPRSMVQQA  185

Query  595   NVHCAYCNGAYLLNG---NPYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNW  765
              VHCAYCNGAY   G   N  Q+H++W FFPFHR YLYF+ERI+  +I+DPTF LPYWNW
Sbjct  186   KVHCAYCNGAYPQVGFTDNDIQVHYSWLFFPFHRMYLYFYERILGKLIDDPTFALPYWNW  245

Query  766   DNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIM  945
             D+P G   P I+ D +  SPLYDQYRN DH+   ++DL+Y G D    + T++  NLAIM
Sbjct  246   DSPVGFPIPDIYTDTS--SPLYDQYRNADHQPPVLVDLSYGGTDDDVDEQTRIDENLAIM  303

Query  946   YRQMITNAPCPLLFFGKPLRADNTQSSGM-GTIENIPHNSVHRWVGDPRSANHEDMGNFY  1122
             YRQM++ A  P LFFG   RA +  +    GTIEN+PHN +H WVGDP   +HEDMGNFY
Sbjct  304   YRQMVSGAKTPDLFFGHAYRAGDLNTQKYPGTIENMPHNDIHIWVGDPTQTHHEDMGNFY  363

Query  1123  SAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCL  1302
             SA  DP+FY+ H NVDRMW IWKTLGGKR DI D DWLD EFLF+DE    V  KVRD L
Sbjct  364   SAGRDPLFYAHHCNVDRMWNIWKTLGGKRKDITDTDWLDAEFLFYDENAELVNCKVRDSL  423

Query  1303  DNEK-LGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAS--TDVLPAPLSKNLTFYVT--  1467
             + EK L Y ++  P+PW   KPT ++T K      V A+  T   PA L    T  V   
Sbjct  424   EPEKQLRYNYEPAPLPWLFTKPTARKT-KNKTKAKVAATQLTSKFPATLDSKTTVEVARP  482

Query  1468  ----RSTSVPETQEEMLNL-DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLP  1632
                 RS      +EE+L + D+ ++ T+ ++FDVF+N+D + +    D++E+AGSF ++P
Sbjct  483   KPRKRSKKEKVDEEELLIIKDIEFEGTEAVKFDVFINDDAE-SLSRRDKSEFAGSFVHVP  541

Query  1633  HVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
                   +     T   L I++L++DL  E D  VLVTLVP+V  S +T+    I 
Sbjct  542   QGKT--TKAKTKTNLKLGITDLLEDLGAEDDSSVLVTLVPRVSNSPITIGGFKIE  594



>gb|AGC54425.1| polyphenol oxidase 1 [Gossypium hirsutum]
Length=616

 Score =   457 bits (1176),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 263/561 (47%), Positives = 353/561 (63%), Gaps = 34/561 (6%)
 Frame = +1

Query  181   IRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVA  360
             + C AS   ++ N DS S  + DRR++LLGLGGLYGA NL    S+PFA A P+  PD++
Sbjct  64    VSCKASDRNQN-NADSSSLNRFDRRDILLGLGGLYGATNLV---SDPFASAAPIAAPDLS  119

Query  361   NC----GPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKY  528
              C      ++ S +S  VP  CCPP    T +  +K P FS + +RPAAH VDA YLEK+
Sbjct  120   LCENSTVTSSSSGTSISVP--CCPP--KATNIIDFKPPRFSNIRLRPAAHLVDANYLEKF  175

Query  529   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLY  699
               A++ MK LP DDPR+F QQANVHCAYCNG Y   G P    QIHF+W FFPFHR+YLY
Sbjct  176   TKAMELMKALPDDDPRSFKQQANVHCAYCNGVYDHVGFPDQQLQIHFSWLFFPFHRFYLY  235

Query  700   FFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDL  879
             F+ERI+  +I DP F +P+WNWD+PPGM  P I+ D    SPLYD+ RN DH+   +LDL
Sbjct  236   FYERILGKLIGDPNFVMPFWNWDSPPGMVIPDIYVDPT--SPLYDEKRNVDHQPPKMLDL  293

Query  880   AYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHN  1059
              Y+G + +     ++K+NL++MYRQM+T    P LF G   RA +  S GMG++EN PH 
Sbjct  294   DYAGTEELLSKRDQIKSNLSVMYRQMVTYK-TPSLFHGAAYRAGDNPSPGMGSVENNPHT  352

Query  1060  SVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-GGKRTDIADKDWL  1236
             +VHRWVGD R    EDMGNFYSA  DP+FY+ H NVDR+W IWK+L G KRTD  D DWL
Sbjct  353   AVHRWVGDKREPFSEDMGNFYSAGRDPLFYAHHCNVDRLWNIWKSLPGKKRTDFTDTDWL  412

Query  1237  DTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAS  1416
             D+ FLF+DE    V+VKVRDCL++  LGY +Q + IPW   KPT +R  + S + S  A+
Sbjct  413   DSSFLFYDENANLVRVKVRDCLNSRTLGYDYQKVNIPWLKNKPTPRRPGRGSGSGSAMAA  472

Query  1417  T--------DVLPAPLSKNLTFYVTRSTS------VPETQEEMLNLDLVYDDTKFIRFDV  1554
                      +  P  L K +   V R+            +E ++  ++  D    ++FDV
Sbjct  473   ETSTKTVIRNAFPIVLDKLVRIEVPRTKKSRTKVEKENEEEVLVLQNIRVDRDVAVKFDV  532

Query  1555  FLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKV  1734
             ++N+++D    E + +E+AGSF N+PH H    A    T   L +S+L++DLD+E DD +
Sbjct  533   YINDEDDETPTEPEDSEFAGSFTNIPHNHH-NPAVKLDTNLTLPLSDLLEDLDIERDDNI  591

Query  1735  LVTLVPKVGGSFVTVNNAYIN  1797
             +VTLVPK G   V++ N  I+
Sbjct  592   VVTLVPKEGKGLVSIGNIKID  612



>emb|CAC29040.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   453 bits (1166),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 246/507 (49%), Positives = 315/507 (62%), Gaps = 31/507 (6%)
 Frame = +1

Query  334   DPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP--SFSKLNVRPAAHAVD  507
             +P+  P+++ C           +   CCPP+   T V  YK+P  S S + +RPA H +D
Sbjct  1     EPIHAPEISKCVVPPKDLPPDAIVDNCCPPLA--TNVIPYKVPRTSPSAMKIRPAIHRMD  58

Query  508   AAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFP  678
               Y+ K++ AI+ MK+LP+DDPRNFYQQA VHCAYCNG Y+    P    Q+H +W FFP
Sbjct  59    KEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFP  118

Query  679   FHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHR  858
             FHRWYLYF+ERI+  +I DPTF LP+WNWD P GM  P  F   NQ SPLYD+ RNQ H 
Sbjct  119   FHRWYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYF--RNQNSPLYDENRNQSH-  175

Query  859   YGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA-DNTQSSGMG  1035
                V+DL Y+G D    D  ++ NNLA+MY+ M+TNA    LF GKP +A D+  + G G
Sbjct  176   LPLVMDLGYAGTDNDVTDQERISNNLALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGG  235

Query  1036  TIENIPHNSVHRWVGD--PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGK-  1206
             +IENIPH  VHRWVGD  PR+ N EDMGNFYSA  D +FY  HSNVDRMWTIW+ LGGK 
Sbjct  236   SIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKG  295

Query  1207  -RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK--PTRKR  1377
              R D  D DWLD  F+F+DE K AV+V+V D LDN+KLGY ++   +PW + K  PT+K+
Sbjct  296   RRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKK  355

Query  1378  TVKLSITESVPASTDVLPAPLSKNLTFYVTR--------STSVPETQEEMLNLDLVYDDT  1533
             T  L+     P  TDV P  L K +   V R             E   E+  +++  D  
Sbjct  356   T-GLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEILEIQGIEVAID--  412

Query  1534  KFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLD  1713
             ++ +FDV+LN DED      ++ EYAGSF +LPH H G       T+ +L ++E ++DL 
Sbjct  413   QYAKFDVYLN-DEDEPEAGKEKAEYAGSFAHLPHKHTGSKKI--RTSLSLGLNEPLEDLG  469

Query  1714  LEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
              E DD VLVTL PKVGG  VTV N  I
Sbjct  470   AEDDDAVLVTLAPKVGGGVVTVENIKI  496



>sp|Q06215.1|PPO_VICFA RecName: Full=Polyphenol oxidase A1, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Vicia faba]
 emb|CAA77764.1| polyphenol oxidase [Vicia faba]
Length=606

 Score =   456 bits (1174),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 267/594 (45%), Positives = 347/594 (58%), Gaps = 59/594 (10%)
 Frame = +1

Query  130   FLNPNPSRAARRGDAVKIRCAASSEGRDENP---DSLSKAKLDRRNVllglgglygaynl  300
             FL      +  R    ++ C  SS     NP     LS     RRNVL+GLGG+YG    
Sbjct  29    FLQKQHQSSKLRKPKRQVTC--SSNNNQNNPKEEQELSNIVGHRRNVLIGLGGIYGTLA-  85

Query  301   gaggSNPFALADPVPLPDVANCGPATISFSSCKVP-YRCCPPITDTTKVEYYKIPSFSKL  477
                 +NP ALA P+  PD++ C P +   S    P   CCPP +  TK+  +K PS   L
Sbjct  86    ----TNPSALASPISPPDLSKCVPPSDLPSGTTPPNINCCPPYS--TKITDFKFPSNQPL  139

Query  478   NVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---Y  648
              VR AAH VD  +LEKYK A + MK LPS+DPRNF QQAN+HCAYC+GAY   G P    
Sbjct  140   RVRQAAHLVDNEFLEKYKKATELMKALPSNDPRNFTQQANIHCAYCDGAYSQIGFPDLKL  199

Query  649   QIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPL  828
             Q+H +W FFPFHRWYLYF+ERI+ S+INDPTF LP+WN+D P GM  P I+ D  + SPL
Sbjct  200   QVHGSWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPDGMQLPTIYAD--KASPL  257

Query  829   YDQYRNQDHRYGHVLDLAYS--GDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPL  1002
             YD+ RN  H+   ++DL +   G DI   +   +K NL+IMYRQ+ +N     LF G P 
Sbjct  258   YDELRNASHQPPTLIDLNFCDIGSDIDRNE--LIKTNLSIMYRQVYSNGKTSRLFLGNPY  315

Query  1003  RADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             RA + +  G G+IEN+PH  VH W GD    N EDMG FYSAA DP+FYS HSNVDR+W 
Sbjct  316   RAGDAEPQGAGSIENVPHAPVHTWTGDNTQTNIEDMGIFYSAARDPIFYSHHSNVDRLWY  375

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
             IWKTLGGK+ D  DKDWL++ FLF+DE K  V+V V+D LD +KLGY +QD+PIPW+  K
Sbjct  376   IWKTLGGKKHDFTDKDWLESGFLFYDENKNLVRVNVKDSLDIDKLGYAYQDVPIPWEKAK  435

Query  1363  PTRKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD---------  1515
             P  +RT    + E      +V    L K+ T ++ R  S  +     L L+         
Sbjct  436   PVPRRTKVQKLVE-----VEVNDGNLRKSPTIFLVRQQSPRKYVTFPLVLNNKVSAIVKR  490

Query  1516  ----------------LVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLP  1632
                             LV +  +F     I+FDV++N+++D   V    TE+AGSF N+P
Sbjct  491   PKKLRSKKEKEEEEEVLVIEGIEFYMNIAIKFDVYINDEDD--KVGAGNTEFAGSFVNIP  548

Query  1633  HVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             H   G       T+  L I++L++DL +EGDD ++VTLVPK G   V +NN  I
Sbjct  549   HSAHGHKNKKIITSLRLGITDLLEDLHVEGDDNIVVTLVPKCGSGQVKINNVEI  602



>gb|AAC28935.1| polyphenol oxidase precursor [Prunus armeniaca]
Length=597

 Score =   456 bits (1173),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 262/535 (49%), Positives = 337/535 (63%), Gaps = 28/535 (5%)
 Frame = +1

Query  238   AKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATIS-FSSCKVPYRC  414
              KLDRRN+L+GLGGLYGA  L      PFA ADP+  PD+  C PA I+   S  VP  C
Sbjct  73    GKLDRRNILIGLGGLYGATTLD---RKPFAFADPIAPPDLTTCKPAEITPGGSETVP--C  127

Query  415   CPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQA  594
             CPP+T  TK++ +K      L   PAAH V   YL K+K A   M+ LP DDPR+  QQA
Sbjct  128   CPPVT--TKIKTFKPDLSIPLRTSPAAHQVTDEYLAKFKKAQAAMRALPDDDPRSMVQQA  185

Query  595   NVHCAYCNGAYLLNG---NPYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNW  765
              VHCAYCNGAY   G   N  Q+HF+W FFPFHR YLYF+ERI+  +I+DPTF LPYWNW
Sbjct  186   KVHCAYCNGAYPQVGFTDNDIQVHFSWLFFPFHRMYLYFYERILGKLIDDPTFALPYWNW  245

Query  766   DNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIM  945
             D+P G   P I+ D +  SPLYDQYRN DH+   ++DL+Y G D    + T++  NLAIM
Sbjct  246   DSPVGFPIPDIYTDTS--SPLYDQYRNADHQPPVLVDLSYGGKDDDVDEQTRIDENLAIM  303

Query  946   YRQMITNAPCPLLFFGKPLRADNTQSSGM-GTIENIPHNSVHRWVGDPRSANHEDMGNFY  1122
             YRQM++ A  P LFFG   RA N  +    GTIEN+PHN++H WVGDP   + EDMGNFY
Sbjct  304   YRQMVSGAKTPDLFFGHAYRAGNLNTGKYPGTIENMPHNNIHIWVGDPSQTHQEDMGNFY  363

Query  1123  SAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCL  1302
             SA  DP+FY+ H+NVDRMW IWKTLGGKR DI D DWLD EFLF+DE    V+VKVRD L
Sbjct  364   SAGRDPLFYAHHANVDRMWNIWKTLGGKRKDITDTDWLDAEFLFYDENAELVRVKVRDSL  423

Query  1303  DNEK-LGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAS--TDVLPAPLSKNLTFYVT--  1467
             + EK L Y ++ + +PW   KPT ++T K      V A+  T   PA L +  T  V   
Sbjct  424   EPEKQLRYNYEPVSLPWLFTKPTARKT-KNKTKAKVAATQLTSKFPATLVEVTTVEVARP  482

Query  1468  ----RSTSVPETQEEMLNL-DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLP  1632
                 RS      +EE+L + D+ ++ T+ ++FDVF+N+D + +    D++E+AGSF ++P
Sbjct  483   KPRKRSKKEKVDEEELLIIKDIEFEGTEAVKFDVFINDDAE-SLSRRDKSEFAGSFVHVP  541

Query  1633  HVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
                   +     T   L I++L++DL  E D  VLVTLVP+V  S +T+    I 
Sbjct  542   QGKT--TKAKTKTNLKLGITDLLEDLGAEDDSSVLVTLVPRVSNSPITIGGFKIE  594



>gb|AII22007.1| polyphenol oxidase-5 [Gossypium hirsutum]
Length=598

 Score =   456 bits (1173),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 265/563 (47%), Positives = 355/563 (63%), Gaps = 34/563 (6%)
 Frame = +1

Query  181   IRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVA  360
             + C AS+ G   N  S S    DRR++LLGLG LYGA NL    S+PFALA P+  PD++
Sbjct  46    VSCKASN-GNQNNEGSSSLNSFDRRDILLGLGTLYGATNLV---SDPFALAAPIAAPDLS  101

Query  361   NC----GPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKY  528
              C      ++ S +S  VP  CCPP   TT +  +K P FS + +RPAAH VDA YLEK+
Sbjct  102   LCENSTVTSSSSGTSISVP--CCPP--KTTNILDFKPPRFSTIRLRPAAHLVDANYLEKF  157

Query  529   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLY  699
               A++ MK LP DDPR+F QQANVHCAYCNGAY   G P    Q+HF+W FFPFHR YLY
Sbjct  158   TKAMELMKALPDDDPRSFKQQANVHCAYCNGAYDQVGFPDQQLQVHFSWLFFPFHRLYLY  217

Query  700   FFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDL  879
             F+ERI+  +I DP F +P+WNWD+PPGM  P I+ D N  SPLYD+ RN +H+  ++LDL
Sbjct  218   FYERILGKLIGDPNFAMPFWNWDSPPGMAIPKIYVDPN--SPLYDEKRNVNHQPPNMLDL  275

Query  880   AYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHN  1059
              Y+G +       ++K+NL++MYRQM+T     L F G   RA +  S GMG+IEN PH 
Sbjct  276   DYAGTEEELSKRDQIKSNLSVMYRQMVTYKTASL-FLGAAYRAGDDPSPGMGSIENNPHT  334

Query  1060  SVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-GGKRTDIADKDWL  1236
             +VHRWVGD R    EDMGNFYSA  DP+FY+ HS+VDR+W+IW+TL G KRTD    DWL
Sbjct  335   AVHRWVGDKRQPFSEDMGNFYSAGRDPLFYAHHSDVDRLWSIWRTLPGKKRTDFTGTDWL  394

Query  1237  DTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RKRTVKLSITESVPA  1413
             D+ FLF+DE    V+VKVRD L+ +  GY +Q + IPW   KP  RK     S  ++V A
Sbjct  395   DSSFLFYDENANLVRVKVRDSLNMKTFGYDYQKVNIPWLKNKPIPRKSGRGKSGGQAVAA  454

Query  1414  STD-------VLPAPLSKNLTFYV-----TRSTSVPETQEEMLNL-DLVYDDTKFIRFDV  1554
              T          P  L K +   V     +R+    E +EE+L L ++  D    ++FDV
Sbjct  455   ETKNTTPISIAFPIALDKLVRVEVPRPKKSRTKLEKEDEEEVLVLQNIQLDRDAAVKFDV  514

Query  1555  FLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKV  1734
             ++N+++D    E + +E+AGSF NLPH H   +     T   L +++L++DL++EGD+ +
Sbjct  515   YINDEDDETPTEPEDSEFAGSFTNLPHNHH-KTGMKLNTNLTLPLTDLLEDLNVEGDESI  573

Query  1735  LVTLVPKVGGSFVTVNNAYINTL  1803
             LVTLVPK G   V++ N  I+ +
Sbjct  574   LVTLVPKEGKGLVSIGNIKIDYI  596



>ref|XP_008371333.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08581.1| polyphenol oxidase IIa [Malus domestica]
Length=600

 Score =   456 bits (1172),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 266/563 (47%), Positives = 337/563 (60%), Gaps = 32/563 (6%)
 Frame = +1

Query  157   ARRGDAVKIRCAASSEG----RDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPF  324
             ARR     I C A++      +D+   S    KLDRRNVL+GLGGLYGA  L      P 
Sbjct  49    ARRS---SISCKATNPNYNNEQDQQQSSNLLGKLDRRNVLIGLGGLYGATTLA---PKPL  102

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV  504
             A A+P+  PD+  C PA I+     V   CCPP++  TK++ +       L  RPAAH V
Sbjct  103   AFANPLAPPDLTKCKPAEITTGGETV--ECCPPVS--TKIKTFTPDRSIPLRTRPAAHLV  158

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
                YL K+K A   M+ LP DDPR+  QQA VHCAYCNGAY   G P    QIHF+W FF
Sbjct  159   TDEYLAKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNGAYPQVGFPDIDIQIHFSWLFF  218

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHR YLYF+ERI+  +I+DPTF LPYWNWD+P G   P I+ D    SPLYDQYRN DH
Sbjct  219   PFHRMYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTT--SPLYDQYRNADH  276

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA-DNTQSSGM  1032
             +   ++DL+Y G D    D T++  NLAIMY QM++ A  P LFFG   RA D T  +  
Sbjct  277   QPPVLVDLSYGGTDDDVDDQTRIDENLAIMYXQMVSGAKTPHLFFGHEYRAGDTTTGTYA  336

Query  1033  GTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRT  1212
             GTIEN PHN++H W GDP   + EDMGNFYSA  DP+FY+ H NVDRMW +WKTLGGKR 
Sbjct  337   GTIENSPHNNIHLWCGDPNQTHQEDMGNFYSAGRDPLFYAHHCNVDRMWNVWKTLGGKRK  396

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEK-LGYTFQDMPIPWKDFKPT-RKRTVK  1386
             D  D DWLD EFLF+DE    V  KVRD L  EK L YT++ + +PW   KPT RK   K
Sbjct  397   DPTDTDWLDAEFLFYDENAELVSCKVRDSLKPEKDLRYTYEPVSVPWLFTKPTARKPKSK  456

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF-----IR  1545
                       T   PA      T  V R      T++E ++ +  L+  D +F     ++
Sbjct  457   TKAKVGATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKIDEEEVLIIKDIEFESNEAVK  516

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDVF+N+D + +    D++E+AGSF ++PH  + G  T K T   L I++L++DL +E D
Sbjct  517   FDVFINDDAE-SLSRKDKSEFAGSFVHVPHNQKTG--TKKKTNLKLGITDLLEDLGVEDD  573

Query  1726  DKVLVTLVPKVGGSFVTVNNAYI  1794
               VLVTLVP+V  S +T+    I
Sbjct  574   SSVLVTLVPRVSNSPITIGGFKI  596



>gb|EYU27938.1| hypothetical protein MIMGU_mgv1a003402mg [Erythranthe guttata]
Length=587

 Score =   454 bits (1169),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 257/580 (44%), Positives = 350/580 (60%), Gaps = 36/580 (6%)
 Frame = +1

Query  127   IFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlga  306
             + + P      R+     I    S+   D+ P      K DRR+VL+GLGGLYGA  L  
Sbjct  24    LLVKPTHIPTIRKPSHRHIISCKSTNNHDQEP----AGKFDRRDVLIGLGGLYGATTLS-  78

Query  307   ggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVR  486
               ++PFA A P+  PDV  CGPA +   +   P  CCPP T  T V+Y   P  + + VR
Sbjct  79    --ASPFAFAAPISAPDVTKCGPADLPQGAA--PTNCCPPPT-ATIVDYKFPPPSTTMRVR  133

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIH  657
             PAAH  D AY+ K+  A++ M+ LP DDPR+F QQA VHCAYC+GAY   G P    Q+H
Sbjct  134   PAAHLADKAYVAKFNRAMELMRALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPNLELQVH  193

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHR+YL+FFERI+  +I+DPTF +PYWN+D+P GMT P ++   N  SPLYD+
Sbjct  194   NSWLFFPFHRYYLFFFERILGKLIDDPTFAMPYWNYDSPAGMTIPAMY--TNPSSPLYDK  251

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              RNQ H+   ++DL +SG   I  +  +VK NL +MYRQM++N+  P LFFG   R    
Sbjct  252   LRNQGHQPPALIDLNFSGSGTITAE-QQVKRNLTVMYRQMVSNSKTPRLFFGSAYRRGED  310

Query  1018  QSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL  1197
              + G G++ENIPH  VH W GDP   N E+MGNFYSA  DP+FY+ HSN+DR+W++WK L
Sbjct  311   PNPGSGSVENIPHGPVHVWTGDPTQPNGENMGNFYSAGRDPIFYAHHSNIDRLWSLWKGL  370

Query  1198  GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR  1377
             GG+R DI D D+LD  FLF+DE    V+VK RDCLDN KLGYT+QD+ IPW   +PT K 
Sbjct  371   GGRRQDITDPDFLDASFLFYDENGQMVRVKTRDCLDNTKLGYTYQDVEIPWLKSRPTPKV  430

Query  1378  T-----------VKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVP------ETQEEML  1506
             +            K +  E+     +VLPA L K L   V R           E +E ++
Sbjct  431   SSVLKKLKKLGKAKAAAAETHRPPKEVLPAKLDKVLKIMVKRPKKKRSKKEKDELEEILI  490

Query  1507  NLDLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLA  1686
                +  +   + +FDV++N+++D  + E + TE+AGSF N+PH H+        T   L+
Sbjct  491   IQGIELERDVYAKFDVYINDEDDETSTE-ENTEFAGSFVNVPHKHK--HGKKIKTQLRLS  547

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
             I+++++DLD E D+ VLVTLVP   G  +T++   I   D
Sbjct  548   ITDILEDLDAEDDEHVLVTLVPTNAGDSITIHGVKIELDD  587



>ref|XP_010054349.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=595

 Score =   454 bits (1169),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 267/563 (47%), Positives = 353/563 (63%), Gaps = 43/563 (8%)
 Frame = +1

Query  181   IRCAA-SSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             I C A S++  ++NP S+   KLDRRNVL+GLGG YGA  L    S+PFALA+P+ +PD 
Sbjct  55    ISCKALSNDDSEQNPMSV---KLDRRNVLIGLGGFYGAVGLR---SDPFALAEPISVPDF  108

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAAHAVDAAYLEKYKT  534
               CG       +C      CPP   TT+V  +K+PS  S   VRPAAH  D  Y+ KY  
Sbjct  109   TQCGKVNPCAKAC------CPP--PTTEVLDFKLPSSNSPTRVRPAAHLADEDYIAKYAE  160

Query  535   AIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNPY---QIHFNWFFFPFHRWYLYFF  705
             AI+ MK LP+DDPR+F QQANVHCAYC+G Y   G P+   Q+H +W FFPFHR+YLYF+
Sbjct  161   AIRLMKALPADDPRSFMQQANVHCAYCDGYYNQVGFPHLEVQVHCSWLFFPFHRYYLYFY  220

Query  706   ERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY  885
             E+I+ S+I DPTF LPYWNWD P GM  P +F D +  SPLYD  RN DH    ++DL Y
Sbjct  221   EKILGSLIKDPTFALPYWNWDAPGGMKMPAMFTDPH--SPLYDFNRNPDHAPPMLVDLNY  278

Query  886   SGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSV  1065
             + + +  P    + NNL+IMYRQM+++     LF G   RA +  + G G+IE +PHN+V
Sbjct  279   NCEHL--PPSNLIHNNLSIMYRQMVSSGKTAKLFLGHAYRAGDHANPGAGSIELMPHNTV  336

Query  1066  HRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG-KRTDIADKDWLDT  1242
             H W GD R  N EDMG  YSAA DP+F++ HSNVDRMWT+WKTLGG KRTD    DWL+ 
Sbjct  337   HNWCGDYRQPNLEDMGILYSAARDPLFFAHHSNVDRMWTLWKTLGGPKRTDFTHPDWLNA  396

Query  1243  EFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITES------  1404
              FLF+DE K AV+VKV+DCL+   LGY +QD+ IPW++ KP   R + + +TE+      
Sbjct  397   SFLFYDENKQAVRVKVKDCLETTNLGYKYQDVDIPWRNSKPV-PRKIAIKVTETSGGIAD  455

Query  1405  ---VPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVF  1557
                +P S    P  L K ++  V      RS    E +EE+L ++ +  +   F++FDV 
Sbjct  456   VAEIPRSIAHFPVKLDKVVSTLVKRPKQKRSKKEKEEKEEVLVIEGIELESDAFVKFDVH  515

Query  1558  LNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVL  1737
             +N DE  +    D TE+AGSF N+PH H+ G      T   L I+EL++DL  E D+K+L
Sbjct  516   IN-DEQASLSSPDMTEFAGSFVNVPHKHKPGKKM--KTKLTLGITELLEDLMCEDDEKIL  572

Query  1738  VTLVPKVGGSFVTVNNAYINTLD  1806
             VTL P+ GG  V ++N  I  +D
Sbjct  573   VTLNPRYGGEDVIISNIKIEFVD  595



>ref|XP_003545882.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=602

 Score =   455 bits (1170),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 244/519 (47%), Positives = 324/519 (62%), Gaps = 34/519 (7%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKI-PSFSKLNVRP  489
             +NPFA A P+  PD+  CGP  +   +   P  CCPP   ++K+  +K  PS   L VRP
Sbjct  94    NNPFAFAAPISPPDLNTCGPPDLP--AGVKPTNCCPP---SSKIIDFKFSPSNQPLRVRP  148

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH V+  YL KYK A+  MK LPSDDPRNF QQANVHCAYC+GAY   G P    Q+H 
Sbjct  149   AAHLVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQVHN  208

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFPFHRWYLYF+ERI+ S+INDPTF LP+WNWD P GM  P I+ D    SPLYD  
Sbjct  209   SWLFFPFHRWYLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPK--SPLYDTL  266

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             RN +H+   ++DL ++ +D I+    K+ NNL IMYRQ+++N   P LF G P RA +  
Sbjct  267   RNANHQPPTLVDLDFNLEDPISNG--KISNNLTIMYRQVVSNGKTPTLFLGNPYRAGDEP  324

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G++EN+PH  VH W GD    N E+MG FYSAA DP+FYS HSN+DRMW+IWKTLG
Sbjct  325   DPGFGSVENVPHGPVHLWTGDINQPNIENMGTFYSAARDPIFYSHHSNIDRMWSIWKTLG  384

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT--RK  1374
             GKR D  D DWL++ FLF+DE K  V+VKV+D LD  KLGY +QD+ IPW + KPT  R 
Sbjct  385   GKRRDFTDSDWLESAFLFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLNSKPTPRRS  444

Query  1375  RTVKLSITESVPASTDVLPAPLSKNLTFYV---------------TRSTSVPETQEEMLN  1509
             R  K+++ ++         A  S+N+ F +               +RS    E +EE+L 
Sbjct  445   RVQKVALAQNFGVGA-AHAAETSRNVKFPLVLDSVVSTMVKRPNKSRSKKEKEEEEEVLV  503

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLA  1686
             ++ + ++    ++FDVF+N DED   +  D TE+AGSF ++PH H   +     T   L 
Sbjct  504   IEGIEFERNTPVKFDVFIN-DEDDKQIRPDNTEFAGSFVSVPHSHMHKNKD-IITCLRLG  561

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             +++L+++L+ E DD V VTLVP+ G   V +    I  L
Sbjct  562   LTDLLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKIELL  600



>ref|XP_003593515.1| Polyphenol oxidase [Medicago truncatula]
 gb|ABN08603.1| Tyrosinase [Medicago truncatula]
 gb|AES63766.1| polyphenoloxidase [Medicago truncatula]
Length=607

 Score =   455 bits (1170),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 238/524 (45%), Positives = 324/524 (62%), Gaps = 32/524 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             +NPFALA P+  PD++ CGP  +   +      CCPP  ++TK+  YKIPS ++ L VR 
Sbjct  90    TNPFALASPISPPDLSTCGPPDLPLGATPNNINCCPP--NSTKIINYKIPSSNQPLRVRQ  147

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH V+  YL+KYK AI+ MK LPS+DPR+F QQAN+HCAYC+GAY   G P    Q+H 
Sbjct  148   AAHLVNDEYLQKYKKAIELMKALPSNDPRSFIQQANIHCAYCDGAYSQVGFPNLDLQVHN  207

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFPFHRWYLYF+ERI+ S+INDPTF LP+WN+D P GM FP I+ D  + SPLYD+ 
Sbjct  208   SWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMQFPSIYTD--RTSPLYDEL  265

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             RN +H+   ++DL Y GDD    +  ++  NL IMYRQ+++N     LF G   RA +  
Sbjct  266   RNANHQPPTLIDLNYDGDDE-NDENERISTNLTIMYRQLVSNGKTSTLFLGSSYRAGDQP  324

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G+IEN+PH  VHRW GD    N E+MG FY+AA DP+F+S HSN+DR W++WKTLG
Sbjct  325   DPGAGSIENVPHGPVHRWSGDNTQPNFENMGTFYAAARDPIFFSHHSNIDRFWSVWKTLG  384

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDF--KPTRK  1374
             GKR D  DKDWL++EFLF+DE K  VKVKV+D LD +KLGY +QD+  PW +   KP RK
Sbjct  385   GKRKDFKDKDWLESEFLFYDENKNLVKVKVKDSLDTKKLGYVYQDVDTPWLNAKPKPCRK  444

Query  1375  RTVK---------LSITESVPASTD-----VLPAPLSKNLTFYVTRSTSVPETQEEMLNL  1512
             +  K           I E+  +  +       P  L   ++  V R       +E+    
Sbjct  445   KIQKNVEVAQGIFFGIGEAHASEINSRSYVTCPLVLDNVVSTIVKRPKKSRSKKEKEEKE  504

Query  1513  DLV------YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT  1674
             +++      +D +  ++FDVF+N DED   ++   TE+AGSF N+PH           + 
Sbjct  505   EVLVIEGIEFDKSLGVKFDVFIN-DEDDKVIKPVNTEFAGSFVNVPHSSHDHKKKKTNSC  563

Query  1675  FNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
               + +++L++DL  E DD V+VTLVP+ G   V + N  I   D
Sbjct  564   LRVGLTDLLEDLGAEDDDSVVVTLVPRYGKGIVKIRNIKIELED  607



>ref|XP_006370117.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
 gb|ERP66686.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
Length=543

 Score =   452 bits (1164),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 237/484 (49%), Positives = 310/484 (64%), Gaps = 30/484 (6%)
 Frame = +1

Query  403   PYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN  579
             P  CCPP +  TK++ ++ PS S  + +RPAAH VD AY+ KY  AI  MK LP DDPR+
Sbjct  65    PSNCCPPTS--TKIKNFEFPSASSPMRIRPAAHLVDKAYVAKYAKAIALMKSLPDDDPRS  122

Query  580   FYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTL  750
             F  QA+VHCAYC+GAY   G P    QIHF+W FFP+HR YLY+FERI+  +I+ PTF L
Sbjct  123   FKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRLYLYYFERILGKLIDGPTFAL  182

Query  751   PYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVK-  927
             P+WNWD P GM  P IF D    SPLYD  R+ +H+   +LDL Y+  D   PDP K + 
Sbjct  183   PFWNWDAPAGMQMPAIFTDPE--SPLYDPLRDANHQPPTLLDLNYAKGDA-NPDPAKAEE  239

Query  928   ---NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSAN  1098
                +NL +MYRQM++ A  P LFFGKP RA +  S GMGTIE  PH  +H W GDP   N
Sbjct  240   LYASNLNVMYRQMVSGATKPTLFFGKPYRAGDDPSPGMGTIETTPHTQIHYWTGDPNQTN  299

Query  1099  HEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-GGKRTDIADKDWLDTEFLFFDETKTA  1275
              E+MGNFYSA  DP+FY  HSNVDRMW +WK + GGKR DI D DWL++EFLF+DE K  
Sbjct  300   GENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKRKDIEDPDWLNSEFLFWDENKEL  359

Query  1276  VKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAST-----DVLPAPL  1440
             V+VKV+D LD +KL Y FQD+PIPW   + T K T +     +   S         P  L
Sbjct  360   VRVKVKDTLDTKKLRYGFQDVPIPWLKTRATPKLTRQEKSRRAAKKSVVLTPISAFPVVL  419

Query  1441  SKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRT  1602
              K ++  V     +RS +  E ++E+L ++ + Y++ + I+FDV +N++ D +    D++
Sbjct  420   DKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQLIKFDVLVNDEPD-SPGGPDKS  478

Query  1603  EYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVN  1782
             E+AGSF N+PH H    A    TT  L I+ L++DL+ EGDD ++VT VP+ GG FVTV 
Sbjct  479   EFAGSFVNVPHKH----AKKSKTTMVLGITGLLEDLEAEGDDTLVVTFVPRSGGDFVTVA  534

Query  1783  NAYI  1794
             N  I
Sbjct  535   NVKI  538



>ref|XP_008225000.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   454 bits (1168),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 260/552 (47%), Positives = 335/552 (61%), Gaps = 36/552 (7%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             ++RC A++ G D     LS+  LDRRN+L+GLG        G   +NPFA A P+  PD+
Sbjct  48    RVRCKATNGGNDHLEQGLSR--LDRRNMLIGLGAGGLYGATGLE-NNPFASAAPISAPDL  104

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV--DAAYLEKYK  531
               CGPA     S      CCPP T  T +  +K+P    L  R AA  V  D  YL KYK
Sbjct  105   TQCGPADKPDGST---IDCCPPTT--TTIIDFKLPDKGPLRTRLAAQDVAKDPVYLAKYK  159

Query  532   TAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYF  702
              AI  M+ LP DDPR+F QQA VHC YC+  Y   G P    Q+HF W FFPFHRWYLYF
Sbjct  160   KAIALMRALPDDDPRSFTQQAMVHCTYCDDGYPQVGYPNLEIQVHFCWLFFPFHRWYLYF  219

Query  703   FERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLA  882
             FE+IM  +I DPTF +P+WNWD P GM  P IF D    SPLYDQYRN  H+   +LDL 
Sbjct  220   FEKIMGELIGDPTFAIPFWNWDAPVGMYLPEIFTDTT--SPLYDQYRNAAHQPPKLLDLN  277

Query  883   YSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNS  1062
             Y G D    D T++K NL  MY+QM++ A    LF+G+P  A +  S G G IEN PHN+
Sbjct  278   YGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDASSPGAGNIENTPHNN  337

Query  1063  VHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKT-LGGKRTDIADKDWLD  1239
             +H W GDP   N EDMG FYSA  DPVF++ HSNVDRMW+I+K+ LGG  TDI   DWLD
Sbjct  338   IHLWTGDPTQKNGEDMGAFYSAGRDPVFFAHHSNVDRMWSIYKSKLGG--TDIKKTDWLD  395

Query  1240  TEFLFFDETKTAVKVKVRDCLDNEKLGYTFQD-MPIPWKDFKPT-RKRTVKLSITESVPA  1413
              EFLF+DE K  ++VKVRD LD  KLGY + D + IPW  +KPT RK + K   T S   
Sbjct  396   AEFLFYDEKKNLMRVKVRDSLDTTKLGYVYDDKVEIPWLTYKPTARKSSNKRKATVSSAD  455

Query  1414  STDVLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-YDDTKFIRFDVFLNEDE  1572
              T   PA L+  ++  V R+++   T      Q+E+L +  + Y   K ++FDV++N+D 
Sbjct  456   LTTNFPATLTDTISVEVARTSTKKRTSAQKKAQDEVLVISGIKYAGNKTVKFDVYVNDDA  515

Query  1573  DVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVP  1752
             + +    D++E+AGSF ++PH      +   TTT  L+I++L+++LD E D  V+VTLVP
Sbjct  516   E-SLAGKDKSEFAGSFVHVPH----KGSKDITTTLRLSITKLLEELDAETDSSVVVTLVP  570

Query  1753  KVG----GSFVT  1776
             K G    G F T
Sbjct  571   KFGTVTIGGFST  582



>gb|AHC98007.1| PPO [Salvia miltiorrhiza]
Length=589

 Score =   454 bits (1167),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 258/573 (45%), Positives = 351/573 (61%), Gaps = 39/573 (7%)
 Frame = +1

Query  142   NPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNP  321
             NPSR+       KI C +S+   +  P     +K DRRN+L+GLGGLYGA  L    ++P
Sbjct  38    NPSRS------YKISCKSSNHDHESPP---PPSKFDRRNLLIGLGGLYGATTLA---TSP  85

Query  322   FALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHA  501
             F+ A P+  PDV  CGPA +   +   P  CCPP+T       +  P  +KL +RPAAH 
Sbjct  86    FSFAAPISGPDVTQCGPADLPAGA--TPTNCCPPLTGEILDFQFPAPP-AKLRIRPAAHL  142

Query  502   VDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFF  672
              D AY+ K+  A++ M+ LP DDPR+F QQANVHCAYC+GAY   G P    Q+H +W F
Sbjct  143   ADDAYIAKFNRAVELMRALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQVHNSWLF  202

Query  673   FPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQD  852
             FPFHR+YLYF+ERI+  +I+DP+F +PYWNWD P GM  P I+   N  S LYD  R++ 
Sbjct  203   FPFHRYYLYFYERILAKLIDDPSFAMPYWNWDAPAGMPIPRIY--ANPSSALYDPLRDKA  260

Query  853   HRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGM  1032
             H+   ++DL YSG D       + + NL +MYRQM++N+  P LFFG P R     + G 
Sbjct  261   HQPPALVDLNYSGTDPATTANQQAQTNLTVMYRQMVSNSKTPRLFFGSPYRRGEDPNPGG  320

Query  1033  GTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRT  1212
             G+IE IPH  VH W GD    N E+MGNFYSAA DP+FY+ HSN+DRMW++WKTLGG+R 
Sbjct  321   GSIEGIPHGPVHVWTGDRTQPNTENMGNFYSAARDPIFYAHHSNIDRMWSVWKTLGGRRQ  380

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT------RK  1374
             DI D D+LD  FLF+DE    V+VKVRDCLD  KLGY +QD+ IPW + +PT       +
Sbjct  381   DITDPDFLDAAFLFYDENAKMVRVKVRDCLDPRKLGYAYQDVEIPWANSRPTPRVSSVLR  440

Query  1375  RTVKLSITESVPAST--DVLPAPLSKNLTFYVTRSTSVP------ETQEEMLNLDLVYDD  1530
             +  KL   ++  A +  +V PA L + L   V R           E +E ++   +  D 
Sbjct  441   KLKKLGRAKAADAQSPREVFPAKLDRVLKVMVKRPKKKRSKKEKDELEEILVIKGIEVDR  500

Query  1531  TKFIRFDVFLN-EDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
               +++FDV++N ED+++ T E   TE+AGSF N+PH H+        T   L+IS++++D
Sbjct  501   DTYVKFDVYINDEDDEITTAE--NTEFAGSFVNVPHKHKHDKKI--KTQLRLSISDILED  556

Query  1708  LDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
             LD E D+ VLVTLVP   G  +T+++  I   D
Sbjct  557   LDAEDDEHVLVTLVPTNAGDAITIHDIKIELDD  589



>ref|XP_007025701.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
 gb|EOY28323.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
Length=618

 Score =   455 bits (1170),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 262/568 (46%), Positives = 349/568 (61%), Gaps = 44/568 (8%)
 Frame = +1

Query  181   IRCAASSEGRDENPDSLSKA--------KLDRRNVllglgglygaynlgaggSNPFALAD  336
             + C A++   D+NP   SK         K DRR+VL+GLGGLYGA +L     + F+LA 
Sbjct  60    VSCKATNG--DQNPTPSSKNTEKSFLLNKFDRRDVLIGLGGLYGAASLS---QDQFSLAA  114

Query  337   PVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAAHAVDAA  513
             P+  P++  CG A +   +   P  CCPP++   K+  +K PS  S L VRPAAH VD A
Sbjct  115   PISAPELEKCGNAELPEGAD--PTNCCPPVS--RKILDFKPPSSNSPLRVRPAAHLVDDA  170

Query  514   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFH  684
             Y+ KY  AI+ MK LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +W FFPFH
Sbjct  171   YIAKYSRAIELMKALPADDPRNFMQQANVHCAYCDGAYDQVGFPDLELQVHNSWLFFPFH  230

Query  685   RWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYG  864
             R+YLYFFE+I+  +I+DPTF LP+WNWD+P GM  P ++   N  SPLY++ RN+ H   
Sbjct  231   RYYLYFFEKILGKLIDDPTFALPFWNWDSPAGMKMPAMYG--NTKSPLYNELRNRSHYPP  288

Query  865   HVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIE  1044
              ++DL Y+G D       ++ +NL IMYRQM++N     LF G P RA +    G G++E
Sbjct  289   TLVDLDYNGTDETTTTRDQLTSNLRIMYRQMVSNGKTARLFLGGPFRAGDEPYQGFGSVE  348

Query  1045  NIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIAD  1224
             N+PH  VH W GD    N EDMG FYSAA DP+FY+ HSNVDRMW +WKTLG KR D  D
Sbjct  349   NVPHGPVHVWCGDNTQPNGEDMGTFYSAARDPIFYAHHSNVDRMWAVWKTLGKKRKDFTD  408

Query  1225  KDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVK------  1386
              DWL+  FLF+DE    V+VKVRDCLDN  LGY +QD+ IPW   KPT ++  K      
Sbjct  409   PDWLNASFLFYDENANLVRVKVRDCLDNRSLGYVYQDVDIPWLKTKPTPRKLRKKVASGG  468

Query  1387  ------LSITESVPASTDVLPAPLSKNLTFYVTR-----STSVPETQEEMLNLDLV-YDD  1530
                     I +    +++  P  L K ++  V R     S    E +EE+L +D +  D 
Sbjct  469   PGIALAAEINKKKVIASNQFPIVLDKIVSVDVPRPKKSRSKKEKEDEEEILVIDQIELDG  528

Query  1531  TKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDL  1710
               F +FDV++N+++D+ T+  D TE+AGSF N+PH H+GG      T   L +++L++DL
Sbjct  529   DSFAKFDVYVNDEDDL-TIGPDNTEFAGSFVNVPHKHKGGKKM--RTCLRLGLTDLLEDL  585

Query  1711  DLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
               E DD V+VTLVPK G   V + +  I
Sbjct  586   GAEDDDSVVVTLVPKYGKGNVKIGSIKI  613



>ref|XP_007025706.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY28328.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
Length=602

 Score =   454 bits (1167),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 248/578 (43%), Positives = 348/578 (60%), Gaps = 31/578 (5%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+FLN    +    G +  + C A++ G      S   + L+R +    L GL G Y   
Sbjct  36    QLFLNKKIKKPDYSGPSKVVSCKATNNG------SKGDSSLNRFDRRDLLIGLGGLYGAT  89

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNV  483
                ++PFALA P+  PD+  CG ATIS ++ +  Y CCPP  +TTKV  +K P++SK+  
Sbjct  90    NLSNDPFALAAPIAAPDLTLCGDATISDTTKETVY-CCPP--ETTKVIDFKPPTYSKIRY  146

Query  484   RPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNG--NPYQIH  657
             R AAH VD  YL K+  A++ M+ LP DDPR+F QQAN+HCAYCNGAY   G     Q+H
Sbjct  147   RSAAHLVDPDYLAKFTKAMELMRALPDDDPRSFKQQANIHCAYCNGAYDQVGFDQDIQVH  206

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
             F+W FFPFHR YLYF+ERI+  +I DP F +P+WNWD P GM  P I+ + N  SPLYD 
Sbjct  207   FSWLFFPFHRLYLYFYERILGKLIGDPDFAMPFWNWDAPAGMPIPAIYVNPN--SPLYDD  264

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              RN +H+   V+DL Y+G D    D   V++NL +MY+QM++ +    LF GK  RA + 
Sbjct  265   KRNVNHQPPKVVDLDYNGTDKDITDKAMVQSNLKVMYKQMVSGSKTASLFHGKVYRAGDK  324

Query  1018  QSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL  1197
              S G G +E   H ++HRW GDPR    EDMGNFYSA  DP+FY+ HSNVDRMW+IWK L
Sbjct  325   PSPGGGVVELGSHTAIHRWCGDPRQTYSEDMGNFYSAGRDPLFYAHHSNVDRMWSIWKGL  384

Query  1198  -GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRK  1374
              G KR D  D DWLD  F+F+DE    V+ +VRDCLD   LGY +Q + +PW   KP  +
Sbjct  385   PGKKRNDFTDTDWLDASFVFYDENANLVRARVRDCLDTRTLGYDYQGVDVPWLKTKPVPR  444

Query  1375  RTVKLSIT---ESVPAST-------DVLPAPLSKNLTFYV-----TRSTSVPETQEEMLN  1509
             +  K       ++V A T       +  P  L K ++  +     +R+    E +E ++ 
Sbjct  445   KFSKKGGKGHGQAVAAETKNKNVIRNAFPIVLDKIVSIEIPRPKKSRTKLEKEEEEVLVL  504

Query  1510  LDLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAI  1689
               +  D +  ++FD+++N+++D      + +E+AGSF N+PH H         T+F+LAI
Sbjct  505   ESIQLDTSTPVKFDIYINDEDDEAPSGPEDSEFAGSFTNVPHNHSHSKKL--ETSFSLAI  562

Query  1690  SELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             SE+++DLD+EGDD ++VTLVP+ G   V+V N  I+ +
Sbjct  563   SEVLEDLDVEGDDNIVVTLVPREGKGLVSVGNIKIDYI  600



>ref|XP_008366047.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08584.1| polyphenol oxidase V [Malus domestica]
Length=610

 Score =   454 bits (1167),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 261/596 (44%), Positives = 348/596 (58%), Gaps = 56/596 (9%)
 Frame = +1

Query  127   IFLNPNPSRAARRGDAVKIRCAASSEGRDENP-----------DSLSKAKLDRRNVllgl  273
             +F NP      R  +   + C A++   D+N            ++LS   LDRR+VL+GL
Sbjct  33    LFENP------RHSNLQAVSCKATNNSSDQNKNPSTSSNDHDHENLSPVNLDRRHVLIGL  86

Query  274   gglygaynlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYY  453
             G LYG        S+PFA+A PV  PD+A CG A   F S  VP  CCPP +   K+  +
Sbjct  87    GSLYGGVAGLG--SDPFAVAKPVSPPDLAKCGGA--DFPSGAVPXNCCPPTS--QKIVDF  140

Query  454   KIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLL  633
             K PS +KL VRPAAH VD AY+EKY  AI+ MK LP DDPR+F QQA+ HCAYC+GAY  
Sbjct  141   KFPSPTKLRVRPAAHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADJHCAYCDGAYDQ  200

Query  634   NGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFD  804
              G P    QIH  W FFPFHR+Y YF ERI+  +I+DPTF LP+WNWD P GM  P +F 
Sbjct  201   VGFPNLELQIHQXWLFFPFHRYYXYFXERILAKLIDDPTFALPFWNWDAPAGMQLPALF-  259

Query  805   DENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLL  984
               N  SPLYD+ R   H+   ++DL ++G D       ++  NL IMYRQM++N+  PLL
Sbjct  260   -ANPDSPLYDELRAASHQPPTLIDLDFNGTDETMSKDAQIDANLKIMYRQMVSNSKKPLL  318

Query  985   FFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSN  1164
             FFG P RA      G G+IE  PH  VH W GD    N EDMGNFYSA  DP+F+S HSN
Sbjct  319   FFGSPYRAGTEPDPGAGSIETTPHGPVHTWTGDNTQPNFEDMGNFYSAXRDPIFFSHHSN  378

Query  1165  VDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPI  1344
             +DRMW IWK++G K  DI DKDWLDT FLF+DE    V+V VRD LDN+KLGYT++D+ I
Sbjct  379   IDRMWNIWKSIGTKNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEI  438

Query  1345  PWKDFKPTRKRT--------------VKLSITESVPASTDVLPAPLSKNLTFYVTRSTSV  1482
             PW   +PT +RT               + + +  V A  D  P  L   ++  V+R    
Sbjct  439   PWLKSRPTPRRTKLARKAKAAGVAKAAETTSSGKVVAGKD-FPINLETKISTVVSRPKPK  497

Query  1483  PETQEE-------MLNLDLVYDDTKFIRFDVFLN--EDEDVNTVELDRTEYAGSFGNLPH  1635
               +++E       ++   +  D    ++FDV++N  +DED      D++E+AGSF ++PH
Sbjct  498   KRSKKEKEDEEEILVIQGIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPH  557

Query  1636  VHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
               +  S     +   L +++L++DL  E D+ V+VTLVP+ G   V + +  I  L
Sbjct  558   KQKEKS----KSCLRLGLTDLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEFL  609



>gb|ADR78836.1| polyphenol oxidase [Ziziphus jujuba]
Length=594

 Score =   453 bits (1166),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 264/581 (45%), Positives = 355/581 (61%), Gaps = 48/581 (8%)
 Frame = +1

Query  127   IFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlga  306
             I   P  +R ++R    ++ C A+    D++P      K DRRNVL+GLGGLYG   LG 
Sbjct  33    ISFAPKLNRLSKR----RVSCKATKG--DQSP----LGKFDRRNVLIGLGGLYGVNGLG-  81

Query  307   ggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFS-KLNV  483
               SN F++A PV  PD++NCGP  +   S   P  CCPP +D  K+  +K+P  S +L V
Sbjct  82    --SNSFSIAAPVAPPDLSNCGPPDLP--SGAKPTDCCPPKSD--KIIDFKLPPQSNQLRV  135

Query  484   RPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQI  654
             RPAAH VD  Y+EKY  AI  MK LP DDPRNF QQAN+HCAYC+ AY   G P    Q+
Sbjct  136   RPAAHVVDKNYIEKYSKAIALMKALPEDDPRNFTQQANIHCAYCDAAYDQVGFPDLELQV  195

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H  W FFP HR+YLYF+E+I+  +INDPTF LP+WNWD+PPGM  P ++   N  SPLYD
Sbjct  196   HNCWLFFPCHRYYLYFYEKILGKLINDPTFALPFWNWDSPPGMQLPALY--ANLKSPLYD  253

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
               RN  H+   +LDL Y+G D       ++ +NL IMYRQ+++N   P LFFG   R+  
Sbjct  254   TLRNAGHQPPTLLDLDYNGTDETTTKRDQLTSNLTIMYRQVVSNGKNPKLFFGGAFRSGE  313

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKT  1194
                 G G+IENIP+  VH W GD    N E+MGNFYSAA DP+F++ HSNVDRMWTIWKT
Sbjct  314   EPDPGAGSIENIPYGPVHLWSGDNTQPNLENMGNFYSAARDPMFFAHHSNVDRMWTIWKT  373

Query  1195  LGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRK  1374
             LGGKR DI D DWL+  FLF+DE K  V+VKVRDCLD +KLGY +QD+ IPW   +PT +
Sbjct  374   LGGKRKDITDPDWLNAGFLFYDENKQLVRVKVRDCLDEKKLGYVYQDVDIPWLKTRPTPR  433

Query  1375  RTVKLSITESVPASTDVLPAPLSKN--------------LTFYVTRSTSVPETQEEMLNL  1512
             ++ KLS   S   +  V  A +SK               +   V R      +++E    
Sbjct  434   KS-KLSKVASAVRALGVAQAAVSKKTVTTTDFPVILDSVIRTVVDRPKKKRRSKQEKEEE  492

Query  1513  D--LVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTT  1671
             +  LV D  +F     ++FDV++N+++D+ +   D++E+AGSF ++P   +        T
Sbjct  493   EEVLVIDGIEFDRDLPVKFDVYVNDEDDLPSGP-DKSEFAGSFVSVPRKQKNQKKL--KT  549

Query  1672  TFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
                L +++L++DL+ E DD V+VTLVP+ G   V++    I
Sbjct  550   CLRLGLTDLLEDLEAEDDDSVVVTLVPRTGKGLVSIGELKI  590



>gb|KCW76289.1| hypothetical protein EUGRSUZ_D00659 [Eucalyptus grandis]
Length=659

 Score =   455 bits (1171),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 267/563 (47%), Positives = 353/563 (63%), Gaps = 43/563 (8%)
 Frame = +1

Query  181   IRCAA-SSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             I C A S++  ++NP S+   KLDRRNVL+GLGG YGA  L    S+PFALA+P+ +PD 
Sbjct  119   ISCKALSNDDSEQNPMSV---KLDRRNVLIGLGGFYGAVGLR---SDPFALAEPISVPDF  172

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAAHAVDAAYLEKYKT  534
               CG       +C      CPP   TT+V  +K+PS  S   VRPAAH  D  Y+ KY  
Sbjct  173   TQCGKVNPCAKAC------CPP--PTTEVLDFKLPSSNSPTRVRPAAHLADEDYIAKYAE  224

Query  535   AIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNPY---QIHFNWFFFPFHRWYLYFF  705
             AI+ MK LP+DDPR+F QQANVHCAYC+G Y   G P+   Q+H +W FFPFHR+YLYF+
Sbjct  225   AIRLMKALPADDPRSFMQQANVHCAYCDGYYNQVGFPHLEVQVHCSWLFFPFHRYYLYFY  284

Query  706   ERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY  885
             E+I+ S+I DPTF LPYWNWD P GM  P +F D +  SPLYD  RN DH    ++DL Y
Sbjct  285   EKILGSLIKDPTFALPYWNWDAPGGMKMPAMFTDPH--SPLYDFNRNPDHAPPMLVDLNY  342

Query  886   SGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSV  1065
             + + +  P    + NNL+IMYRQM+++     LF G   RA +  + G G+IE +PHN+V
Sbjct  343   NCEHL--PPSNLIHNNLSIMYRQMVSSGKTAKLFLGHAYRAGDHANPGAGSIELMPHNTV  400

Query  1066  HRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG-KRTDIADKDWLDT  1242
             H W GD R  N EDMG  YSAA DP+F++ HSNVDRMWT+WKTLGG KRTD    DWL+ 
Sbjct  401   HNWCGDYRQPNLEDMGILYSAARDPLFFAHHSNVDRMWTLWKTLGGPKRTDFTHPDWLNA  460

Query  1243  EFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITES------  1404
              FLF+DE K AV+VKV+DCL+   LGY +QD+ IPW++ KP   R + + +TE+      
Sbjct  461   SFLFYDENKQAVRVKVKDCLETTNLGYKYQDVDIPWRNSKPV-PRKIAIKVTETSGGIAD  519

Query  1405  ---VPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVF  1557
                +P S    P  L K ++  V      RS    E +EE+L ++ +  +   F++FDV 
Sbjct  520   VAEIPRSIAHFPVKLDKVVSTLVKRPKQKRSKKEKEEKEEVLVIEGIELESDAFVKFDVH  579

Query  1558  LNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVL  1737
             +N DE  +    D TE+AGSF N+PH H+ G      T   L I+EL++DL  E D+K+L
Sbjct  580   IN-DEQASLSSPDMTEFAGSFVNVPHKHKPGKKM--KTKLTLGITELLEDLMCEDDEKIL  636

Query  1738  VTLVPKVGGSFVTVNNAYINTLD  1806
             VTL P+ GG  V ++N  I  +D
Sbjct  637   VTLNPRYGGEDVIISNIKIEFVD  659



>ref|XP_008364151.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=582

 Score =   452 bits (1164),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 260/574 (45%), Positives = 346/574 (60%), Gaps = 35/574 (6%)
 Frame = +1

Query  133   LNPNPSRA-ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             L PN S+   +R     +R A  ++G ++N D    A+LDRRN+L+GLG       +   
Sbjct  26    LFPNKSQTPLQRKPKQCLRVAQKTKGDNDNLDQ-GLARLDRRNMLIGLGAGGLYGAV---  81

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRP  489
               NPFA A PV  PD+  CGPA     S      CCPP T  T +  +++P    L  RP
Sbjct  82    -GNPFAFAAPVSAPDLTTCGPANKPDGST---IDCCPPTT--TTIIDFELPDSGPLRTRP  135

Query  490   AAHAV--DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQI  654
             AA  V  D  YL KYK A++ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+
Sbjct  136   AAQDVANDPEYLAKYKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQV  195

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H+ W FFPFHRWYLYF+E+IM  +I DPTF LP+WNWD P GM  P IF D +  S LYD
Sbjct  196   HYCWLFFPFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFIDTS--SSLYD  253

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
             QYRN  H+   +LDL Y G D    D T++K NL  MY+QM++NA    LF+G+P  A +
Sbjct  254   QYRNAAHQPPKLLDLNYGGTDDDVDDATRIKENLTTMYKQMVSNATSHRLFYGEPYSAGD  313

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-  1191
               S G G IE  PHN++H W GDP   N EDMG FYSAA DP+FYS HSNVDRMW I+K 
Sbjct  314   EPSPGAGNIETTPHNNIHLWAGDPTQTNGEDMGTFYSAARDPLFYSHHSNVDRMWXIYKD  373

Query  1192  TLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTF-QDMPIPWKDFKP-  1365
              LGG  TDI + DWLD EFLF+DE K  V+VKVRD LD +KLGY + +++ IPW + KP 
Sbjct  374   KLGG--TDIENTDWLDAEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDENVSIPWLESKPT  431

Query  1366  TRKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-Y  1524
             TRK T K     S    +   PA LS  ++  VTR +    T      Q+E+L +  + +
Sbjct  432   TRKSTNKRKAXVSSSDLSTTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEF  491

Query  1525  DDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIK  1704
                + ++FDV++N+D D +    D++E+AGSF ++PH H+        T   L+I+ L++
Sbjct  492   AGNETVKFDVYVNDDAD-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSITSLLE  546

Query  1705  DLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
             +LD E D+ ++VTLVPKVG   +T+    I  ++
Sbjct  547   ELDAETDNSLVVTLVPKVGKGPITIGGFSIELIN  580



>emb|CBZ41492.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=593

 Score =   452 bits (1162),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 253/552 (46%), Positives = 329/552 (60%), Gaps = 26/552 (5%)
 Frame = +1

Query  184   RCAASSEGRDENPDS-LSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVA  360
             R A S + +D++     +  K+DRRNVLLGLG L GA        N  A ADP+  PD+ 
Sbjct  49    RHAISCKTQDDHDHRHANSGKIDRRNVLLGLGTLSGATATFG--PNSLAFADPIMAPDIT  106

Query  361   NCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLEKYKTA  537
              CGPAT  F        CCPP   TTK+  +K+PS +  L VRPAAH V+  Y+ KY   
Sbjct  107   LCGPAT--FPEGVATTNCCPP--STTKILDFKVPSQANTLRVRPAAHLVNKDYIAKYNKV  162

Query  538   IQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGN---PYQIHFNWFFFPFHRWYLYFFE  708
             +Q MK LP DDPRNF QQA+VHCAYC+G Y   G     +Q+H +W F+PFHR+YLYFFE
Sbjct  163   VQLMKALPEDDPRNFMQQASVHCAYCDGTYDQLGFQDLEFQVHASWLFYPFHRYYLYFFE  222

Query  709   RIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYS  888
             +I   +I+DP FT+P+WNWD P GMT P I+ ++N  S LYD  R+  H+   ++DL Y+
Sbjct  223   KICGKLIDDPNFTIPFWNWDAPDGMTIPYIYTNKN--SSLYDSLRDAKHQPPSLVDLDYN  280

Query  889   GDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVH  1068
             G D       +   NL IMYRQM+  +    LF G P RA +  S G G +EN+PH  VH
Sbjct  281   GVDRNLSPSKQTSTNLNIMYRQMVMASKTTSLFLGSPYRAGDDPSPGGGIMENVPHTPVH  340

Query  1069  RWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEF  1248
              W GD    N EDMGNFYSA  DP+FY+ H+NVDRMW+IWK+L G+R D  D DWLD+ F
Sbjct  341   NWTGDRSQPNVEDMGNFYSAGRDPIFYAHHANVDRMWSIWKSLVGERKDYTDTDWLDSLF  400

Query  1249  LFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPASTDVL  1428
             LF+DE    V+VKVRDCLD++ LGY +QD+ IPW + KP  +   +L   ++V  + DV 
Sbjct  401   LFYDENADLVRVKVRDCLDSKNLGYVYQDVDIPWLNSKPYPRLKKRLRAYKNVLFAKDVF  460

Query  1429  PAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDT----------KFIRFDVFLNEDEDV  1578
             P  L K +   V R   +   +E   +     +            KF++FDV +NED D 
Sbjct  461   PGSLDKLIKVMVPRPKKLRSQEENGHDEVEEEEILVIEGIEVKMDKFVKFDVLVNED-DE  519

Query  1579  NTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKV  1758
                  D+TE+AGSF N+PH H+ G      T   L ISEL+KDL  E D  VLVTLVPK 
Sbjct  520   KKATADKTEFAGSFVNIPHKHKPGKNM--KTRLRLGISELLKDLGAEDDKNVLVTLVPKT  577

Query  1759  GGSFVTVNNAYI  1794
              G  + ++   I
Sbjct  578   KGGEIRIDEIKI  589



>gb|AAK53414.1|AF368291_1 polyphenol oxidase [Populus tremuloides]
Length=563

 Score =   451 bits (1159),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 239/496 (48%), Positives = 317/496 (64%), Gaps = 30/496 (6%)
 Frame = +1

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPS-FSKLNVRPAAHA  501
             A A P+  PD+ NC    +   + + P  CC P+    K+  ++ PS FS L  R AAH 
Sbjct  65    AYAKPITSPDLTNC--KLVDLPNPENPTDCCSPLP--RKIIDFRPPSPFSPLRTRRAAHL  120

Query  502   VDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFF  672
             VD  Y+ KY  AI  MK LP DDPRNFYQQANVHCAYC+ AY   G P     +HF W F
Sbjct  121   VDEDYVAKYAEAISLMKSLPEDDPRNFYQQANVHCAYCDDAYEQVGFPKLELDVHFCWLF  180

Query  673   FPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQD  852
             FP+HR+YLYF+ERI+  +INDPTF LP+WNWD+P GM  P IF D    SPLYDQ+R+Q+
Sbjct  181   FPWHRYYLYFYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTDPK--SPLYDQFRDQN  238

Query  853   HRYGHVLDLAYSGDDIIAPDPTKV----KNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             H+   +LDL Y+  D   P+PT       +N  +MY+QM++ A  P LFFGKP RA +  
Sbjct  239   HQPPVLLDLDYAAGD---PNPTNANQVYSSNRRVMYKQMVSGAAKPTLFFGKPYRAGDDA  295

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-  1197
               G GTIE+ PHN++HRW GDP   N EDMGNFYSAA DP+F+  HSNVDRMWTIWKT+ 
Sbjct  296   RPGAGTIESSPHNNIHRWTGDPTQENTEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIP  355

Query  1198  GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RK  1374
             GG R DI D DWL++EFLF++E    V+ KVRDCLDN +L YT+Q++ IPW   KP  R+
Sbjct  356   GGLRRDITDPDWLNSEFLFYNENAELVRCKVRDCLDNRRLRYTYQNVEIPWLKSKPIPRR  415

Query  1375  RTVKLSITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTK  1536
                K + T++        P  L K +   V     +RS    E ++E+L ++ + YD+ K
Sbjct  416   LGKKAAETKTALTPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDNDK  475

Query  1537  FIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDL  1716
             F+RFDVF+N+D ++ + + + TE+AGSF N+ H      A    T   L I+EL++DL+ 
Sbjct  476   FVRFDVFINDDLEIPS-KPENTEFAGSFVNVSH----KRAKKSKTRLILGITELLEDLET  530

Query  1717  EGDDKVLVTLVPKVGG  1764
             +GDD ++V LVP+  G
Sbjct  531   DGDDSIVVALVPRSNG  546



>gb|AHF20575.1| polyphenol oxidase [Hevea brasiliensis]
Length=600

 Score =   451 bits (1161),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 231/517 (45%), Positives = 318/517 (62%), Gaps = 31/517 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRP  489
              +PFA A P+  P+   CG A +  +  K P  CCPP +  TK+  +K+PS  S L +RP
Sbjct  87    GDPFAFAKPISTPEPTKCGKADLP-NYAKPPTNCCPPTS--TKILDFKLPSSQSPLRIRP  143

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH  D AY+ KY  A++ MK LP DDPR+F QQA VHCAYCNGAY   G P    Q+H 
Sbjct  144   AAHLADDAYIAKYSKAVKLMKALPEDDPRSFMQQAKVHCAYCNGAYDQVGFPDLQIQVHN  203

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFPFHR+YLYF E+I+  +I+DPTF LPYWNWD+P GM  P ++   N  SPLYDQY
Sbjct  204   SWLFFPFHRYYLYFHEKILGKLIDDPTFALPYWNWDSPKGMQLPALY--ANPKSPLYDQY  261

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             RN++H+   ++DL Y+  +   P+   + +NL IMYRQMI+N     LF G P RA +  
Sbjct  262   RNKNHQPPTIVDLDYNATEGPTPEQETISSNLTIMYRQMISNGKTAKLFLGSPYRAGDEP  321

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G+IENIPHN +H W GD    N E+MGNFYSA  DP+FY+ HSNVDRMWTIWKTLG
Sbjct  322   DPGAGSIENIPHNPLHVWTGDNFQRNLENMGNFYSAGRDPIFYAHHSNVDRMWTIWKTLG  381

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT  1380
             GKRT+  D DWLD  FL +DE    V+VKVRDC+D++KL Y +Q++ IPW   +PT +R 
Sbjct  382   GKRTEFTDPDWLDAAFLLYDENANLVRVKVRDCIDHKKLRYAYQEVEIPWLKSRPTPRRL  441

Query  1381  VKL---------SITESVPAS----TDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLV  1521
             +K           + ++        T+  P  L K +   V+R       +E+    +++
Sbjct  442   IKKMAKVFHHHDQVAQAAETQNLTPTNSFPLKLDKVIRTMVSRPKKSRSKKEKEEEEEIL  501

Query  1522  ------YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNL  1683
                   ++    ++FDV++N++ D  +   +++E+AGSF N+PH H+ G      T   L
Sbjct  502   VINGIEFERDAVVKFDVYVNDEHDSPSGP-NKSEFAGSFVNVPHAHKHGKKM--KTCLRL  558

Query  1684  AISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
              I++L++DL  E DD V+V LVP++G   V +    I
Sbjct  559   GITDLLEDLGAEDDDNVVVALVPRIGKGQVRIGGIKI  595



>emb|CDO99592.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   451 bits (1159),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 257/568 (45%), Positives = 350/568 (62%), Gaps = 41/568 (7%)
 Frame = +1

Query  148   SRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFA  327
             S   +R    K+ C A++  R+ +          RRNVL+GLGGLYGA +L    ++PFA
Sbjct  32    STTKKRNHHFKVSCQATNGERNAS----------RRNVLIGLGGLYGAASLA---ADPFA  78

Query  328   LADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAV  504
             LA P+  PDV+ CGPA +   S   P  CCPP    T +  +K+P+ S  L VRPAAH V
Sbjct  79    LAAPIQAPDVSKCGPADLP--SGATPTNCCPP--PATTIVDFKLPAPSNTLRVRPAAHLV  134

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             D AY+ K++ A+Q MK LP DDPR+F QQANVHCAYC+GAY   G P    Q+H +W F 
Sbjct  135   DEAYIAKFQRAVQLMKALPDDDPRSFKQQANVHCAYCDGAYDQVGFPNLELQVHNSWLFL  194

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHR+YLYF+ERI+  +INDPTF +P+WNWD   GM  P I+ D    SPLYD  R+  H
Sbjct  195   PFHRYYLYFYERILGKLINDPTFAMPFWNWDAQGGMRLPDIYTDPT--SPLYDTLRDGSH  252

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   ++DL ++G D    D  ++  N  IMYRQM++N+  P LFFG P RA +    G G
Sbjct  253   QPPTMIDLDFNGTDSNISDSQQLSQNYTIMYRQMVSNSRTPRLFFGSPYRAGDDPDPGAG  312

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTD  1215
              +ENIPH  VH W GD    N EDMGNFYSA  DP+FY+ HSN+DRMWT+WKTLGG+R D
Sbjct  313   QLENIPHGPVHVWTGDRTQPNLEDMGNFYSAGRDPIFYAHHSNIDRMWTLWKTLGGRRQD  372

Query  1216  IADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT-VKLS  1392
             I D DWL+  F+F+DE    V+V+VRDCLD  KLGY++Q +  PW + +PT + T V   
Sbjct  373   ITDTDWLNASFVFYDENAQMVRVRVRDCLDTTKLGYSYQTVDTPWLNSRPTPRLTKVARK  432

Query  1393  ITESVPAS--------TDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLV------YDD  1530
             I + V A+        TD+ PA L K +   V R       +E+    +++       + 
Sbjct  433   IKKLVVANAADHSHSPTDIFPAKLDKIIKVMVKRPKKKRSKKEKDEKEEILVIEKIEVER  492

Query  1531  TKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDL  1710
               F +FD+++N+++D  +   + TE+AGSF N+PH H+        T  NL+++E+++DL
Sbjct  493   DAFAKFDIYINDEDDPKSTP-ENTEFAGSFVNVPHKHK--HGKKIKTHLNLSLTEILEDL  549

Query  1711  DLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             D E D+ V+VTLVP+VG   VT+    I
Sbjct  550   DAEDDEHVMVTLVPRVGCDAVTIGGIKI  577



>gb|ABY84850.1| polyphenol oxidase [Cydonia oblonga]
Length=504

 Score =   448 bits (1152),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 231/496 (47%), Positives = 314/496 (63%), Gaps = 33/496 (7%)
 Frame = +1

Query  349   PDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKY  528
             PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL VRP AHAVD AY +K+
Sbjct  6     PDVSKCGSADLPPGAEVT--NCCPP--PATKIIDFKLPAPAKLRVRPPAHAVDKAYRDKF  61

Query  529   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLY  699
               A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W FFPFHR+YLY
Sbjct  62    YKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFFPFHRYYLY  121

Query  700   FFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDL  879
             FFE+I+  +INDPTF +P+WNWD+PPGM  P I+ D    SPLYD++R+  H+   ++DL
Sbjct  122   FFEKILGKLINDPTFAMPFWNWDSPPGMPLPTIYTDPK--SPLYDKFRSAKHQPPTLIDL  179

Query  880   AYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHN  1059
              Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G G+IE  PH 
Sbjct  180   DYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPGGGSIEGTPHG  239

Query  1060  SVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLD  1239
              VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKRTD+ D DWLD
Sbjct  240   PVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKRTDLTDSDWLD  299

Query  1240  TEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--------TVKLSI  1395
             + FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R          KL +
Sbjct  300   SGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVALSKIAKKLGV  359

Query  1396  TESVPASTDVL------PAPLSKNLTFYV------TRSTSVPETQEEMLNLDLV-YDDTK  1536
               +  AS+  +      P  L   ++  V       RS    E +EE+L ++ + +D   
Sbjct  360   AHAAVASSSKVVAGTEFPISLGSKISTVVKRPQQKKRSKKAKEDEEEILVIEGIEFDRDV  419

Query  1537  FIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDL  1716
              ++FDVF+N+ +D+ +   D+TE+AGSF ++PH H+        T   L +++L+++++ 
Sbjct  420   AVKFDVFVNDVDDLPSGP-DKTEFAGSFVSVPHRHKHKKKI--NTILRLGLTDLLEEIEA  476

Query  1717  EGDDKVLVTLVPKVGG  1764
             E DD V+VTLVPK G 
Sbjct  477   EDDDSVVVTLVPKYGA  492



>gb|AGU01537.1| polyphenol oxidase [Malus domestica]
Length=616

 Score =   451 bits (1161),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 258/591 (44%), Positives = 346/591 (59%), Gaps = 56/591 (9%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENP-----------DSLSKAKLDRRNVllglgglygaynlga  306
             R  +   + C A++   D+N            ++ S   LDRRNVL+GLG LYG      
Sbjct  38    RHSNLQAVSCKATNNSSDQNKNPSTSSNDHDHENPSPVNLDRRNVLIGLGSLYGGVAGLG  97

Query  307   ggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVR  486
               S+PFA+A PV  PD+A CG A   F S  VP  CCPP +   K+  +K PS +KL VR
Sbjct  98    --SDPFAVAKPVSPPDLAKCGAA--DFPSGAVPTNCCPPTSQ--KIVDFKFPSPTKLRVR  151

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIH  657
             PAAH VD AY+EKY  AI+ MK LP DDPR+F QQA++HCAYC+GAY   G P    QIH
Sbjct  152   PAAHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIH  211

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHR+YLYF ERI+  +I+DPTF LP+WNWD P GM  P +F   N  SPLYD+
Sbjct  212   QSWLFFPFHRYYLYFHERILAKLIDDPTFALPFWNWDAPAGMQLPALF--ANPDSPLYDE  269

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              R   H+   ++DL ++G D       ++  NL IMYRQM++N+  PLLFFG P RA   
Sbjct  270   LRADSHQPPTLIDLDFNGTDETMSKDAQIDANLKIMYRQMVSNSKKPLLFFGSPYRAGTE  329

Query  1018  QSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL  1197
                G G+IE  PH  VH W GD    N EDMGNFYSAA DP+F+S HSN+DRMW IWK++
Sbjct  330   PDPGAGSIETTPHGPVHTWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNIDRMWNIWKSI  389

Query  1198  GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR  1377
             G K  DI D DWLDT FLF+D+    V+V VRD LDN+KLGYT++D+ IPW   +PT +R
Sbjct  390   GTKNKDINDTDWLDTGFLFYDKNAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPTPRR  449

Query  1378  T--------------------VKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQE  1497
             T                     + + +  V A  D  P  L   ++  V+R      +++
Sbjct  450   TKLARKAKAAGVAKAAGVAKAAETTSSGKVVAGKD-FPINLETKISTVVSRPKPKKRSKK  508

Query  1498  E-------MLNLDLVYDDTKFIRFDVFLN--EDEDVNTVELDRTEYAGSFGNLPHVHEGG  1650
             E       ++   +  D    ++FDV++N  +DED      D++E+AGSF ++PH  +  
Sbjct  509   EKEDEEEILVIQGIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQKEK  568

Query  1651  SATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             S     +   L +++L++DL  E D+ V+VTLVP+ G   V + +  I  L
Sbjct  569   S----KSCLRLGLTDLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEFL  615



>ref|XP_003526194.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Glycine max]
Length=596

 Score =   450 bits (1157),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 253/571 (44%), Positives = 347/571 (61%), Gaps = 35/571 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R ++     ++ C + ++ + E PD   +    RRN+LLGLGGL GA  L    +NPFA 
Sbjct  39    RKSKHHHTPRVTCNSGNQNKGEKPDIHIE---QRRNILLGLGGLCGAATLN---NNPFAF  92

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDA  510
             A P+  PD+  CGP  +   +   P  CCPP + T  +++   PS   L VRPAAH VD 
Sbjct  93    AAPISPPDLTTCGPPDLPEGA--EPTNCCPPFSSTI-IDFKFPPSNKPLRVRPAAHLVDK  149

Query  511   AYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPF  681
              YL KYK AI  MK LP++DPRNF QQANVHCAYC G+Y   G P    Q+H +W FFP+
Sbjct  150   NYLAKYKKAIDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLELQVHSSWLFFPY  209

Query  682   HRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRY  861
             HRW+LYF+ERI+ S+INDPTF LP+WNWD P GM  P I+ D    SPLYD  RN +H+ 
Sbjct  210   HRWFLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPK--SPLYDPLRNANHQP  267

Query  862   GHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTI  1041
               ++D  ++ D+ I+    ++  NL IMYRQ+++N   P LF G P RA +    G G++
Sbjct  268   PTLVDFDFNLDNPISNG--RISTNLTIMYRQLVSNGKTPTLFLGNPYRAGDAPDPGGGSV  325

Query  1042  ENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIA  1221
             E +PH  VH W GD    N E+MG+FYSAA DP+FYS HSNVDRMW+IWKTLGGKR D  
Sbjct  326   EGVPHGPVHLWTGDINQPNIENMGDFYSAARDPIFYSHHSNVDRMWSIWKTLGGKRRDFT  385

Query  1222  DKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITE  1401
             D DWL++  LF+DE K  V+VKV+DCLD  KLGY +QD+ IPW   KP+ +R+    +  
Sbjct  386   DSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDVEIPWLKSKPSPRRSRVQKVAL  445

Query  1402  SVPASTDVL-PAPLSKNLTFYVTRSTSVP---------------ETQEEMLNLDLV-YDD  1530
                 +T V   A  S+N+ F +   + V                E +EE+L ++ V YD 
Sbjct  446   GPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSRSKKEKEEEEEVLVIEGVEYDS  505

Query  1531  TKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDL  1710
                ++FDV +N DED   ++ + +EYAGSF  +PH H+  +     T   L +++L+++L
Sbjct  506   NIPVKFDVLIN-DEDDKQIQPEDSEYAGSFVTVPHSHKHKNKK-IITCLRLGLTDLLEEL  563

Query  1711  DLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             + E DD V+VTLVP+ G   V +    I+ +
Sbjct  564   EAEDDDSVVVTLVPRYGKGRVQIGGIKIDLV  594



>gb|KHN46528.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=596

 Score =   450 bits (1157),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 253/571 (44%), Positives = 347/571 (61%), Gaps = 35/571 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R ++     ++ C + ++ + E PD   +    RRN+LLGLGGL GA  L    +NPFA 
Sbjct  39    RKSKHHHTPRVTCNSGNQNKGEKPDIHIE---QRRNILLGLGGLCGAATLN---NNPFAF  92

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDA  510
             A P+  PD+  CGP  +   +   P  CCPP + T  +++   PS   L VRPAAH VD 
Sbjct  93    AAPISPPDLTTCGPPDLPEGA--EPTNCCPPFSSTI-IDFKFPPSNKPLRVRPAAHLVDK  149

Query  511   AYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPF  681
              YL KYK AI  MK LP++DPRNF QQANVHCAYC G+Y   G P    Q+H +W FFP+
Sbjct  150   NYLAKYKKAIDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLELQVHSSWLFFPY  209

Query  682   HRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRY  861
             HRW+LYF+ERI+ S+INDPTF LP+WNWD P GM  P I+ D    SPLYD  RN +H+ 
Sbjct  210   HRWFLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPK--SPLYDPLRNANHQP  267

Query  862   GHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTI  1041
               ++D  ++ D+ I+    ++  NL IMYRQ+++N   P LF G P RA +    G G++
Sbjct  268   PTLVDFDFNLDNPISNG--RISTNLTIMYRQLVSNGKTPTLFLGNPYRAGDAPDPGGGSV  325

Query  1042  ENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIA  1221
             E +PH  VH W GD    N E+MG+FYSAA DP+FYS HSNVDRMW+IWKTLGGKR D  
Sbjct  326   EGVPHGPVHLWTGDINQPNIENMGDFYSAARDPIFYSHHSNVDRMWSIWKTLGGKRRDFT  385

Query  1222  DKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITE  1401
             D DWL++  LF+DE K  V+VKV+DCLD  KLGY +QD+ IPW   KP+ +R+    +  
Sbjct  386   DSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDVEIPWLKSKPSPRRSRVQKVAL  445

Query  1402  SVPASTDVL-PAPLSKNLTFYVTRSTSVP---------------ETQEEMLNLDLV-YDD  1530
                 +T V   A  S+N+ F +   + V                E +EE+L ++ V YD 
Sbjct  446   GPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSRSKKEKEEEEEVLVIEGVEYDS  505

Query  1531  TKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDL  1710
                ++FDV +N DED   ++ + +EYAGSF  +PH H+  +     T   L +++L+++L
Sbjct  506   NIPVKFDVLIN-DEDDKQIQPEDSEYAGSFVTVPHSHKHKNKK-IITCLRLGLTDLLEEL  563

Query  1711  DLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             + E DD V+VTLVP+ G   V +    I+ +
Sbjct  564   EAEDDDSVVVTLVPRYGKGRVQIGGIKIDLV  594



>ref|XP_007025703.1| Larreatricin hydroxylase [Theobroma cacao]
 gb|EOY28325.1| Larreatricin hydroxylase [Theobroma cacao]
Length=605

 Score =   450 bits (1157),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 251/565 (44%), Positives = 342/565 (61%), Gaps = 32/565 (6%)
 Frame = +1

Query  181   IRCAASSEGRDENPDSLSKAK----LDRRNVllglgglygaynlgaggSNPFALADPVPL  348
             + C A++ G ++NP   S +K    L+R +    L GL G Y      ++PFALA P+  
Sbjct  47    VSCRATNNG-NQNPTPSSNSKGDSALNRFDRRDLLIGLGGLYGATNLANDPFALAAPIAA  105

Query  349   PDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKY  528
             PD+  CG A IS ++ +  Y C P  T  T    YK PSFSKL  RP AH VDA YL K+
Sbjct  106   PDLTLCGNAVISETTGETTYCCPPTTTTITD---YKPPSFSKLRYRPPAHLVDADYLAKF  162

Query  529   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLY  699
               A+  MK+LPSDDPR+F QQA VHCAYCNGAY   G P    Q+HF+W FFPFHRWYLY
Sbjct  163   TKAMNLMKELPSDDPRSFMQQAYVHCAYCNGAYDQVGFPDQDLQVHFSWLFFPFHRWYLY  222

Query  700   FFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDL  879
             F+ERI+  +I DP F +P+WNWD P GM  P I+   N  SPLYD  RN +H+   + DL
Sbjct  223   FYERILGKLIGDPDFVMPFWNWDAPAGMPIPAIY--VNPQSPLYDDKRNVNHQPPKLADL  280

Query  880   AYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHN  1059
              Y+G D    D  ++  NL +MY+QM++NA    LF GKP RA +  S G G++E   H 
Sbjct  281   DYNGTDKDITDAEQIAINLKLMYKQMVSNATTATLFHGKPYRAGDAGSPGGGSVELGCHT  340

Query  1060  SVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-GGKRTDIADKDWL  1236
             ++HRWVGDPR   +EDMGNFYSA  DPVFY+ H NVDRMW+IWKTL G KR D +D DWL
Sbjct  341   AIHRWVGDPRQTYNEDMGNFYSAGRDPVFYAHHGNVDRMWSIWKTLPGTKRNDFSDTDWL  400

Query  1237  DTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVK----------  1386
             D  F+F+DE    V+VKVRDC+D++ LGY +Q +  PW   KPT ++  K          
Sbjct  401   DASFVFYDENANLVRVKVRDCVDSKNLGYDYQPVDNPWLKTKPTARKFAKKGGKARGSAM  460

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE------MLNLDLVYDDTKFIRF  1548
              +  +S     +  P  L K ++  + R       +E+      ++   +       ++F
Sbjct  461   AAEIKSKNVVRNAFPIVLDKTVSIEIPRPRKSRSKREKEEDEEVLVLEGIQLATQAAVKF  520

Query  1549  DVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDD  1728
             D+++N+++D      +  E+AGSF N+PH H    A    TTF+LAIS++++DLD+EGDD
Sbjct  521   DIYINDEDDEAPSGPEDAEFAGSFTNIPHSHT--HAKKLNTTFSLAISDVLEDLDVEGDD  578

Query  1729  KVLVTLVPKVGGSFVTVNNAYINTL  1803
              ++VTLVP+ G   V+V N  ++ +
Sbjct  579   NIVVTLVPREGKGLVSVGNIKVDYI  603



>ref|XP_004303397.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=603

 Score =   450 bits (1157),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 251/569 (44%), Positives = 348/569 (61%), Gaps = 31/569 (5%)
 Frame = +1

Query  163   RGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPV  342
             R   +  +C +S++   +      +  LDRRNVL+GLGGLYG        ++PFA A PV
Sbjct  42    RSSRIICKCTSSNQNPSDEHKHSHQTNLDRRNVLIGLGGLYGVGLGS---ADPFAFAKPV  98

Query  343   PLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLE  522
               PD++ CG A +   +   P  CCPPI+D  K+  +  PS S L VRPAAHAVD AY++
Sbjct  99    APPDLSKCGAADLPPGA--TPINCCPPISD--KIVDFTFPSSSPLRVRPAAHAVDQAYID  154

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             KY  AI+ MK LP  DPR+F QQA++HCAYC+GAY   G P    QIH +W F+PFHR+Y
Sbjct  155   KYSKAIELMKALPDSDPRSFSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFYPFHRYY  214

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYF+E+I+  +I+DPTF LP+WNWD+PPGM  P +F D    SPLY++ RN +H+   +L
Sbjct  215   LYFYEKILGKLIDDPTFALPFWNWDSPPGMKLPALFADPK--SPLYNELRNANHQPPTLL  272

Query  874   DLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIP  1053
             DL ++  D    +  ++ +NL IMYRQM++NA    LFFG   RA    S G G+IE+ P
Sbjct  273   DLDWNLTDTPTTEADQISSNLKIMYRQMVSNAKKQQLFFGTAYRAGTDPSPGSGSIESTP  332

Query  1054  HNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDW  1233
             H  VH W GD    N+EDMGNFYSAA DP+F+S HSNVDRMW++WKTLG    DI D DW
Sbjct  333   HGPVHVWTGDNTQPNYEDMGNFYSAARDPIFFSHHSNVDRMWSVWKTLGATNKDITDPDW  392

Query  1234  LDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPA  1413
             LDT FLF+DE    V+VKVRDCLD++KLGY +QD+ IPW   KPT +R+      ++V  
Sbjct  393   LDTGFLFYDENAQLVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPTPRRSKLAKTAKAVGV  452

Query  1414  STDVLPAP-----------LSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF-----  1539
             +      P           L   ++  V R      +++E  + +  LV    +F     
Sbjct  453   ARAATSGPKVVGRGDFPIKLDSKISTVVKRPKQKKRSKKEKEDEEEILVIGGIEFEKDTA  512

Query  1540  IRFDVFLNEDEDVNT-VELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDL  1716
             ++FDV++N+ ED +   + D +E+AGSF N+PH H+        +   L +++L++DL  
Sbjct  513   VKFDVYVNDLEDDDEPGKPDDSEFAGSFVNVPHKHKDKKKKKTKSCLRLGLTDLLEDLGA  572

Query  1717  EGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             E D+ V+VTLVP+ G   + ++   I  L
Sbjct  573   EDDESVVVTLVPRYGTKSLKIDTIKIEFL  601



>ref|XP_008371328.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=587

 Score =   449 bits (1156),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 261/567 (46%), Positives = 343/567 (60%), Gaps = 35/567 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R  ++  A ++ C A+ +G +EN D    A+LDRRN+L+GLG             NPFA 
Sbjct  39    RKPKQCLAGRVXCKAT-KGDNENLDQ-GLARLDRRNMLIGLGAGGLYGAA----GNPFAF  92

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH--AV  504
             A PV  PD+  CGPA     S      CCPP T  T +  +K+P    L  R AA   A 
Sbjct  93    AAPVSAPDLTTCGPADKPDGST---IDCCPPTT--TTIIDFKLPDRGPLRTRLAAQDVAK  147

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             + AYL KYK AI+ M+ LP DDPR+F QQA VHC+YC+G Y   G      Q+H+ W FF
Sbjct  148   NPAYLAKYKKAIELMRALPDDDPRSFAQQAKVHCSYCDGGYPQVGYSDLEIQVHYCWLFF  207

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+E+IM  +I DPTF LP+WNWD P GM  P IF D +  S LYDQYRN  H
Sbjct  208   PFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDTS--SSLYDQYRNAAH  265

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   +LD  YSG D    D T +K NL  MY+QM++ A    LFFG+P  A +  S G G
Sbjct  266   QPPKLLDFNYSGTDDBVDDATXIKENLTTMYQQMVSKATSHRLFFGEPYSAGDDPSPGAG  325

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-TLGGKRT  1212
              IE+IPHN++H W GDP   N EDMG FYS+  DP+FYS HSNVDRMW+I+K  LGG  T
Sbjct  326   NIESIPHNNIHFWTGDPTQTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGG--T  383

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTF-QDMPIPWKDFKPT-RKRTVK  1386
             DI   DWLDTEFLF+DE K  V+VKV D LD +KLGY + + +PIPW   KPT RK T K
Sbjct  384   DIEKTDWLDTEFLFYDEKKNLVRVKVCDSLDTKKLGYVYDEKVPIPWLKSKPTXRKSTNK  443

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVT------RSTSVPETQEEMLNLDLV-YDDTKFIR  1545
                  S    T   PA LS  ++  VT      R+T+  + Q+E+L +  + +   + ++
Sbjct  444   RKAAVSSSDLTTTFPATLSBTISVEVTRPSATKRTTAQKKAQDEVLVIKGIEFAGNETVK  503

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDV++N+D D +    D++E+AGSF ++PH H+        T   L+I+ L+++LD E D
Sbjct  504   FDVYVNDDAD-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSITSLLEELDAETD  558

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTLD  1806
               ++VTLVPKVG   +T+    I  ++
Sbjct  559   SSLVVTLVPKVGKGPITIGGFSIELIN  585



>gb|AAW58109.2| polyphenol oxidase [Prunus salicina var. cordata]
Length=597

 Score =   449 bits (1156),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 258/534 (48%), Positives = 334/534 (63%), Gaps = 28/534 (5%)
 Frame = +1

Query  238   AKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATIS-FSSCKVPYRC  414
              K DRRN+L+GL GLYGA  L      PFA ADP+  PD++ C PA I+   S  VP  C
Sbjct  73    GKFDRRNILIGLSGLYGATALD---PKPFAFADPIAPPDLSTCKPAEITPGGSETVP--C  127

Query  415   CPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQA  594
             CPP+   TK++ +K      L  RPAAH V   YL K+K A   M+ LP DDPR+  QQA
Sbjct  128   CPPVM--TKIKTFKPDLSIPLRTRPAAHQVTDEYLAKFKKAQAAMRALPDDDPRSMVQQA  185

Query  595   NVHCAYCNGAYLLNG---NPYQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNW  765
              VHCAYCNGAY   G   N  Q+HF+W FFPFHR YLYF+ERI+  +I+DPTF LPYWNW
Sbjct  186   KVHCAYCNGAYPQVGFTDNDIQVHFSWLFFPFHRMYLYFYERILGKLIDDPTFALPYWNW  245

Query  766   DNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIM  945
             D+P G   P I+ D +  SPLYD+YRN DH+   ++DL+Y G +    + T++  NLAIM
Sbjct  246   DSPVGFPIPDIYTDPS--SPLYDKYRNADHQPPVLVDLSYGGTNDDVDEQTRIDENLAIM  303

Query  946   YRQMITNAPCPLLFFGKPLRADNTQSSGM-GTIENIPHNSVHRWVGDPRSANHEDMGNFY  1122
             YRQM++ A  P LFFG   RA +  +    GTIEN+PHN++H WVGDP   +HEDMGNFY
Sbjct  304   YRQMVSGAKNPDLFFGHAYRAGDLNTQKYPGTIENMPHNNIHIWVGDPTQTHHEDMGNFY  363

Query  1123  SAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCL  1302
             SA  DP+FY+ H NVDRMW IWKTLGGKR DI D DWLD EFLF+DE    V  KVRD L
Sbjct  364   SAGRDPLFYAHHCNVDRMWNIWKTLGGKRKDITDTDWLDAEFLFYDENAELVNCKVRDSL  423

Query  1303  DNEK-LGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAS--TDVLPAPLSKNLTFYVT--  1467
             + EK L Y ++  P+PW   KPT ++T K      V A+  T   PA L    T  V   
Sbjct  424   EPEKQLRYNYEPAPLPWLFTKPTARKT-KNKTKAKVAATQLTSKFPATLDSKTTVEVARP  482

Query  1468  ----RSTSVPETQEEMLNL-DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLP  1632
                 RS      +EE+L + D+ ++ T+ ++FDVF+N+D + +    D++E+AGSF ++P
Sbjct  483   KPRKRSKKEKVDEEELLIIKDIEFEGTEAVKFDVFINDDAE-SLSRRDKSEFAGSFVHVP  541

Query  1633  HVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
                   + T   T   L I++L++DL  E D  VLVTLVP++  S +T+    I
Sbjct  542   QGKTKKAKT--KTNLKLGITDLLEDLGAEDDSSVLVTLVPRISNSPITIGGFKI  593



>gb|AAG21983.1|AF263611_1 polyphenol oxidase PPO1 [Populus trichocarpa x Populus deltoides]
Length=563

 Score =   448 bits (1153),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 238/493 (48%), Positives = 315/493 (64%), Gaps = 30/493 (6%)
 Frame = +1

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPS-FSKLNVRPAAHA  501
             A A P+  PD+  C    +   + + P  CC P+    K+  ++ PS FS L  R AAH 
Sbjct  65    AFAKPITPPDLTKC--ELVDLPNPENPSNCCTPLP--KKIIDFRPPSPFSPLRTRRAAHL  120

Query  502   VDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFF  672
             VD  Y+ KY  AI  MK LP +DPRNFYQQANVHCAYCNGAY   G P     +H  WFF
Sbjct  121   VDEDYVAKYAEAISLMKSLPENDPRNFYQQANVHCAYCNGAYEQVGFPKLEIDVHSCWFF  180

Query  673   FPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQD  852
             FP+HR+YLYF+ERI+  +INDPTF LP+WNWD+P GM  P IF D    SPLYDQ+R+Q+
Sbjct  181   FPWHRYYLYFYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTDPK--SPLYDQFRDQN  238

Query  853   HRYGHVLDLAYSGDDIIAPDPTKV----KNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             H+   +LDL Y   D   P+PT       +NL +MY+QM++ A  P LFFGK  RA    
Sbjct  239   HQPPILLDLDYGAGD---PNPTNANQLYSSNLTVMYKQMVSGAAKPTLFFGKSYRAGEDT  295

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-  1197
             S G GTIE  PHN++HRW GDP   N+EDMGNFYSAA DP+F+  HSNVDRMWTIWKT+ 
Sbjct  296   SPGAGTIETTPHNNIHRWTGDPTQENNEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIP  355

Query  1198  GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RK  1374
             GG R DI+D DWL++EFLF++E    V+ KV DCLDN  L YT+Q++ IPW + KP  R+
Sbjct  356   GGTRRDISDPDWLNSEFLFYNENAELVRCKVSDCLDNTGLRYTYQNVEIPWLESKPIPRR  415

Query  1375  RTVKLSITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTK  1536
                K + T++        P  L K +   V     +RS    E ++E+L ++ + YD  K
Sbjct  416   LGKKAAETKTALTPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDKGK  475

Query  1537  FIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDL  1716
             F++FDVF+N+D ++ + + + TE+AGSF N+ H H    A    T   L I+EL++DL+ 
Sbjct  476   FVKFDVFINDDVEMPS-KPENTEFAGSFVNVSHKH----AKKSKTRLILGITELLEDLES  530

Query  1717  EGDDKVLVTLVPK  1755
             +GDD ++V LVP+
Sbjct  531   DGDDSIVVALVPR  543



>ref|XP_008349220.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=610

 Score =   450 bits (1157),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 255/562 (45%), Positives = 336/562 (60%), Gaps = 39/562 (7%)
 Frame = +1

Query  196   SSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPA  375
             S+   D + ++ S   LDRR VL+GLG LYG        S+PFA+A PV  PD+A CG A
Sbjct  61    STSSNDHDHENPSPVNLDRRXVLIGLGSLYGGVAGLG--SDPFAVAKPVSPPDLAKCGAA  118

Query  376   TISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKD  555
                F S  VP  CCPP +   K+  +K PS +KL VRPAAHAVD AY+EKY  AI+ MK 
Sbjct  119   --DFPSGAVPTNCCPPTS--QKIVDFKFPSPTKLRVRPAAHAVDKAYIEKYSKAIELMKA  174

Query  556   LPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSM  726
             LP DDPR+F QQA+VHCAYCNGAY   G P    QIH +W FFPFHR+YLYF ERI+  +
Sbjct  175   LPDDDPRSFTQQADVHCAYCNGAYDQVGFPNLELQIHQSWLFFPFHRYYLYFHERILAKL  234

Query  727   INDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIA  906
             I+DPTF LP+WNWD P GM  P ++   N  SPLYD+ R   H+   ++DL ++G D   
Sbjct  235   IDDPTFALPFWNWDAPAGMQLPALY--ANPDSPLYDELRAASHQPPTLIDLDFNGTDETM  292

Query  907   PDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDP  1086
                 +++ NL IMYRQM++N+  PLLFFG P RA      G G IE  PH  VH W GD 
Sbjct  293   SKDAQIEANLKIMYRQMVSNSKKPLLFFGSPYRAGTEPDPGXGXIEXTPHGPVHXWTGDN  352

Query  1087  RSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDET  1266
                N EDMGNFYS A DP+F+  H N DRMW IWK++G K  DI DKDWLDT FLF+DE 
Sbjct  353   TQPNXEDMGNFYSXARDPIFFXHHXNXDRMWNIWKSIGTKNXDINDKDWLDTGFLFYDEN  412

Query  1267  KTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT--------------VKLSITES  1404
                V+V VRD LDN+KLGYT++D+ IPW   +PT +RT               + + +  
Sbjct  413   AELVRVTVRDTLDNKKLGYTYEDVEIPWLXSRPTPRRTKLARKAKAAGVAKAAETTSSGK  472

Query  1405  VPASTDVLPAPLSKNLTFYVTRSTSVPETQEE-------MLNLDLVYDDTKFIRFDVFLN  1563
             V A  D  P  L   +   V+R      +++E       ++   +  D    ++FDV++N
Sbjct  473   VVAGKD-FPINLETKIXTVVSRPKPKKRSKKEKEDEEEILVIXGIELDKDVAVKFDVYVN  531

Query  1564  --EDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVL  1737
               +DED      D++E+AGSF ++PH  +  S     +   L +++L++DL  E D+ V+
Sbjct  532   DVDDEDAAPSGPDKSEFAGSFVSVPHKQKEKS----KSCLRLGLTDLLEDLGAEDDESVV  587

Query  1738  VTLVPKVGGSFVTVNNAYINTL  1803
             VTLVP+ G   V + +  I  L
Sbjct  588   VTLVPRYGAQAVKIGSIKIEFL  609



>gb|AEY78528.1| polyphenol oxidase [Canarium album]
Length=606

 Score =   449 bits (1156),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 247/521 (47%), Positives = 324/521 (62%), Gaps = 32/521 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKI-PSFSKLNVRP  489
             S+PFA+A PV  PD+A CG A +   + +    CCPP +   K+  +K+ PS + L +RP
Sbjct  94    SDPFAVAAPVSAPDLAKCGKANLPAGAKQT--NCCPPTS--KKILGFKLHPSNAPLRIRP  149

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH VD AY+ KY  AI+ MK LP+DDPR F QQANVHCAYC+GAY   G P    Q+H 
Sbjct  150   AAHLVDDAYIAKYSRAIELMKALPADDPRGFMQQANVHCAYCDGAYDQIGFPNLELQVHN  209

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFPFHR+YLYF+E+I+  +I DPTF LP+WNWD+PPGM  P ++   N  SPLYD +
Sbjct  210   SWLFFPFHRYYLYFYEKILGKLIEDPTFALPFWNWDSPPGMQMPAMY--ANPKSPLYDNF  267

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             RN  H+   ++DL Y+  D    +  ++ +NL IMYRQM++N     LFFG   RA +  
Sbjct  268   RNASHQPPTLVDLDYNRTDETTTNKDQLSSNLKIMYRQMVSNGKTAKLFFGNAYRAGDEP  327

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G+G+IENIPH  VH W GD    N EDMGNFYSAA DP+FYS HSN+DRMWTIWKTLG
Sbjct  328   DPGLGSIENIPHGPVHLWCGDKTQPNLEDMGNFYSAARDPIFYSHHSNIDRMWTIWKTLG  387

Query  1201  G-KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RK  1374
             G KR +  D DWLD  FLF+DE    V+VKVRDCLDN+KLGY +Q + IPW + KPT RK
Sbjct  388   GKKRKEFTDPDWLDAGFLFYDENANLVRVKVRDCLDNKKLGYDYQKVDIPWLNTKPTPRK  447

Query  1375  RTV-KLSITESVPASTDVLPAPLSKNLTFYV----TRSTSVPETQEEMLNLD-------L  1518
             R V K+  T  V  + +     L+    F +    T ST VP  ++     +       L
Sbjct  448   RIVNKVRSTFGVAHAAETRRIQLTARSQFPLVLDKTMSTLVPRPKKSRSKKEKEEEEEVL  507

Query  1519  VYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNL  1683
             V +   F     ++FDV++N++ DV +   D TE+AGSF N+PH H+        T   L
Sbjct  508   VIEGIDFERDAQVKFDVYINDEHDVPSGP-DDTEFAGSFVNVPHKHK--HGKKIKTCLRL  564

Query  1684  AISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
              +++LI+DL+ E DD V+VTLVP+ G     +    I   D
Sbjct  565   GLTDLIEDLEAEDDDSVVVTLVPRYGKGLARIGGIKIEFYD  605



>ref|XP_008224999.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   448 bits (1153),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 259/557 (46%), Positives = 342/557 (61%), Gaps = 33/557 (6%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             ++RC A++ G D     LS+  LDRRN+L+GLG      + G   +NPFA A PV  P+ 
Sbjct  48    RVRCKATNGGDDHLQQGLSR--LDRRNMLIGLGAGGLYGSTGLE-NNPFAFAAPVSAPEF  104

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV--DAAYLEKYK  531
               CGPA     S      CCPP T TT +++ K+P    L  R AA  V  D  YL KYK
Sbjct  105   TKCGPADKPDGST---IDCCPP-TATTIIDF-KLPDKGPLRTRLAAQNVAKDPVYLAKYK  159

Query  532   TAIQKMKDLPSDDPRNFYQQANVHCAYCNGAY---LLNGNPYQIHFNWFFFPFHRWYLYF  702
              AI  M+ LP DDPR+F QQA VHC+YC+G Y     +    Q+HF W F+PFHRWYLYF
Sbjct  160   KAIALMRALPDDDPRSFAQQAKVHCSYCDGGYPQVEYSDLEIQVHFCWLFYPFHRWYLYF  219

Query  703   FERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLA  882
             FE+IM  +I DPTF LP+WNWD P GM  P IF D    S LYDQYRN  H+   +LDL 
Sbjct  220   FEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDTT--SSLYDQYRNAAHQPPKLLDLN  277

Query  883   YSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNS  1062
             Y G D    D T++K NL  MY+QM++ A    LF+G+P  A +  + G G IE+IPHN+
Sbjct  278   YGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDDPNPGAGNIESIPHNN  337

Query  1063  VHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKT-LGGKRTDIADKDWLD  1239
             +H W GD    N EDMG FYSA  DP+FY+ HSNVDRMW+I+K+ LGG  TDI  KD+LD
Sbjct  338   IHLWTGDTTQTNGEDMGAFYSAGRDPLFYAHHSNVDRMWSIYKSKLGG--TDIEKKDYLD  395

Query  1240  TEFLFFDETKTAVKVKVRDCLDNEKLGYTFQD-MPIPWKDFKPT-RKRTVKLSITESVPA  1413
              EFLF+DE K  V+VKVRD LD  KLGY + + + IPW  +KPT RK + K   T S   
Sbjct  396   AEFLFYDEKKNLVRVKVRDSLDTTKLGYVYDNKVEIPWLTYKPTARKSSNKRKATVSSAD  455

Query  1414  STDVLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-YDDTKFIRFDVFLNEDE  1572
              T   PAPL+  ++  V R+++   T      Q+E+L +  + Y   + ++FDV++N+D 
Sbjct  456   LTTNFPAPLTDTISVEVARTSTTKRTSAQKKAQDEVLVISGIKYAGNETVKFDVYVNDDA  515

Query  1573  DVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVP  1752
             + +    D++E+AGSF  +PH  +       TTT  L+I++L+++LD E D  V+VTLVP
Sbjct  516   E-SLAGKDKSEFAGSFIQVPHKGK----KDITTTLRLSITKLLEELDAETDSSVVVTLVP  570

Query  1753  KVGG-SFVTVNNAYINT  1800
             KVG  +   V+   INT
Sbjct  571   KVGTITIGGVSTELINT  587



>ref|XP_002316852.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
 gb|EEE97464.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
Length=563

 Score =   447 bits (1150),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 238/493 (48%), Positives = 314/493 (64%), Gaps = 30/493 (6%)
 Frame = +1

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPS-FSKLNVRPAAHA  501
             A A P+  PD+  C    +   + + P  CC P+    K+  ++ PS FS L  R AAH 
Sbjct  65    AFAKPITPPDLTKC--ELVDLPNPENPSNCCTPLP--KKIIDFRPPSPFSPLRTRRAAHL  120

Query  502   VDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFF  672
             VD  Y+ KY  AI  MK LP DDPRNFYQQANVHCAYCNGAY   G P     +H  WFF
Sbjct  121   VDEDYVAKYAEAISLMKSLPEDDPRNFYQQANVHCAYCNGAYEQVGFPKLEIDVHSCWFF  180

Query  673   FPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQD  852
             FP+HR+YLYF+ERI+  +INDPTF LP+WNWD+P GM  P IF D    SPLYDQ+R+Q+
Sbjct  181   FPWHRYYLYFYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTDPK--SPLYDQFRDQN  238

Query  853   HRYGHVLDLAYSGDDIIAPDPTKV----KNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             H+   +LDL Y       P+PT       +NL +MY+QM++ A  P LFFGK  RA    
Sbjct  239   HQPPILLDLDYGAG---YPNPTNANQLYSSNLTVMYKQMVSGAAKPTLFFGKSYRAGEDT  295

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-  1197
             S G GTIE  PHN++HRW GDP   N+EDMGNFYSAA DP+F+  HSNVDRMWTIWKT+ 
Sbjct  296   SPGAGTIETTPHNNIHRWTGDPTQENNEDMGNFYSAARDPIFFCHHSNVDRMWTIWKTIP  355

Query  1198  GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RK  1374
             GG R DI+D DWL++EFLF++E    V+ KV DCLDN  L YT+Q++ IPW + KP  R+
Sbjct  356   GGTRRDISDPDWLNSEFLFYNENAELVRCKVSDCLDNTGLRYTYQNVEIPWLESKPIPRR  415

Query  1375  RTVKLSITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTK  1536
                K + T++        P  L K +   V     +RS    E ++E+L ++ + YD  K
Sbjct  416   LGKKAAETKTALTPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDKGK  475

Query  1537  FIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDL  1716
             F++FDVF+N+D ++ + + + TE+AGSF N+ H H    A    T   L I+EL++DL+ 
Sbjct  476   FVKFDVFINDDVEMPS-KPENTEFAGSFVNVSHKH----AKKSKTRLILGITELLEDLES  530

Query  1717  EGDDKVLVTLVPK  1755
             +GDD ++V LVP+
Sbjct  531   DGDDSIVVALVPR  543



>dbj|BAM15848.1| hypothetical protein [Portulaca oleracea]
Length=600

 Score =   448 bits (1153),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 252/577 (44%), Positives = 348/577 (60%), Gaps = 36/577 (6%)
 Frame = +1

Query  148   SRAARRGDAVKIRCAASSEGRDENP------DSLSKAKLDRRNVllglgglygaynlgag  309
             SR   R  + KI C A+ +  DENP       +++  KLDRRN+L+GLGGLYGA      
Sbjct  28    SRCQTRHASPKISCKAT-KNDDENPRKIHEDKTIANKKLDRRNMLIGLGGLYGAATALG-  85

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRP  489
              S+P  LA P+  P++A CGPA +     +  + CCPP+     +++   P+ + L VRP
Sbjct  86    -SDPTTLAAPITAPNIAQCGPADLP-QDAQGDHNCCPPVAQNI-IDFTLPPTPATLKVRP  142

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH+VD  YL+K+  AI  MK LP  DPR+F QQA VHCAYC+G Y   G P    Q+H 
Sbjct  143   AAHSVDNEYLQKFNRAISLMKALPDTDPRSFSQQAKVHCAYCDGGYNQVGFPNLDLQVHG  202

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W F PFHR YLYFFERI+ ++INDPTF +P+WNWDNP GM  P I+ D N  SPLYD  
Sbjct  203   SWLFLPFHRCYLYFFERILGNLINDPTFAMPFWNWDNPAGMQMPAIYADRN--SPLYDSE  260

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             R+  H+   ++DL + G+D           NL +MYRQM++NA    LF G+P +A  + 
Sbjct  261   RDGPHQPPTLVDLNFDGEDTDMSTDDLTTANLTVMYRQMVSNAKTARLFLGQPYKAGGSP  320

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G++EN+PH  VH W GD    N EDMGNFYSAA DP+FY+ HSN+DRMW+IWKTLG
Sbjct  321   RGG-GSLENVPHGPVHIWTGDRNQPNTEDMGNFYSAARDPIFYAHHSNIDRMWSIWKTLG  379

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT  1380
               R +  D DWLD  F+F+DE   AVK++VRDCLD +KLGYT+QD+ +PW + +PT KR+
Sbjct  380   ANRVEFTDSDWLDASFVFYDENAQAVKIRVRDCLDTKKLGYTYQDVDLPWLNSQPTPKRS  439

Query  1381  --------VKLSITESVPASTDV----LPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVY  1524
                     +K +   + P ST       P PL   L   + R       +E+ L  +++ 
Sbjct  440   RIATLFSKLKPAKATTHPPSTSTSPVKFPKPLDSTLKIDIQRPKKSRSKKEKKLQEEVLV  499

Query  1525  DDTK-----FIRFDVFLNEDEDVNTVE-LDRTEYAGSFGNLP-HVHEGGSATPKTTTFNL  1683
              + +     F++FDV++N+++DV   + + +TEYAGSF N+P             TT  L
Sbjct  500   VEVELQSDVFVKFDVYVNDEDDVPLKKTIVKTEYAGSFANVPHKHKHKKEHRKMKTTLRL  559

Query  1684  AISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
              +++LI+DL  + DD V+VTLVP+ G     + +  I
Sbjct  560   GLTDLIEDLGADDDDGVMVTLVPRSGKEVTIIKDVKI  596



>ref|XP_008346980.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   446 bits (1148),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 239/523 (46%), Positives = 319/523 (61%), Gaps = 37/523 (7%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             S+PFA+A PV  PD+A CG A   F S  VP  CCPP +   K+  +K PS +KL VRPA
Sbjct  30    SDPFAVAKPVXPPDLAKCGAA--DFPSGAVPINCCPPTS--QKIVDFKFPSPTKLRVRPA  85

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH VD AY+EKY  AI+ MK LP DDPR+F QQA++HCAYC+GAY   G P    QIH  
Sbjct  86    AHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIHQC  145

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W FFPFHR+Y YF ERI+  +I+DPTF LP+WNWD P GM  P +F   N  SPLYD+ R
Sbjct  146   WLFFPFHRYYXYFXERILAKLIDDPTFALPFWNWDAPAGMQLPALF--ANPDSPLYDELR  203

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
                H+   ++DL ++G D    +  +++ NL IMYRQM++N+  PLLFFG P RA     
Sbjct  204   AASHQPPTLIDLDFNGTDETMSNDAQIEANLKIMYRQMVSNSKKPLLFFGSPYRAGTEPD  263

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
              G G+IE  PH  VH W GD    N EDMGNFYSA  DP+F+S HSN+DRMW IWK++G 
Sbjct  264   PGGGSIETTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNIDRMWNIWKSIGT  323

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT-  1380
             K  DI DKDWLDT FLF+DE    V+V VRD LDN+KLGYT++D+ IPW   +PT +RT 
Sbjct  324   KNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPTPRRTK  383

Query  1381  -------------VKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE-------  1500
                           + + +  V A  D  P  L   ++  V+R      +++E       
Sbjct  384   LARKAKAAGVAKAXETTSSGKVVAGKD-FPINLETKISTVVSRPKPKKRSKKEKEDEEEI  442

Query  1501  MLNLDLVYDDTKFIRFDVFLN--EDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT  1674
             ++   +  D    ++FDV++N  +DED      D++E+AGSF ++PH  +  S     + 
Sbjct  443   LVIQGIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQKEKS----KSC  498

Query  1675  FNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
               L +++L++DL  E D+ V+VTLVP+ G   V + +  I  L
Sbjct  499   LRLGLTDLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEFL  541



>gb|AES87890.2| polyphenoloxidase [Medicago truncatula]
Length=606

 Score =   448 bits (1153),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 244/532 (46%), Positives = 325/532 (61%), Gaps = 52/532 (10%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             +NPFALA P+  PD++ C  + IS  S  +   CCPP   +TK+  YK P  ++ L VR 
Sbjct  85    TNPFALASPISPPDLSKCRSSHIS--SGAIDIDCCPP--KSTKIIDYKFPPLTQPLRVRQ  140

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH V+  YL+KYK AI+ MK LPS+DPR+F QQANVHCAYC+GAY   G P    Q+H 
Sbjct  141   AAHLVNDEYLQKYKKAIELMKALPSNDPRSFMQQANVHCAYCDGAYSQVGFPNLDLQVHG  200

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFPFHRWYLYF+ERI+ S+INDPTF LP+WN+D P GM FP I+ D    SPLYD+ 
Sbjct  201   SWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMRFPSIYTDPT--SPLYDKL  258

Query  841   RNQDHR--------YGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGK  996
             RN  H+        YGH  D+   G++ I      +  NL IMYRQ+++      LF G 
Sbjct  259   RNAKHQPPTLIDFNYGHCDDIDEDGENNI------IHTNLTIMYRQVVSRGKNSRLFLGY  312

Query  997   PLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRM  1176
             P RA        G++E +PHN+VH W GD R  NHE+MG FYSAA DPVF+S HSN+DR+
Sbjct  313   PYRAGGVPKCA-GSVEIVPHNTVHNWSGDTRQPNHENMGTFYSAARDPVFFSHHSNIDRL  371

Query  1177  WTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKD  1356
             W+IWKTLGGKR D  DKDWL++EFLF+DE K  VKV V+DCLD +KLGY +QD+ IPW +
Sbjct  372   WSIWKTLGGKRKDFYDKDWLESEFLFYDENKNLVKVNVKDCLDTQKLGYVYQDVFIPWLN  431

Query  1357  FKPTRKRTV-----------------KLS-ITESVPASTDVLPAPLS-KNLTFYVTR--S  1473
              KPT  + +                 +LS I E++  S + +  PL   N+   + R   
Sbjct  432   AKPTPCKKIQKKVEVAQGNSFGTGKARLSEINENLTNSRNDVKFPLVLDNIVSTIVRRPK  491

Query  1474  TSVPETQEEMLNLDLVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHV  1638
              S  +T++E     LV +  +F     ++FDVF+N DED   ++   TE+AGSF N+PH 
Sbjct  492   KSRSKTEKEEEEEVLVIEGIEFDKSLGVKFDVFIN-DEDAKEIKPVNTEFAGSFVNVPHS  550

Query  1639  HEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
                       +   + +++L+KDL  E DD ++VTLVP+     V + N  I
Sbjct  551   SHDHKKKKTNSCLRVGLTDLLKDLGAEDDDSIVVTLVPRYRKGLVKITNIKI  602



>ref|XP_008371330.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
Length=587

 Score =   447 bits (1151),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 258/567 (46%), Positives = 338/567 (60%), Gaps = 35/567 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R  ++  A ++RC A+ +G ++N D    A+LDRRN+L+GLG             N FA 
Sbjct  39    RKPKQCLAGRVRCKAT-KGDNDNLDQ-GLARLDRRNMLIGLGTGGLYSAA----GNSFAF  92

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH--AV  504
             A PV  PD+  CGPA     S      CCPPIT  T +  +K+P    L  R AA   A 
Sbjct  93    AAPVSAPDLTTCGPADKPDGST---IDCCPPIT--TTIIDFKLPDRGPLRTRIAAQDVAK  147

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             + AYL KYK AI+ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+HF W FF
Sbjct  148   NPAYLAKYKKAIELMRALPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFF  207

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+E+IM  +I DPTF LP+WNWD P GM  P IF + +  S LYDQ RN  H
Sbjct  208   PFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTBTS--SSLYDQNRNTAH  265

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   +LDL Y G D    D T++K NL  MY+QM++ A    LF+G+P  A +    G G
Sbjct  266   QPPKLLDLNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDEPDPGAG  325

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-TLGGKRT  1212
              IE  PHN++H WVGDP   N EDMG FYSA  DP+ YS HSNVDRMW+I+K  LGG  T
Sbjct  326   NIETTPHNNIHLWVGDPTQTNGEDMGTFYSAGRDPLXYSHHSNVDRMWSIYKDKLGG--T  383

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTF-QDMPIPWKDFKPT-RKRTVK  1386
             DI   DWLD EFLF+DE K  V+VKVRD LD +KLGY + + +PIPW   KPT RK T K
Sbjct  384   DIEXTDWLDAEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTARKSTNK  443

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPET--QEEMLNLDLVYDDTKF-----IR  1545
                T S    T   PA LS  ++  VTR ++   T  Q++  +  LV    +F     ++
Sbjct  444   RKATVSSSDLTTTFPATLSDTISVEVTRPSATKRTAAQKKAXDEVLVIKGIEFAGNEPVK  503

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDV++N+D + +    D++E+AGSF ++PH H+        T   L+I  L+++LD E D
Sbjct  504   FDVYVNDDAE-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSIMSLLEELDAETD  558

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTLD  1806
               ++VTLVPKVG   +T+    I  ++
Sbjct  559   SSLVVTLVPKVGKGPITIGGFSIELIN  585



>gb|AAP33165.1| polyphenol oxidase [Medicago sativa]
Length=607

 Score =   448 bits (1152),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 235/524 (45%), Positives = 319/524 (61%), Gaps = 31/524 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             +NPFALA P+  PD++ CGP  +   +      CCPP  ++TK+  YKIPS ++ L VR 
Sbjct  89    TNPFALASPISPPDLSTCGPPDLPLGATPNNINCCPP--NSTKIINYKIPSSNQPLRVRQ  146

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH V+  YL+KYK A++ MK LPS DPR+F QQAN+HCAYC+GAY   G P    Q+H 
Sbjct  147   AAHLVNDEYLQKYKKALELMKALPSSDPRSFVQQANIHCAYCDGAYSQVGFPNLDLQVHN  206

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFPFHRWYLYF+ERI+ S+INDPTF LP+WN+D+P GM  P I+ D    SPLYD+ 
Sbjct  207   SWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDSPNGMQLPSIYADST--SPLYDKL  264

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             R   H+   ++DL Y   D+      ++ +NL  MYRQM++N     LF G   RA +  
Sbjct  265   RTASHQPPTLIDLNYDDVDVDDDANGRISSNLTTMYRQMVSNGKTSSLFLGSSYRAGDEP  324

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G+IEN+PH  VHRW GD    N E+MG FY+AA DP+F+S HSN+DR W+IWKTLG
Sbjct  325   DPGAGSIENVPHGPVHRWSGDNTQPNFENMGVFYAAARDPIFFSHHSNIDRFWSIWKTLG  384

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDF--KPTRK  1374
             GKR D  DKDWL++EFLF+DE K  VKVKV+DCLD +KLGY +QD+ IPW +   KP RK
Sbjct  385   GKRKDFKDKDWLESEFLFYDENKNLVKVKVKDCLDTKKLGYVYQDVDIPWLNAKPKPCRK  444

Query  1375  RTVK---------LSITESVPASTD-----VLPAPLSKNLTFYVTRSTSVPETQEEMLNL  1512
                K           I E+  +  +       P  L   ++  V R       +E+    
Sbjct  445   NIQKNVEVAQGNFFGIGEARASEINSRSYVTCPLVLDNVVSTIVKRPKKSRSKKEKEEEE  504

Query  1513  DLV------YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT  1674
             +++      +D +  ++FDVF+N DED   ++   TE+AGSF N+PH           + 
Sbjct  505   EVLVIEGIEFDKSLGVKFDVFIN-DEDDKVIKPINTEFAGSFVNVPHSSHDHKKKKTNSC  563

Query  1675  FNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
               + +++L++DL  E DD ++VTLVP+ G   V + N  I   D
Sbjct  564   LRVGLTDLLEDLGAEDDDSIVVTLVPRYGKGIVKIRNIKIELED  607



>ref|XP_008364152.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08583.1| polyphenol oxidase IVa [Malus domestica]
Length=587

 Score =   447 bits (1150),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 258/567 (46%), Positives = 338/567 (60%), Gaps = 35/567 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R  ++  A ++RC A+ +G ++N D    A+LDRRN+L+GLG             N FA 
Sbjct  39    RKPKQCLAGRVRCKAT-KGDNDNLDQ-GLARLDRRNMLIGLGTGGLYSAA----GNSFAF  92

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH--AV  504
             A PV  PD+  CGPA     S      CCPPIT  T +  +K+P    L  R AA   A 
Sbjct  93    AAPVSAPDLTTCGPADKPDGST---IDCCPPIT--TTIIDFKLPDRGPLRTRIAAQDVAK  147

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             + AYL KYK AI+ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+HF W FF
Sbjct  148   NPAYLAKYKKAIELMRALPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFF  207

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+E+IM  +I DPTF LP+WNWD P GM  P IF + +  S LYDQ RN  H
Sbjct  208   PFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTBTS--SSLYDQNRNTAH  265

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   +LDL Y G D    D T++K NL  MY+QM++ A    LF+G+P  A +    G G
Sbjct  266   QPPKLLDLNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDEPDPGAG  325

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-TLGGKRT  1212
              IE  PHN++H WVGDP   N EDMG FYSA  DP+FYS HSNVDRMW+I+K  LGG  T
Sbjct  326   NIETTPHNNIHLWVGDPTQTNGEDMGTFYSAGRDPLFYSHHSNVDRMWSIYKDKLGG--T  383

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTF-QDMPIPWKDFKPT-RKRTVK  1386
             DI   DWLD  FLF+DE K  V+VKVRD LD +KLGY + + +PIPW   KPT RK T K
Sbjct  384   DIEXTDWLDAXFLFYDEKKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTARKSTNK  443

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPET--QEEMLNLDLVYDDTKF-----IR  1545
                T S    T   PA LS  ++  VTR ++   T  Q++  +  LV    +F     ++
Sbjct  444   RKATVSSSDLTTTFPATLSDTISVEVTRPSATKRTAAQKKAXDEVLVIKGIEFAGNEPVK  503

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDV++N+D + +    D++E+AGSF ++PH H+        T   L+I  L+++LD E D
Sbjct  504   FDVYVNDDAE-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSIMSLLEELDAETD  558

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTLD  1806
               ++VTLVPKVG   +T+    I  ++
Sbjct  559   XSLVVTLVPKVGKGPITIGGFSIELIN  585



>gb|KDP20931.1| hypothetical protein JCGZ_21402 [Jatropha curcas]
Length=592

 Score =   447 bits (1149),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 231/519 (45%), Positives = 327/519 (63%), Gaps = 42/519 (8%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             ++P ALA PV  PD+  CG A +  ++  +P  CCPP   +TK+  +K+PS +  L +RP
Sbjct  78    NDPSALAKPVAAPDLTKCGKADLPANA--LPTNCCPP--PSTKILDFKLPSSNNPLRIRP  133

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH  D AY+ KY  AI+ MK LP DDPR+F QQA+VHCAYC+GAY   G P    QIH 
Sbjct  134   AAHLADDAYVAKYSKAIELMKALPDDDPRSFKQQASVHCAYCDGAYHQVGFPDLDLQIHN  193

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFPFHR+YLYF+E+I+  +I+DP F LP+WNWD+P GM  P +F      S LYDQY
Sbjct  194   SWLFFPFHRYYLYFYEKILGKLIDDPNFALPFWNWDSPAGMQIPKMFVSPK--SALYDQY  251

Query  841   RNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             R++ H+   ++DL YSG +    +  ++ +NL IMYRQM++N     LFFG   R+ +  
Sbjct  252   RHKSHQPPTLIDLDYSGTESSYSNQEQLSSNLTIMYRQMVSNGKTAKLFFGNAYRSGDEP  311

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G+IENIPH  VH W GD    N EDMGNFYSA  DP+F++ H+NVDRMWT+WKTLG
Sbjct  312   DPGAGSIENIPHGPVHLWTGDSTQPNKEDMGNFYSAGRDPIFFAHHANVDRMWTLWKTLG  371

Query  1201  G-KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR  1377
             G KRT+I D DWL+ EFLF+DE    V+VKV+D +D +KLGY +QD+ +PW   KPT ++
Sbjct  372   GSKRTEITDTDWLNAEFLFYDENANLVRVKVKDSIDYKKLGYGYQDVEVPWLKSKPTPRK  431

Query  1378  TVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNL---------------  1512
              +K  I +++    +   A  ++NL    T  +S P   E++  +               
Sbjct  432   VIK-KIVKALHHGQEAKAAENNQNL----TPISSFPLVLEKVTRVLVKRPKKSRSKKEKE  486

Query  1513  ----DLVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK  1665
                  L+ D  +F     ++FDV++N+++D  + + D++E+AGSF ++PH H  G  T  
Sbjct  487   EEEEVLLVDGIEFARESAVKFDVYINDEDDSTSTKPDKSEFAGSFVSVPHTHSHG--TKM  544

Query  1666  TTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVN  1782
              T   L +++L++DL  E DD+VLVTLVP+ G   V ++
Sbjct  545   KTCLRLGLTDLLEDLGAEDDDEVLVTLVPRYGIGLVKID  583



>ref|XP_010039984.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45576.1| hypothetical protein EUGRSUZ_L00689 [Eucalyptus grandis]
Length=595

 Score =   447 bits (1149),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 264/563 (47%), Positives = 349/563 (62%), Gaps = 43/563 (8%)
 Frame = +1

Query  181   IRCAA-SSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             I C A S++  ++NP S+   KLDRRN L+GLGG YGA  L    S+PFALADP+ + D 
Sbjct  55    ISCKALSNDDSEQNPMSV---KLDRRNALIGLGGFYGAVGLR---SDPFALADPISVLDF  108

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP-SFSKLNVRPAAHAVDAAYLEKYKT  534
               CG        C      CPP   TTKV  +K+P S S   VRPAAH  D  Y+ KY  
Sbjct  109   TQCGKVKPCVKDC------CPP--PTTKVLDFKLPPSNSPTRVRPAAHLADKDYIAKYAE  160

Query  535   AIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFF  705
             A + MK LP+DDPR+F QQANVHCAYC+G Y   G P    Q+H +W FFPFHR+YLYF+
Sbjct  161   ATKLMKALPADDPRSFMQQANVHCAYCDGYYHQVGFPNLELQVHDSWLFFPFHRYYLYFY  220

Query  706   ERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY  885
             E+I+ ++I DPTF LPYWNWD P GM  P +F D    SPLYD  RN +H    ++DL Y
Sbjct  221   EKILGNLIGDPTFALPYWNWDAPDGMKMPAMFTDPQ--SPLYDANRNPEHAQPTLVDLNY  278

Query  886   SGDDIIAPDPTKVK-NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNS  1062
                +   P P+ ++ NNLAIMYRQ+++      LF G   RA +  S G G+IEN+PHN+
Sbjct  279   ---NCKHPPPSDLESNNLAIMYRQIVSCGKTAKLFLGHAYRAGDQASPGRGSIENMPHNT  335

Query  1063  VHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG-KRTDIADKDWLD  1239
             VH W GD R    EDMG FYSA  DP+F++ HSNVDRMWT+WKTLGG KRTD  D DWL+
Sbjct  336   VHDWCGDYRQPKREDMGIFYSAGRDPLFFAHHSNVDRMWTLWKTLGGRKRTDFTDPDWLN  395

Query  1240  TEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RKRTVKLSITE-----  1401
               FLF+DE   A++VKV+DCL+   LGY +QD+ IPW+++KP  RK+  KL  +      
Sbjct  396   ATFLFYDENAQAMRVKVKDCLETSNLGYKYQDVDIPWRNYKPVPRKKAKKLPKSSGKIAD  455

Query  1402  --SVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVF  1557
                +P      P  L K ++ +V      RS    E +EE+L ++ +  +   F++FDV 
Sbjct  456   VAGIPRHIVHFPVKLDKVVSTWVKRPKQKRSKKEKEEEEEVLAIEGIELESDAFVKFDVH  515

Query  1558  LNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVL  1737
             +N+ +D +    D+TE+AGSF N+PH H+ G      T   L I++L++DL  E D+KVL
Sbjct  516   INDKQD-SLSSPDKTEFAGSFVNVPHKHKPGKKM--KTKLTLGITDLLEDLMREEDEKVL  572

Query  1738  VTLVPKVGGSFVTVNNAYINTLD  1806
             VTL P+ GG  V ++N  I  +D
Sbjct  573   VTLAPRCGGEDVIISNIKIEFVD  595



>ref|XP_011096441.1| PREDICTED: aureusidin synthase-like [Sesamum indicum]
Length=585

 Score =   446 bits (1147),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 261/561 (47%), Positives = 349/561 (62%), Gaps = 33/561 (6%)
 Frame = +1

Query  184   RC-AASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVA  360
             RC   S +  D + +S +  K DRRNVL+GLGGLYGA  L    ++PF+ A P+  PD+ 
Sbjct  38    RCPKVSCKSPDNDQESAAPGKFDRRNVLIGLGGLYGATTLA---ASPFSFAAPISAPDIT  94

Query  361   NCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLEKYKTA  537
              CGPA +   +   P  CCPP   T K+  +K P  S  + VRPAAH  D AY+ K+  A
Sbjct  95    KCGPADLPPGAA--PTNCCPP--PTAKIIDFKFPPPSTTMRVRPAAHLADEAYIAKFNKA  150

Query  538   IQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFE  708
             ++ M+ LP DDPR+F QQA+VHCAYC+GAY   G P    Q+H +W FFPFHR+YLYFFE
Sbjct  151   VELMRALPEDDPRSFKQQASVHCAYCDGAYDQVGFPNLELQVHNSWLFFPFHRYYLYFFE  210

Query  709   RIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYS  888
             RI+  +I+DPTF +P+WNWD+P GM  P ++ + N  SPLYD  R+Q H+   VLDL YS
Sbjct  211   RILGKLIDDPTFAMPFWNWDSPGGMRIPAMYANPN--SPLYDSLRDQRHQPPTVLDLNYS  268

Query  889   GDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVH  1068
             G D       + + NL +MYRQM++N+    LFFG P R  +  + G G+IENIPH  VH
Sbjct  269   GTDPTISADQQTRRNLTVMYRQMVSNSRTARLFFGSPYRRGDDPNPGSGSIENIPHGPVH  328

Query  1069  RWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEF  1248
              W GD    N E+MGNFYSA  DP+FY+ HSN+DR+W+IWKTLGG+R DI D+D+LD  F
Sbjct  329   VWTGDRNQPNFENMGNFYSAGRDPIFYAHHSNIDRLWSIWKTLGGRRQDITDRDFLDASF  388

Query  1249  LFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAST---  1419
             +F+DE    V+VKVRDCLD+ KLGY +QD+ IPW D +PT + +  L   + +  +    
Sbjct  389   VFYDENAQMVRVKVRDCLDHTKLGYVYQDVEIPWLDSRPTPRVSSVLRKLKKLGKANAAD  448

Query  1420  -----DVLPAPLSKNLTFYVTRSTSVP------ETQEEMLNLDLVYDDTKFIRFDVFLN-  1563
                  DV PA L K L   V R           E +E ++   +  D   + +FDV++N 
Sbjct  449   THSPKDVFPATLDKVLKVMVKRPKKKRSKKEKDELEEILVIEGIELDRDVYAKFDVYIND  508

Query  1564  EDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVT  1743
             ED+++ T E   TE+AGSF N+PH H+ G      T   L+I+E+++DLD + DD VLVT
Sbjct  509   EDDEITTPE--NTEFAGSFVNVPHKHKHGKKI--KTQLRLSITEIMEDLDADDDDHVLVT  564

Query  1744  LVPKVGGSFVTVNNAYINTLD  1806
             LVP   G  VTV+   I   D
Sbjct  565   LVPTNAGDAVTVHGIKIELDD  585



>emb|CDP06093.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   446 bits (1146),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 242/491 (49%), Positives = 318/491 (65%), Gaps = 19/491 (4%)
 Frame = +1

Query  316   NPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLN-VRPA  492
             NPFA+A P+  P+++ CGP         V   CCPP+    KV  YK+P   K+N  RPA
Sbjct  80    NPFAMAAPIAAPEISKCGPPADLPPGAVVTDNCCPPVPG--KVIDYKLPPPPKVNRFRPA  137

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNPYQI--HFNW  666
             AH V   Y+EK   A++ MK LP+DDPRNF QQANVHCAYCNGAY+  G+  +I  H++W
Sbjct  138   AHLVKKDYIEKLNKAVELMKALPADDPRNFTQQANVHCAYCNGAYVQPGSDQEISVHYSW  197

Query  667   FFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRN  846
              FFPFHRWYLYF+ERI+  +I DP+F LP+WNWDN  GMT P IF D  Q S LY++ RN
Sbjct  198   LFFPFHRWYLYFYERILGKLIGDPSFGLPFWNWDNIGGMTIPSIFMD--QSSALYNENRN  255

Query  847   QDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSS  1026
             Q H    V+DL Y+G D  A    +++NNLAIMYRQM++NA     FFGK  RA +  ++
Sbjct  256   QSHLPPTVVDLGYNGTDRDATCTERIENNLAIMYRQMVSNATTGRDFFGKEYRAGDQPNA  315

Query  1027  --GMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G+IE  PH  +HRWVGDPR  N ED+GNFYSA  D +FYS H+NVDRMWTIW+ LG
Sbjct  316   FAGAGSIEASPHIPLHRWVGDPRQPNGEDLGNFYSAGRDVLFYSHHANVDRMWTIWQQLG  375

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RKR  1377
             GKR ++ D DWL++ F+F+DE    V+VKVRD   N+++GY ++ + IPW   KP  R R
Sbjct  376   GKRKEVPDPDWLNSSFIFYDENAQPVRVKVRDSFSNDRMGYIYEKVDIPWLKNKPVPRVR  435

Query  1378  TVKLSITESVPASTDVLPAPLSKNLTFYVTR-STSVPETQEEMLNLDLV-----YDDTKF  1539
               +++ T   P +  V P PL+K +   V R   S  + Q+E     LV     +   K+
Sbjct  436   KSRVAFTSGAPPADKVFPGPLNKIVKVLVKRPKLSRSKRQKEEEEERLVVYGIEFSMDKY  495

Query  1540  IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLE  1719
             ++FDVF+N DED N  +  ++EY GSF NLPH  + G     T TF L  +E+++DLD+E
Sbjct  496   VKFDVFIN-DEDDNPNDFAKSEYVGSFANLPHKVKSGMKAKTTQTFEL--TEILEDLDVE  552

Query  1720  GDDKVLVTLVP  1752
              DD +LVTLVP
Sbjct  553   DDDALLVTLVP  563



>ref|XP_008349252.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   444 bits (1142),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 239/523 (46%), Positives = 316/523 (60%), Gaps = 37/523 (7%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             S+PFA+A PV  PD+A CG A   F S  VP  CCPP +   K+  +K PS +KL VRPA
Sbjct  30    SDPFAVAKPVXPPDLAKCGAA--DFPSGAVPXNCCPPTS--QKIVDFKFPSPTKLRVRPA  85

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH VD AY+EKY  AI+ MK LP DDPR+F QQA++HCAYC+GAY   G P    QIH  
Sbjct  86    AHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIHQC  145

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W FFPFHR+Y YF ERI+  +I+DPTF LP+WNWD P GM  P +F   N  SPLYD+ R
Sbjct  146   WLFFPFHRYYXYFXERILAKLIDDPTFALPFWNWDAPAGMQLPALF--ANPDSPLYDELR  203

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
                H+   ++DL ++G D       ++  NL IMYRQM++N+  PLLFFG P RA     
Sbjct  204   AASHQPPTLIDLDFNGTDETMSXDAQIXANLKIMYRQMVSNSKKPLLFFGSPYRAXTEPD  263

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
              G G+IE  PH  VH W GD    N EDMGNFYSA  DP+F+S HSN+DRMW IWK++G 
Sbjct  264   PGXGSIETTPHGPVHXWTGDNTQPNFEDMGNFYSAXRDPIFFSHHSNIDRMWNIWKSIGT  323

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT-  1380
             K  DI DKDWLDT FLF+DE    V+V VRD LDN+KLGYT++D+ IPW   +PT +RT 
Sbjct  324   KNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLXSRPTPRRTK  383

Query  1381  -------------VKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE-------  1500
                           + + +  V A  D  P  L   +   V+R      +++E       
Sbjct  384   LARKAKAAGVAKAXETTSSGKVVAGKD-FPINLETKIXTVVSRPKPKKRSKKEKEDEEEI  442

Query  1501  MLNLDLVYDDTKFIRFDVFLN--EDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT  1674
             ++   +  D    ++FDV++N  +DED      D++E+AGSF ++PH  +  S     + 
Sbjct  443   LVIXGIELDKDVAVKFDVYVNDVDDEDAAPSGPDKSEFAGSFVSVPHKQKEKS----KSC  498

Query  1675  FNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
               L +++L++DL  E D+ V+VTLVP+ G   V + +  I  L
Sbjct  499   LRLGLTDLLEDLGAEDDESVVVTLVPRYGAQAVKIGSIKIEFL  541



>gb|ACR61399.1| polyphenol oxidase [Solanum melongena]
Length=546

 Score =   444 bits (1142),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 249/549 (45%), Positives = 333/549 (61%), Gaps = 41/549 (7%)
 Frame = +1

Query  139   PNPSRA---ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             P PS+     +R    K+ C  S+   D+N + + K  +DRRNVLLGLGG+YGA N    
Sbjct  11    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQNQNEVEKNSVDRRNVLLGLGGMYGAANFAPL  70

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPI-TDTTKVEYYKIPSFSKLNVR  486
              ++      P    D+++C  A I+ +  +V Y CC P   D  K+ YYK PS +KL +R
Sbjct  71    AASAAPTPPP----DLSSCSIAKITETE-EVSYSCCAPTPDDLNKIPYYKFPSMTKLRIR  125

Query  487   PAAHAVDAAYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYLLNGNPYQIH  657
               AHA D  Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY +     Q+H
Sbjct  126   QPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQVH  185

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWD+P GM  P +FD E   + LYDQ
Sbjct  186   NSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDGEG--TALYDQ  243

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGK-------  996
              RNQ HR G V+DL   GD++   +   + NNL +MYRQ    APCP +F  +       
Sbjct  244   VRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQWYY-APCPRMFLARLTFLGIT  302

Query  997   -----PLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHS  1161
                  PL++  T  S  G ++      +     + R+++ E+MG+FYSA  DPVF+  HS
Sbjct  303   LKPQEPLKSSLTVLSTFGLVQCQVQPCL-----NGRTSHGENMGHFYSAGLDPVFFCHHS  357

Query  1162  NVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMP  1341
             NVDRMW+ WK +GGKR DI+ KDWL++EF F+DE     +VKVRDCLD +K+GY +  MP
Sbjct  358   NVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMP  417

Query  1342  IPWKDFKPTRKRTVKLSITESVPASTDVLP-APLSKNLTFYVTRSTSV-----PETQEEM  1503
              PW++FKP  K +V    T S+P  + V P A L K ++F + R  S         QEEM
Sbjct  418   RPWRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEM  477

Query  1504  LNL-DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTT  1674
             L   ++ YD+  ++RFDVFLN D +VN  ELD+ E+AGS+ NLPHVH  G  T    T T
Sbjct  478   LTFNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDHVATAT  537

Query  1675  FNLAISELI  1701
               LAI+EL+
Sbjct  538   LQLAITELL  546



>ref|XP_008371334.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08582.1| polyphenol oxidase IIb [Malus domestica]
Length=600

 Score =   446 bits (1146),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 262/556 (47%), Positives = 331/556 (60%), Gaps = 30/556 (5%)
 Frame = +1

Query  181   IRCAASSEGRDE---NPDSLSK--AKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
             I C A++   +E    P+  S    KLDRRNVL+GLGGLYGA  L      P A A P+ 
Sbjct  53    ISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLIGLGGLYGATTLA---QKPLAFATPLA  109

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEK  525
              PD+  C  A I+     V   CCPP++  TK++ +       L  RPAAH V   YL K
Sbjct  110   PPDLTKCTLAEITTGGETVA--CCPPVS--TKIKTFTXDQSIPLRTRPAAHLVTDEYLAK  165

Query  526   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYL  696
             +K A   M+ LP DDPR+  QQA VHCAYCNGAY   G P    Q+HF+W FFPFHR YL
Sbjct  166   FKKAQALMRALPEDDPRSMVQQAKVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHRMYL  225

Query  697   YFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLD  876
             YF+ERI+  +I+DPTF LPYWNWD+P G   P I+ D    SPLYDQYR+  H+   ++D
Sbjct  226   YFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTT--SPLYDQYRHAGHQPPVLVD  283

Query  877   LAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG-MGTIENIP  1053
             L+Y G D    D T++  NLAIMYRQM++ A  P LFFG   RA  T +    GTIEN P
Sbjct  284   LSYGGTDDDVDDQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGETTTGKYAGTIENNP  343

Query  1054  HNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDW  1233
             HN++H W GDP   N EDMGNFYSA  DP+FY+ H NVDRMW IWKTLGGKR D  D DW
Sbjct  344   HNNIHLWCGDPNQPNKEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLGGKRKDPTDTDW  403

Query  1234  LDTEFLFFDETKTAVKVKVRDCLDNEK-LGYTFQDMPIPWKDFKPT-RKRTVKLSITESV  1407
             LD EFLF+DE    V  KVRD +   K L YT++ + +PW   KPT RK   K     S 
Sbjct  404   LDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAKVSA  463

Query  1408  PASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF-----IRFDVFLNE  1566
                T   PA      T  V R      T++E  N +  L+  D +F     ++FDVF+N+
Sbjct  464   TQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVFIND  523

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTL  1746
             D + +    D++E+AGSF ++PH  + G+ T   T   L I++L++DL +E D  VLVTL
Sbjct  524   DAE-SLSRKDKSEFAGSFVHVPHNQKTGTKT--KTNLKLGITDLLEDLGVEDDSSVLVTL  580

Query  1747  VPKVGGSFVTVNNAYI  1794
             VP+V  S +TV    I
Sbjct  581   VPRVSNSPITVGGFKI  596



>ref|XP_007214660.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
 gb|AFI08585.1| polyphenol oxidase II [Prunus persica]
 gb|EMJ15859.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
Length=596

 Score =   445 bits (1145),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 256/533 (48%), Positives = 326/533 (61%), Gaps = 27/533 (5%)
 Frame = +1

Query  238   AKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCC  417
              KLDRRN+L+GLGGLYGA  L      PFA ADP+  PD+  C  A I+     VP  CC
Sbjct  73    GKLDRRNILIGLGGLYGATTLD---PKPFAFADPIAPPDLTKCQLAEITTGGETVP--CC  127

Query  418   PPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQAN  597
             PP+T  TK++ +K      L  RPAA  V   YL K+K A   M+ LP DDPR+  QQA 
Sbjct  128   PPVT--TKIKTFKPDLSIPLRTRPAAQQVTDEYLAKFKKAQAAMRALPDDDPRSMVQQAK  185

Query  598   VHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWD  768
             VHCAYCNGAY   G P    Q+HF+W FFPFHR YLYF+ERI+  +I+DPTF LPYWNWD
Sbjct  186   VHCAYCNGAYPQVGFPDNDLQVHFSWLFFPFHRMYLYFYERILGKLIDDPTFALPYWNWD  245

Query  769   NPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMY  948
             +P G   P I+ D +  SPLYDQYRN DH+   ++DL Y   +    D T++  NLAIMY
Sbjct  246   SPAGFPIPDIYTDTS--SPLYDQYRNSDHQPPVLVDLGYGKTNDDVDDQTRIDENLAIMY  303

Query  949   RQMITNAPCPLLFFGKPLRADNTQSSGM-GTIENIPHNSVHRWVGDPRSANHEDMGNFYS  1125
             RQM++ A  P LFFG   RA +  +    GTIEN+PHN++H WVGDP   + EDMGNFYS
Sbjct  304   RQMVSGAKTPDLFFGHAYRAGDLNTKKYPGTIENMPHNNIHLWVGDPNQTHQEDMGNFYS  363

Query  1126  AANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLD  1305
             A  DP+FY+ H NVDRMWTIWKTLGGKR DI D DWLD EFLF+DE    V  KVRD LD
Sbjct  364   AGRDPLFYAHHCNVDRMWTIWKTLGGKRQDITDTDWLDAEFLFYDENAELVNCKVRDSLD  423

Query  1306  NEK-LGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAS--TDVLPAPLSKNLTFYVT---  1467
               K L Y ++   +PW   KPT ++T K      V A+  T   PA      T  V    
Sbjct  424   TAKQLRYNYEPASLPWLFTKPTARKT-KNKTKAKVAATQLTSKFPATFDSKTTVEVARPK  482

Query  1468  ---RSTSVPETQEEMLNL-DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPH  1635
                RS      +EE+L + D+ ++  + ++FDVF+N+D + +    D++E+AGSF ++P 
Sbjct  483   PRKRSKKEKVDEEELLIIKDIEFEGNEAVKFDVFINDDAE-SLSRRDKSEFAGSFVHVPQ  541

Query  1636  VHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
                  +     T   L I++L++DL  E D  VLVTLVP+V  S +T+    I
Sbjct  542   GKT--TKAKTKTNLKLGITDLLEDLGAEDDSSVLVTLVPRVSNSPITIGGFKI  592



>dbj|BAA21676.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   445 bits (1144),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 251/571 (44%), Positives = 353/571 (62%), Gaps = 44/571 (8%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlg  303
             Q+ L   P R+  R    ++ C A++  + +     +++KLDRRNVLLGLGGLYG   + 
Sbjct  31    QVSLLTKPKRSLGR----EVSCNATNNDQFDQ----AQSKLDRRNVLLGLGGLYGVAGMV  82

Query  304   aggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNV  483
                ++P      +  PDV+ CGP  +   +  VP  CCPP   +TK+  +K+P+ + L +
Sbjct  83    ---TDPRGFGKSIAPPDVSKCGPGDLPQGA--VPTNCCPP--PSTKIIDFKLPAPANLRI  135

Query  484   RPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQI  654
             RP AHAVD AY +KY  A++ MK LP DD R+F QQ  VHCAYC+GAY   G P    Q+
Sbjct  136   RPPAHAVDQAYRDKYYKAMELMKALPDDDSRSFKQQGAVHCAYCDGAYDQVGFPELELQL  195

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H +W FFPFHR+YLYF E+I+ ++INDPTF LP+WNWD+P GM  P I+ D    SPLYD
Sbjct  196   HNSWLFFPFHRYYLYFCEKILGNLINDPTFALPFWNWDSPAGMPLPAIYADPK--SPLYD  253

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
             + R+  H+   ++DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +
Sbjct  254   KLRSAKHQPPTLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGNPYRAGD  313

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKT  1194
                 G G+IE  PH  VH W GD    N EDMGNFYSA  DP+F++ HSNVDRMW+IWKT
Sbjct  314   EPDPGGGSIEGTPHAPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIWKT  373

Query  1195  LGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRK  1374
             LGGKR D+ D DWLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +
Sbjct  374   LGGKRADLTDSDWLDSGFLFYNENAELVRVKVRDCLETKHLGYVYQDVDIPWLSSKPTPR  433

Query  1375  R--------TVKLSITE-SVPASTDVL-----PAPLSKNLTFYVTR------STSVPETQ  1494
             R          KL +   +V +S+ V+     P  L   ++  V R      S    E +
Sbjct  434   RAEVALSPIAKKLGVAHPAVASSSKVVAGTEFPINLGSKISTVVKRPKQKKRSKKAKEDE  493

Query  1495  EEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTT  1671
             EE+L ++ + +D    ++FDV++N+ +D+ +   D+TE+AGSF ++PH H+        T
Sbjct  494   EEILVIEGIEFDRDVAVKFDVYVNDVDDLPSGP-DKTEFAGSFVSVPHSHKHKKKM--NT  550

Query  1672  TFNLAISELIKDLDLEGDDKVLVTLVPKVGG  1764
             T  L +++L+++++ E DD V+VTLVPK G 
Sbjct  551   TLRLGLTDLLEEIEAEDDDSVVVTLVPKFGA  581



>ref|XP_002519016.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF43227.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
Length=589

 Score =   444 bits (1143),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 257/567 (45%), Positives = 348/567 (61%), Gaps = 46/567 (8%)
 Frame = +1

Query  181   IRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVA  360
             I C A++   D+NP +       RR++L+ LGGLY A  L     +P A A PV  PD+ 
Sbjct  41    ISCKATANDHDQNPTT-------RRDILIVLGGLYVAITL----GDPLAFAKPVSAPDLT  89

Query  361   NCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAAHAVDAAYLEKYKTA  537
              CG A +  SS K P  CCPP   +TK+  +K+PS  S L +RPAAH VD AYL KY  A
Sbjct  90    KCGKADLP-SSAK-PTNCCPP--PSTKILDFKLPSSNSPLRIRPAAHVVDDAYLAKYSKA  145

Query  538   IQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFE  708
             I+ MK LP DDPR+F QQANVHCAYC+GAY   G P    Q+H +W FFPFHR++LYF E
Sbjct  146   IELMKALPDDDPRSFMQQANVHCAYCDGAYHQVGLPDLDLQVHNSWLFFPFHRYFLYFHE  205

Query  709   RIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYS  888
             +I+  +I+DPTF LP+WNWD+P GM  P I+ D    SPLYDQ+RN++H+   ++DL Y+
Sbjct  206   KILGKLIDDPTFALPFWNWDSPAGMQLPAIYVDPK--SPLYDQFRNKNHQPPTLVDLDYN  263

Query  889   GDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVH  1068
             G +        + +NL IMYRQM++N     LF G   RA +    G G+IENIPH  VH
Sbjct  264   GSENPTSKQELLSSNLTIMYRQMVSNGKTARLFHGSAYRAGDEADPGAGSIENIPHGPVH  323

Query  1069  RWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG-KRTDIADKDWLDTE  1245
              W GD    N EDMGNFYSAA DP+F++ HSNVDRMWTIWKTLGG KRT+  D DWLD E
Sbjct  324   VWCGDNTQPNLEDMGNFYSAARDPIFFAHHSNVDRMWTIWKTLGGNKRTEFTDPDWLDAE  383

Query  1246  FLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVK-------------  1386
             F+F+DE    V+VKVRDC+D +KLGY +QD+ IPW   +P  +R +K             
Sbjct  384   FIFYDENANPVRVKVRDCIDTKKLGYIYQDVDIPWLKSRPKSRRLIKKVANKVFHHDGQA  443

Query  1387  --LSITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFI  1542
                + T ++P  T   P  L K ++        +RS    E +EE+L +D + ++    +
Sbjct  444   AHAAETLNLPPIT-AFPLVLDKVISTVAKRPKKSRSKKEKEEEEEVLLIDAIEFERNALV  502

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FDV++N++ D  +   D +E+AGSF N+PH H+        T   L +++L++D+  E 
Sbjct  503   KFDVYVNDEHDSTSARPDNSEFAGSFVNIPHKHK--HGKKMKTCLRLGLTDLLEDMGAED  560

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             DD V+VTLVP+ G   V +    I+ +
Sbjct  561   DDTVVVTLVPRYGKGLVKIGGIMIDYI  587



>sp|Q9ZP19.1|PPO1_IPOBA RecName: Full=Polyphenol oxidase I, chloroplastic; Short=PPO-I; 
AltName: Full=Catechol oxidase I [Ipomoea batatas]
 emb|CAA06855.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   441 bits (1133),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 226/490 (46%), Positives = 302/490 (62%), Gaps = 21/490 (4%)
 Frame = +1

Query  337   PVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAY  516
             P+  P+++ C           V   CCPP+   + +  YK+P+ + + VRPAAH +D   
Sbjct  2     PIQAPEISKCVVPPADLPPGAVVDNCCPPVA--SNIVDYKLPAVTTMKVRPAAHTMDKDA  59

Query  517   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHR  687
             + K+  A++ MK LP+DDPRNFYQQA VHCAYCNG Y     P    Q+H +W FFPFHR
Sbjct  60    IAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHR  119

Query  688   WYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGH  867
             WYLYF+ERI+  +I DP+F LP+WNWDNP GM  P   +D    S LYD  RNQ H    
Sbjct  120   WYLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDST--SSLYDSNRNQSHLPPV  177

Query  868   VLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIEN  1047
             V+DL Y+G D    D  ++ +NLA+MY+QM+TNA    LF GK  RA +  S G G+IE 
Sbjct  178   VVDLGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYRAGDAPSPGAGSIET  237

Query  1048  IPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGK--RTDIA  1221
              PH  +HRWVGDPR+ N+EDMGNFYSA  D  FY  HSNVDRMWTIW+ L GK  + D  
Sbjct  238   SPHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWTIWQQLAGKPRKRDYT  297

Query  1222  DKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK--PTRKRTVKLSI  1395
             D DWL+  FLF+DE   AVKV++ D LDN+K+GY +   P+PW D K  PT+K+    S 
Sbjct  298   DSDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKPVPTKKKGGYASK  357

Query  1396  TESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE------MLNLDLVYDDTKFIRFDVF  1557
             +++ P    V P  L K +   V R       +E+      +L + +  +  K+ +FDV+
Sbjct  358   SKA-PFVASVFPVTLDKVVQVKVARPKKSRSAEEKEAEEEILLIVGIEVEIDKYAKFDVY  416

Query  1558  LNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVL  1737
             LN+ +D +  + D+ EYAGSF +LPH H+G       TT +L ++E ++DL  E DD +L
Sbjct  417   LNDSDDPSGGK-DKAEYAGSFAHLPHKHKGMKKI--RTTLSLGLNEPLEDLGAEDDDTIL  473

Query  1738  VTLVPKVGGS  1767
             VTL PKVGG 
Sbjct  474   VTLAPKVGGG  483



>gb|ABI96939.1| putative polyphenol oxidase [Neillia thyrsiflora]
Length=451

 Score =   438 bits (1127),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 225/457 (49%), Positives = 299/457 (65%), Gaps = 31/457 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PD++ CG   +   +  +P  CCPP+   TK+  +K+P+ ++L +RP AH
Sbjct  1     PFAFAKPVAPPDISKCGAPDLP--TGALPTNCCPPLA--TKIIDFKVPAPNRLRIRPPAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY++KY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH  W 
Sbjct  57    AVDQAYIDKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQVGFPDLEIQIHNCWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR++LYF+ERI+  +INDPTF LP+WNWD+P GM  P IF   N  SPLYD+ RN+
Sbjct  117   FFPFHRYFLYFYERILGKLINDPTFALPFWNWDSPAGMQLPAIF--ANPQSPLYDKLRNR  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G +      T +  NL IMYRQM++NA  PLLFFG P RA +    G
Sbjct  175   QHQPPTLVDLDYNGTEDNTSRETTINANLKIMYRQMVSNAKNPLLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PHN VH W GD    N EDMGNFYSAA DP+F+S HSNVDR+W IWKTLGGKR
Sbjct  235   AGSIELTPHNPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRLWIIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TDI D DWLD+ FLF++E    V+VKVRDCL+++KLGY +QD+ IPW D KPT +R    
Sbjct  295   TDITDSDWLDSGFLFYNENAELVRVKVRDCLESKKLGYVYQDVDIPWLDSKPTPRRAEQV  354

Query  1378  ----TVKLSITESVPASTDVL-----PAPLSKNLTFYVTR------STSVPETQEEMLNL  1512
                   KL +  +  +ST ++     P  L   ++  V R      +    E +EE+L +
Sbjct  355   LSKIAKKLGVAHAAESSTKIVAATEFPINLDTKISTVVKRPQQKKRTKKQKEDEEEILVI  414

Query  1513  DLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             + + ++    ++FDV++N+ +D +    D+TE+AGSF
Sbjct  415   EGIEFERDVAVKFDVYVNDVDDPSGP--DKTEFAGSF  449



>gb|ADI44161.1| polyphenol oxidase 2 [Fragaria pentaphylla]
Length=603

 Score =   444 bits (1141),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 249/569 (44%), Positives = 349/569 (61%), Gaps = 31/569 (5%)
 Frame = +1

Query  163   RGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPV  342
             R   +  +  +S++   +      +  +DRRNVL+GLGGLYG    G   ++PFA A PV
Sbjct  42    RSSRIICKSTSSNQSPSDEHKHPHQTNVDRRNVLIGLGGLYGVGLGG---ADPFAFAKPV  98

Query  343   PLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLE  522
               PD++ CG A +   +   P  CCPPI+D  K+  +  PS S L VRPAAHAVD AY++
Sbjct  99    APPDLSKCGAADLPPGA--TPINCCPPISD--KIVDFTFPSSSPLRVRPAAHAVDQAYID  154

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             KY  AI+ MK LP  DPR+F QQA++HCAYC+GAY   G P    QIH +W FFPFHR+Y
Sbjct  155   KYSKAIELMKALPDSDPRSFSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFFPFHRYY  214

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYF+E+I+  +I+DPTF LP+WNWD+PPGM  P +F D    SPLY++ RN +H+   +L
Sbjct  215   LYFYEKILGKLIDDPTFALPFWNWDSPPGMKLPALFADPK--SPLYNELRNANHQPPTLL  272

Query  874   DLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIP  1053
             DL ++  D    +  ++ +NL IMYRQM++NA    LFFG   RA    S G G+IE+ P
Sbjct  273   DLDWNLTDTPTTEADQISSNLKIMYRQMVSNAKKQQLFFGTAYRAGTDPSPGSGSIESTP  332

Query  1054  HNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDW  1233
             H  +H W GD    N+EDMGNFYSAA DP+F+S HSNVDRMW++WKT G    DI D DW
Sbjct  333   HGPIHVWTGDNTQPNYEDMGNFYSAARDPIFFSHHSNVDRMWSVWKTFGATNKDITDPDW  392

Query  1234  LDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT------VKLSI  1395
             LDT FLF+DE    V+VKVRDCLD++KLGY +QD+ IPW   KPT +R+        + +
Sbjct  393   LDTGFLFYDENAQLVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPTPRRSKLAKAAKAIGV  452

Query  1396  TESVPASTDVL-----PAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF-----  1539
               +  +   V+     P  L   ++  V R      +++E  + +  LV    +F     
Sbjct  453   ARAASSGPKVVGRSDFPIKLDSKISTVVKRPKQKKRSKKEKEDEEEILVIGGIEFEKDMA  512

Query  1540  IRFDVFLNEDEDVNT-VELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDL  1716
             ++FDV++N+ ED +   + D +E+AGSF N+PH H+        +   L +++L++DL  
Sbjct  513   VKFDVYVNDLEDDDEPGKPDDSEFAGSFVNVPHKHKDKKKKKTKSCLRLGLTDLLEDLGA  572

Query  1717  EGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             E D+ V+VTLVP+ G   + ++   I  L
Sbjct  573   EDDESVVVTLVPRYGTKSLKIDTIKIEFL  601



>gb|AII22006.1| polyphenol oxidase-4 [Gossypium hirsutum]
Length=584

 Score =   443 bits (1139),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 248/565 (44%), Positives = 336/565 (59%), Gaps = 55/565 (10%)
 Frame = +1

Query  181   IRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVA  360
             + C A++ G D+N       K DRR++LLGLGGLYG  +L    ++  A A PV  PD  
Sbjct  43    VSCKATN-GDDQN-------KFDRRDILLGLGGLYGVSSL----NDSLAFAKPVTGPDFT  90

Query  361   NCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAI  540
             +CG   +   +  +   CCPP + T  V++   PS + L  RPAAH V+  YL K+  AI
Sbjct  91    HCGRPDLPIGAANI--NCCPPPS-TKIVDFVLPPSNAPLQTRPAAHLVNDDYLAKFSKAI  147

Query  541   QKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFER  711
             + MK LP+ DPR+F QQANVHCAYC+GAY   G P    Q+H +W FFPFHR+YLYFFE+
Sbjct  148   ELMKALPASDPRSFMQQANVHCAYCDGAYHQLGFPDLDLQVHNSWLFFPFHRFYLYFFEK  207

Query  712   IMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSG  891
             I+  +I+DPTF +P+WNWD+P GM  P I+ + N  SPLYD+ RN  H+   +LDL Y+G
Sbjct  208   ILGKLIDDPTFAMPFWNWDSPAGMQMPAIYANPN--SPLYDKLRNARHKPPTLLDLDYNG  265

Query  892   DDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHR  1071
              D       ++ +NL +MYRQM++N     LF G   RA      G G++ENIPH  VH 
Sbjct  266   VDETLSSKDQISSNLNVMYRQMVSNGKTAKLFLGNAYRAGEEPDPGAGSLENIPHGLVHI  325

Query  1072  WVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFL  1251
             W GD    N E+MGNFYSA  DP+FY+ HSNVDRMW++WKTLGGKRTD  D DWLD+ FL
Sbjct  326   WCGDNTQQNFENMGNFYSAGRDPIFYAHHSNVDRMWSVWKTLGGKRTDFTDSDWLDSAFL  385

Query  1252  FFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPASTDVLP  1431
             F+DE    V+VKVRDCLD +KL Y +Q++ IPW   KPT KR +       V  +  V  
Sbjct  386   FYDENANLVRVKVRDCLDTKKLRYEYQNVEIPWLKTKPTPKRVI-----SKVKRALGVAN  440

Query  1432  APLSKNLTFYVTRSTSVPETQEEMLNLDLV------------------------YDDTKF  1539
             A  +K +   V R+   P   +++++L++                         +D  + 
Sbjct  441   AAETKKM---VVRNFKFPLVLDDIVSLEVARPKKSRSRKEEEEEEEVLVIENIEFDRHQV  497

Query  1540  IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLE  1719
             ++FDV++N DED   +  D TE+AGSF N+PH H+ G      T   L ++ L+++LD E
Sbjct  498   VKFDVYIN-DEDDTVIGPDNTEFAGSFVNVPHKHKHGKKM--ATFLRLGLTYLLEELDAE  554

Query  1720  GDDKVLVTLVPKVGGSFVTVNNAYI  1794
              DD V+VTLVPK G     +    I
Sbjct  555   DDDGVVVTLVPKFGKGLAKIGGIKI  579



>ref|XP_004293563.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=587

 Score =   442 bits (1136),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 255/541 (47%), Positives = 332/541 (61%), Gaps = 33/541 (6%)
 Frame = +1

Query  181   IRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVA  360
             I C A++   D+N D++   KLDRRN+L+GLG        G   +NPFA A PVP PD+A
Sbjct  50    IVCKATNN-NDQNKDAV--GKLDRRNMLIGLGAGGLYGTAGLE-TNPFAFAAPVPPPDLA  105

Query  361   NCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV--DAAYLEKYKT  534
              CGPA     +      CCPP   TT +  +K+P    +  R AA  V  D  YL KYK 
Sbjct  106   TCGPADKPDGTT---IDCCPP--KTTTIIDFKLPDPGPMRTRLAAQNVAKDPVYLAKYKK  160

Query  535   AIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFF  705
             AI+ M+ LP DDPR+  QQA VHC+YC+G Y + G      Q+HF W F+P+HR YLYF+
Sbjct  161   AIELMRALPDDDPRSLAQQAMVHCSYCDGGYPMAGFSDLEIQVHFCWLFYPWHRLYLYFY  220

Query  706   ERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY  885
             E+IM  +I+DPTF LP+WNWD P GM  P IF D    S LYDQYRN  H+   +LDL Y
Sbjct  221   EKIMCKLIDDPTFALPFWNWDAPAGMYIPSIFTDTT--SSLYDQYRNAAHQPPKLLDLNY  278

Query  886   SGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSV  1065
              G D    D T+++ NL  MY+QMI+ A    LFFG+P  A +  + G G IE+IPHN++
Sbjct  279   GGTDDDTDDKTRIRENLTTMYQQMISKATSHRLFFGEPYSAGDEPNPGAGNIESIPHNNI  338

Query  1066  HRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTE  1245
             H W GDP   N EDMG FYSA  DP+FYS H+NVDRMW+I+K  GG  TDI  KDWLDTE
Sbjct  339   HLWTGDPTQTNGEDMGAFYSAGRDPIFYSHHANVDRMWSIYKARGG--TDITKKDWLDTE  396

Query  1246  FLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RKRTVKLSITESVPASTD  1422
             FLF+DE K  V+VKVRD LD  KLGY +QD+ IPW + KPT RK   K     S    T 
Sbjct  397   FLFYDENKNLVRVKVRDSLDESKLGYKYQDVEIPWLNSKPTARKSKNKRKAAVSSADLTS  456

Query  1423  VLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-YDDTKFIRFDVFLNEDEDVN  1581
               PA LS+ ++  V R ++   T      +EE+L +  + +  ++ ++FDV++N+D D  
Sbjct  457   KFPATLSETISVEVARPSAAKRTTAEKTKEEEVLVISGIEFAGSEMLKFDVYVNDDADEV  516

Query  1582  TVELDRTEYAGSFGNLPHVHEGGSATPKT-TTFNLAISELIKDLDLEGDDKVLVTLVPKV  1758
             + + D+ E+AGSF ++PH      A  K  T   L I+ L+ DL  E D+ V+VTLVPK 
Sbjct  517   SGK-DKAEFAGSFVHVPH-----RANKKIKTNLRLGITNLLTDLGAEEDNSVVVTLVPKF  570

Query  1759  G  1761
             G
Sbjct  571   G  571



>dbj|BAA21677.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   441 bits (1135),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 253/573 (44%), Positives = 348/573 (61%), Gaps = 48/573 (8%)
 Frame = +1

Query  124   QIFLNPNPSRAARRGDAVKIRCAASSEGRDENPDSLSKA--KLDRRNVllglgglygayn  297
             Q+ L   P R+  R    K+ C      +D N D + +A  KL+RRNVLLGLGGLYG   
Sbjct  31    QVSLLTKPKRSFGR----KVSC------KDTNNDEIDQAQSKLERRNVLLGLGGLYGVGG  80

Query  298   lgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKL  477
             +    ++P      +  PDV+ CGPA +      VP  CCPP   +TK+  +K+P+ +KL
Sbjct  81    MD---TDPRGWGKAIAPPDVSKCGPADLP--QGGVPTICCPP--RSTKIIDFKLPAPAKL  133

Query  478   NVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---Y  648
              +RP AHA D AY +K+  A++ MK LP DDPR+F QQ  VHCAYC+GAY   G P    
Sbjct  134   RIRPPAHAGDQAYRDKHYKAMELMKALPDDDPRSFKQQGAVHCAYCDGAYDQVGFPELEL  193

Query  649   QIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPL  828
             QIH +W FFP HR+YLYFFE+I+  +INDPTF  P+WNWD+P GM  P I+ D    SPL
Sbjct  194   QIHNSWLFFPLHRYYLYFFEKILGKLINDPTFAGPFWNWDSPAGMPLPAIYADPK--SPL  251

Query  829   YDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             YD+ R+  H+   ++DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA
Sbjct  252   YDKLRSAQHQPPTLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGNPYRA  311

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +    G G+IE  PH  VH W GD    N EDMGNFYSA  DP+F++ HSNVDRMW+IW
Sbjct  312   GDEPDPGGGSIEGTPHAPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIW  371

Query  1189  KTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT  1368
             KTLGGKR D+ D DWLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT
Sbjct  372   KTLGGKRADLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPT  431

Query  1369  RKR--------TVKLSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPE  1488
              +R          KL +  +  AS+  +      P  L   ++  V R      S    E
Sbjct  432   PRRAKVALSKIAKKLGVAHAAVASSSKVVAGTEFPINLGSKISTVVKRPKQKKRSKKAKE  491

Query  1489  TQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK  1665
              +EE+L ++ + +D    ++FDV++N+ +D+ +   D+TE+AGSF ++PH H+       
Sbjct  492   DEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPSGP-DKTEFAGSFVSVPHSHKHKKKM--  548

Query  1666  TTTFNLAISELIKDLDLEGDDKVLVTLVPKVGG  1764
              T   L +++L+++++ E DD V+VTLVPK G 
Sbjct  549   NTILRLGLTDLLEEIEAEDDDSVVVTLVPKFGA  581



>ref|XP_007211389.1| hypothetical protein PRUPE_ppa003190mg [Prunus persica]
 gb|EMJ12588.1| hypothetical protein PRUPE_ppa003190mg [Prunus persica]
Length=594

 Score =   441 bits (1134),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 258/573 (45%), Positives = 335/573 (58%), Gaps = 33/573 (6%)
 Frame = +1

Query  139   PNPSRAARRGDAVKI---RCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             PN S+   +  +V +   RC A +   D     L   KLDRRN+L+GLG        G  
Sbjct  36    PNKSQKPTKQCSVSVGGVRCQAKNGDNDHLDQGL--GKLDRRNMLIGLGAGGLYGAAGLE  93

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRP  489
              +NPFA A PV  PD   CGPA     S      CCPPIT T  +  +K+P    L  R 
Sbjct  94    -NNPFAFAAPVSAPDFTECGPADKPDGST---IDCCPPITKT--IIDFKLPDPGPLRTRR  147

Query  490   AAH--AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQI  654
              A   A D  YL KYK A+  M+ LP DDPR+  QQA VHC+YC+G Y   G P    Q+
Sbjct  148   PAQDLAKDPVYLAKYKKAVALMRALPDDDPRSLAQQAMVHCSYCDGGYPQVGFPDLEIQV  207

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             HF W F+PFHRWYLYF+E+IM  +I DPTF LP+WNWD P GM  P IF D    S LYD
Sbjct  208   HFCWLFYPFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDPT--SSLYD  265

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
             QYRN  H+   +LDL Y G D    D T++K NL  MY+QM++ A    LF+G+P  A +
Sbjct  266   QYRNAAHQPPKLLDLNYGGSDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGD  325

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKT  1194
               S G G IE+IPHN++H W GDP+  N E+MG FYSA  DP+FYS HSNVDRMW+I+K 
Sbjct  326   DASPGAGNIESIPHNNIHLWSGDPKQTNGENMGAFYSAGRDPLFYSHHSNVDRMWSIYKD  385

Query  1195  LGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQD-MPIPWKDFKPT-  1368
             L G  TDI   DWL+TEFLF+DE K  V+VKVRD LD +KLGY + + +PIPW   KP  
Sbjct  386   LLGG-TDIDKTDWLNTEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDNKVPIPWLKAKPNP  444

Query  1369  RKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF-  1539
             RK   +     S    T   PA LS  ++  V R ++   T E+    D  LV    +F 
Sbjct  445   RKSQNQRKAAVSSGDLTTAFPATLSDKISVEVARPSTTKRTSEQKKAQDEVLVIKGIEFA  504

Query  1540  ----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
                 ++FDVF+N+D D    + D++E+AGSF ++PH  +        T   L+I++L+++
Sbjct  505   GNEPLKFDVFVNDDADSEAGK-DQSEFAGSFIHVPHKQKKNI----KTNLRLSITKLLEE  559

Query  1708  LDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
             LD E D  ++VTLVPK+G   +T+    I  L+
Sbjct  560   LDAETDKSLVVTLVPKLGKGPITIGGFSIELLN  592



>gb|KHN46329.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=624

 Score =   441 bits (1135),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 243/524 (46%), Positives = 328/524 (63%), Gaps = 41/524 (8%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAA  495
             P A+A P+  PD+  CGP  ++  +   P  CCPPI+ T  +  +K+PS  + L VRPAA
Sbjct  105   PLAIAAPILPPDLKTCGPPDLATGA--KPVNCCPPISST--IIDFKLPSSGAPLRVRPAA  160

Query  496   HAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNW  666
             H V+  Y+ KY+ A+++MK L  +DPRNF QQANVHCAYC+GAY   G P    Q+H  W
Sbjct  161   HLVNDVYIAKYREALKRMKALSPNDPRNFTQQANVHCAYCDGAYHQVGFPNLDLQVHNCW  220

Query  667   FFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPG-MTFPGIFDDENQLSPLYDQYR  843
              FFP+HRWYLYF+ERI+ ++I DPTF LP+WNWDNP G MT P  + D+N  SPLYD  R
Sbjct  221   LFFPYHRWYLYFYERILGNLIGDPTFALPFWNWDNPKGGMTIPSFYVDKN--SPLYDPLR  278

Query  844   NQDHRYGHVLDLAYSGDDIIAP------DPT-KVKNNLAIMYRQMITNAPCPLLFFGKPL  1002
             N +H+   ++DL Y+  D   P      DP  ++ +NL+IMYR +I+N   P LF G P 
Sbjct  279   NLNHQPPVLIDLDYNRRDDDDPSASESVDPNEQIASNLSIMYRNVISNGKLPRLFLGSPY  338

Query  1003  RADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             RA +    G G++EN+PH  VH W GD R  N E+MG FYSAA DP+F+S H+NVDRMW+
Sbjct  339   RAGDEPEPGAGSLENVPHGPVHSWTGDKREPNRENMGIFYSAARDPIFFSHHANVDRMWS  398

Query  1183  IWKTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDF  1359
             IWKT+ GGKR D  D DWL++ F F+DE K  V+VKV+D LD  KLGY +QD+ IPW   
Sbjct  399   IWKTIPGGKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLKN  458

Query  1360  KPTRKRT--VKLSI-----------TESVPASTDVLPAPLSKNLTFYVT-----RSTSVP  1485
             KP  KR+   KL++            E+ P S    P  L   ++  V      RS    
Sbjct  459   KPKPKRSKAKKLALAQDFIVGAAQAVETTPKSVK-FPLTLDSKVSTLVKRPKLLRSKEEK  517

Query  1486  ETQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP  1662
             E +EE+L +D + +D  K ++FDVF+N DED   +    TE+AGSF ++PH H   +   
Sbjct  518   EEEEEVLVIDGIEFDRNKAVKFDVFIN-DEDDKVITPSNTEFAGSFVSVPHSHVHKNKKI  576

Query  1663  KTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             K T F + +++L++DL+ E DD +LVTLVPK G   VT+ +  I
Sbjct  577   K-TCFRVGLTDLLEDLEAENDDSILVTLVPKYGKGLVTIRDIKI  619



>ref|XP_010647098.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Vitis vinifera]
Length=601

 Score =   441 bits (1133),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 231/504 (46%), Positives = 311/504 (62%), Gaps = 31/504 (6%)
 Frame = +1

Query  349   PDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP-SFSKLNVRPAAHAVDAAYLEK  525
             PD++ CG A +   +   P  CCPP++  +K+  +K+P   S   +RPAAH     Y+ K
Sbjct  103   PDLSECGAADLPAGA--QPTNCCPPVS--SKIIDFKLPPKNSPFRIRPAAHLASKEYIAK  158

Query  526   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYL  696
             YK AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H +W F P+HR+YL
Sbjct  159   YKKAIELMKALPDDDPRSFMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRYYL  218

Query  697   YFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLD  876
             YF+E+I+  +INDPTF LP+WNWD P GM  P +F D N  SPLYD+ R+  H+   ++D
Sbjct  219   YFYEKILGKLINDPTFALPFWNWDAPAGMQMPAMFADPN--SPLYDKLRDPKHQPPKLID  276

Query  877   LAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPH  1056
             L Y+  D    +  ++ +NL+IMYRQ++++A    LF G   RA +    G GT+ENIPH
Sbjct  277   LDYTXTDSNDTNEQQISSNLSIMYRQIVSSAKTTSLFMGAAYRAGDEPDPGQGTLENIPH  336

Query  1057  NSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWL  1236
               VH W GD    N EDMGNFYSAA DP+F+S HSNVDRMWT+WK LGGKR D  D DWL
Sbjct  337   GPVHIWCGDRTQPNIEDMGNFYSAARDPIFFSHHSNVDRMWTVWKGLGGKRKDFTDPDWL  396

Query  1237  DTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITE-----  1401
             D  F+F+DE    V+VKVRDCLD  KL Y +Q++ IPW   +P  ++ +K  + +     
Sbjct  397   DAGFVFYDENAQLVRVKVRDCLDPTKLRYAYQEVDIPWLKSRPKPRQILKKVVNKLKHKS  456

Query  1402  ------SVPASTD-VLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFI  1542
                    +P+S+  V P  L   L   V     +RS    E +EE+L +  +  +  KF+
Sbjct  457   GVANAAEIPSSSSIVFPIKLDSTLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKFV  516

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FD+F+N DED      D TE+AGSF N+PH H  G    K T   + ISEL++DL+ E 
Sbjct  517   KFDIFIN-DEDDPVSRPDNTEFAGSFVNVPHQHSHGKK--KNTILRIGISELLEDLEAED  573

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             DD V+VTLVP+ G   +T+    I
Sbjct  574   DDSVVVTLVPRYGADVITIGGIEI  597



>gb|ACN86310.1| polyphenol oxidase [Juglans regia]
Length=603

 Score =   440 bits (1132),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 249/561 (44%), Positives = 344/561 (61%), Gaps = 34/561 (6%)
 Frame = +1

Query  178   KIRC-AASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPD  354
             ++ C A + + ++ N     + K DRR+VLLGLGG+YGA NL    ++PFALADPV  P+
Sbjct  51    RVACRATNGDQQNINNGQNPQGKFDRRDVLLGLGGMYGAANLC---NDPFALADPVSAPE  107

Query  355   VANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAAHAVDAAYLEKYK  531
             +  C  A +   +  +P  CCPP +   K++ + +PS  + L VRPAAH VD  Y+ KY 
Sbjct  108   LTLCSEADLPAGA--LPVNCCPPTS--KKIKDFVLPSQNTPLRVRPAAHLVDNDYIAKYN  163

Query  532   TAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYF  702
               I+ MK LP+DDPR+F QQANVHCAYC+GAY   G P    Q+H  W FFPFHR+Y+YF
Sbjct  164   KGIELMKSLPADDPRSFTQQANVHCAYCDGAYTQVGFPDLSLQVHECWLFFPFHRYYVYF  223

Query  703   FERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLA  882
             FE+I+  +I DPTF LP+WNWD+PPGM  P ++   N  S +YD  RN +H+   ++DL 
Sbjct  224   FEKILGKLIGDPTFALPFWNWDSPPGMQLPSLYAVSN--SAIYDPLRNANHQPPTIIDLD  281

Query  883   YSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNS  1062
             Y           +V +NL IMYRQM++ A  P LFFG P RA +    G GTIE+ PHN+
Sbjct  282   YGETSESTTTTDQVPSNLKIMYRQMVSGAKNPTLFFGSPYRAGDEPDPGAGTIESTPHNN  341

Query  1063  VHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDT  1242
             +H W GD    N E+MGNFYSA  DP+F++ HSNVDRMWTIWKTLGGKR DI D DWL++
Sbjct  342   IHLWTGDDTQPNIENMGNFYSAGRDPIFFAHHSNVDRMWTIWKTLGGKRKDITDPDWLNS  401

Query  1243  EFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPA---  1413
              F F+DE    V+VKV+DC+DN KL Y +QD+ IPW   KPT +++    + ++ PA   
Sbjct  402   SFFFYDENADPVRVKVKDCVDNTKLRYVYQDVEIPWLKTKPTPRKSRVKKVAKAFPAGHG  461

Query  1414  --------STDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLVYDDTKF-IRFD  1551
                     S+   P  L K ++  V     +RS    + +EE+L ++ +  +    ++FD
Sbjct  462   GVAQAAETSSVKFPIVLDKVISTVVARPKKSRSKKEKDDEEEVLVIEGIEVERDIPVKFD  521

Query  1552  VFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDK  1731
             VF+N+++D  T     TE+AGSF ++P          K T   + IS+L++DL  E DD 
Sbjct  522   VFINDEDDAPTGPGINTEFAGSFVSVPQQK---QTKKKKTYLRIGISDLLEDLGAEDDDS  578

Query  1732  VLVTLVPKVGGSFVTVNNAYI  1794
             V+VTLVP+ G     +    I
Sbjct  579   VVVTLVPRFGKGKAIIGGIKI  599



>ref|XP_003522849.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
 gb|KHN32510.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   440 bits (1131),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 231/515 (45%), Positives = 309/515 (60%), Gaps = 30/515 (6%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PD+  C  A +       P  CCPPI+ T  +++   PS   L VR AAH
Sbjct  91    PFANAAPILGPDLTTCVQAELP--EGVEPTNCCPPIS-TNIIDFKFPPSNQPLRVRSAAH  147

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
              V+  YL KY+ A+  MK+LPSDDPR+F QQA VHCAYC+G Y   G P    ++HF+W 
Sbjct  148   LVNKDYLAKYEKAVNLMKNLPSDDPRSFAQQAKVHCAYCDGGYHQLGFPDLDLEVHFSWL  207

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFP+HRWYLYF ERI+ S+INDPTF LP+WNWD P GM  P ++ D    SPLYD  RN 
Sbjct  208   FFPYHRWYLYFHERILASLINDPTFALPFWNWDAPGGMQLPSMYADPK--SPLYDSLRNA  265

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
             +H+   +++L ++ +D  A     +  NL  MYRQ+++NA  P LFFG P RA +  + G
Sbjct  266   NHQPPTLVNLDFTIEDPNAE--ANISTNLTTMYRQLVSNAKTPTLFFGNPYRAGDQPNPG  323

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G++E+ PH  VH W GD      EDMGN Y+AA DP+FY  HSNVDRMW+IWKTLGGKR
Sbjct  324   GGSVESTPHGPVHAWTGDINHPTMEDMGNLYAAARDPIFYCHHSNVDRMWSIWKTLGGKR  383

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT--RKRTV  1383
              D+ D DWL++ FLF+DE K  V+VK +DCLD  KLGY +QD+ IPW   KPT  R R  
Sbjct  384   RDLTDPDWLESAFLFYDENKNLVRVKTKDCLDTRKLGYVYQDVDIPWLKSKPTPLRSRAQ  443

Query  1384  KLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE----------------MLNLD  1515
             K+ +T           A  S+N+ F +   + V    +                 ++   
Sbjct  444   KVELTPLFGGVAAAHAAETSRNVKFPLVLDSVVSTVVKRPKKSRSKKEKEEKEEILVVEG  503

Query  1516  LVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT-FNLAIS  1692
             + ++ +  ++FDVF+N DED   V+ D TE+AGSF ++PH HE      K  T   L ++
Sbjct  504   IEFESSTGVKFDVFIN-DEDDKLVKPDNTEFAGSFVSVPHSHEHHKNNKKIVTCLRLGLT  562

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
             +L+++L  E DD VLVTLVPK G   V +    I+
Sbjct  563   DLLEELGAEDDDSVLVTLVPKYGKGRVNIRGIKID  597



>dbj|BAO79387.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=602

 Score =   440 bits (1131),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 231/504 (46%), Positives = 311/504 (62%), Gaps = 31/504 (6%)
 Frame = +1

Query  349   PDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP-SFSKLNVRPAAHAVDAAYLEK  525
             PD++ CG A +   +   P  CCPP++  +K+  +K+P   S   +RPAAH     Y+ K
Sbjct  104   PDLSECGAADLPAGA--QPTNCCPPVS--SKIIDFKLPPKNSPFRIRPAAHLASKEYIAK  159

Query  526   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYL  696
             YK AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H +W F P+HR+YL
Sbjct  160   YKKAIELMKALPDDDPRSFMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRYYL  219

Query  697   YFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLD  876
             YF+E+I+  +INDPTF LP+WNWD P GM  P +F D N  SPLYD+ R+  H+   ++D
Sbjct  220   YFYEKILGKLINDPTFALPFWNWDAPAGMQMPAMFADPN--SPLYDKLRDAKHQPPKLID  277

Query  877   LAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPH  1056
             L Y+  D    +  ++ +NL+IMYRQ++++A    LF G   RA +    G GT+ENIPH
Sbjct  278   LDYNLTDSNDTNEQQISSNLSIMYRQIVSSAKTTSLFMGAAYRAGDEPDPGQGTLENIPH  337

Query  1057  NSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWL  1236
               VH W GD    N EDMGNFYSAA DP+F+S HSNVDRMWT+WK LGGKR D  D DWL
Sbjct  338   GPVHIWCGDRTQPNIEDMGNFYSAARDPIFFSHHSNVDRMWTVWKGLGGKRKDFTDPDWL  397

Query  1237  DTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITE-----  1401
             D  F+F+DE    V+VKVRDCLD  KL Y +Q++ IPW   +P  ++ +K  + +     
Sbjct  398   DAGFVFYDENAQLVRVKVRDCLDPTKLRYAYQEVDIPWLKSRPKPRQILKKVVNKLKHKS  457

Query  1402  ------SVPASTD-VLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFI  1542
                    +P+S+  V P  L   L   V     +RS    E +EE+L +  +  +  KF+
Sbjct  458   GVANAAEIPSSSSIVFPIKLDSTLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKFV  517

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FD+F+N DED      D TE+AGSF N+PH H  G    K T   + ISEL++DL+ E 
Sbjct  518   KFDIFIN-DEDDPVSRPDNTEFAGSFVNVPHQHSHGKK--KNTILRIGISELLEDLEAED  574

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             DD V+VTLVP+ G   +T+    I
Sbjct  575   DDSVVVTLVPRYGADVITIGGIEI  598



>emb|CAN61652.1| hypothetical protein VITISV_006012 [Vitis vinifera]
Length=601

 Score =   439 bits (1130),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 231/504 (46%), Positives = 311/504 (62%), Gaps = 31/504 (6%)
 Frame = +1

Query  349   PDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP-SFSKLNVRPAAHAVDAAYLEK  525
             PD++ CG A +   +   P  CCPP++  +K+  +K+P   S L +RPAAH     Y+ K
Sbjct  103   PDLSECGAADLPAGA--QPTNCCPPVS--SKIIDFKLPPKNSPLRIRPAAHLASKEYIAK  158

Query  526   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYL  696
             YK AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H +W F P+HR+YL
Sbjct  159   YKKAIELMKALPDDDPRSFMQQADVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRYYL  218

Query  697   YFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLD  876
             YF+E+I+  +INDPTF LP+WNWD P GM  P +F D N  SPLYD+ R+  H+   ++D
Sbjct  219   YFYEKILGKLINDPTFALPFWNWDAPAGMQMPAMFADPN--SPLYDKLRDAKHQPPKLID  276

Query  877   LAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPH  1056
             L Y+  D    +  ++ +NL+IMYRQ++++A    LF G   RA +    G GT+ENIPH
Sbjct  277   LDYNLTDSNDTNEQQISSNLSIMYRQIVSSAKTTSLFMGAAYRAGDEPDPGQGTLENIPH  336

Query  1057  NSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWL  1236
               VH W GD    N EDMGNFYSAA DP+F+S HSNVDRMWT+WK LGGKR D  D DWL
Sbjct  337   GPVHIWCGDRTQPNIEDMGNFYSAARDPIFFSHHSNVDRMWTVWKGLGGKRKDFTDPDWL  396

Query  1237  DTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITE-----  1401
             D  F+F+DE    V+VKVRDCLD  KL Y + ++ IPW   +P  ++ +K  + +     
Sbjct  397   DAGFVFYDENAQLVRVKVRDCLDPTKLRYAYHEVDIPWLKSRPKPRQILKKVVNKLKHKS  456

Query  1402  ------SVPASTD-VLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTKFI  1542
                    +P+S+  V P  L   L   V     +RS    E +EE+L +  +  +  KF+
Sbjct  457   GVANAAEIPSSSSIVFPIKLDSTLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKFV  516

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FD+F+N DED      D TE+AGSF N+PH H  G    K T   + ISEL++DL+ E 
Sbjct  517   KFDIFIN-DEDDPVSRPDNTEFAGSFVNVPHQHSHGKK--KNTILRIGISELLEDLEAED  573

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             DD V+VTLVP+ G   +T+    I
Sbjct  574   DDSVVVTLVPRYGADVITIGGIEI  597



>emb|CDP22269.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   433 bits (1113),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 218/412 (53%), Positives = 276/412 (67%), Gaps = 14/412 (3%)
 Frame = +1

Query  547   MKDLPSDDPRNFYQQANVHCAYCNGAYLLNGN--PYQIHFNWFFFPFHRWYLYFFERIMQ  720
             MK LP+DDPRNF QQANVHCAYCNGAY+ +G+    Q+H +W FFPFHRWYLYF+ERI+ 
Sbjct  1     MKALPADDPRNFTQQANVHCAYCNGAYIQSGSDQEIQVHNSWLFFPFHRWYLYFYERILG  60

Query  721   SMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDI  900
              +I DP+F LP+WNWDN  GMT P IF D  Q S LY+Q RNQ H    V+DL Y+G D 
Sbjct  61    KLIGDPSFGLPFWNWDNIGGMTLPSIFQD--QSSALYNQNRNQSHLPPTVVDLGYNGTDT  118

Query  901   IAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVG  1080
              A D  ++KNNLAIMYRQM+TN+     FFGK  RA +  S G G+IE IPH  +HRWVG
Sbjct  119   DATDIERIKNNLAIMYRQMVTNSTTAKDFFGKEYRAGDAPSPGAGSIEAIPHIPIHRWVG  178

Query  1081  DPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFD  1260
             DPR  N EDMGNFYSA  D VFYS H+NVDRMWTIW+ LGGKR ++ D DWL++ F+F+D
Sbjct  179   DPRQPNGEDMGNFYSAGRDIVFYSHHANVDRMWTIWQQLGGKRKEVPDPDWLNSSFIFYD  238

Query  1261  ETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT-VKLSITESVPASTDVLPAP  1437
             E    V VKV DC  N+K+GY +Q + IPW   KP  + T  +++ T   P +  V P P
Sbjct  239   ENAQPVCVKVGDCFSNDKMGYIYQKVDIPWVKNKPVARVTKSRVAFTSGAPQADKVFPGP  298

Query  1438  LSKNLTFYVTR-STSVPETQEEMLNLDLV-----YDDTKFIRFDVFLNEDEDVNTVELDR  1599
             L+K +   V R   S  + Q+E     LV     +   K+++FDVF+N DED N  +  +
Sbjct  299   LNKTVKVLVKRPKLSRSKKQKEEEEERLVVSGIEFSMDKYVKFDVFIN-DEDDNPNDFAK  357

Query  1600  TEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPK  1755
             +EY GSF +LPH  +G      T TF L  +E+++DLD+E DD +LVTLVPK
Sbjct  358   SEYVGSFAHLPHKVKGDMKVKTTQTFEL--TEILEDLDVEEDDALLVTLVPK  407



>ref|XP_010910928.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=594

 Score =   438 bits (1127),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 248/544 (46%), Positives = 338/544 (62%), Gaps = 28/544 (5%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKA-----KLDRRNVllglgglygaynlgaggSNPFALADPV  342
             +I C A+ +   E P   ++A     KLDRR++L+GLGGLYGA        N  AL  P+
Sbjct  44    RISCKATRD-EHEKPTHTTEAIGSSGKLDRRDMLIGLGGLYGAAAGLGV--NRKALGLPI  100

Query  343   PLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYL  519
               PD++ CGPA +   S   P  CCPP T  +K+  +K+P  S  L +RPAAH VD+ YL
Sbjct  101   EAPDISKCGPADLP--SGATPTDCCPPFT--SKIIDFKLPPRSDPLRIRPAAHLVDSEYL  156

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
              KY  A++ MK LP+DDPRNF QQANVHCAYC+G+Y   G P    Q+H +W FFP+HR+
Sbjct  157   AKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIEIQVHNSWIFFPWHRF  216

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYF E+I+  +I D TF LP+WNWD P GM  P I+ D +  S LYD+ R+  H+  ++
Sbjct  217   YLYFHEKILGKLIGDETFALPFWNWDAPAGMRMPSIYTDPS--SSLYDKLRDAKHQPPYL  274

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL ++G D       ++ +NL IMYRQ+I N     LF G P  A +  + G G++EN+
Sbjct  275   IDLDFNGRDPSFTQAQQIDHNLNIMYRQVIANGKTAQLFMGSPYHAGDQPNPGGGSLENV  334

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH +VH W GD    N EDMG  YSAA DP+F++ HSNVDRMW +WK LGGK  D  DKD
Sbjct  335   PHGTVHVWTGDRNQPNGEDMGTLYSAARDPIFFAHHSNVDRMWYVWKMLGGKHKDFEDKD  394

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSI-TESV  1407
             WL+T FLF+DE    V+VK++DCLD + L YT+QD+ IPW   +PT K TV       S+
Sbjct  395   WLNTSFLFYDENADLVRVKIKDCLDTQWLRYTYQDVEIPWLKARPTPKGTVAAKKGARSL  454

Query  1408  PASTD-VLPAPLSKNLTF-----YVTRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLNE  1566
              A T+   P  L  +++       V+RS+   + +EE+L ++ + +D   FI+FDV++N 
Sbjct  455   RAVTEAAFPVTLESSVSATVRRPKVSRSSKEKKDEEEVLVVEGIEFDRDMFIKFDVYINT  514

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK-TTTFNLAISELIKDLDLEGDDKVLVT  1743
              E+   V+   +E+AGSF N+PH H       K  T   L I+EL++DL  E DD VLVT
Sbjct  515   PEE-EGVDPGSSEFAGSFVNVPHKHNHSKKEKKLRTALRLGITELLEDLGAEADDSVLVT  573

Query  1744  LVPK  1755
             LVP+
Sbjct  574   LVPR  577



>ref|XP_006594327.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=670

 Score =   441 bits (1134),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 243/524 (46%), Positives = 328/524 (63%), Gaps = 41/524 (8%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAA  495
             P A+A P+  PD+  CGP  ++  +   P  CCPPI+ T  +  +K+PS  + L VRPAA
Sbjct  151   PLAIAAPILPPDLKTCGPPDLATGA--KPVNCCPPISST--IIDFKLPSSGAPLRVRPAA  206

Query  496   HAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNW  666
             H V+  Y+ KY+ A+++MK L  +DPRNF QQANVHCAYC+GAY   G P    Q+H  W
Sbjct  207   HLVNDVYIAKYREALKRMKALSPNDPRNFTQQANVHCAYCDGAYHQVGFPNLDLQVHNCW  266

Query  667   FFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPG-MTFPGIFDDENQLSPLYDQYR  843
              FFP+HRWYLYF+ERI+ ++I DPTF LP+WNWDNP G MT P  + D+N  SPLYD  R
Sbjct  267   LFFPYHRWYLYFYERILGNLIGDPTFALPFWNWDNPKGGMTIPSFYVDKN--SPLYDPLR  324

Query  844   NQDHRYGHVLDLAYSGDDIIAP------DPT-KVKNNLAIMYRQMITNAPCPLLFFGKPL  1002
             N +H+   ++DL Y+  D   P      DP  ++ +NL+IMYR +I+N   P LF G P 
Sbjct  325   NLNHQPPVLIDLDYNRRDDDDPSASESVDPNEQIASNLSIMYRNVISNGKLPRLFLGSPY  384

Query  1003  RADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             RA +    G G++EN+PH  VH W GD R  N E+MG FYSAA DP+F+S H+NVDRMW+
Sbjct  385   RAGDEPEPGAGSLENVPHGPVHSWTGDKREPNRENMGIFYSAARDPIFFSHHANVDRMWS  444

Query  1183  IWKTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDF  1359
             IWKT+ GGKR D  D DWL++ F F+DE K  V+VKV+D LD  KLGY +QD+ IPW   
Sbjct  445   IWKTIPGGKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLKN  504

Query  1360  KPTRKRT--VKLSI-----------TESVPASTDVLPAPLSKNLTFYVT-----RSTSVP  1485
             KP  KR+   KL++            E+ P S    P  L   ++  V      RS    
Sbjct  505   KPKPKRSKAKKLALAQDFIVGAAQAVETTPKSVK-FPLTLDSKVSTLVKRPKLLRSKEEK  563

Query  1486  ETQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATP  1662
             E +EE+L +D + +D  K ++FDVF+N DED   +    TE+AGSF ++PH H   +   
Sbjct  564   EEEEEVLVIDGIEFDRNKAVKFDVFIN-DEDDKVITPSNTEFAGSFVSVPHSHVHKNKKI  622

Query  1663  KTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             K T F + +++L++DL+ E DD +LVTLVPK G   VT+ +  I
Sbjct  623   K-TCFRVGLTDLLEDLEAENDDSILVTLVPKYGKGLVTIRDIKI  665



>emb|CAC83609.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   434 bits (1117),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 226/499 (45%), Positives = 301/499 (60%), Gaps = 21/499 (4%)
 Frame = +1

Query  337   PVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAY  516
             P+  P+++ C           V   CCPP+   + +  YKIP  + + VRPAAH +D   
Sbjct  2     PIQAPEISKCVVPPADLPPGAVVDNCCPPVA--SNIVDYKIPVVTTMKVRPAAHTMDKDA  59

Query  517   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHR  687
             + K+  A+  M+ LP DDPRNFYQQA VHCAYCNG Y     P    Q+H +W FFPFHR
Sbjct  60    IAKFARAVDLMRALPGDDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFPFHR  119

Query  688   WYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGH  867
             WYLYF+ERI+  +I DP+F LP+WNWDNP GM  P   +D    S LYD  RNQ H    
Sbjct  120   WYLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDST--SSLYDSNRNQSHLPPV  177

Query  868   VLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIEN  1047
             V+DL Y+G D    D  ++ +NLA+MY+QM+TNA    LF GK  RA +  S G G+IE 
Sbjct  178   VVDLGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYRAGDAPSPGAGSIET  237

Query  1048  IPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGK--RTDIA  1221
              PH  +HRWVGDPR+ N+EDMGNFYSA  D  FY  HSNVDRMW IW+ L GK  + D  
Sbjct  238   SPHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWAIWQQLAGKPRKRDYT  297

Query  1222  DKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK--PTRKRTVKLSI  1395
             D DWL+  FLF+DE   AVKV++ D LDN+K+GY +   P+PW D K  PT+K+    S 
Sbjct  298   DSDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKPVPTKKKGGYASK  357

Query  1396  TESVPASTDVLPAPLSKNLTFYVTR------STSVPETQEEMLNLDLVYDDTKFIRFDVF  1557
             +++ P    V P  L K +   V R      +      +E +L   +  +  K+ +FDV+
Sbjct  358   SKA-PFVASVFPVTLDKVVQVKVARPKKSRSAEEKEAEEEILLIEGVEVEIDKYAKFDVY  416

Query  1558  LNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVL  1737
             LN+ +D +  + D+ EYAGS  +LPH H+G       TT +L ++E ++DL  E DD +L
Sbjct  417   LNDSDDPSGGK-DKAEYAGSSAHLPHKHKGMKKI--RTTLSLGLNEPLEDLGAEDDDTIL  473

Query  1738  VTLVPKVGGSFVTVNNAYI  1794
             V L PKVGG  V+V+N  +
Sbjct  474   VALAPKVGGGVVSVDNIKV  492



>gb|AAK56323.1|AF380300_1 polyphenol oxidase 2 precursor [Malus domestica]
Length=586

 Score =   437 bits (1123),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 253/566 (45%), Positives = 335/566 (59%), Gaps = 34/566 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R  ++  A ++RC A+ +G ++N D    A+LDRRN+L+GLG             N FA 
Sbjct  39    RKPKQCLAGRVRCKAT-KGDNDNLDQ-GLARLDRRNMLIGLGTGGLYSAA----GNSFAF  92

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV--  504
             A PV  PD+  CGPA     S      CCPPIT  T +  +K+P    L  R AA  V  
Sbjct  93    AAPVSAPDLTTCGPADKPDGST---IDCCPPIT--TTIIDFKLPDRGPLRTRIAAQDVAK  147

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             + AYL KYK AI+ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+HF W FF
Sbjct  148   NPAYLAKYKKAIELMRALPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFF  207

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+E+IM  +I DPTF LP+WN D P GM  P IF D +  S LYDQ RN  H
Sbjct  208   PFHRWYLYFYEKIMGELIGDPTFALPFWNRDAPAGMYIPEIFTDTS--SSLYDQNRNTAH  265

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   +LDL Y G D    D T++K NL  MY+QM++ A    LF+G+P  A +    G G
Sbjct  266   QPPKLLDLNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPYSAGDEPDPGAG  325

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-TLGGKRT  1212
              IE  PHN++H WVGDP   N EDMG FYSA  DP+FYS HSNVDRMW+I+K  LGG  T
Sbjct  326   NIETTPHNNIHLWVGDPTQTNGEDMGTFYSAGRDPLFYSHHSNVDRMWSIYKDKLGG--T  383

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTF-QDMPIPWKDFKPTRKRTVKL  1389
             DI + DWLD EFLF+DE K  V+VKVRD LD +KLGY + + +PIPW   KPT       
Sbjct  384   DIENTDWLDAEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTLVSRRIR  443

Query  1390  SITESVPASTDVLPAPLSKNLTFYVTRSTSVPET--QEEMLNLDLVYDDTKF-----IRF  1548
                + +   T   PA LS  ++  VTR ++   T  Q++  +  LV    +F     ++F
Sbjct  444   ERPQFIFDLTTTFPATLSDTISVEVTRPSATKRTAAQKKAHDEVLVIKGIEFAGNEPVKF  503

Query  1549  DVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDD  1728
             DV++N+D + +    D++E+AGSF ++PH H+        T   L+I  L+++LD E D 
Sbjct  504   DVYVNDDAE-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSIMSLLEELDAETDS  558

Query  1729  KVLVTLVPKVGGSFVTVNNAYINTLD  1806
              ++VTLVPKVG   +T+    I  ++
Sbjct  559   SLVVTLVPKVGKGPITIGGFSIELIN  584



>gb|AEQ30073.1| polyphenol oxidase [Litchi chinensis]
Length=599

 Score =   437 bits (1123),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 254/569 (45%), Positives = 349/569 (61%), Gaps = 41/569 (7%)
 Frame = +1

Query  178   KIRCAASSEGRD---ENPDSLSK------AKLDRRNVllglgglygaynlgaggSNPFAL  330
             K+ C  +S   D   ++P++ SK       K+DRR VLLGLGGLYG   L    S+P + 
Sbjct  39    KVSCKVTSNNSDHLRKSPNTSSKDGELTPKKVDRREVLLGLGGLYGVTTLS---SDPLSF  95

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDA  510
             A PV  PD++ CG A +   +   P  CCPP ++   +++   PS S L +RPAAH  D 
Sbjct  96    AAPVSAPDLSRCGKADLPAGA--KPTNCCPPKSNKI-IDFKLPPSNSPLRIRPAAHLADN  152

Query  511   AYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPF  681
              Y+ KY  A++ MK LP+DDPRNF QQA+VHCAYC+GAY   G P    Q+  +W FFPF
Sbjct  153   EYIAKYYKAVELMKALPADDPRNFMQQADVHCAYCDGAYDQIGFPNLDLQVRNSWLFFPF  212

Query  682   HRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRY  861
             HR+YLYF+E+I+  +I DPTF +P+WNWD+PPG   P +F   N  SPLYD  RN +H+ 
Sbjct  213   HRYYLYFYEKILGKLIGDPTFVMPFWNWDSPPGTPMPAMF--ANPKSPLYDTLRNSNHQP  270

Query  862   GHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTI  1041
               + DL YSG D+   +  ++ +NL +MYRQM++N+  P LF G   RA +    G G +
Sbjct  271   PTLADLDYSGTDVTTTNEKQISSNLKVMYRQMVSNSKTPRLFLGNTYRAGDEPDPGAGAL  330

Query  1042  ENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIA  1221
             EN+PH  +H W GD +  N E+MGNFYSAA DP+FY+ HSNVDRMWT+WKTLGGKRT+  
Sbjct  331   ENLPHGPIHLWCGDTKQPNFENMGNFYSAARDPIFYAHHSNVDRMWTVWKTLGGKRTNFT  390

Query  1222  DKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW----KDFKPTRKRTVKL  1389
             D DWL+  FLF+DE    V+VKVRDCLD++KLGY +QD+ +PW       K  RK+  KL
Sbjct  391   DPDWLNAGFLFYDENANLVRVKVRDCLDSKKLGYVYQDVDVPWLRTKPKPKKLRKKVAKL  450

Query  1390  SITESVPASTDVLPAPLSK-NLTFYVTRSTSVPETQEEMLNLD-------LVYDDTKF--  1539
                 ++ A  +    P S+  L     +ST VP  ++     +       LV D+  F  
Sbjct  451   LGPVALAAEINTKLTPSSQFPLVLDSIKSTVVPRPKKSRSKKEKEEEEEILVIDNIGFER  510

Query  1540  ---IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDL  1710
                ++FDV++N DED   +  + TE+AGSF N+PH H+ G      T   L +++L++DL
Sbjct  511   EAVVKFDVYVN-DED-QAIGPENTEFAGSFVNVPHKHKHGKKM--KTCLRLGLTDLLEDL  566

Query  1711  DLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
             + E DD V+VTLVPK G   V++    I+
Sbjct  567   EAEDDDSVVVTLVPKYGKGLVSIGGIKID  595



>gb|ABI96941.1| putative polyphenol oxidase [Physocarpus capitatus]
Length=451

 Score =   431 bits (1109),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 297/458 (65%), Gaps = 33/458 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PD++ CG A +   +   P  CCPP    TK+  +K+P+ ++L VRP AH
Sbjct  1     PFAFAKPVAPPDISKCGAADLP--NGVQPTNCCPP--PGTKIIDFKLPAPNRLRVRPPAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY++KY  AIQ MK LP DDPR+F QQA VHCAYC+GAY   G P    QIH +W 
Sbjct  57    AVDQAYIDKYSKAIQLMKALPDDDPRSFKQQALVHCAYCDGAYDQVGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYF+ERI+  +INDPTF LP+WNWD+P GM  P I+   N  SPLYD++R+ 
Sbjct  117   FFPFHRYYLYFYERILGKLINDPTFALPFWNWDSPAGMQLPAIY--ANPKSPLYDKFRHH  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G +      T +  NL IMYRQM++NA  PLLFFG P RA +    G
Sbjct  175   QHQPPTLVDLDYNGTEDNTSRETTINANLKIMYRQMVSNAKNPLLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE+ PH  VH W GD    N EDMGNFYSA  DP+F+S HSNVDR+W+IWKTLGGKR
Sbjct  235   GGSIESTPHGPVHLWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TDI D DWLD+ FLF++E    V+VKVRD L+++KLGY +QD+ IPW D KPT +R    
Sbjct  295   TDITDSDWLDSGFLFYNENAELVRVKVRDSLESKKLGYVYQDVDIPWLDSKPTPRRAKQA  354

Query  1378  ----TVKLSITESVPASTDVL-----PAPLSKNLTFYVTR------STSVPETQEEMLNL  1512
                   KL I  +  +ST ++     P  L   ++  VTR      +    E +EE+L +
Sbjct  355   LSKIAKKLGIARAAESSTKIVAATAFPINLDTKISTVVTRPQQKKRNKKQKEDEEEILVI  414

Query  1513  DLV-YDDTKFIRFDVFLNE-DEDVNTVELDRTEYAGSF  1620
             + + ++    ++FDV++N+ DE +     D TE+AGSF
Sbjct  415   EGIEFERDVAVKFDVYVNDVDEPIGP---DNTEFAGSF  449



>ref|XP_009408264.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   436 bits (1122),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 245/533 (46%), Positives = 332/533 (62%), Gaps = 19/533 (4%)
 Frame = +1

Query  238   AKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCC  417
             AK+DRR+VL+GLGGL GA     G     ALA+P+  PD++ CGPA +      V   CC
Sbjct  58    AKVDRRDVLVGLGGLCGAAAGLGGFDKA-ALANPIQAPDLSKCGPADLPTGVPVV--NCC  114

Query  418   PPITDTTKVEYYKIPS-FSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQA  594
             PP     K+  +K PS  S L VRPAAH VD  YL KYK AI+ MK LP+DDPRNF QQA
Sbjct  115   PPYRPGAKIVDFKRPSPSSPLRVRPAAHLVDPEYLAKYKKAIELMKALPADDPRNFMQQA  174

Query  595   NVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNW  765
             +VHCAYC+GAY   G P    Q+H +W FFP+HR YLYF ERI+  +I D TF+LP+WNW
Sbjct  175   DVHCAYCDGAYDQIGFPNLEIQVHNSWLFFPWHRLYLYFNERILGKLIGDDTFSLPFWNW  234

Query  766   DNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIM  945
             D P GM  P I+ D +  SPLYD+ R+  H+   ++DL Y+G D   PD  ++ +NL IM
Sbjct  235   DAPGGMMLPSIYADPS--SPLYDKLRDAKHQPPVLVDLDYNGTDPTFPDAQQIDHNLKIM  292

Query  946   YRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYS  1125
             YRQ+ +N   PLLF G   RA    + G G++EN+PHN+VH W GD    N E+MG FY+
Sbjct  293   YRQVFSNGKTPLLFLGSAYRAGEQPNPGAGSVENMPHNNVHLWTGDRTQPNFENMGTFYA  352

Query  1126  AANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLD  1305
             AA DP+F++ H+N+DRMW +WK L  K  D  D DWL   FLF+DE    V+V V+DCL+
Sbjct  353   AARDPIFFAHHANIDRMWYLWKKLSRKHQDFNDSDWLKASFLFYDENADLVRVTVKDCLE  412

Query  1306  NEKLGYTFQDMPIPWKDFKPTRKRT-VKLSITESVPASTDV-----LPAPLSKNLTF-YV  1464
              + L YT+QD+ IPW + +PT K    + + + S+ A+ +V     L +P+   +    V
Sbjct  413   TDWLRYTYQDVKIPWVNARPTPKLAKARKAASSSLKATAEVQFPVTLESPVKATVKRPKV  472

Query  1465  TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVH  1641
              RS    E +EE+L ++ + +D   FI+FDVF+N  E  + +    +E+AGSF N+PH H
Sbjct  473   GRSGKEKEDEEEILIVEGIEFDRDYFIKFDVFVNATEG-DGITAGASEFAGSFVNVPHKH  531

Query  1642  EGGSATPK-TTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
             +      K  T   L I++L++D+  E DD VLVT+VPK G   V+V    I+
Sbjct  532   KHRKDENKLKTRLCLGITDLLEDIGAEDDDSVLVTIVPKAGKGKVSVGGLRID  584



>gb|ABI96925.1| putative polyphenol oxidase [Adenostoma fasciculatum]
Length=454

 Score =   431 bits (1108),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 225/461 (49%), Positives = 297/461 (64%), Gaps = 36/461 (8%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             P A A PV  PDV+ CG A +   +   P  CCP     TK+  +K+P+ ++L VRPAAH
Sbjct  1     PLAFAKPVAPPDVSKCGAADLP--TGAEPMNCCP--LPATKIIDFKLPAPTQLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
              VD AY++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QIH +W 
Sbjct  57    TVDQAYIDKYTKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYF+E+I+  +INDPTF LP+WNWD+P GM  P IF   N  SPLYD++RN 
Sbjct  117   FFPFHRYYLYFYEKILGKLINDPTFVLPFWNWDSPAGMQLPAIF--ANPKSPLYDKFRNA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
             +H+  +++DL ++G D    + T++  NL IMYRQM++NA  PLLFFG P RA +    G
Sbjct  175   NHQPPNLVDLDFNGTDENDSNATQINANLKIMYRQMVSNAKNPLLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  +H W GD    N EDMGNFYSA  DP+FYS HSNVDRMW+IWKTLGGKR
Sbjct  235   AGSIEGTPHGPIHLWTGDNTQPNFEDMGNFYSAGKDPIFYSHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVK-  1386
             TDI DKDWLD+ FLF++E    V+VKVRD L+++ LGY +Q++ IPW D KPT  R VK 
Sbjct  295   TDITDKDWLDSGFLFYNENAELVRVKVRDSLESKNLGYVYQEVDIPWLDSKPTPIRGVKH  354

Query  1387  ----------------LSITESVPASTDVLPAPLSKNLTFYVTR------STSVPETQEE  1500
                             LS ++ VP S    P  L   ++  V R      +    E +EE
Sbjct  355   AMSKIAKKLGHARAAELSSSKVVPQSD--FPIILETKISTVVKRPQQKKRNKKQKEDEEE  412

Query  1501  MLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             +L ++ + +D    ++FDVF+N+ +D+ +   + TE+AGSF
Sbjct  413   ILVVEGIEFDRDVAVKFDVFVNDVDDLPSGPAN-TEFAGSF  452



>ref|XP_008371327.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=585

 Score =   436 bits (1120),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 253/567 (45%), Positives = 337/567 (59%), Gaps = 35/567 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R  ++  A ++RC  + +G ++N D    A+LDRRN+L+GLG       +     NPFA 
Sbjct  37    RKPKQCLAGRVRCKXT-KGDNDNLDQ-GLARLDRRNMLIGLGAGGLYGXV----GNPFAF  90

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV--  504
             A P+  PD+  C PA+    S      CCPP T  T +  +++P    L  RPAA  V  
Sbjct  91    AAPISAPDLTTCVPASKPDGST---IDCCPPTT--TTIIDFELPDSGPLRTRPAAQDVAN  145

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             D  YL KYK A++ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+HF W FF
Sbjct  146   DPEYLAKYKNAVEMMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHFCWLFF  205

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+E+IM  +I D TF LP+WNWD P GM  P IF D    S LYDQYRN  H
Sbjct  206   PFHRWYLYFYEKIMGELIGDQTFALPFWNWDAPAGMYIPEIFTDTT--SSLYDQYRNTAH  263

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   +LDL Y   D    D T++K NL  MY+QM++NA C  LF+G+P  A +    G G
Sbjct  264   QPPKLLDLNYGXTDDDVDDATRIKENLTTMYKQMVSNATCHRLFYGEPYSAGDEPDPGAG  323

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-TLGGKRT  1212
              IE  PHN++H WVGDP   N EDMG FYSAA DPVFYS HSNVDRMW I+K  LGG  T
Sbjct  324   NIETTPHNNIHLWVGDPTQPNGEDMGTFYSAARDPVFYSHHSNVDRMWXIYKDKLGG--T  381

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQ-DMPIPWKDFKPT-RKRTVK  1386
             DI + DWLD EFLF+DE K   +V  RD LD +KLGY +  ++ IPW   KPT RK T K
Sbjct  382   DIENTDWLDAEFLFYDEKKNLXRVXXRDSLDTKKLGYVYDXNVSIPWLXSKPTXRKSTNK  441

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-YDDTKFIR  1545
                  S    +   PA LS  ++  VTR +    T      Q+E+L +  + +   + ++
Sbjct  442   RKAXVSSSDLSTTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEFAGNETVK  501

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDV++N+D D +    D++E+AGSF ++PH H+        T   L+I+ L+++LD E D
Sbjct  502   FDVYVNDDAD-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSITSLLEELDAETD  556

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTLD  1806
             + ++VTLVPKVG   +T+    I  ++
Sbjct  557   NSLVVTLVPKVGKGPITIGGFSIELIN  583



>emb|CDP06099.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   435 bits (1119),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 245/529 (46%), Positives = 323/529 (61%), Gaps = 31/529 (6%)
 Frame = +1

Query  241   KLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCP  420
             KLDRRNVLLG+GG     +      NP A A P+  P    C  AT   S       CCP
Sbjct  67    KLDRRNVLLGIGGGLYGASTFV--GNPSAFAAPLS-PTFTACHDATDPDSK---EIDCCP  120

Query  421   PITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANV  600
             P      +  +   + S +  RPAA  VD+ YL+KYKTAI+KM++L SDDPR+F  QANV
Sbjct  121   PSATAADITDFVPTAPSVIATRPAAQQVDSTYLKKYKTAIEKMRNLSSDDPRSFTAQANV  180

Query  601   HCAYCNGAYLLNGNP-----YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNW  765
             HCAYCNG Y  +G         +H +W FFPFHRWYLYFFE+I Q+M++D TF LP+WNW
Sbjct  181   HCAYCNGGYYQDGYADSSLLLDVHNSWLFFPFHRWYLYFFEKICQNMVDDDTFALPFWNW  240

Query  766   DNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIM  945
             DNPPGM  P IF D +  SPLYD  RN  H    VLDL+Y G D      T +KNNL +M
Sbjct  241   DNPPGMYLPAIFKDSS--SPLYDSLRNPSH-LNTVLDLSYEGTDSTDSTITVIKNNLILM  297

Query  946   YRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYS  1125
             Y+QM+T +  PL FFGK  RA  T   G G+IE  PH +VHRW GDP  ++ E+MG+FYS
Sbjct  298   YKQMVTQSTTPLSFFGKTFRAGETSDPGAGSIETSPHTNVHRWTGDPNESHGENMGSFYS  357

Query  1126  AANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLD  1305
             A  DPVFY+ H+NVDRMW++W +LGG+  +  D DWL++ F F++E    VKV V+DCLD
Sbjct  358   AGRDPVFYAHHANVDRMWSLWNSLGGQ--NFTDSDWLNSSFYFYNEQAKPVKVYVKDCLD  415

Query  1306  NEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPASTDVLPAPLSKNLTFYV-----TR  1470
                LGYT+Q + IPW + KP+ +RT     T   P  + V P  L K +T  V      R
Sbjct  416   TSVLGYTYQTVDIPWLNSKPSPRRTAVALPT--APTPSQVFPTTLEKAITVLVKRPKKKR  473

Query  1471  STSVPETQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEG  1647
             +    ++ EE+L +  + Y+  +F++FDV++NED   +    ++TE  GSF N+PH H  
Sbjct  474   TKKEKQSAEEVLEISGIQYNIGEFVKFDVYINEDTP-DESGPEKTELVGSFINVPHGHSM  532

Query  1648  GSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
              S    TTT +  ISE++++L  +  + VLVTLVPK   S VT++   I
Sbjct  533   IS----TTTKSFDISEVLQELGADEFESVLVTLVPK--SSTVTISGVKI  575



>ref|XP_008225002.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Prunus mume]
Length=594

 Score =   435 bits (1119),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 256/573 (45%), Positives = 335/573 (58%), Gaps = 33/573 (6%)
 Frame = +1

Query  139   PNPSRAARRGDAVKI---RCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgag  309
             PN S+   +  +V +   RC A++   D     L   KLDRRN+L+GLG        G  
Sbjct  36    PNKSQKPTKQCSVSVGGVRCQATNGDNDHLEQGL--GKLDRRNMLIGLGAGGLYGAAGLE  93

Query  310   gSNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRP  489
              +N FA A P+P PD   CGPA     S      CCPPIT T  +  +K+P    L  R 
Sbjct  94    -NNRFAFAAPLPAPDFTECGPADKPDGST---IDCCPPITKT--IIDFKLPDRGPLRTRR  147

Query  490   AAH--AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQI  654
              A   A D  YL K+K AI  M+ LP DDPR+  QQA VHC+YC+G Y   G P    Q+
Sbjct  148   PAQDLAKDPVYLAKFKKAIALMRALPDDDPRSLAQQAMVHCSYCDGGYPQVGFPDLEIQV  207

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H  W F+PFHRWYLYF+E+IM  +I DPTF LP+WNWD P GM  P IF D    S LYD
Sbjct  208   HSCWLFYPFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDPT--SSLYD  265

Query  835   QYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
             QYRN  H+   +LDL Y G D    D T++K NL  MY+QM++ A    LF+G+   A +
Sbjct  266   QYRNAAHQPPKLLDLNYGGSDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGETYSAGD  325

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKT  1194
               S G G IE++PHN++H W GDP+  N E+MG FYSA  DP+FYS HSNVDRMW+I+K 
Sbjct  326   ASSPGAGNIESLPHNNIHLWTGDPKQTNGENMGAFYSAGRDPLFYSHHSNVDRMWSIYKD  385

Query  1195  LGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQD-MPIPWKDFKPT-  1368
             L G  TDI   DWL+TEFLF+DE K  V+VKVRD LD  KLGY + + +PIPW   KP  
Sbjct  386   LLGG-TDIDKADWLNTEFLFYDEKKNLVRVKVRDSLDTRKLGYVYDNKVPIPWLKAKPNP  444

Query  1369  RKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF-  1539
             RK   K     S    T   PA LS  ++  V R ++   T E+    D  LV    +F 
Sbjct  445   RKSQNKRKAAVSSGDLTTTFPATLSDKISVEVARPSTTKRTSEQKKAQDEVLVIKGIEFA  504

Query  1540  ----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKD  1707
                 ++FDVF+N+D D    + D++E+AGSF ++PH  +G +     T   L+I++L+++
Sbjct  505   GNEPLKFDVFVNDDADSEAGK-DQSEFAGSFIHVPH-KQGKNI---KTNLRLSITKLLEE  559

Query  1708  LDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
             LD E D  ++VTLVPK+G   +T+    I  L+
Sbjct  560   LDAETDTSLVVTLVPKLGKGPITIGGFSIELLN  592



>gb|AHH92831.1| polyphenol oxidase [Musa acuminata AAA Group]
Length=588

 Score =   434 bits (1117),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 254/559 (45%), Positives = 336/559 (60%), Gaps = 25/559 (4%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             RR    KI C AS E      +  + AKLDRR+VL+GLGGL GA       S   AL +P
Sbjct  39    RRHAHPKISCKASDEH-----EMTANAKLDRRDVLVGLGGLCGAAAGLGIDSK--ALGNP  91

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPP-ITDTTKVEYYKIPSFSKLNVRPAAHAVDAAY  516
             +  PD+  CGPA +   +   P  CCPP   D   +++ + P+ S L VRPAAH VD+ Y
Sbjct  92    IQAPDLTKCGPADLPTGA--TPTNCCPPYFPDKKIIDFKRPPNSSPLRVRPAAHLVDSDY  149

Query  517   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHR  687
             L+KYK A++ M+ LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +W FFP+HR
Sbjct  150   LDKYKKAVELMRALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPWHR  209

Query  688   WYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGH  867
             +YLYF ERI+  +I D TF LP+WNWD P GM  P I+ D +  S LYD++R+  H+   
Sbjct  210   FYLYFHERILGKLIGDDTFALPFWNWDAPGGMKLPSIYADPS--SSLYDKFRDAKHQPPV  267

Query  868   VLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIEN  1047
             ++DL Y+G D    D  ++  NL IMYRQ+I+N   PLLF G   RA +  + G G++EN
Sbjct  268   LVDLDYNGTDPSFTDAEQIDQNLKIMYRQVISNGKTPLLFLGSAYRAGDNPNPGAGSLEN  327

Query  1048  IPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADK  1227
             IPH  VH W GD    N EDMGNFYSA  DP+F++ HSNVDRMW +WK LGGK  D  DK
Sbjct  328   IPHGPVHGWTGDRSQPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKKLGGKHQDFNDK  387

Query  1228  DWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESV  1407
             DWL+T FLF+DE    V+V ++DCL  E L Y +QD+ IPW   +PT K           
Sbjct  388   DWLNTTFLFYDENADLVRVTLKDCLQPEWLRYDYQDVEIPWLKTRPTPKALKAQKTAAKT  447

Query  1408  PASTDVLPAPLSKNLTF-------YVTRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLN  1563
               +T   P P++             V+RS    E +EE+L ++ + +D   FI+FDVF+N
Sbjct  448   LKATAETPFPVTLQSAVSTTVRRPKVSRSGKEKEEEEEVLIVEGIEFDRDYFIKFDVFVN  507

Query  1564  EDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT-FNLAISELIKDLDLEGDDKVLV  1740
               E    +    +E+AGSF N+PH H+      K  T   L I++L++D+  E DD VLV
Sbjct  508   ATEG-EGITPGASEFAGSFVNVPHKHKHSKKEKKLMTRLCLGITDLLEDIGAEDDDSVLV  566

Query  1741  TLVPKVGGSFVTVNNAYIN  1797
             T+VPK G   V+V    I+
Sbjct  567   TIVPKAGKGKVSVAGLRID  585



>ref|XP_011016645.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=560

 Score =   434 bits (1115),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 239/493 (48%), Positives = 317/493 (64%), Gaps = 30/493 (6%)
 Frame = +1

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPS-FSKLNVRPAAHA  501
             A A P+  PD+ NC    +   + + P  CC P+    K+  ++ PS F  L  R AAH 
Sbjct  62    AYAKPITPPDLTNC--ELVDLPNPENPTNCCSPLP--KKIIDFRPPSPFFPLRTRRAAHL  117

Query  502   VDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFF  672
             VD  Y+ KY  AI  MK LP DDPRNFYQQANVHCAYCNGAY   G P     +HF W F
Sbjct  118   VDEDYVAKYAEAISLMKSLPEDDPRNFYQQANVHCAYCNGAYEQVGFPKLELDVHFCWLF  177

Query  673   FPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQD  852
             FP+HR+YLYF+ERI+  +INDPTF LP+WNWD+P GM  P IF D    SPLYDQ+R+Q+
Sbjct  178   FPWHRYYLYFYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTDPK--SPLYDQFRDQN  235

Query  853   HRYGHVLDLAYSGDDIIAPDPTKV----KNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             H+   +LDL Y+  D   P+PT       +NL +MY+QM++ A  P LFFGKP RA +  
Sbjct  236   HQPPVLLDLDYAAGD---PNPTNANKVYSSNLRVMYKQMVSGAAKPTLFFGKPYRAGDDS  292

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-  1197
               G GTIEN PHN++HRW GDP   N EDMGNFYSAA DP+F+  HSNVDRMWT+WKT+ 
Sbjct  293   RPGAGTIENSPHNNIHRWTGDPTQENTEDMGNFYSAARDPIFFCHHSNVDRMWTLWKTIP  352

Query  1198  GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RK  1374
             GG R DI+D DWL++EFLF++E    V+ KVRDCLDN +L YT+Q++ IPW   KP  R+
Sbjct  353   GGIRRDISDPDWLNSEFLFYNENAELVRCKVRDCLDNRRLRYTYQNVEIPWLKSKPIPRR  412

Query  1375  RTVKLSITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV-YDDTK  1536
                K + T++        P  L K +   V     +RS    E ++E+L ++ + YD  K
Sbjct  413   LGKKAAETKTALTPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDKGK  472

Query  1537  FIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDL  1716
             F++FDVF+N+D ++ + + + TE+AGSF N+ H H   S     T   L I+EL++DL+ 
Sbjct  473   FVKFDVFINDDLEMPS-KPENTEFAGSFVNVSHKHAKKSK----TRLILGITELLEDLET  527

Query  1717  EGDDKVLVTLVPK  1755
             + DD ++V LVP+
Sbjct  528   DDDDSIVVALVPR  540



>ref|XP_009773173.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=606

 Score =   435 bits (1118),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 228/512 (45%), Positives = 316/512 (62%), Gaps = 25/512 (5%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
              +PFA A PVP PDV+ CGPA +   +   P  CCPP T    +++   P  + L  RPA
Sbjct  98    GHPFAFAAPVPGPDVSKCGPADLPPGAA--PVNCCPPTTANI-IDFQLPPPSTTLRTRPA  154

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH+ D+AY+EK+  AIQ MK LP DDPR+F QQANVHCAYC+GAY   G P    Q+HF+
Sbjct  155   AHSADSAYIEKFNRAIQLMKQLPDDDPRSFRQQANVHCAYCDGAYDQLGFPNSELQVHFS  214

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W F PFHR YLYFFE+I+ S+INDPTF +P+WNWD+P GM  P ++   N+ S L+D  R
Sbjct  215   WLFLPFHRCYLYFFEKILGSLINDPTFVIPFWNWDHPDGMRLPAMY--ANRSSSLFDPLR  272

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
             ++ H+   ++DL ++G D    +  +   NL IMYRQM++    P  F G P RA   + 
Sbjct  273   DRRHQPPVMVDLDFNGTDPNISNAQQTSQNLTIMYRQMVSLGSTPATFLGDPYRAGG-EP  331

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
              G G++ENIPH  VH W GD    N E+MG+FYSAA DP+FY+ HSN+DR+W++WKTLGG
Sbjct  332   GGAGSLENIPHGPVHVWTGDRTQPNFENMGDFYSAARDPIFYAHHSNIDRLWSVWKTLGG  391

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP------  1365
             +R D  D D+L+  FLF+DE    V+++VRDCLD  +LGY +Q +  PW + +P      
Sbjct  392   RRQDFTDPDFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGVANPWINSRPRARVSS  451

Query  1366  ---TRKRTVKLSITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDLV  1521
                + +R V+    ++ P++ DV P  L   +   V      R+    + +EE L ++ +
Sbjct  452   ALSSVRRLVEARAADNFPSAKDVFPTKLDHVIRVMVKRPIKKRNKKEKDAKEEFLVVEGI  511

Query  1522  YDDTK-FIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISEL  1698
               +T  F++FDV +N DED   +  +  E+AGSF N+PH   G S   + T   LAI+EL
Sbjct  512   ELETDVFVKFDVLIN-DEDETVISPNNAEFAGSFVNVPHHSHGKSDKKRKTKLKLAITEL  570

Query  1699  IKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             ++DLD E DD V+VT VPK G   V +    I
Sbjct  571   LEDLDAEDDDHVVVTFVPKNGSGAVKIGGVKI  602



>ref|XP_009334704.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   434 bits (1117),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 261/556 (47%), Positives = 331/556 (60%), Gaps = 30/556 (5%)
 Frame = +1

Query  181   IRCAASSEGRDE---NPDSLSK--AKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
             I C A++   +E    P+  S    KLDRRNVLLGLGGLYGA  L      P A A P+ 
Sbjct  53    ISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLA---QKPLAFAAPLA  109

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEK  525
              PD+  C  A I+     V   CCPP++  TK++ +       L  RPAAH V   YL K
Sbjct  110   PPDLTKCTLAEITTGGETV--ACCPPVS--TKIKAFTPDRSIPLRTRPAAHLVTDEYLAK  165

Query  526   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYL  696
             +K A   M+ LP DDPR+  QQANVHCAYCNGAY   G P    Q+HF+W FFPFHR YL
Sbjct  166   FKKAQALMRALPEDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHRMYL  225

Query  697   YFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLD  876
             YF+ERI+  +I+DPTF LPYWNWD+P     P I+ D    SPLYDQYRN  H+   ++D
Sbjct  226   YFYERILGKLIDDPTFALPYWNWDSPVCFPIPDIYTDTT--SPLYDQYRNAGHQPPVLVD  283

Query  877   LAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA-DNTQSSGMGTIENIP  1053
             L+Y G D    + T++  NLAIMYRQM++ A  P LFFG   RA D T  +  GTIEN P
Sbjct  284   LSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGNYAGTIENNP  343

Query  1054  HNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDW  1233
             HN++H W GDP   N EDMGNFYS+  DP+FY+ H NVDRMW IWKTLGGKR D  D DW
Sbjct  344   HNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLGGKRKDPTDTDW  403

Query  1234  LDTEFLFFDETKTAVKVKVRDCLDNEK-LGYTFQDMPIPWKDFKPT-RKRTVKLSITESV  1407
             LD EFLF+DE    V  KVRD +   K L YT++ + +PW   KPT RK   K     S 
Sbjct  404   LDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAKVSA  463

Query  1408  PASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLN-------LDLVYDDTKFIRFDVFLNE  1566
                T   PA      T  V R      T++E  N        D+ ++  + ++FDVF+N+
Sbjct  464   TQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVFIND  523

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTL  1746
             D + +    D++E+AGSF ++PH  + G+ T   T   L I++L++DL +E D  VLVTL
Sbjct  524   DAE-SLSRKDKSEFAGSFVHVPHKQKTGTKT--KTNLKLGITDLLEDLGVEEDSCVLVTL  580

Query  1747  VPKVGGSFVTVNNAYI  1794
             VP+V  S +TV    I
Sbjct  581   VPRVSNSPITVGGFKI  596



>ref|XP_009610962.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   434 bits (1117),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 249/565 (44%), Positives = 346/565 (61%), Gaps = 33/565 (6%)
 Frame = +1

Query  172   AVKIRCAASSEGR-----DENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALAD  336
             + ++ C  S + +      +N DS +   +DRRN+LLGLGGLYGA  +  G S  FA A 
Sbjct  50    SFQVSCKGSEDDQTIYNTSKNSDSSNNKIIDRRNILLGLGGLYGAATIVGGHS--FAFAA  107

Query  337   PVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAY  516
             PV  PDV+ CGPA +   +   P  CCPP T    +++   P  + L  RPAAHA D+AY
Sbjct  108   PVNGPDVSKCGPADLPPGAA--PVNCCPPTTANI-IDFQLPPPSTTLRTRPAAHAADSAY  164

Query  517   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHR  687
             +EK+  AIQ MK LP DDPR+F QQANVHCAYC+GAY   G P    Q+HF+W F PFHR
Sbjct  165   IEKFNRAIQLMKQLPDDDPRSFKQQANVHCAYCDGAYDQLGFPNSELQVHFSWLFLPFHR  224

Query  688   WYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGH  867
              YLYFFE+I+ S+INDPTF +P+WNWD+P GM  P ++   N+ S L+D  R++ H+   
Sbjct  225   CYLYFFEKILGSLINDPTFAIPFWNWDHPDGMRLPAMY--TNRSSSLFDPLRDRRHQPPV  282

Query  868   VLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIEN  1047
             ++DL ++G D    +  +   NL IMYRQM++    P  F G P RA   +  G G++EN
Sbjct  283   MVDLDFNGTDPNISNAQQTSQNLTIMYRQMVSLGSTPTTFLGDPYRAGG-EPGGAGSLEN  341

Query  1048  IPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADK  1227
             IPH  VH W GD    N E+MG+FYSAA DP+FY+ HSN+DR+W++WKTLGG+R D  D 
Sbjct  342   IPHGPVHVWTGDRTQPNFENMGDFYSAARDPIFYAHHSNIDRLWSVWKTLGGRRQDFTDP  401

Query  1228  DWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP---------TRKRT  1380
             D+L+  FLF+DE    V+++VRDCLD  +LGY +Q++  PW + +P         + +R 
Sbjct  402   DFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYAYQNVANPWINSRPRARVSSALSSVRRL  461

Query  1381  VKLSITESVPASTDVLPAPLSKNLTFYV------TRSTSVPETQEEMLNLDLVYDDTK-F  1539
             V+    ++ P++ DV P  L   +   V       R+    + +EE+L ++ +  +T  F
Sbjct  462   VEARAADNFPSAKDVFPTKLDHVIRVMVKRPNKKKRNKKEKDAKEEILVVEGIELETDVF  521

Query  1540  IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLE  1719
             ++FDV +N DED   +  +  E+AGSF N+PH   G S   + T   LAI+EL++DLD E
Sbjct  522   VKFDVLIN-DEDETVISPNNAEFAGSFVNVPHHSHGKSGKKRKTKLKLAITELLEDLDAE  580

Query  1720  GDDKVLVTLVPKVGGSFVTVNNAYI  1794
              DD VLVT VPK G   V +    I
Sbjct  581   DDDHVLVTFVPKNGSGAVKIGGVKI  605



>ref|XP_008442274.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis melo]
Length=576

 Score =   433 bits (1114),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 237/561 (42%), Positives = 342/561 (61%), Gaps = 37/561 (7%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDV  357
             +I C AS    + N  + S  K+DRR++L+GL GLYG+  L    S  FALA P+  P++
Sbjct  27    RISCKAS----NHNDQNTSNPKIDRRDILIGLTGLYGSSTLSQ--SPHFALAAPIQTPNI  80

Query  358   ANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTA  537
             + CGP  +   +   P  CCPP    T +  ++ P  +KL VRPAAH  D  Y+EKYK A
Sbjct  81    SKCGPPDLPPGAD--PTNCCPP--PATTILDFQPPPPTKLRVRPAAHLADQNYIEKYKKA  136

Query  538   IQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNPY--QIHFNWFFFPFHRWYLYFFER  711
             I+ MK LP DDPR+F QQANVHCAYCNGAY   G P   Q+H +W FFPFHR+YLYF E+
Sbjct  137   IELMKALPEDDPRSFTQQANVHCAYCNGAYDQIGFPVEVQVHNSWLFFPFHRFYLYFHEK  196

Query  712   IMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSG  891
             I+  +I D +F LP+WN+D P GM  P ++ +E   S LYD+ RN++H    ++DL + G
Sbjct  197   ILGELIGDSSFALPFWNYDAPGGMKMPRMYAEEK--SSLYDELRNENHLPPRLVDLDFGG  254

Query  892   -DDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVH  1068
              DD    D  ++++NL+IMYRQM++ +  P LFFG      +  S G G++ENIPH  VH
Sbjct  255   VDDPNIGDDAQIRSNLSIMYRQMVSGSRTPSLFFGSAYVEGDEPSPGGGSVENIPHGPVH  314

Query  1069  RWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEF  1248
              W GD    N E+MGNFYSAA DP+F++ HSNVDR+W++WKTLGG+R D+ + +WL+  F
Sbjct  315   VWCGDNDQPNFENMGNFYSAARDPIFFAHHSNVDRLWSVWKTLGGRRKDLQNPEWLNASF  374

Query  1249  LFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESV-------  1407
             +F++E    V+V VRDCLD++ LGYT+Q + +PW   +PT +R  K ++   +       
Sbjct  375   IFYNEKAQPVRVHVRDCLDSKSLGYTYQPVDLPWLQTRPTPRRAQKTTVAFGIASALAAG  434

Query  1408  PASTDVLPAPLSKNLTFYVTRSTSVPETQEE------------MLNLDLVYDDTKFIRFD  1551
             P+S+ V PA +   +T     S  V   ++             ++   + +D    I+FD
Sbjct  435   PSSSRVKPANIKFPITVKSPVSVEVKRPKKSRSKKEKEEEEEVLVIYGIGFDPNNGIKFD  494

Query  1552  VFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDK  1731
             VF+N DED   ++ D TE+AGSF N+PH           T   + I+E+++DL+ + DD 
Sbjct  495   VFIN-DEDDKEIKPDNTEFAGSFVNVPHKQAHKKKV--KTGLRVGITEVLEDLEADNDDS  551

Query  1732  VLVTLVPKVGGSFVTVNNAYI  1794
             ++VT+VPK+G    ++    I
Sbjct  552   IIVTIVPKIGAGLFSIGGLKI  572



>gb|ADF59059.2| polyphenol oxidase V [Pyrus x bretschneideri]
Length=605

 Score =   434 bits (1115),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 255/564 (45%), Positives = 337/564 (60%), Gaps = 33/564 (6%)
 Frame = +1

Query  169   DAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPL  348
             D  K    +S++  +ENP   S   LDRRNVL+GLGGLYG        S+ FALA PV  
Sbjct  55    DQNKNHSTSSNDHDNENP---SPVNLDRRNVLIGLGGLYGGVAGLG--SDHFALAKPVSP  109

Query  349   PDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKY  528
             PD+  CGPA +   S  +P  CCPP +   K+  +K PS  KL VRPAA +VD AY++KY
Sbjct  110   PDIDKCGPADLP--SGALPTNCCPPTS--QKIVDFKFPSPGKLRVRPAAQSVDKAYIDKY  165

Query  529   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLY  699
               AI+ MK LP DDPR+F QQA+VHCAYC+GAY   G P    QIH  W FFPFHR+YLY
Sbjct  166   SKAIELMKALPDDDPRSFSQQADVHCAYCDGAYDEVGFPNLELQIHNCWLFFPFHRYYLY  225

Query  700   FFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDL  879
             F+ERI+  +I DPTF LP+WN+D P GM  P ++   N  SPLYD++R   H+   ++DL
Sbjct  226   FYERILGKLIGDPTFALPFWNYDAPAGMQIPALY--TNPDSPLYDKFRAASHQPPTLIDL  283

Query  880   AYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHN  1059
              ++G D    +  ++  NL +MYRQMI+NA   LLFFG PLRA      G G+IE  PH 
Sbjct  284   DFNGTDETISNDARIDANLKLMYRQMISNAKKQLLFFGAPLRAGTEPDPGQGSIETAPHG  343

Query  1060  SVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLD  1239
              VH W GD    N EDMGNFYSA  DP+F++ HSNVDRMW IWK+LG K  DI D DWLD
Sbjct  344   PVHLWTGDNTQPNIEDMGNFYSAGRDPIFFAHHSNVDRMWNIWKSLGTKNKDINDPDWLD  403

Query  1240  TEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAS-  1416
               FLF+DE    V+V+VRDCLDN+KLGYT++D+ IPW   +PT +RT    + ++   + 
Sbjct  404   AGFLFYDENAELVRVRVRDCLDNKKLGYTYEDVEIPWLKTRPTPRRTKAAGVAKAAETTS  463

Query  1417  ------TDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKFIRFDV---FLN  1563
                   +   P  L   +   V R      +++E  + +  LV D  +F + DV   F  
Sbjct  464   LGKLVGSKDFPVSLETKIRTVVPRPKQKKRSKKEKEDEEEILVIDGIEFDK-DVAVKFDV  522

Query  1564  EDEDVNTVELDR----TEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDK  1731
                DV+  E       +E+AGSF ++PH H+    +       L ++EL++DL  E D+ 
Sbjct  523   CVNDVDDDEAPSGPIYSEFAGSFVSVPHKHKENKRS--KGCLRLGLTELLEDLGAEDDES  580

Query  1732  VLVTLVPKVGGSFVTVNNAYINTL  1803
             V+VTLVP+     V + +  I  L
Sbjct  581   VVVTLVPRFSSQAVKIGSIKIEFL  604



>ref|XP_004485748.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Cicer arietinum]
Length=601

 Score =   434 bits (1115),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 235/520 (45%), Positives = 317/520 (61%), Gaps = 32/520 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             +NPFALA P+  PD++ CGP  +   +      CCPP  ++T +  +KIPS ++ L +R 
Sbjct  84    NNPFALASPISPPDLSTCGPPDLPLGATPNNINCCPP--NSTNIIDFKIPSTNQPLRIRQ  141

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP----YQIH  657
             AAH VD  YL KY  A++ MK LPSDDPR+F QQAN+HCAYC+GAY   G P     Q+H
Sbjct  142   AAHLVDNKYLRKYNKAVELMKSLPSDDPRSFIQQANIHCAYCDGAYSQVGFPSDLDLQVH  201

Query  658   FNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQ  837
              +W FFPFHRWYLYF+ERI+ S+INDPTF LP+WN+D P GM FP I+ D    S LYD+
Sbjct  202   NSWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMQFPTIYTDTK--SSLYDK  259

Query  838   YRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNT  1017
              RN DH+   +++L + GDD    +  +V  NL IMYRQ+++N     LF G   RA + 
Sbjct  260   LRNTDHQPPTLINLNFDGDDDDDVN-ERVSTNLTIMYRQVVSNGKTSKLFLGNSYRAGDE  318

Query  1018  QSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL  1197
                G G++EN+PH +VH W GD    N EDMG FYSAA DP+F+S HSN+DR+W+IWKTL
Sbjct  319   PDPGAGSVENVPHGTVHGWSGDKTQPNREDMGVFYSAARDPIFFSHHSNIDRLWSIWKTL  378

Query  1198  GGK-RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-R  1371
             GGK R D  D DWL++ FLF+DE K  V VKV+DCLD + LGY +QD+ IPW   KPT R
Sbjct  379   GGKNRKDFTDSDWLESGFLFYDENKNLVNVKVKDCLDTKNLGYVYQDVDIPWLKSKPTPR  438

Query  1372  KRTVK-----------LSITESVPASTDVLPAPLSKN---LTFYVTRSTSVPETQEEMLN  1509
              +T K           +    +  +S   +  PL  +    T       S  + ++E   
Sbjct  439   GKTQKKVEVAQGLHFGIGEAHAFESSRKYVKFPLVLDNVVSTIVKRPKKSRSKKEKEEEE  498

Query  1510  LDLVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT  1674
               LV +  +F     ++FDVF+N DED   +    TE+AGSF N+PH +E        + 
Sbjct  499   EVLVIEGIEFERNLAVKFDVFIN-DEDDKVIRPVDTEFAGSFVNVPHFNENKGKKKIISC  557

Query  1675  FNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
               L +++L++DL  E DD V+VTLVP+ G   V + +  I
Sbjct  558   LRLGLTDLLEDLGAEDDDSVVVTLVPRNGKGLVKIRSIKI  597



>ref|XP_009414395.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=590

 Score =   433 bits (1114),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 253/559 (45%), Positives = 335/559 (60%), Gaps = 25/559 (4%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             RR    KI C AS E      +  + AKLDRR+VL+GLGGL GA           AL +P
Sbjct  41    RRHAHSKISCKASDEH-----EMTANAKLDRRDVLVGLGGLCGAAAGLGIDGK--ALGNP  93

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPP-ITDTTKVEYYKIPSFSKLNVRPAAHAVDAAY  516
             +  PD+  CGPA +   +   P  CCPP   D   +++ + P+ S L VRPAAH VD+ Y
Sbjct  94    IQAPDLTKCGPADLPKGA--TPTNCCPPYFPDKKIIDFKRPPNSSPLRVRPAAHLVDSDY  151

Query  517   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHR  687
             L+KYK A++ M+ LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +W FFP+HR
Sbjct  152   LDKYKKAVELMRALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPWHR  211

Query  688   WYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGH  867
             +YLYF ERI+  +I D TF LP+WNWD P GM  P I+ D +  S LYD++R+  H+   
Sbjct  212   FYLYFHERILGKLIGDDTFALPFWNWDAPGGMKLPSIYADPS--SSLYDKFRDAKHQPPV  269

Query  868   VLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIEN  1047
             ++DL Y+G D    D  ++  NL IMYRQ+I+N   PLLF G   RA +  + G G++EN
Sbjct  270   LVDLDYNGTDPSFTDAEQIDQNLKIMYRQVISNGKTPLLFLGSAYRAGDNPNPGAGSLEN  329

Query  1048  IPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADK  1227
             IPH  VH W GD    N EDMGNFYSA  DP+F++ HSNVDRMW +WK LGGK  D  DK
Sbjct  330   IPHGPVHGWTGDRNQPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKKLGGKHQDFNDK  389

Query  1228  DWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESV  1407
             DWL+T FLF+DE    V+V ++DCL  E L Y +QD+ IPW   +PT K           
Sbjct  390   DWLNTTFLFYDENADLVRVTLKDCLQPEWLRYDYQDVEIPWLKTRPTPKALKAQKTAAKT  449

Query  1408  PASTDVLPAPLSKNLTF-------YVTRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLN  1563
               +T   P P++             V+RS    E +EE+L ++ + +D   FI+FDVF+N
Sbjct  450   LKATAETPFPVTLQSAVSTTVRRPKVSRSGKEKEEEEEVLIVEGIEFDRDYFIKFDVFVN  509

Query  1564  EDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTT-FNLAISELIKDLDLEGDDKVLV  1740
               E    +    +E+AGSF N+PH H+      K  T   L I++L++D+  E DD VLV
Sbjct  510   ATEG-EGITPGASEFAGSFVNVPHKHKHSKKEKKLKTRLCLGITDLLEDIGAEDDDSVLV  568

Query  1741  TLVPKVGGSFVTVNNAYIN  1797
             T+VPK G   V+V    I+
Sbjct  569   TIVPKAGKGKVSVAGLRID  587



>gb|ABI96945.1| putative polyphenol oxidase [Prunus mexicana]
Length=452

 Score =   428 bits (1100),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 221/457 (48%), Positives = 295/457 (65%), Gaps = 30/457 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PD++ CG A +   +   P  CCPP+   TK+  +K+P+  KL VRPAAH
Sbjct  1     PFAFAKPVNPPDLSKCGAADLP--TGATPTNCCPPLA--TKIIDFKLPAPGKLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             +VD AY++KY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH +W 
Sbjct  57    SVDQAYIDKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYF+E+I+  +INDPTF LP+WNWD+P GM  P +F   N  SPLYD++R  
Sbjct  117   FFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALF--ANPKSPLYDKFRAA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G D    + T++  NL IMYRQM++NA  P LFFG P RA +    G
Sbjct  175   SHQPPTLIDLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSAA DP+F+S HSNVDRMW+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TDI+  DWLD+ FLF++E    V+VKVRD L+++ LGY +Q++ IPW   KPT +R    
Sbjct  295   TDISQSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPTPRRAKLG  354

Query  1378  ----TVKLSITESVPASTDVL-----PAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVY  1524
                   KL +  +  +ST ++     P  L   ++  V R       ++E    +  LV 
Sbjct  355   LSKIAKKLGVAHAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVI  414

Query  1525  DDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             +  +F     ++FDV++N+ +D+ +   D+TE+AGSF
Sbjct  415   EGIEFDRDVAVKFDVYVNDVDDLPSGP-DKTEFAGSF  450



>ref|XP_009334541.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   433 bits (1114),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 262/556 (47%), Positives = 331/556 (60%), Gaps = 30/556 (5%)
 Frame = +1

Query  181   IRCAASSEGRDE---NPDSLSK--AKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
             I C A++   +E    P+  S    KLDRRNVLLGLGGLYGA  L      P A A P+ 
Sbjct  53    ISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLA---QKPLAFAAPLA  109

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEK  525
              PD+  C  A I+     V   CCPP++  TK++ +       L  RPAAH V   YL K
Sbjct  110   PPDLTKCTLAEITTGGETV--ACCPPVS--TKIKAFTPDRSIPLRTRPAAHLVTDEYLAK  165

Query  526   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYL  696
             +K A   M+ LP DDPR+  QQA VHCAYCN AY   G P    Q+HF+W FFPFHR YL
Sbjct  166   FKKAQALMRALPEDDPRSMVQQAKVHCAYCNDAYPQVGFPDIDIQVHFSWLFFPFHRMYL  225

Query  697   YFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLD  876
             YF+ERI+  +I+DPTF LPYWNWD+P G   P I+ D    SPLYDQYRN  H+   ++D
Sbjct  226   YFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTT--SPLYDQYRNAGHQPPVLVD  283

Query  877   LAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA-DNTQSSGMGTIENIP  1053
             L+Y G D    + T++  NLAIMYRQM++ A  P LFFG   RA D T  +  GTIEN P
Sbjct  284   LSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGNYAGTIENNP  343

Query  1054  HNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDW  1233
             HN++H W GDP   N EDMGNFYS+  DP+FY+ H NVDRMW IWKTLGGKR D  D DW
Sbjct  344   HNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLGGKRKDPTDTDW  403

Query  1234  LDTEFLFFDETKTAVKVKVRDCLDNEK-LGYTFQDMPIPWKDFKPT-RKRTVKLSITESV  1407
             LD EFLF+DE    V  KVRD +   K L YT++ + +PW   KPT RK   K     S 
Sbjct  404   LDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAKVSA  463

Query  1408  PASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVYDDTKF-----IRFDVFLNE  1566
                T   PA      T  V R      T++E  N +  L+  D +F     ++FDVF+N+
Sbjct  464   TQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVFIND  523

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTL  1746
             D + +    D++E+AGSF ++PH  + G+ T   T   L I++L++DL +E D  VLVTL
Sbjct  524   DAE-SLSRKDKSEFAGSFVHVPHKQKTGTKT--KTNLKLGITDLLEDLGVEEDSCVLVTL  580

Query  1747  VPKVGGSFVTVNNAYI  1794
             VP+V  S +TV    I
Sbjct  581   VPRVSNSPITVGGFKI  596



>ref|XP_009782447.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=598

 Score =   432 bits (1112),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 224/504 (44%), Positives = 312/504 (62%), Gaps = 17/504 (3%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
              +PFA A PVP PDV+ CGPA +   +   P  CCPP T    +++   P  + L  RPA
Sbjct  98    GHPFAFAAPVPGPDVSKCGPADLPPGAA--PVNCCPPTTANI-IDFQLPPPSTTLRTRPA  154

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH+ D+AY+EK+  AIQ MK LP +DPR+F QQANVHCAYC+GAY   G P    Q+H +
Sbjct  155   AHSADSAYIEKFNRAIQLMKQLPDNDPRSFKQQANVHCAYCDGAYEQLGFPSSELQVHSS  214

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W FFPFHR YLYFFE+I+ S+INDPTF +P+WNWD+P GM  P ++   N+ S L+D  R
Sbjct  215   WLFFPFHRCYLYFFEKILGSLINDPTFAIPFWNWDHPDGMRLPAMY--ANRSSSLFDPLR  272

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
             +Q H+   ++DL ++G D    +  +   NL IMYRQM++    P  F G P RA   + 
Sbjct  273   DQKHQPPVIVDLDFNGADPNISNAQQTSQNLTIMYRQMVSLGSTPAAFLGDPYRAGG-EP  331

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
              G G++ENIPH +VH W GD    N E+MG FY+A  DP+FY+ HSN+DR+W++WKTLGG
Sbjct  332   GGAGSLENIPHGTVHVWTGDRTQPNFENMGVFYAAGRDPIFYAHHSNIDRLWSVWKTLGG  391

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTV  1383
             +R D  D D+L++ FLF+DE    V+++VRDCLD  +LGY +Q +  PW + +P  + + 
Sbjct  392   RRQDFTDPDFLNSSFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGVVNPWINSRPRARVSS  451

Query  1384  KLSITESVPASTDVLPAPLSKNLTFYV------TRSTSVPETQEEMLNLDLVYDDTK-FI  1542
              LS    +  + D  P  L   +   V       R+    + +EE L ++ +  +T  F+
Sbjct  452   ALSSVRRLAEAKDYFPTKLDHVIRVMVKRPNNKKRNKEEKDAKEEFLVVEGIELETDVFV  511

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FDV +N DED   +  +  E+AGSF N+PH+  G S   + T   LAI+EL++DLD E 
Sbjct  512   KFDVLIN-DEDETVISPNNAEFAGSFVNVPHLSHGKSDEKRKTKLKLAITELLEDLDAED  570

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             DD V+VT VPK G   V +    I
Sbjct  571   DDHVVVTFVPKNGSGAVKIGGVKI  594



>ref|XP_006347083.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum tuberosum]
Length=616

 Score =   433 bits (1114),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 246/551 (45%), Positives = 331/551 (60%), Gaps = 38/551 (7%)
 Frame = +1

Query  223   DSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSSCKV  402
             DSL+   +DRRNVLLGLGGLYGA  L  G   PFALA PV  PDV  CG A +   +   
Sbjct  73    DSLNNM-IDRRNVLLGLGGLYGASTLVGGL--PFALAAPVNGPDVTKCGAADLPPGAA--  127

Query  403   PYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNF  582
             P  CCPP++    +  +++PS + L  RPAAH+VD+AY+EK+   IQ MK LP DDPR+F
Sbjct  128   PVNCCPPMSGN--IIDFQLPSSTALRTRPAAHSVDSAYIEKFNRGIQLMKQLPDDDPRSF  185

Query  583   YQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLP  753
              QQANVHCAYC+GAY   G P    Q+H +W F PFHR YLYFFERI+ S+INDPTF +P
Sbjct  186   KQQANVHCAYCDGAYDQLGFPNSELQVHSSWIFLPFHRCYLYFFERILGSLINDPTFAMP  245

Query  754   YWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNN  933
             +WNWD+P GM  PG++   N  S LYD+ R++ H+   ++DL ++G D    +  +   N
Sbjct  246   FWNWDHPDGMRMPGLY--TNSTSSLYDRLRDRRHQPPTMVDLDFNGTDPNISNAQQTSQN  303

Query  934   LAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMG  1113
             L  MYRQM++    P  F G P RA      G G++EN+ H +VH W GD   AN E+MG
Sbjct  304   LTNMYRQMVSLGRTPETFLGDPYRAGGV-PGGAGSLENMAHGAVHVWTGDRTQANFENMG  362

Query  1114  NFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVR  1293
             +FYSAA DP+FY+ HSN+DR+WT+WKTLGG+R D  D D+L+T FLF+DE    V+++VR
Sbjct  363   DFYSAARDPIFYAHHSNIDRLWTVWKTLGGRRQDFTDPDFLNTSFLFYDEKAQMVRIRVR  422

Query  1294  DCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESV---------------PASTDVL  1428
             D LD+ KLGY +Q++  PW + +PT + +  LS    +               P   ++ 
Sbjct  423   DVLDSSKLGYVYQNVTNPWINSRPTPRVSRALSSVRRLVEAKAADDNSNVMNFPRPKEIF  482

Query  1429  PAPLSKNLTFYVTRSTSVPETQEE-------MLNLDLVYDDTKFIRFDVFLNEDEDVNTV  1587
             P  L   +   V R       ++E       ++   L  +   F++FDV +N DED   V
Sbjct  483   PTKLDHVIKVMVKRPNKKKRNKKEKNEKEEILIVEGLEVESDVFVKFDVLIN-DEDETLV  541

Query  1588  ELDRTEYAGSFGNLPHVHEGGSA--TPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVG  1761
               D  E+ GSF N+PH   G     + + T   LAI+EL++DLD E D+ VLVT VPK G
Sbjct  542   SPDNAEFVGSFVNVPHHSHGKGEKNSKRKTKLKLAITELLEDLDAENDENVLVTFVPKNG  601

Query  1762  GSFVTVNNAYI  1794
                V +    I
Sbjct  602   SGAVKIGGVKI  612



>ref|XP_011083298.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=579

 Score =   432 bits (1110),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 245/555 (44%), Positives = 340/555 (61%), Gaps = 29/555 (5%)
 Frame = +1

Query  157   ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALAD  336
             A R    ++ C   +     N +  +  K+DRRN+LLGL GLYGA NL    S+P A A 
Sbjct  37    ASRRHRFQVSCKGVA-----NQEPTADGKVDRRNMLLGLSGLYGAANLV---SDPQAYAA  88

Query  337   PVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAY  516
             P+  P+   CG A    +   +   CCP  +D  K+  YK+P  +K+ +RPAAH V   Y
Sbjct  89    PIEAPEFKACGEARDVATGDLLDVNCCPLPSD--KIIDYKLPPVNKMRIRPAAHKVTKEY  146

Query  517   LEKYKTAIQKMKDLPSDDP---RNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFP  678
             L K++ AI++MK L  DDP   R F QQAN+HCAYCNGA+   G      Q+H +W FFP
Sbjct  147   LAKFEEAIRRMKALDKDDPTDPRGFMQQANIHCAYCNGAHDQVGYKNLDIQVHNSWLFFP  206

Query  679   FHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHR  858
             FHRWYLYF+ERI+  +I+DPTF LP+WNWDNP GM  P IFD  N  SPLY+  RNQ +R
Sbjct  207   FHRWYLYFYERILGKLIDDPTFVLPFWNWDNPKGMQMPKIFD--NTGSPLYNANRNQANR  264

Query  859   YGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGT  1038
                ++DL +SG    + D  KV NNL +MY +MI +    + F G+P RA N+ S GMG+
Sbjct  265   PPAIIDLGFSG---ASDDLQKVVNNLTVMYSEMIRSVNSTIDFMGQPYRAGNSPSPGMGS  321

Query  1039  IENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR-TD  1215
              E   H + H WVG+P++   EDMGNFYSA  D +FY  H+NVDRMW+IW+TL      D
Sbjct  322   SERGSHVAAHVWVGNPKNKYREDMGNFYSAGRDTLFYCHHANVDRMWSIWRTLKTDVPKD  381

Query  1216  IADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRK--RTVKL  1389
             I D D+L+  FLF+DE K  V+VKV DCLD+ ++GY F+ + IPW ++KP RK  +    
Sbjct  382   ITDPDFLNAAFLFYDENKQLVRVKVADCLDHRRMGYDFERVDIPWLNYKPPRKAAKAKVE  441

Query  1390  SITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKFIRFDVFLNED  1569
             +I++      D+ P  L K +T  +   ++  +  E ++  ++  D TKFI+FDVF+N D
Sbjct  442   TISQGAQKPEDLFPLNLKK-ITRVLVPKSAKGKADEVLVLENIETDTTKFIKFDVFVN-D  499

Query  1570  EDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLV  1749
             ED N  ELD+ EYAG+F  +PH  +        +T +L ++EL +D+D+  DD ++VTL+
Sbjct  500   EDDNAEELDKAEYAGTFAQVPHKTKDKKG---KSTISLRLTELYEDIDVADDDTIVVTLI  556

Query  1750  PKVGGSFVTVNNAYI  1794
             P+  G  VT+    I
Sbjct  557   PRSNGDDVTIGGIKI  571



>ref|XP_007148200.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
 gb|ESW20194.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
Length=576

 Score =   432 bits (1110),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 250/554 (45%), Positives = 341/554 (62%), Gaps = 41/554 (7%)
 Frame = +1

Query  148   SRAARRGDAVKIRCAASSEGRDENP--DSLSKAKLDRRNVllglgglygaynlgaggSNP  321
             +R  +     ++ C  +   +  NP  + L     +RRNVLLGLGGL GA  L    +NP
Sbjct  38    TRKPKHNHIPRVTCRGNPNHQTPNPSEEQLPHIVENRRNVLLGLGGLCGAVTLN---NNP  94

Query  322   FALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP-SFSKLNVRPAAH  498
             FA A PV  PD+  CGP  ++      P  CCPP   ++K+  +K P S   L VRPAAH
Sbjct  95    FAFAAPVLPPDLTTCGPPDLA--EGVKPINCCPP---SSKIIDFKFPPSNQPLRVRPAAH  149

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
              V   YL KYK A+  MK LPS+DPR+F QQANVHCAYC+GAY   G P    Q+H +W 
Sbjct  150   LVTDDYLAKYKKALDLMKKLPSNDPRSFMQQANVHCAYCDGAYHQVGFPDLDLQVHNSWL  209

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHRWYLYF+ERI+ S+INDPTF LP+WNWD P GM  P I+ D    SPLYD  RN 
Sbjct  210   FFPFHRWYLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYADPK--SPLYDPLRNS  267

Query  850   DHRYGHVLDLAYSGDDIIAPDP-TKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSS  1026
             +H+   ++DL +   DI  PD   K+ +NL IMYRQ+++N   P LF G   RA +    
Sbjct  268   NHQPPTLVDLDF---DIEDPDADGKISSNLTIMYRQVVSNGKTPRLFLGNAYRAGDEPDP  324

Query  1027  GMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGK  1206
             G G++EN+PH  VH W GD    N E+MG FYSAA DP+F+S HSN+DRMW+IWKTLGGK
Sbjct  325   GGGSVENVPHGPVHVWTGDIDQPNIENMGTFYSAARDPIFFSHHSNIDRMWSIWKTLGGK  384

Query  1207  RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT--RKRT  1380
             R D +D DWL++  LF+DE K  V+VKV+DCLD  KLGY +QD+ +PW + +PT  + R 
Sbjct  385   RRDFSDSDWLESGLLFYDEDKNLVRVKVKDCLDTTKLGYVYQDVDVPWLNSRPTPVKSRA  444

Query  1381  VKLSITESVPASTDVLPAPLSKNLTFYV---------------TRSTSVPETQEEMLNLD  1515
              K+++T++         A  S+N+ F +               +RS    E +EE+L ++
Sbjct  445   RKVAVTQNFGVGA-ARAAETSRNVKFPLVLDSVVSTRVQRPKKSRSKKAKEEEEEVLVIE  503

Query  1516  LV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              + +D    ++FDVF+N DED   +  D TE+AGSF ++ H H+  + + K T   L ++
Sbjct  504   GIEFDRNTPVKFDVFVN-DEDDKVIRPDNTEFAGSFVSVAHTHKHKNKSMK-TCLRLGLT  561

Query  1693  ELIKDLDLEGDDKV  1734
             +L+++L+ + DD V
Sbjct  562   DLLEELEADDDDSV  575



>gb|ABI96946.1| putative polyphenol oxidase [Pyrus communis subsp. caucasica]
Length=453

 Score =   427 bits (1098),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 220/458 (48%), Positives = 293/458 (64%), Gaps = 31/458 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AH
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPQGAEAT--NCCPP--PATKIIDFKLPAPAKLRIRPPAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W 
Sbjct  57    AVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+ D    SPLYD++R+ 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPK--SPLYDKFRSA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G
Sbjct  175   KHQPPTLIDLDYNGTEDNVSTETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TD+ADKDWLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPTR+R    
Sbjct  295   TDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTRRRAKVA  354

Query  1378  ----TVKLSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLN  1509
                   KL +  +  AS+  +      P  L   ++  V R      S    E +EE+L 
Sbjct  355   LGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILV  414

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             ++ + +D    ++FDVF+N+ +D+ +   D+TE+AGSF
Sbjct  415   IEGIEFDRDVAVKFDVFVNDVDDLPSGP-DKTEFAGSF  451



>ref|XP_004146644.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis sativus]
 gb|KGN64656.1| hypothetical protein Csa_1G073640 [Cucumis sativus]
Length=577

 Score =   431 bits (1108),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 234/568 (41%), Positives = 343/568 (60%), Gaps = 34/568 (6%)
 Frame = +1

Query  160   RRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADP  339
             R+   + I    S +  + N  +    K+DRR++L+GL GLYG+  L    S  FALA P
Sbjct  17    RKTKTLLITPRISCKATNHNDQNFPNPKIDRRDILIGLTGLYGSSTLSQ--STHFALAAP  74

Query  340   VPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYL  519
             +  P+++ CGP  +   +      CCPP    T +  ++ P  SKL VRPAAH  D  Y+
Sbjct  75    IETPNISKCGPPDLPPGADAT--NCCPP--PATTILDFQPPPPSKLRVRPAAHLADRNYI  130

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNPY--QIHFNWFFFPFHRWY  693
             EKYK A++ MK LP DDPR+F QQANVHCAYCNGAY   G P   Q+H +W FFPFHR+Y
Sbjct  131   EKYKKAVELMKALPEDDPRSFTQQANVHCAYCNGAYDQVGFPVEVQVHNSWLFFPFHRFY  190

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYF E+I+  +I DP+F LP+WN+D P GM  PG++ +E   S LYD+ RN++H    ++
Sbjct  191   LYFHEKILGELIGDPSFALPFWNYDAPDGMKMPGMYAEEK--SSLYDELRNENHLPPRLV  248

Query  874   DLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIP  1053
             DL + G D    D  ++K+NL+IMYRQM++ +  P LFFG    A +  S G G++ENIP
Sbjct  249   DLDFGGVDPNIGDDAQIKSNLSIMYRQMVSGSRTPSLFFGSAYVAGDEPSPGGGSVENIP  308

Query  1054  HNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDW  1233
             H  VH W GD    N E+MGNFYSAA DP+F++ HSN+DR+W++WKTLGG+R ++ + +W
Sbjct  309   HGPVHVWCGDTDQPNFENMGNFYSAARDPIFFAHHSNIDRLWSVWKTLGGRRQNLQNPEW  368

Query  1234  LDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLS-------  1392
             L+  F+F+DE    ++V+VRDCLD++ LGY +Q + +PW   +PT +R  K S       
Sbjct  369   LNASFIFYDEKAQPIRVRVRDCLDSKSLGYIYQPVDLPWLQTRPTPRRAQKTSTVAFGIA  428

Query  1393  --ITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE------------MLNLDLVYDD  1530
               +    P+S+ V PA +   +T     S  V   ++             ++   + +D 
Sbjct  429   PALAAGGPSSSRVKPANIKFPITVKSPVSVEVKRPKKSRSKKEKEEEEEVLVIYGIGFDP  488

Query  1531  TKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDL  1710
                I+FDVF+N DED   ++ D TE+AGSF N+PH H         T   + I+E ++DL
Sbjct  489   NNGIKFDVFIN-DEDDKEIKPDNTEFAGSFVNVPHKHG--HKKKVKTGLRVGITEELEDL  545

Query  1711  DLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             + + DD ++VT++P++G    +++   I
Sbjct  546   EADNDDSIIVTILPRIGAGLFSIDGLKI  573



>gb|ABI96929.1| putative polyphenol oxidase [Chamaebatiaria millefolium]
Length=453

 Score =   426 bits (1096),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 222/459 (48%), Positives = 294/459 (64%), Gaps = 33/459 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +   P  CCPP    TK+  +K+P+ ++L VRPAAH
Sbjct  1     PFAFAKPVAPPDVSKCGAADLP--TGAEPMNCCPP--PATKIIDFKLPAPTRLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
              VD AY++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QIH +W 
Sbjct  57    TVDQAYIDKYTKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYF+E+I+  +INDPTF LP+WNWD+P GM  P IF + N  SPLYD+ RN 
Sbjct  117   FFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPAIFANPN--SPLYDKLRNA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
             +H+  +++DL Y+G D    + T++  NL IMYRQM++NA  PLLF   P RA +    G
Sbjct  175   NHQPPNLVDLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPLLFL-NPYRAGDEPDPG  233

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  +H W GD    N EDMGNFYSA  DP+FYS HSNVDRMW IWKTLGGKR
Sbjct  234   GGSIEGTPHGPIHLWTGDNTQPNFEDMGNFYSAGRDPIFYSHHSNVDRMWAIWKTLGGKR  293

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKL  1389
             TDI DKDWLD+ FLF++E    V+VKVRD L+++ LGY +Q++ IPW D KPT  R  KL
Sbjct  294   TDITDKDWLDSGFLFYNENAELVRVKVRDSLESKNLGYVYQEVDIPWLDSKPTPIRGAKL  353

Query  1390  SITESVPASTDVLPAPLSK-----------NLTFYVTRSTSVP----------ETQEEML  1506
             ++++          A LS            NL   ++     P          E +EE+L
Sbjct  354   AVSKIAKKLGHARAAELSSSKVVPQSDFPINLETKISTVVKRPQQKKRNKKQKEDEEEIL  413

Query  1507  NLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
              ++ + +D    ++FDV++N+ +D+ +   + TE+AGSF
Sbjct  414   VIEGIEFDRDVAVKFDVYVNDVDDLPSGPAN-TEFAGSF  451



>gb|AII22011.1| polyphenol oxidase-9 [Gossypium hirsutum]
Length=567

 Score =   430 bits (1106),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 248/549 (45%), Positives = 339/549 (62%), Gaps = 29/549 (5%)
 Frame = +1

Query  181   IRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVA  360
             I C A + G  E+P    K K DRR+VL+GLGGLY             A+A P+  P++ 
Sbjct  33    IPCKAIN-GEQEHP----KHKFDRRDVLIGLGGLYYGAASLND-----AMAAPISAPEME  82

Query  361   NCGPATISFSSCKVPYRCCPPITDTTKVEYYKIP-SFSKLNVRPAAHAVDAAYLEKYKTA  537
              CG A +          CCPP++   ++  +K P S S + VRPAAH VD  Y+ KY  A
Sbjct  83    KCGRADVPEGVQTT--DCCPPVS--KRILDFKPPFSNSPVRVRPAAHLVDDEYIRKYSKA  138

Query  538   IQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFE  708
             I+ MK LP DDPR+F QQANVHCAYC GAY   G P    Q+H +W FFPFHR+YLYFFE
Sbjct  139   IELMKALPHDDPRSFMQQANVHCAYCEGAYDQVGFPNLELQVHNSWLFFPFHRYYLYFFE  198

Query  709   RIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYS  888
             RI+  +I+DPTF LP+WNWD+P GM  P +F D N  S LYD++RN  H    ++DL Y+
Sbjct  199   RILGHLIDDPTFGLPFWNWDSPAGMWMPDMFMDTN--SSLYDKFRNSRHYPPTMVDLDYN  256

Query  889   GDDIIAPDPTK--VKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNS  1062
             G+D       K  VK+NL+IMYRQM++NA  P LF G P RA +    G G+IEN+PH  
Sbjct  257   GEDEHETKMNKDQVKSNLSIMYRQMVSNAKTPRLFLGGPFRAGDEPYQGSGSIENVPHGP  316

Query  1063  VHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG-KRTDIADKDWLD  1239
             VH W GD +  N EDMG FYSAA DP+FY+ HSNVDRMW++WKT+    R D  D DWL+
Sbjct  317   VHVWCGDDKQPNGEDMGTFYSAARDPIFYAHHSNVDRMWSVWKTIENINRKDFDDPDWLN  376

Query  1240  TEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESVPAST  1419
               FLF+DE    V+VKVRDCLD+  LGY +Q + +PW   KPT ++  K +     P S+
Sbjct  377   ASFLFYDENANLVRVKVRDCLDHRNLGYVYQFVDLPWLKEKPTPRKLTKKNKAPPPPVSS  436

Query  1420  D--VLPAPLSKNLTF-YVTRSTSVPETQEEMLNLDLVYDDTKFIRFDVFLNEDEDVNT-V  1587
                VL  P+  N+     +RS +  E +EE+L +D+      F++FDV++N+++D  + +
Sbjct  437   TEFVLDKPVRVNVERPRKSRSKTEKEEKEEILVIDIELKGDLFVKFDVYVNDEDDAGSNI  496

Query  1588  ELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGS  1767
               + TE+AGS+ N+P+ H+ G      T   L +++L++DL  + DD ++VTLVPK G  
Sbjct  497   GSENTEFAGSYVNVPNKHKQGKTL--KTRLRLGLTDLLEDLGADDDDGIVVTLVPKYGKG  554

Query  1768  FVTVNNAYI  1794
              + ++   I
Sbjct  555   NIKISGIKI  563



>ref|XP_003593517.1| Polyphenol oxidase A1 [Medicago truncatula]
 gb|ABN08604.1| Tyrosinase [Medicago truncatula]
 gb|AES63768.1| polyphenoloxidase [Medicago truncatula]
Length=608

 Score =   432 bits (1110),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 238/527 (45%), Positives = 324/527 (61%), Gaps = 40/527 (8%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRP  489
             +NPFALA P+  PD++ CGP  +   +      CCPP  ++TK+  YK PS ++ L VR 
Sbjct  85    ANPFALASPISAPDLSTCGPPDLPSGATPSGLNCCPP--NSTKIIDYKFPSSTQPLRVRQ  142

Query  490   AAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHF  660
             AAH V+  YL+KYK AI+ MK LPS+DPRNF QQAN+HCAYC+GAY   G P    Q+H 
Sbjct  143   AAHLVNDEYLQKYKKAIELMKALPSNDPRNFIQQANIHCAYCDGAYSQVGFPNLDLQVHS  202

Query  661   NWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQY  840
             +W FFPFHRWYLYF+ERI+ S+INDPTF LP+WN+D P GM FP I+ D  + SPLYD+ 
Sbjct  203   SWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMQFPSIYTD--RTSPLYDEL  260

Query  841   RNQDHRYGHVLDLAYS-GDDIIAPDPT-KVKNNLAIMYRQMITNAPCPLLFFGKPLRADN  1014
             RN +H+   ++D  Y  GDD    D   ++  NL IMYRQ+++      LF G P RA +
Sbjct  261   RNANHQPPTLIDFNYVPGDDSDEVDENERISTNLTIMYRQVVSGGKTSTLFLGNPYRAGD  320

Query  1015  TQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKT  1194
                 G G++E +PHN VH W GD    N EDMG+FYSAA DP+F+S HSN+DR W+IWKT
Sbjct  321   APDPGAGSVEIVPHNIVHLWSGDDTQPNFEDMGDFYSAARDPIFFSHHSNIDRFWSIWKT  380

Query  1195  LGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRK  1374
             LGGKR D  DKDWL++EFLF+DE K  VKV V+DCLD +KLGY +QD+ IPW + KPT  
Sbjct  381   LGGKRKDFNDKDWLESEFLFYDENKNLVKVNVKDCLDTKKLGYVYQDVDIPWLNAKPTPC  440

Query  1375  RTVKLSITESVPASTDVLPAPLS---KNLTFYVTRSTSVPETQEEMLNL-----------  1512
             + ++  +  +   S     A LS   +NLT         P   ++M++            
Sbjct  441   KKIQKKVEVAQGNSFGTGKARLSEINENLT-NSRNDIKFPLVLDDMVSTTVKRPKKSRSK  499

Query  1513  -------------DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGS  1653
                           +V+D    ++FDVF+N+ + V  V+   TE+AGSF N+PH     +
Sbjct  500   KEKEEEEEVLVIEGIVFDTKACVKFDVFINDKDKV--VKPFNTEFAGSFVNVPHSLHEQT  557

Query  1654  ATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
                  ++    +++L++DL ++ DD V+VTLVP+ G   V + N  I
Sbjct  558   MKNINSSCRFGLTDLLEDLGVDDDDSVVVTLVPRYGKGLVKIRNIMI  604



>gb|AFO55219.1| chloroplast polyphenol oxidase III [Eriobotrya japonica]
Length=614

 Score =   432 bits (1110),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 253/542 (47%), Positives = 323/542 (60%), Gaps = 25/542 (5%)
 Frame = +1

Query  208   RDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISF  387
             +D+   S    KLDRRNVL+GLGGLYGA  L      P A A+P+  PD+  C  A I+ 
Sbjct  81    QDQQQSSNLLGKLDRRNVLIGLGGLYGATTLV---PKPLAFANPLAPPDLTKCTLAEITT  137

Query  388   SSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSD  567
                 V   CCPP++  TK++ +       L  RPAAH V   YL K+K A   M+ LP D
Sbjct  138   GGETV--ECCPPVS--TKIKTFTPDLSIPLRTRPAAHLVTDEYLAKFKKAQALMRALPED  193

Query  568   DPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDP  738
             DPR+  QQA VHCAYCNGAY   G P    Q+HF+W FFPF   YLYF+ERI+  +I+DP
Sbjct  194   DPRSMVQQAKVHCAYCNGAYPQIGFPDIDIQVHFSWLFFPFPPMYLYFYERILGKLIDDP  253

Query  739   TFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPT  918
             TF LPYWNWD+  G   P I+ D    SPLYDQYRN DH+   ++DL+Y G D    + T
Sbjct  254   TFALPYWNWDSLDGFPIPDIYTDTT--SPLYDQYRNADHQPPVLVDLSYGGTDDDVDEQT  311

Query  919   KVKNNLAIMYRQMITNAPCPLLFFGKPLRA-DNTQSSGMGTIENIPHNSVHRWVGDPRSA  1095
             ++  NLAIMYRQM++ A  P LFFG   RA D T  +  GTIEN PHN++H W GDP   
Sbjct  312   RIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGTYAGTIENTPHNNIHLWCGDPNQT  371

Query  1096  NHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTA  1275
             N EDMGNFYSA  DP+FY+ H NVDRMW IWKTLGGKR D  D DWLD EFLF+DE    
Sbjct  372   NKEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLGGKRKDPTDTDWLDAEFLFYDENAEL  431

Query  1276  VKVKVRDCLDNEK-LGYTFQDMPIPWKDFKPT-RKRTVKLSITESVPASTDVLPAPLSKN  1449
             V  KVRD L   K L YT++ + +PW   KPT RK   K     +    T   PA     
Sbjct  432   VSCKVRDSLKPAKDLRYTYEPVSVPWLFTKPTARKPKSKTKAKVAATQLTTKFPATFDSK  491

Query  1450  LTFYVTRSTSVPETQEEMLNLD--LVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEY  1608
              T  V R      T++E ++ +  L+  D +F     ++  VF+N+D + +    D++E+
Sbjct  492   TTVEVARPKPRKRTKKEKIDEEEVLIIKDIEFESNEAVKLIVFINDDAE-SLSRKDKSEF  550

Query  1609  AGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNA  1788
             AGSF ++PH  + G  T K T   L I++L++DL  E +  VLVTLVP+V  S +T+   
Sbjct  551   AGSFVHVPHNQKTG--TKKKTNLKLGITDLLEDLGAEDESSVLVTLVPRVSNSPITIGGF  608

Query  1789  YI  1794
              I
Sbjct  609   KI  610



>gb|ABI96926.1| putative polyphenol oxidase [Cercocarpus betuloides]
Length=455

 Score =   426 bits (1095),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 222/460 (48%), Positives = 294/460 (64%), Gaps = 33/460 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +   P  CCPP+   +K+  +K+PS + L VRPAAH
Sbjct  1     PFAFAKPVAPPDVSKCGAADLP--TGAQPTNCCPPVA--SKIIDFKLPSPTPLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY+EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH +W 
Sbjct  57    AVDKAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYF E+I+ S+I DPTF LP+WNWD P GM  P I+   N  SPLYD++R  
Sbjct  117   FFPFHRYYLYFHEKILGSLIGDPTFALPFWNWDAPAGMPLPAIY--ANPKSPLYDKFRAA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
             +H+   ++DL ++G +  A + T++  NL IMYRQM++NA  P LFFG P RA +    G
Sbjct  175   NHQPPTLVDLDFNGTEDAASNETQINANLKIMYRQMVSNAKTPQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSA  DP+F++ HSNVDR+W+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRLWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT---  1380
             TDI D DWLD+ FLF+DE    V+VKVRDCL+++ LGY +QD  IPW + KPT +R    
Sbjct  295   TDITDTDWLDSGFLFYDENAQMVRVKVRDCLESKNLGYVYQDANIPWLESKPTPRRVKAA  354

Query  1381  -----VKLSITES--------VPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD--  1515
                   KL +  +        V A      A L   ++  V R      +++E    +  
Sbjct  355   LGKIAKKLHVAHAADNSSASKVVARAAFPIAKLDTKMSTVVARPKQKKRSKKEKEQEEEI  414

Query  1516  LVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             LV +  +F     ++FDV++N+++D+ +   D++E+AGSF
Sbjct  415   LVIEGIEFDRDVAVKFDVYVNDEDDLPSGP-DKSEFAGSF  453



>ref|XP_010245321.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=597

 Score =   431 bits (1107),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 251/539 (47%), Positives = 340/539 (63%), Gaps = 31/539 (6%)
 Frame = +1

Query  232   SKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYR  411
             S  +LDRRNVL+GLGGLYGA  LG   ++  A   P+  PD++ CG A +   +   P  
Sbjct  68    SLGRLDRRNVLIGLGGLYGATGLG---ADRLAFGAPIMPPDLSKCGAANLPAGA--KPTN  122

Query  412   CCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQ  588
             CCPP +  +++  +K+PS S+ + VRPAAH VD  Y+ KY  AI  MK LP+DDPRNF Q
Sbjct  123   CCPPAS--SEIVDFKLPSSSEPMRVRPAAHMVDEEYIAKYSKAIALMKALPADDPRNFTQ  180

Query  589   QANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYW  759
             QANVHCAYC+GAY   G P    Q+H +W FFPFHR+YLYF+ER++  +I+DPTF LPYW
Sbjct  181   QANVHCAYCDGAYDQIGFPDLELQVHNSWLFFPFHRYYLYFYERMLGKLIDDPTFALPYW  240

Query  760   NWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLA  939
             NWD P GM  P ++ + N  SPLYD+ R+  H+   ++DL Y+  D        +KNNLA
Sbjct  241   NWDAPAGMKMPTMYANPN--SPLYDKLRDAKHQPPTMIDLNYNVQDTTMTPEQLLKNNLA  298

Query  940   IMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNF  1119
              MYRQ+++N     LF G P RA +    G G++EN+PH  VH W GD    N E+MGNF
Sbjct  299   TMYRQVVSNGSTAQLFLGSPYRAGDQPDPGFGSLENVPHGPVHLWAGDRTQPNIENMGNF  358

Query  1120  YSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDC  1299
             YSAA DP+FY+ HSNVDRMWTIWK LGG+R D  D DWL+  FL +DE K  V+VKVRDC
Sbjct  359   YSAARDPIFYAHHSNVDRMWTIWKKLGGRRKDFKDPDWLNAGFLLYDENKQLVRVKVRDC  418

Query  1300  LDNEKLGYTFQDMPIPWKDFKPTRKRTV----KLSITE----SVPASTDVLPAPLSKNLT  1455
             LD +KL Y++QD+ IPW   +PT  + +    KL IT+        +    P  L     
Sbjct  419   LDEKKLRYSYQDVEIPWMKTRPTPGKLMAAAQKLKITDRGLKKKKPTVSEFPKELDAPFK  478

Query  1456  FYV-----TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGS  1617
               V     +RS    E +EE+L +D V  +    ++FDV++N++++ +    D++E+AGS
Sbjct  479   VVVKRPRKSRSKKEKEDEEEILVIDQVELERDTVVKFDVYINDEDEPSP---DKSEFAGS  535

Query  1618  FGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             F N+PH H G   +   T     ISEL++DL+ E DD+V+VT+VP++GG  VT+    I
Sbjct  536   FVNVPHKH-GKKMSKLKTCLRFGISELLEDLEAEDDDEVVVTIVPRIGGDLVTIGGIKI  593



>gb|ABI96951.1| putative polyphenol oxidase [Vauquelinia californica]
Length=453

 Score =   425 bits (1093),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 219/458 (48%), Positives = 294/458 (64%), Gaps = 31/458 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PDV+ CG A +   +      CCPP    TK+  +K+P+ SKL +RP AH
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEVT--NCCPP--PATKIIDFKLPAPSKLRIRPPAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W 
Sbjct  57    AVDQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGYPELELQVHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF +P+WNWD+PPGM  P I+ D    SPLYD++R+ 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPPGMPLPAIYADPK--SPLYDKFRSA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
             +H+   ++DL Y+G +    + T +  NL IMYRQM++N+  P LFFG P RA +    G
Sbjct  175   NHQPPTLIDLDYNGTEDNVSNETTINANLKIMYRQMVSNSKNPQLFFGNPDRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH   H W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPGHLWTGDHTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TD+ D DWLD+ FLF++E    V+VKVRDCL+ +KLGY +QD+ IPW   KPT +R    
Sbjct  295   TDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKKLGYGYQDVDIPWLSSKPTPRRAKVA  354

Query  1378  ----TVKLSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLN  1509
                   KL +  +  AS+  +      P  L   ++  V R      S    E +EE+L 
Sbjct  355   LSKIAKKLGVAHAAGASSSKVVTGTEFPISLGSKISTVVKRPKQKKRSKKDKEDEEEILV  414

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             ++ + +D    ++FDV++N+ +D+ +   D+TE+AGSF
Sbjct  415   IEGIEFDRDVAVKFDVYVNDVDDLPSGP-DKTEFAGSF  451



>gb|ABI96932.1| putative polyphenol oxidase [Fallugia paradoxa]
Length=452

 Score =   425 bits (1092),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 221/457 (48%), Positives = 293/457 (64%), Gaps = 30/457 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +   P  CCPP    TK+  +K+P+ S L VRPAAH
Sbjct  1     PFAFAKPVAPPDVSKCGAADLP--NGVTPTNCCPPAA--TKIIDFKLPAPSTLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD  Y+ KY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH +W 
Sbjct  57    AVDDVYIAKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYF+E+I+  +INDPTF LP+WNWD+P GM  P +F   N  SPLYD++R  
Sbjct  117   FFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALF--ANPKSPLYDKFRAA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+  H++DL Y+G +    + T+V +NL+IMYRQM++NA    LFFG P RA +    G
Sbjct  175   THQPPHLIDLDYNGTEDNTSNTTQVNSNLSIMYRQMVSNAKNAQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSAA DP+F+S HSNVDRMW+IWKTL  K 
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLATKN  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRT---  1380
              DI D DWLD+ FLF+DE    V+VKVRDCLD++ LGY +QD+ IPW + KPT +R+   
Sbjct  295   KDITDSDWLDSGFLFYDENANMVRVKVRDCLDSKNLGYVYQDVEIPWLNSKPTPRRSKVA  354

Query  1381  -----VKLSITESVPASTDVL-----PAPLSKNLTFYVTR-------STSVPETQEEMLN  1509
                   KL +  +  +S  V+     P  L++ +   V R            E +E ++ 
Sbjct  355   FSKIAKKLGVANAATSSAKVVAITDFPLTLNQKIRVAVPRPKQKKRSKKQKEEEEEILVI  414

Query  1510  LDLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
               + +D    ++FDV++N+++D+ +   D++E+AGSF
Sbjct  415   EGIEFDRDVAVKFDVYINDEDDLPSGP-DKSEFAGSF  450



>ref|XP_010242012.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=610

 Score =   430 bits (1106),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 257/573 (45%), Positives = 345/573 (60%), Gaps = 39/573 (7%)
 Frame = +1

Query  148   SRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFA  327
             S  AR G+    +  ASS G  E     S  ++DRRNVL+ LGGLYGA  LG   ++  A
Sbjct  49    SCGARGGEQKPTQGDASSSGNGEG----SLGRMDRRNVLISLGGLYGATGLG---ADRLA  101

Query  328   LADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVD  507
                P+  PD+  CG A +  S+   P  CCPP T +  V++   P    + VR AAH VD
Sbjct  102   FGAPIMAPDLTKCGAADLPTSA--KPTNCCPP-TSSKVVDFKLPPQNEDMRVRQAAHLVD  158

Query  508   AAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFP  678
               Y+ KY+ AI +MK LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +W FFP
Sbjct  159   DEYVAKYQDAIARMKALPTDDPRNFTQQANVHCAYCDGAYDQVGFPDLELQVHNSWLFFP  218

Query  679   FHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHR  858
             FHR+YLYF+ERI+  +I DPTF LP+WNWD P GMT P ++   N  S LY++ R+  H+
Sbjct  219   FHRYYLYFYERILGKLIGDPTFALPFWNWDAPAGMTLPAMY--TNPSSSLYNKLRDTKHQ  276

Query  859   YGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGT  1038
                ++DL Y+  D    +  ++K+NLAIMYRQM++N     LF G P RA +    G G+
Sbjct  277   PPTLIDLDYNLKDPSITNEEQLKHNLAIMYRQMVSNGSTAQLFLGTPYRAGDEPDPGNGS  336

Query  1039  IENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDI  1218
             +EN+PH  VH W GD    N EDMGNFYSAA DP+FY+ H+NVDRMWTIWKTLGGKR D 
Sbjct  337   LENVPHGPVHLWAGDRNQPNVEDMGNFYSAARDPIFYAHHANVDRMWTIWKTLGGKRRDF  396

Query  1219  ADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSIT  1398
              D DWLD+ FLF+DE    VKVKVRDCLD +KL YT+Q + IPW   KPT  R +K ++ 
Sbjct  397   TDPDWLDSAFLFYDENAELVKVKVRDCLDEKKLRYTYQSVDIPWLKTKPTPVRKMKEALK  456

Query  1399  ESVPASTDV---------------LPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDL  1518
             E       +                P  L       V     +RS    E +EE+L ++ 
Sbjct  457   EEEGLKDKIKERVLKLEKKIAVSEFPKQLDTAFKTVVKRPRKSRSKKEKEDEEEILVIEK  516

Query  1519  V-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISE  1695
             +  +    ++FDV++N +++ +    D++E+AGSF N+PH H         T   L+I+E
Sbjct  517   IELERDSVVKFDVYINNEDEPSP---DKSEFAGSFVNVPHKHGKKKKKRVKTFLRLSITE  573

Query  1696  LIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             L++DL+ E DD+V+VT+VP++GG  V +    I
Sbjct  574   LLEDLETEDDDEVVVTIVPRLGGDLVIIGGIKI  606



>gb|AAK13242.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   430 bits (1105),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 222/510 (44%), Positives = 312/510 (61%), Gaps = 32/510 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISF----SSCKVPYRCCPPITDTTKVEYYKIPSFSKLN  480
             +N  A   PVP+PD+ +C    I       +   P  CCPP +  + +  +K P+F+KL 
Sbjct  88    NNSLAFGAPVPIPDLTSCVVPPIELPDDIKNIDPPISCCPPFS--SDIIDFKFPTFNKLR  145

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGN--PYQI  654
             VRPAA  V+  Y  KY  A++ M+ LP DDPR+FYQQAN+HCAYC G Y   G     Q+
Sbjct  146   VRPAAQLVNDDYFAKYNKALELMRALPDDDPRSFYQQANIHCAYCVGGYTQKGYDVELQV  205

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H +W F PFHRWYLYF+ERI+ S+INDPTF +P+WNWD P GM  P IF + N  S LYD
Sbjct  206   HNSWLFLPFHRWYLYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPN--SSLYD  263

Query  835   QYRNQDHRYGHVLDLAYS-GDDIIAPDPT---KVKNNLAIMYRQMITNAPCPLLFFGKPL  1002
               RN  H+   ++DL Y+  +D  A +P+   ++K NL  M++QMI+N+  P  F G P 
Sbjct  264   PRRNPTHQPPTIVDLNYNKANDNPATNPSAEEQIKINLTWMHKQMISNSKTPRQFLGSPY  323

Query  1003  RADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             R  +T   G G++ENIPH  +H W GDPR  + EDMG+F++A  DP+FY+ H+NVDRMW+
Sbjct  324   RGGDTPFKGAGSLENIPHTPIHIWTGDPRQPHGEDMGHFWAAGRDPLFYAHHANVDRMWS  383

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
             +WKTLG KR D  D DWL++EFLF+DE K  VKVKV+D  ++ KLGY +QD+ IPW  +K
Sbjct  384   VWKTLGKKRKDFTDPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDVDIPWIKYK  443

Query  1363  PTRKRTVKLSITESVPAS------TDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLN  1509
                 R VK        A        D  P  L   ++  V     +R++   E +EE+L 
Sbjct  444   SKPSRRVKSKDKNKSSAQRPSRKLVDKFPIVLDSVVSIIVKRPKKSRNSKEKEDEEEILV  503

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK-----TT  1671
             +D + YD+   ++FDV +N DED   +  + TE+AGS+ ++ HVH+ G    K      T
Sbjct  504   IDGIEYDNKTEVKFDVIVN-DEDDKEIGGENTEFAGSYVSVLHVHDHGKNKKKKNNNIVT  562

Query  1672  TFNLAISELIKDLDLEGDDKVLVTLVPKVG  1761
                L +++L++DL  + DD ++VTL+P+ G
Sbjct  563   CLRLGLTDLLEDLKADDDDSIVVTLIPRYG  592



>gb|ABI96928.1| putative polyphenol oxidase [Chamaebatia foliolosa]
Length=455

 Score =   424 bits (1090),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 299/462 (65%), Gaps = 37/462 (8%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +   P  CCPP+   +K+  +K+PS S+L VRPAAH
Sbjct  1     PFAFAKPVAPPDVSKCGAADLP--TGAQPTNCCPPVA--SKIIDFKLPSPSRLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY+EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH +W 
Sbjct  57    AVDQAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYF E+I+ S+I DPTFTLP+WNWD P GM  P ++   N  S LYD++R  
Sbjct  117   FFPFHRYYLYFHEKILGSLIGDPTFTLPFWNWDAPAGMPLPALY--ANPKSSLYDKFRAA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL ++G +    + T++  NL IMYRQM++NA  P LFFG P RA +    G
Sbjct  175   KHQPPTLVDLDFNGTEDSVSNETQINANLKIMYRQMVSNAKTPQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSA  DP+F++ HSNVDR+W+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRLWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKL  1389
             TDI D DWLD+ FLF+DE    V+VKVRDCL+++ LGY +QD+ IPW + KPT +R VK+
Sbjct  295   TDITDTDWLDSGFLFYDENAQMVRVKVRDCLESKNLGYVYQDVNIPWLESKPTPRR-VKV  353

Query  1390  SITESVPASTDVLPAPLSKNLTFYVTR------------STSVPETQEEMLNLD------  1515
             ++ + +     V  A  + + +  V R            ST VP  +++  +        
Sbjct  354   ALGK-IAKKLHVAHAADNSSASKVVARAAFPIKKLDTKISTVVPRPKQKKRSKKEKEQEE  412

Query  1516  --LVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSF  1620
               LV +  +F     ++FDV++N+++D+ +   D++E+AGSF
Sbjct  413   EILVIEGIEFDRDVAVKFDVYVNDEDDLPSGP-DKSEFAGSF  453



>gb|ABI96930.1| putative polyphenol oxidase [Crataegus monogyna]
Length=453

 Score =   424 bits (1090),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 219/458 (48%), Positives = 292/458 (64%), Gaps = 31/458 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RPAAH
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEVT--NCCPP--PATKIIDFKLPAPAKLRIRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W 
Sbjct  57    AVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGYPELELQVHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF +P+WNWD+PPGM  P I+ D    SPLYD++R+ 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPPGMPLPAIYADPK--SPLYDKFRSA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G
Sbjct  175   KHQPPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TD+ D DWLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R    
Sbjct  295   TDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPTPRRAKVA  354

Query  1378  ----TVKLSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLN  1509
                   KL +  +  AS+  +      P  L   ++  V R      S    E +EE+L 
Sbjct  355   LSKIAKKLGVAHAAVASSSKVVAGTEFPINLGSKISTVVKRPKQKKRSKKDKEDEEEILV  414

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             ++ + +D    ++FDVF+N+ +D+ +   D+TE+AGSF
Sbjct  415   IEGIEFDRDVAVKFDVFVNDVDDLPSGP-DKTEFAGSF  451



>gb|ABI96938.1| putative polyphenol oxidase [Lyonothamnus floribundus]
Length=454

 Score =   424 bits (1089),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 221/459 (48%), Positives = 295/459 (64%), Gaps = 32/459 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +   P  CCPP    TK+  +K+P+ S+L VRPAAH
Sbjct  1     PFAFAKPVLPPDVSKCGAADLP--TGAKPMNCCPP--PATKIIDFKLPAPSRLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY+EKY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QIH +W 
Sbjct  57    AVDQAYIEKYTKAMELMKALPEDDPRSFKQQAAVHCAYCDGAYHQVGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+Y+YF E+I+  +INDPTF LP+WNWD+P GM  PG+F + N  SPLYD++RN 
Sbjct  117   FFPFHRYYVYFHEKILGKLINDPTFALPFWNWDSPSGMQLPGLFANPN--SPLYDKFRNA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
             +H+  +++DL Y+G D      T++  NL IMYRQM++NA  P LFFG P RA +    G
Sbjct  175   NHQPPNLVDLDYNGTDENVSKETQINANLKIMYRQMVSNAKHPRLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH+ +H W GD    N EDMGNFYSA  DP+FYS HSNVDRMW IWKTLGGKR
Sbjct  235   SGSIEGTPHSQIHLWTGDNTQPNFEDMGNFYSAGKDPIFYSHHSNVDRMWCIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-------  1368
             TDI+D DWL++ FLF++E    V+VKV+D L+ + LGY +Q++ IPW   KPT       
Sbjct  295   TDISDSDWLNSGFLFYNENSELVRVKVKDSLETKNLGYVYQEVDIPWLHSKPTPLRRPKE  354

Query  1369  --RKRTVKLSITESVP-ASTDVLP-APLSKNLTFYVTRSTSVPETQEEMLNLD------L  1518
               RK   KL +  +   +S+ V+P +    NL   ++     P+ ++            L
Sbjct  355   ALRKIAKKLGVARAAELSSSKVVPESEFPINLETKISTVVKRPQQKKRNKKEKEDEEEIL  414

Query  1519  VYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             V +  +F     ++FDVF+N+ +++ +   D TE+AGSF
Sbjct  415   VIEGIEFDRDVAVKFDVFVNDVDELPSGPAD-TEFAGSF  452



>sp|Q6UIL3.1|LAHY_LARTR RecName: Full=(+)-larreatricin hydroxylase, chloroplastic; AltName: 
Full=Polyphenol oxidase; Flags: Precursor [Larrea tridentata]
 gb|AAQ67412.1| (+)-larreatricin hydroxylase [Larrea tridentata]
Length=584

 Score =   427 bits (1099),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 258/575 (45%), Positives = 355/575 (62%), Gaps = 46/575 (8%)
 Frame = +1

Query  145   PSRAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPF  324
             PSR + R    ++ C AS++ +D+  D      +DRRN+L+GLGGLYGA N+    SN  
Sbjct  23    PSRVSLR----RVSCKASNDNKDKPNDQEKTFSIDRRNMLIGLGGLYGASNVFP--SNQS  76

Query  325   ALADPVP---LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPA  492
              LA P+    LPD  +C P         V   CCPP  D      +++PS  S+L +RPA
Sbjct  77    TLAAPIQPPVLPD--SCHPPEDLAEGVNV--LCCPP--DVKDPIDFQMPSNPSRLRIRPA  130

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH  D  Y+EKYK A+  MK LP +DPR+FYQQAN+HCAYCNGAY   G P    Q+H +
Sbjct  131   AHLADPTYIEKYKKALAAMKALPQNDPRSFYQQANIHCAYCNGAYDQVGFPDVNIQVHHS  190

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W F PFHRWYLYF+ERI+ S+I+DPTF +P+WNWD P GM  P +F D N  SPLYD  R
Sbjct  191   WLFLPFHRWYLYFYERILGSLIDDPTFAIPFWNWDAPKGMHMPHMFIDPN--SPLYDAKR  248

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADN-TQ  1020
             N  H    ++DL +S  +  + +P ++ NNL+IMY+Q++  A    LF G+PL+A +   
Sbjct  249   NPAHFPDTIVDLDFSSGEAPSHNPRQIGNNLSIMYKQVV-RAKKARLFHGRPLQAGSFPD  307

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
              SG G++E  PH ++H W GDPR +N E+MGNFYSA  DP+FY+ H+NVDRMW IWK   
Sbjct  308   ESGDGSLEGTPHGNIHLWSGDPRQSNFENMGNFYSAGRDPLFYAHHANVDRMWYIWKNSL  367

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK------  1362
             G R D   KDWL+  FL FDE    V+V VRD LD  KLGY +Q++ IPW + K      
Sbjct  368   G-RKDYKKKDWLNAGFLLFDENAQPVRVYVRDALDERKLGYAYQEVDIPWINSKPKPRKA  426

Query  1363  ---PTRKRTVKLSITESVPASTDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLNLDL  1518
                P R R+   + T+ +    +  P  L   ++F V     +RS S  E +EE+L ++ 
Sbjct  427   NPWPNRLRSKATTTTKLI----NKFPLTLDSTVSFEVKRPKKSRSKSEKEDEEEVLVIEK  482

Query  1519  VYDDTKF-IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTTFNLAI  1689
             +  + +F ++FDV++N DED +    D+TE+AGSF N+PH H  G    K  TT  ++ I
Sbjct  483   IKHEPQFPLKFDVYIN-DEDEDPSAADQTEFAGSFVNVPHFHRHGDKKDKRQTTNLSIGI  541

Query  1690  SELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             SE++ +LD++GDD ++VTLVP+VG   +T+  A I
Sbjct  542   SEVLDELDVDGDDSIVVTLVPRVGSGQITIGGAKI  576



>gb|ABI96944.1| putative polyphenol oxidase [Prunus dulcis]
Length=451

 Score =   422 bits (1085),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 219/457 (48%), Positives = 293/457 (64%), Gaps = 30/457 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PD++ CG A +   +   P  CCPP    TK+  +K+P+  KL VRPAAH
Sbjct  1     PFAFAKPLNPPDLSKCGAADLP--TGATPTNCCPP--PATKIIDFKLPAPGKLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY+EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH +W 
Sbjct  57    AVDQAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYF+E+I+  +INDPTF LP+WNWD+P GM  P +F   N  SPLYD++R  
Sbjct  117   FFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALF--ANPKSPLYDKFRAA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G D    + +++  NL IMYRQM++NA  P LFF  P RA +    G
Sbjct  175   SHQPPTLIDLDYNGTDEKVSNESQINANLKIMYRQMVSNAKNPQLFFANPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSAA DP+F+S HS+VDRMW+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSSVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TDI+  DWLD+ FLF++E    V+VKVRD L+++ LGY +Q++ IPW   KPT +R    
Sbjct  295   TDISHSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPTPRRAKLA  354

Query  1378  ----TVKLSITESVPASTDVL-----PAPLSKNLTFYVTRSTSVPETQEEMLNLD--LVY  1524
                   KL +  +  +ST ++     P  L   ++  V R       ++E    +  LV 
Sbjct  355   VSKIAKKLGVAHAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVI  414

Query  1525  DDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             +  +F     ++FDV++N+ +D+ +   D+TE+AGSF
Sbjct  415   EGIEFDRDVAVKFDVYVNDVDDLPSGP-DKTEFAGSF  450



>gb|ACM09905.1| polyphenol oxidase 1/4 [Trifolium pratense]
Length=605

 Score =   427 bits (1099),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 222/510 (44%), Positives = 312/510 (61%), Gaps = 32/510 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISF-SSCKV---PYRCCPPITDTTKVEYYKIPSFSKLN  480
             +N  A   PVP+PD+ +C    I      K+   P  CCPP +  + +  +K P+F KL 
Sbjct  88    NNSLAFGAPVPIPDLTSCVVPPIELPDDMKIINPPLSCCPPFS--SDIIDFKFPTFKKLR  145

Query  481   VRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNG--NPYQI  654
             VRPAA  V+  Y  KY  A++ M+ LP+DDPR+FYQQAN+HCAYC G Y   G     Q+
Sbjct  146   VRPAAQLVNDDYFAKYNKALELMRALPNDDPRSFYQQANIHCAYCVGGYTQKGYDAELQV  205

Query  655   HFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYD  834
             H +W F PFHRWYLYF+ERI+ S+INDPTF +P+WNWD P GM  P IF + N  S LYD
Sbjct  206   HNSWLFLPFHRWYLYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPN--SSLYD  263

Query  835   QYRNQDHRYGHVLDLAYS-GDDIIAPDPT---KVKNNLAIMYRQMITNAPCPLLFFGKPL  1002
               RN  H+   ++DL Y+  +D  A +P+   ++K NL  M++QMI+N+     F G P 
Sbjct  264   PRRNPSHQPPTIVDLNYNKANDNPATNPSAEEQIKINLTWMHKQMISNSKTNRQFLGSPY  323

Query  1003  RADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             R  +T   G G++ENIPH  +H W GDPR  + EDMG+FY+A  DP+FY+ H+NVDRMW+
Sbjct  324   RGGDTPFKGAGSLENIPHTPIHIWTGDPRQPHGEDMGHFYAAGRDPLFYAHHANVDRMWS  383

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
             +WKTLG KR D  D DWL++EFLF+DE K  VKVKV+D  ++ KLGY +QD+ IPW  +K
Sbjct  384   VWKTLGKKRKDFTDPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDVDIPWIKYK  443

Query  1363  PTRKRTVKLSITESVPAS------TDVLPAPLSKNLTFYV-----TRSTSVPETQEEMLN  1509
                 R VK        A        D  P  L   ++  V     +R++   E +EE+L 
Sbjct  444   SKPSRRVKSKDKNKSSAQRPSKKLVDKFPIVLDSIVSIIVKRPKKSRNSKEKEDEEEILV  503

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK-----TT  1671
             +D + YD+   ++FDV +N DED   +  + TE+AG++ ++ HVH+ G    K      T
Sbjct  504   IDGIEYDNKTEVKFDVIVN-DEDDKVIGGENTEFAGTYVSVLHVHDHGKNKKKKNNNIVT  562

Query  1672  TFNLAISELIKDLDLEGDDKVLVTLVPKVG  1761
                L +++L++DL  + DD ++VTL+P+ G
Sbjct  563   CLRLGLTDLLEDLKADDDDSIVVTLIPRYG  592



>dbj|BAM15846.1| hypothetical protein [Portulaca oleracea]
Length=597

 Score =   427 bits (1097),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 247/561 (44%), Positives = 339/561 (60%), Gaps = 32/561 (6%)
 Frame = +1

Query  175   VKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPD  354
             +KI C A+ +   +NP+   +  LDRRN+LLGLGGLYGA         P +LA P   P 
Sbjct  45    LKISCNAAKKDDQQNPNE--QHVLDRRNMLLGLGGLYGAAATFGVA--PASLAKPT-APA  99

Query  355   VANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEKYKT  534
             +  C P +    +  V   CCPP+++   +++    S     +RPAAH VD  YLEKY  
Sbjct  100   ITQCSPDSEELPA-NVKVNCCPPMSNNI-LDFKPSNSSRITRIRPAAHLVDTKYLEKYHK  157

Query  535   AIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFF  705
             AI  MK LP  DPR+F QQANVHCAYCNGAY   G P    Q+H +W FFPFHR YLYF+
Sbjct  158   AISLMKALPDSDPRSFTQQANVHCAYCNGAYHQVGFPKIDLQVHGSWLFFPFHRAYLYFY  217

Query  706   ERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAY  885
             E+I+ S+INDPTF +PYWNWD+P GMT P IF D    S LYD  R+  H     LDL+Y
Sbjct  218   EKILGSLINDPTFAIPYWNWDHPDGMTLPAIFADPK--STLYDPVRDSVHTPMVALDLSY  275

Query  886   SGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSV  1065
              G D   P   ++K NL +MYRQM++NA    LF G+P RA +T S   G++E +PH  V
Sbjct  276   DGTDHDVPKDQQIKTNLTVMYRQMVSNAKNSGLFMGQPYRAGDTGSKP-GSLETMPHGPV  334

Query  1066  HRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTE  1245
             H WVG  ++ N EDMGNFYSAA DP+FY+ H NVDRMW++W+TLG K  +  D D+LD+ 
Sbjct  335   HIWVGK-KTPNREDMGNFYSAARDPIFYAHHGNVDRMWSVWRTLGPKNKNFKDSDFLDSS  393

Query  1246  FLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESV------  1407
             F+F+DE   AV+++VRD LD +KLGY +Q + +PW   +PT +R    ++   V      
Sbjct  394   FVFYDENAKAVRIRVRDVLDTKKLGYEYQPVDLPWLKSRPTPRRAKVKAVFNKVKDAVAA  453

Query  1408  -PASTDV----LPAPLSKNLTFYVTR--STSVPETQEEMLNLDLVYDDTK---FIRFDVF  1557
              P++ DV     P PL K +  ++ R   +     +++   + ++  ++K   F +FDV+
Sbjct  454   EPSTMDVPTVAFPKPLDKVIRTHLMRPQKSRTKRAKDDEEEVLVIEVESKAHEFSKFDVY  513

Query  1558  LN-EDEDVNTVELDRTEYAGSFGNLPHVHE-GGSATPKTTTFNLAISELIKDLDLEGDDK  1731
             +N EDE +      RTEYAGSF N+PH H+ GG      TT    +++LI+DL  + D+ 
Sbjct  514   VNDEDEYLTKENRVRTEYAGSFVNVPHKHKTGGKEHKMNTTLRFGLTDLIEDLGADDDEG  573

Query  1732  VLVTLVPKVGGSFVTVNNAYI  1794
             + V LVP+VG   V + +  I
Sbjct  574   IDVILVPRVGTESVVIKSVKI  594



>gb|ABI96934.1| putative polyphenol oxidase [Gillenia trifoliata]
Length=453

 Score =   422 bits (1084),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 292/458 (64%), Gaps = 31/458 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PDV+ CG A +   +      CCPP    TK+  +K P+ ++L +RPAAH
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEAT--NCCPP--PATKIIDFKRPAPAQLRIRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY +KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W 
Sbjct  57    AVDQAYTDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQVHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+ D    SPLYD+ R  
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFAIPFWNWDSPAGMPLPAIYADPK--SPLYDKLRAA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
             +H+   ++DL Y+  +    + T +  NL +MYRQM++N+  P LFFG P RA +    G
Sbjct  175   NHQPPTLIDLDYNRTEDNVSNETTINANLKLMYRQMVSNSKTPQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH SVH W GD    N EDMGNFYSA  DP+FY+ HSNVDRMW+IWKTLGGKR
Sbjct  235   TGSIEGSPHGSVHLWTGDNTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TD+ D DWLD+ FLF++E    V+VKVRDCL+++ LGY +QD+ IPW   KPT +R    
Sbjct  295   TDLTDSDWLDSGFLFYNENAELVRVKVRDCLESKNLGYVYQDVDIPWLSSKPTPRRAKVA  354

Query  1378  ----TVKLSITESVPASTDVL------PAPLSKNLTFYV------TRSTSVPETQEEMLN  1509
                   KL +  +  AS+  +      P  L   ++  V       RS    E +EE+L 
Sbjct  355   LSKIAKKLGVAHAAGASSSKVVAGTEFPISLGSKISTVVKRPQQKKRSKKDKEDEEEILV  414

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             ++ + +D    ++FDV++N+ +D+ +   D+TE+AGSF
Sbjct  415   IEGIEFDRDVAVKFDVYVNDVDDLPSGP-DKTEFAGSF  451



>ref|XP_008225030.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=586

 Score =   426 bits (1094),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 227/521 (44%), Positives = 312/521 (60%), Gaps = 40/521 (8%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             ++PFA A+P+  PD+  CGPA +   S  +P  CCPP     K+  +K+P  S+L VRPA
Sbjct  75    TDPFAFANPISPPDLTQCGPADLP--SGALPTNCCPPTY--PKIIDFKLPPPSRLRVRPA  130

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             A  VD +Y++KY  AI  MK LP DDPRNF QQANVHCAYC+GAY   G P    QIH  
Sbjct  131   AQTVDQSYIDKYSKAIALMKALPDDDPRNFTQQANVHCAYCDGAYDQVGFPDLELQIHNC  190

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W FFPFHR+YLYF+ERI+  +I+DPTF LP+WNWD P GM  P ++   N  S LYD+ R
Sbjct  191   WLFFPFHRYYLYFYERILAKLIDDPTFALPFWNWDAPAGMQLPALY--ANSDSSLYDELR  248

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
                H+   ++DL ++G D       +V  N      Q   NA  PLLFFG P RA     
Sbjct  249   AAAHQPPTLVDLDFNGTDEKVNREARVNTNRG----QRGANARNPLLFFGWPYRAGTEAD  304

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
              G G++E IPH  VH W GD    N EDMGNFYSAA DP+F++ HSNVDRMW+IWK LG 
Sbjct  305   PGAGSVEAIPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFAHHSNVDRMWSIWKNLGT  364

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTV  1383
             K  D++DKDWLD+ FLF++E    V+VKVRDCLD+ KLGY ++D+ IPW   +PT +RT 
Sbjct  365   KNKDLSDKDWLDSGFLFYNENAELVRVKVRDCLDSRKLGYVYEDVEIPWLKSRPTPRRTK  424

Query  1384  K---------------LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE------  1500
             +                S+ + V +S    P  L   ++  V+R       ++E      
Sbjct  425   QQRKAKAVGVAKAAGTTSLGKLVKSSE--FPIQLESKISTVVSRPRQKKRNKKEKEDEEE  482

Query  1501  -MLNLDLVYDDTKFIRFDVFLNE--DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTT  1671
              ++   + Y+    ++FDV++N+  D+D      D++E+AGSF ++PH H+      K  
Sbjct  483   ILVIEGIEYEKNAVVKFDVYMNDVGDDDDVLSGPDKSEFAGSFVSVPHTHKEKRNKSK-G  541

Query  1672  TFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
                L +++L++DL+ E D+ ++VTLVP+ G   VT+ +  I
Sbjct  542   CLRLGLTDLLEDLEAEDDESIVVTLVPRFGAQTVTIGSIRI  582



>gb|ABI96948.1| putative polyphenol oxidase [Sorbus californica]
Length=453

 Score =   420 bits (1080),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 218/458 (48%), Positives = 290/458 (63%), Gaps = 31/458 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AH
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEVT--NCCPP--PATKIIDFKLPAPAKLRIRPPAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W 
Sbjct  57    AVDQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF +PYWNWD+P GM  P I+ D    SPLYD++R+ 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFAIPYWNWDSPAGMPLPAIYADPK--SPLYDKFRSA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G
Sbjct  175   KHQPPTLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TD+ D DWLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R    
Sbjct  295   TDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPTPRRAKVA  354

Query  1378  ----TVKLSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLN  1509
                   KL +  +  AS+  +      P  L   ++  V R      S    E +EE+L 
Sbjct  355   LSKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILV  414

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             ++ + +D    ++FDVF+N+ +D+ +   D+TE+AGSF
Sbjct  415   IEGIEFDRDVAVKFDVFVNDVDDLPSGP-DKTEFAGSF  451



>ref|XP_007159290.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
 gb|ESW31284.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
Length=594

 Score =   425 bits (1093),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 231/522 (44%), Positives = 319/522 (61%), Gaps = 38/522 (7%)
 Frame = +1

Query  316   NPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAA  495
             N  A+A P   PD  +CGP  +   +      CCPP + T  +  +K P  + L VRP A
Sbjct  77    NNIAIAAPTS-PDFKSCGPPDLPRGAEST--DCCPPKSST--IVDFKFPPRTPLRVRPGA  131

Query  496   HAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNW  666
             H VD  Y +KYK A+  MK LPS+DPR+F QQAN+HCAYCNGAY   G P    Q+H +W
Sbjct  132   HLVDDIYRDKYKEALSIMKGLPSEDPRSFIQQANIHCAYCNGAYHQVGFPDLDLQVHNSW  191

Query  667   FFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPG-MTFPGIFDDENQLSPLYDQYR  843
              FFP+HR+YLYF+ERI+ S+I DPTF +P+WNWD+P G MT P +F D+N  SPLYD  R
Sbjct  192   LFFPYHRFYLYFYERILGSLIGDPTFAIPFWNWDHPKGGMTMPSLFTDKN--SPLYDPRR  249

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPT-----KVKNNLAIMYRQMITNAPCPLLFFGKPLRA  1008
             N  H+   ++DL Y+  D   P+ +     ++ +NL IMYR +++    P LF G P RA
Sbjct  250   NLSHQPPTLIDLDYNRKDDNNPNQSESVADQISSNLTIMYRNVVSGGKLPKLFLGSPYRA  309

Query  1009  DNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIW  1188
              +    G G++E++PH  VH W GDPR  N EDMG FYSA  DP+FY+ H+NVDR+W+IW
Sbjct  310   GSDPHPGAGSLEHVPHIPVHSWCGDPREPNREDMGVFYSAGKDPIFYAHHANVDRVWSIW  369

Query  1189  KTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW--KDF  1359
             KT+ GGKR D  D DWL++ FLF+DE K  V+VKV+D LD   LGY +QD+ +PW  K  
Sbjct  370   KTIPGGKRRDFTDPDWLESSFLFYDENKNLVRVKVKDSLDTRNLGYVYQDIDLPWLKKKP  429

Query  1360  KPTRKRTVKLSITESV-----------PASTDVLPAPLSKNLTFYVT-----RSTSVPET  1491
             KP   +  K+++ +S             +S+   P  L   ++  V      RS    E 
Sbjct  430   KPRMSKAKKVALAKSFGVTAARAAETTTSSSVRFPLSLDSKVSIVVKRPKLLRSKEEKEE  489

Query  1492  QEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKT  1668
             +EE+L +D + +   K ++FDVF+N DED   ++   +E+AGSF +LPH H   S   K 
Sbjct  490   EEEVLVIDGIEFGRDKAVKFDVFIN-DEDDEVIKASNSEFAGSFVSLPHTHLHKSMKVK-  547

Query  1669  TTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             T F + +++L++DL+ E DD ++VTLVPK G   VT+    I
Sbjct  548   TCFRVGLTDLLEDLEAENDDSIVVTLVPKYGKGLVTIQGIKI  589



>gb|ABI96935.1| putative polyphenol oxidase [Heteromeles arbutifolia]
Length=453

 Score =   420 bits (1079),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 290/458 (63%), Gaps = 31/458 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AH
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEAT--NCCPP--PATKIIDFKLPAPAKLRIRPPAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W 
Sbjct  57    AVDQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+ D    SPLYD++R+ 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPK--SPLYDKFRSA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G
Sbjct  175   KHQPPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TD+ D DWLD+ FLF++E    V+VKVRDCL+ + LGY +QD+ IPW   KPT +R    
Sbjct  295   TDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVA  354

Query  1378  ----TVKLSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLN  1509
                   KL +  +  AS+  +      P  L   ++  V R      S    E +EE+L 
Sbjct  355   LSKIAKKLGVAHAAVASSSKVVAGAEFPISLGSKISTVVKRPKQKKRSKKAKEDEEEILV  414

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             ++ + +D    ++FDVF+N+ +D+ +   D+TE+AGSF
Sbjct  415   IEGIEFDRDVAVKFDVFVNDVDDLPSGP-DKTEFAGSF  451



>gb|ABI96940.1| putative polyphenol oxidase [Oemleria cerasiformis]
Length=457

 Score =   420 bits (1079),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 224/462 (48%), Positives = 291/462 (63%), Gaps = 35/462 (8%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +   P  CCPP    TK+  +++PS S+L VRPAAH
Sbjct  1     PFAFAKPVLPPDVSKCGAADLP--TGAEPMNCCPP--PATKIIDFRLPSPSRLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QIH +W 
Sbjct  57    AVDKAYIDKYYKAMELMKGLPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF LP+WNWD P GM  P IF D    SPLYD+ RN 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFALPFWNWDAPAGMQIPAIFADPR--SPLYDKLRNA  174

Query  850   DHR---YGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             +H+     +V+DL Y+G D        +  NL IMYRQM++N   PLLFFG P RA +  
Sbjct  175   NHQPTSAANVIDLDYNGTDENISKQATINANLKIMYRQMVSNGKNPLLFFGIPYRAGDEP  234

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G+IE IPH  VH W GD    N EDMGNFYS   DP+FYS HSNVDRMW IWKTLG
Sbjct  235   DPGGGSIEGIPHGPVHLWTGDNTQLNFEDMGNFYSXGKDPIFYSHHSNVDRMWNIWKTLG  294

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT----  1368
             GKRTD+ D DWL++ FLF++E    V+VKV+D LD++KLGY +QD+ IPW + KP     
Sbjct  295   GKRTDLTDSDWLNSGFLFYNENAELVRVKVKDSLDSKKLGYVYQDVDIPWLESKPVPLVR  354

Query  1369  RKRTV-----KLSITESVPASTDVLPAPLSKNLTFYVTRSTSVP------------ETQE  1497
              K+TV     KL +  +   S+  + A     L      ST V             E +E
Sbjct  355   AKQTVSKLARKLGVAHAAELSSSKVVAESEFPLDLVTKISTVVKRPQQKKRNKKQKEDEE  414

Query  1498  EMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             E+L ++ + ++    ++FDV++N+ +++ +   + TE+AGSF
Sbjct  415   EILVIEGIEFERDVAVKFDVYVNDVDELPSGPAN-TEFAGSF  455



>ref|XP_008345876.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=585

 Score =   424 bits (1091),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 249/567 (44%), Positives = 332/567 (59%), Gaps = 35/567 (6%)
 Frame = +1

Query  151   RAARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFAL  330
             R  ++  A ++RC   ++G ++N D    A+LDRRN+L+GLG       +     NPFA 
Sbjct  37    RKPKQCLAGRVRCK-XTKGDNDNLDQ-GLARLDRRNMLIGLGAGGLYGXV----GNPFAF  90

Query  331   ADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV--  504
             A P   PD+  C PA     S      CCPP T  T +  +++P    L  RPAA  V  
Sbjct  91    AAPXSAPDLTTCXPAXKPDGST---IDCCPPTT--TTIIDFELPDSGPLRTRPAAQDVAN  145

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             D  YL KYK A++ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+H  W FF
Sbjct  146   DPEYLAKYKXAVEXMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHXCWLFF  205

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             PFHRWYLYF+E+IM  +I D TF LP+WNWD P GM  P IF D    S LYDQYRN  H
Sbjct  206   PFHRWYLYFYEKIMGELIGDXTFALPFWNWDAPAGMYIPEIFXD--TXSSLYDQYRNXAH  263

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   +LDL Y   D    D T++K NL  MY+QM++NA     F+G+P  A +    G G
Sbjct  264   QPPKLLDLNYGXTDDDVDDATRIKENLTTMYKQMVSNATXHRXFYGEPYSAGDEPXPGAG  323

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWK-TLGGKRT  1212
              IE  PHN++H W GDP   N EDMG FYSAA DP FYS HSNVDRMW I+K  LGG  T
Sbjct  324   NIETTPHNNIHLWXGDPTQXNGEDMGTFYSAARDPXFYSHHSNVDRMWXIYKDKLGG--T  381

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTF-QDMPIPWKDFKPT-RKRTVK  1386
             DI + DWLD EFLF+DE K   +V VRD LD +KLGY + +++ IPW   KPT RK T K
Sbjct  382   DIENTDWLDAEFLFYDEKKNLXRVXVRDSLDTKKLGYVYDENVSIPWLXSKPTXRKSTNK  441

Query  1387  LSITESVPASTDVLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLV-YDDTKFIR  1545
                  S    +   PA LS  ++  VTR +    T      Q+E+L +  + +   + ++
Sbjct  442   RKAXVSSSDLSTTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEFAGNETVK  501

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDV++N+D D +    D++E+AGSF ++PH H+        T   L+I+ L+++LD E D
Sbjct  502   FDVYVNDDAD-SLAGKDKSEFAGSFVHVPHKHKKNIK----TNLRLSITSLLEELDAETD  556

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTLD  1806
             + ++VTLVPKVG   +T+    I  ++
Sbjct  557   NSLVVTLVPKVGKGPITIGGFSIELIN  583



>gb|ABI96937.1| putative polyphenol oxidase [Kageneckia oblonga]
Length=453

 Score =   419 bits (1077),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 290/458 (63%), Gaps = 31/458 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PDV+ CG A +   +      CCPP    TK+  +K+P+  KL +RP AH
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEFT--NCCPP--PATKIIDFKLPAPGKLRIRPPAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W 
Sbjct  57    AVDQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+ D    SPLYD+ R+ 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPK--SPLYDKLRSA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G +      T +  NL IMYR+M++N+  PLLFFG P RA +    G
Sbjct  175   SHQPPTLIDLDYNGTEDNVSTETTINANLKIMYRRMVSNSKNPLLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSA  DP+FY+ HSNVDRMW+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TD+ D DWLD+ FLF++E    V+VKVRDCLD +K GY +QD+ IPW   KP+ +R    
Sbjct  295   TDLTDSDWLDSGFLFYNENAELVRVKVRDCLDTKKFGYVYQDVDIPWLSSKPSPRRAKVA  354

Query  1378  ----TVKLSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLN  1509
                   KL +  +  AS+  +      P  L   ++  V R      S    E +EE+L 
Sbjct  355   LGKIAKKLGVAHAAGASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKDKEDEEEILV  414

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             ++ + +D    ++FDV++N+ +D+ +   D+TE+AGSF
Sbjct  415   IEGIEFDRDVAVKFDVYVNDVDDLPSGP-DKTEFAGSF  451



>gb|ABX09994.1| chloroplast polyphenol oxidase [Taraxacum officinale]
Length=599

 Score =   424 bits (1090),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 257/562 (46%), Positives = 327/562 (58%), Gaps = 38/562 (7%)
 Frame = +1

Query  196   SSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPA  375
             S +  D++   +    LDRRNVLL LGGLYGA       SN  A ADP+  PD+  CGPA
Sbjct  51    SCKSADDHHHDIDSGTLDRRNVLLRLGGLYGAAATFG--SNSLAFADPIMAPDLTQCGPA  108

Query  376   TISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLEKYKTAIQKMK  552
              I      +   CCPP T  TK++ +K+P  S  L +RPAAH VD  Y++K+  AI  MK
Sbjct  109   DIPAGG--IVTDCCPPFT--TKIQDFKLPPPSNTLRIRPAAHLVDKDYIDKFNKAIGLMK  164

Query  553   DLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQS  723
              LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W FFPFHR YLYFFE+I   
Sbjct  165   ALPDDDPRSFKQQAVVHCAYCDGAYEQVGYPGLDLQVHNSWLFFPFHRCYLYFFEKICGK  224

Query  724   MINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDII  903
             +INDPTF +P+WNWD   GMT P I+   N  SPLYD  R+  H+   V+DL Y+G D  
Sbjct  225   LINDPTFAIPFWNWDAADGMTIPDIY--TNSKSPLYDTLRDAKHQPPSVVDLDYNGVDEN  282

Query  904   APDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGD  1083
                  +   NL IMYRQM+++A    LF G P RA +  + G GT+ENIPH  VH W GD
Sbjct  283   LSPSEQTSTNLTIMYRQMVSSAKTASLFMGSPYRAGDEPNPGGGTLENIPHGPVHIWTGD  342

Query  1084  PRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDE  1263
                 N E+MGNFYSA  DP+FY+ H+NVDRMW+IWKTLGG+R D  D DWLD+ F F+DE
Sbjct  343   RNQPNGENMGNFYSAGKDPIFYAHHANVDRMWSIWKTLGGRRKDFTDSDWLDSSFSFYDE  402

Query  1264  TKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP------TRKRTV--KLSIT---ESVP  1410
                 V+VKVRDCLD++KLGY ++D+ IPW   KP      +R++ V  K ++    E +P
Sbjct  403   NAEFVRVKVRDCLDSKKLGYAYEDVKIPWLKTKPRSKYGKSRRKAVGHKHAVARADELIP  462

Query  1411  ASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKFIRFDVFLNEDEDVNT--  1584
              + DV PA L K +   +      P+        D   +       +V  NE    +   
Sbjct  463   FAKDVFPASLDKVM---IKVLVPRPKKSRSKKQKDEEEEVLVVEGIEVKRNEFVKFDVFV  519

Query  1585  --------VELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLV  1740
                        D+TE+AGSF N+PHVH+       TT   L ISEL+ DL  + DD VLV
Sbjct  520   DDDDDEVRATADKTEFAGSFVNVPHVHKHEKNV--TTRLRLGISELLDDLGADDDDNVLV  577

Query  1741  TLVPKVGGSFVTVNNAYINTLD  1806
             TLVPK  G  V++    I   D
Sbjct  578   TLVPKTEGGEVSIGMIKIEYED  599



>gb|AAO16865.1| polyphenol oxidase [Ananas comosus]
Length=577

 Score =   423 bits (1088),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 224/499 (45%), Positives = 305/499 (61%), Gaps = 17/499 (3%)
 Frame = +1

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV  504
             A+  P+  PD++ CGP      +   P  CCPP   +T V++   P    L VRPAA +V
Sbjct  85    AVGAPIQAPDISTCGPPA-DLPATAPPTDCCPPY-QSTIVDFKLPPRSDPLRVRPAAQSV  142

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             DA YL KYK A++ MK LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +W FF
Sbjct  143   DADYLAKYKKAVELMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQVHSSWLFF  202

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             P+HR+YLYF ERI+  +I D TF LP+WNWD P GM  P I+ D +  SPLYD+ RN  H
Sbjct  203   PWHRFYLYFNERILGKLIGDDTFALPFWNWDAPGGMQIPAIYADAS--SPLYDKLRNAKH  260

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   ++DL Y+G D       ++ +NL IMYRQ+I+    P LF G   RA +    G G
Sbjct  261   QPPTLVDLDYNGTDPTFTPEQQIAHNLTIMYRQVISGGKTPELFMGAAYRAGDAPDPGAG  320

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTD  1215
             T+E +PHN++H W GDP   N EDMG FY+AA DP+F++ H NVDRMW +W+ LGG   D
Sbjct  321   TLELVPHNTMHLWTGDPNQPNDEDMGTFYAAARDPIFFAHHGNVDRMWYVWRKLGGTHRD  380

Query  1216  IADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSI  1395
               D DWL+  FLF+DE    V+VKV+DCL+ + L YT+QD+ IPW   KPT K+T     
Sbjct  381   FTDPDWLNASFLFYDENAQLVRVKVKDCLEADALRYTYQDVDIPWISAKPTPKKTPG---  437

Query  1396  TESVPASTDV-LPAPLSKNLTFYVTR-STSVPETQEEMLNLDLV-YDDTKFIRFDVFLNE  1566
               + P++T+   P  L K ++  V R  T     +EE+L ++ +  D    ++FDV++N 
Sbjct  438   -GAAPSTTEATFPVVLDKPVSATVARPKTGRSTGEEEVLVVEGIELDKDVAVKFDVYINA  496

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK--TTTFNLAISELIKDLDLEGDDKVLV  1740
               D   V  + +E+AGSF  +PH H+ G        TT  L I++L++D+  E D+ VLV
Sbjct  497   -PDNEGVGPEASEFAGSFVQVPHKHKKGKKEKARIKTTLRLGITDLLEDIGAEDDESVLV  555

Query  1741  TLVPKVGGSFVTVNNAYIN  1797
             TLVP++G   V V    I+
Sbjct  556   TLVPRIGEGLVKVGGLRID  574



>ref|XP_004232833.2| PREDICTED: polyphenol oxidase, chloroplastic-like [Solanum lycopersicum]
Length=626

 Score =   424 bits (1091),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 244/550 (44%), Positives = 328/550 (60%), Gaps = 39/550 (7%)
 Frame = +1

Query  232   SKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYR  411
             S   +DRRNVLLGLGGLYGA  L  G   PF LA PV  PDV  CG A +   +  V   
Sbjct  83    SNNMIDRRNVLLGLGGLYGASTLVGGL--PFVLAAPVNGPDVTKCGAADLPPGAELV--N  138

Query  412   CCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQ  588
             CCPP++ +  +  +++PS S  L  RPAAH+VD+AY+EK+  AIQ MK LP DDPR+F Q
Sbjct  139   CCPPMSGS--IIDFQLPSSSTPLRTRPAAHSVDSAYIEKFNRAIQLMKQLPDDDPRSFKQ  196

Query  589   QANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYW  759
             QAN+HCAYC+GAY   G P    Q+H +W F PFHR YLYFFERI+ S+INDPTF +P+W
Sbjct  197   QANIHCAYCDGAYDQLGFPNSELQVHSSWIFLPFHRCYLYFFERILGSLINDPTFAMPFW  256

Query  760   NWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLA  939
             NWD+P GM  PG++   N  S LYD+ R++ H+   ++DL ++G D       +   NL 
Sbjct  257   NWDHPDGMRMPGLY--TNPTSSLYDRLRDRRHQPPTMVDLDFNGTDPNISTAQQTSQNLT  314

Query  940   IMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNF  1119
              MYRQM++    P  F G P RA      G G++EN+ H +VH W GD   AN E+MG+F
Sbjct  315   NMYRQMVSLGRTPETFLGDPYRAGGV-PGGAGSLENMAHGAVHVWTGDRTQANFENMGDF  373

Query  1120  YSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDC  1299
             YSAA DP+FY+ HSN+DR+WT+WKTLGG+R D  D D+L+T FLF+DE    V+++VRD 
Sbjct  374   YSAARDPIFYAHHSNIDRLWTVWKTLGGRRQDFTDPDFLNTSFLFYDEKAQMVRIRVRDV  433

Query  1300  LDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESV----------------PASTDVLP  1431
             LD+ KLGY +Q++   W + +PT + +  LS    +                P   ++ P
Sbjct  434   LDSSKLGYVYQNVRNQWINSRPTPRVSRALSSVRRLVEARAADDNNNNIMNFPRPKEIFP  493

Query  1432  APLSKNLTFYVTRSTSVPETQEE-------MLNLDLVYDDTKFIRFDVFLNEDEDVNTVE  1590
               L   +   V R       ++E       ++   L  +   F++FDV +N DED   + 
Sbjct  494   TKLDHVIKVMVKRPNKKKRNKKEKNEREEILIVEGLEVESDVFVKFDVLIN-DEDETLIS  552

Query  1591  LDRTEYAGSFGNLPHVHEGGSA--TPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGG  1764
              D  E+AGSF N+PH   G     + + T   LAI+EL++DLD E DD VLVT VPK G 
Sbjct  553   PDNAEFAGSFVNVPHHSHGKGEKNSKRKTKLKLAITELLEDLDAENDDNVLVTFVPKNGS  612

Query  1765  SFVTVNNAYI  1794
               V +    I
Sbjct  613   GAVKIGGVKI  622



>gb|ABI96927.1| putative polyphenol oxidase [Chaenomeles speciosa]
Length=453

 Score =   418 bits (1075),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 290/458 (63%), Gaps = 31/458 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A P+  PDV+ CG A +   +      CCPP    TK+  +K+P+ +KL +RP AH
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEFT--NCCPP--PATKIIDFKLPAPTKLRIRPPAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    Q+H +W 
Sbjct  57    AVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF +P+WNWD+P GM  P I+ D    SPLYD++R+ 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYADPK--SPLYDKFRSA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+   ++DL Y+G +      T +  NL IMYRQM++N+    LFFG P RA +    G
Sbjct  175   QHQPPTLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYRAGDEPDPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G+IE  PH  VH W GD    N EDMGNFYSA  DPVFY+ HSNVDRMW+IWKTLGGKR
Sbjct  235   GGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TD+ D DWLD+ FLF++E    V+VKVRDCL+ ++LGY +QD+ IPW   KPT +R    
Sbjct  295   TDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKRLGYVYQDVDIPWLSSKPTPRRAKVA  354

Query  1378  ----TVKLSITESVPASTDVL------PAPLSKNLTFYVTR------STSVPETQEEMLN  1509
                   KL +  +  AS+  +      P  L   ++  V R      S    E +EE+L 
Sbjct  355   LSKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSKKDKEDEEEILV  414

Query  1510  LDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
             ++ + +D    ++FDVF+N+ +D+ +   D TE+AGSF
Sbjct  415   IEGIEFDRDVAVKFDVFVNDVDDLPSGP-DNTEFAGSF  451



>ref|XP_008778193.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   423 bits (1087),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 251/560 (45%), Positives = 338/560 (60%), Gaps = 30/560 (5%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKA-----KLDRRNVllglgglygaynlgaggSNPFALADPV  342
             +I C A  E   E P   S+A     KLDRR++L+GLGGLYGA        N  AL  P+
Sbjct  44    RISCKARDE--HEKPMHTSEATGSLGKLDRRDMLIGLGGLYGAAAGLGV--NRKALGLPI  99

Query  343   PLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYL  519
               PD++ CGPA +   S  +P  CCPP T  +K+  +K+P  S  L +RPAAH VD+ YL
Sbjct  100   EAPDISKCGPADLP--SGAIPTDCCPPFT--SKIIDFKLPPRSDPLRIRPAAHLVDSEYL  155

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
              KY  A++ MK LP+DDPRNF QQANVHCAYC+G+Y   G P    Q+H +W FFP+HR+
Sbjct  156   AKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIEIQVHNSWIFFPWHRF  215

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYF E+I+  +I D TF LP+WNWD P GM  P I+ D +  S LYD+ R+  H+  ++
Sbjct  216   YLYFHEKILGKLIGDETFALPFWNWDAPAGMRMPSIYTDPS--SSLYDKLRDAKHQPPYL  273

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL ++G D       ++ +NL IMYRQ+I N     LF G P RA +  + G G++EN+
Sbjct  274   IDLDFNGQDPSFTQAQQIDHNLKIMYRQVIANGKTAQLFMGSPYRAGDQPNPGAGSLENV  333

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH +VH W GD    N EDMG  YSA+ DP+FY+ HSNVDRMW +WK LGGK  D  DKD
Sbjct  334   PHGTVHLWTGDRNQPNGEDMGILYSASRDPIFYAHHSNVDRMWYVWKKLGGKHKDFDDKD  393

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSI-TESV  1407
             WL+T FLF+DE    V+VK++DCLD + L YT+QD+ IPW   +PT K T+       S+
Sbjct  394   WLNTSFLFYDENADIVRVKIKDCLDMQWLRYTYQDVEIPWLRTRPTPKGTMAAKKGARSL  453

Query  1408  PASTDV-LPAPLSKNLTFYVTR------STSVPETQEEMLNLDLVYDDTKFIRFDVFLNE  1566
              A T+   P  L   ++  V R      S    + +E ++   + +D   FI+FDV +N 
Sbjct  454   RAITEARFPVTLDSPVSATVRRPKVSRSSKEKEDEEEVLVVEGIEFDRDGFIKFDVHINT  513

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK-TTTFNLAISELIKDLDLEGDDKVLVT  1743
              E+   V+   +E+AG+F ++PH H+      K  T   L I+EL++DL  E DD VLVT
Sbjct  514   PEEA--VDPGSSEFAGAFVSVPHKHKHSKKEKKLITALRLGITELLEDLGAEADDSVLVT  571

Query  1744  LVPKVGGSFVTVNNAYINTL  1803
             LVP+ G   V V    I  L
Sbjct  572   LVPRNGIGKVKVGGLRIEFL  591



>gb|ACB12082.1| polyphenol oxidase [Triticum monococcum subsp. aegilopoides]
Length=577

 Score =   422 bits (1086),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 247/566 (44%), Positives = 324/566 (57%), Gaps = 42/566 (7%)
 Frame = +1

Query  157   ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALAD  336
             AR+   + I C A+  GR           +DRR V+LGLGG   A      G    A+A 
Sbjct  36    ARQPRHLSISCEATGRGR-----------VDRREVILGLGGAAAAGLATDQGRG--AIAA  82

Query  337   PVPLPDVANCGPATISFSSCKVPYRCCP-PITDTTKVEYYKIPSFSKLNVRPAAHAVDAA  513
             P+  PD+ NC   T    +      CCP P T  T  E    P+ S L VRPAAH VDA 
Sbjct  83    PIQAPDLRNC--QTPELPNTPPDTNCCPTPGTGITDFEL--PPASSPLRVRPAAHLVDAG  138

Query  514   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFH  684
             YL +Y+ A+  MK LP+DDPR+F QQ +VHCAYC+ AY   G P    QIH  W FFP+H
Sbjct  139   YLARYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDLELQIHNCWLFFPWH  198

Query  685   RWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYG  864
             R+YLYF ERI+  +I D TF LP+WNWD P GMT P I+   N+ SPLYD+ R+  H+  
Sbjct  199   RFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIY--ANRSSPLYDERRDPAHQPP  256

Query  865   HVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIE  1044
              ++DL  SG D   P   ++  NL IMYRQMI+NA   LLF G+P RA +    G G++E
Sbjct  257   VLVDLDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAGSLE  316

Query  1045  NIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIAD  1224
             N+PH +VH W GDPR  N  DMGNF+SAA DP+F++ H N+DR+W +W+ L    TD  D
Sbjct  317   NVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVWRGLRPSNTDFTD  376

Query  1225  KDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITES  1404
              DWLD  FLF+DE    V+V+VRDCLD   L YT+QD+ +PW + +P      K S    
Sbjct  377   PDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNARP-----AKASGGTP  431

Query  1405  VPASTDVLPAPLSKNLTFYVT-----RSTSVPETQEEML---NLDLVYDDTKFIRFDVFL  1560
              PA+T  LPA L   +   VT     RS    + +EE+L    +++     KFI+FDV +
Sbjct  432   APATTGTLPATLDSTIRVTVTRPRVSRSRREKDDEEEVLVVEGIEIADHFNKFIKFDVLV  491

Query  1561  NEDE-DVNTVELDRTEY-AGSFGNLPHV---HEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             NE E  V+      T Y AGSF + PH+    E    + KT      + +L+ D+  +GD
Sbjct  492   NEPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTVA-RFGVCDLMDDIGADGD  550

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTL  1803
               V+V+LVP+ GG  VTV    I+ L
Sbjct  551   QTVVVSLVPRCGGELVTVGGVSISYL  576



>gb|ADC92563.1| polyphenol oxidase [Nelumbo nucifera]
Length=597

 Score =   423 bits (1087),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 248/539 (46%), Positives = 336/539 (62%), Gaps = 31/539 (6%)
 Frame = +1

Query  232   SKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYR  411
             S  +LDRRNVL+GLGGLYGA  L    +   A   P+  PD++ CG A +   +   P  
Sbjct  68    SLGRLDRRNVLIGLGGLYGATGLC---AGRLAFGAPIMPPDLSKCGAANLPAGA--KPTN  122

Query  412   CCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQ  588
              CPP +  +++  +K+PS S+ + VRPAAH VD  Y+ KY  AI  MK LP+DDPRNF Q
Sbjct  123   RCPPAS--SEIVDFKLPSSSEPMRVRPAAHMVDEEYIAKYSKAIALMKALPADDPRNFTQ  180

Query  589   QANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYW  759
             QANVHCAYC+GAY   G P    Q+H +W FF FHR+YLYF+ER++  +I+DPTF LPYW
Sbjct  181   QANVHCAYCDGAYDQIGFPDLELQVHNSWLFFSFHRYYLYFYERMLGKLIDDPTFALPYW  240

Query  760   NWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLA  939
             NWD P GM  P ++ + N  SPLYD+ R+  H+   ++DL Y+  D        +KNNLA
Sbjct  241   NWDAPAGMKMPTMYANPN--SPLYDKLRDAKHQPPTMIDLNYNVQDTTMTPEQLLKNNLA  298

Query  940   IMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNF  1119
              MYRQ+++N     LF G P RA +    G G++EN+PH  VH W GD    N E+MGNF
Sbjct  299   TMYRQVVSNGSTAQLFLGSPYRAGDQPDPGFGSLENVPHGPVHLWAGDRTQPNIENMGNF  358

Query  1120  YSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDC  1299
             YSAA DP+FY+ HSNVDRMWTIWK LGG+R D  D DWL+  FL +DE K  V+VKVRDC
Sbjct  359   YSAARDPIFYAHHSNVDRMWTIWKKLGGRRKDFKDPDWLNAGFLLYDENKQLVRVKVRDC  418

Query  1300  LDNEKLGYTFQDMPIPWKDFKPTRKRTV----KLSITE----SVPASTDVLPAPLSKNLT  1455
             LD +KL Y++QD+ IPW   +PT  + +    KL IT+        +    P  L     
Sbjct  419   LDEKKLRYSYQDVEIPWMKTRPTPGKLMAAAQKLKITDRGLKKKKPTVSEFPKELDAPFK  478

Query  1456  FYV-----TRSTSVPETQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGS  1617
               V     +RS    E +EE+L +D V  +    ++FDV++N++++ +    D++E+AGS
Sbjct  479   VVVKRPRKSRSKKEKEDEEEILVIDQVELERDTVVKFDVYINDEDEPSP---DKSEFAGS  535

Query  1618  FGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             F N+PH H G   +   T     ISEL++DL+ E DD+V+VT+VP++GG  VT+    I
Sbjct  536   FVNVPHKH-GKKMSKLKTCLRFGISELLEDLEAEDDDEVVVTIVPRIGGDLVTIGGIKI  593



>dbj|BAO79386.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=607

 Score =   423 bits (1087),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 252/574 (44%), Positives = 326/574 (57%), Gaps = 41/574 (7%)
 Frame = +1

Query  157   ARRGDAVKIRCAASSEGRDENPDSLS------KAKLDRRNVllglgglygaynlgaggSN  318
             +RR    K+ C  +S   D N DS S        KLDRRNVLLG+GGLYGA       + 
Sbjct  42    SRRFAPSKVSC--NSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGA-TK  98

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAA  495
             P A   P+  PD++ CG AT+       P  CCPP+T  TK+  +++PS  S +  RPAA
Sbjct  99    PLAFGAPIQAPDISKCGTATVP--DGVTPTNCCPPVT--TKIIDFQLPSSGSPMRTRPAA  154

Query  496   HAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGN---PYQIHFNW  666
             H V   YL KYK AI+  K LP DDPR+F QQANVHC YC GAY   G      Q+H +W
Sbjct  155   HLVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASW  214

Query  667   FFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRN  846
              F PFHR+YLYF ERI+  +I+DPTF LPYW WDNP GM  P I+   +  S LYD+ RN
Sbjct  215   LFLPFHRYYLYFNERILAKLIDDPTFALPYWAWDNPDGMYMPTIY--ASSPSSLYDEKRN  272

Query  847   QDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSS  1026
               H    V+DL Y G +   PD     +NLAIMY+Q+++ A  P LF G P RA +    
Sbjct  273   AKHLPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSGATTPKLFLGYPYRAGDAIDP  332

Query  1027  GMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGK  1206
             G GT+E++PHN VH+W G     + EDMGNFY+A  DP+F+  H+NVDRMW IWKT+GGK
Sbjct  333   GAGTLEHVPHNIVHKWTGLADKPS-EDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGGK  391

Query  1207  -RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW-------KDFK  1362
              R D  D DWLD  F+F+DE K  VKVKV DC+D  KL Y +QD+PIPW       K   
Sbjct  392   NRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPIPWLPKKTKAKAKT  451

Query  1363  PTRKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE----------MLNL  1512
              T+     ++    +P +T        K L   +      P+              +L  
Sbjct  452   TTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVLLIK  511

Query  1513  DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              +  D   F++FDV++N DED +      +E+AGSF N+PH H     T   T    AI+
Sbjct  512   GIELDRENFVKFDVYIN-DEDYSVSRPKNSEFAGSFVNVPHKHMKEMKT--KTNLRFAIN  568

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             EL++DL  E D+ V+VT+VP+ GG  VT+    I
Sbjct  569   ELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEI  602



>ref|XP_008779317.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Phoenix dactylifera]
Length=592

 Score =   422 bits (1086),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 248/544 (46%), Positives = 334/544 (61%), Gaps = 30/544 (6%)
 Frame = +1

Query  178   KIRCAASSEGRDENPDSLSKA-----KLDRRNVllglgglygaynlgaggSNPFALADPV  342
             +I C A  E   E P   S+A     KLDRR++L+GLGGLYGA        N  AL  P+
Sbjct  44    RISCKARDE--HEKPMHTSEATGSSGKLDRRDMLIGLGGLYGAAAGLGV--NRKALGLPI  99

Query  343   PLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYL  519
               PD++ CGPA +   S  +P  CCPP T  +K+  +K+P  S  L +RPAAH VD+ YL
Sbjct  100   EAPDISKCGPADLP--SGAIPTDCCPPFT--SKIIDFKLPPRSDPLRIRPAAHLVDSEYL  155

Query  520   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRW  690
              KY  A++ MK LP+DDPRNF QQANVHCAYC+G+Y   G P    Q+H +W FFP+HR+
Sbjct  156   AKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIEIQVHDSWIFFPWHRF  215

Query  691   YLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHV  870
             YLYF E+I+  +I D TF LP+WNWD P GM  P I+ D +  S LYD+ R+  H+  ++
Sbjct  216   YLYFHEKILGKLIGDETFALPFWNWDAPAGMGMPSIYTDPS--SSLYDKLRDAKHQPPYL  273

Query  871   LDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             +DL ++G D       ++ +NL IMYRQ+I N     LF G P RA +  + G G+ EN+
Sbjct  274   VDLDFNGQDPSFTQAQQIDHNLKIMYRQVIANGKTAQLFMGSPYRAGDQPNPGGGSFENV  333

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH +VH W GD    N EDMG  YSA+ DP+FY+ HSNVDRMW +WK LGGK  D  DKD
Sbjct  334   PHGTVHEWTGDRNQPNGEDMGVLYSASRDPIFYAYHSNVDRMWYVWKKLGGKHKDFDDKD  393

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSIT-ESV  1407
             WL+T FLF+DE    V+VK++DCLD + L YT+QD+ IPW   +PT K T+    +  S+
Sbjct  394   WLNTSFLFYDENADIVRVKIKDCLDTQWLRYTYQDVEIPWLRTRPTPKGTMAAKKSARSL  453

Query  1408  PASTDV-LPAPLSKNLTFYVTR------STSVPETQEEMLNLDLVYDDTKFIRFDVFLNE  1566
              A T+   P  L   ++  V R      S    + +E ++   + +D   FI+FDV++N 
Sbjct  454   RAITEATFPVTLDSPVSATVRRPKVSRSSKEKEDEEEVLVVEGIEFDRDVFIKFDVYINT  513

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK-TTTFNLAISELIKDLDLEGDDKVLVT  1743
              ED   V+   +E+AG+F N+PH H+      K  T   L I+EL++DL  E DD VLVT
Sbjct  514   PED--GVDPGSSEFAGAFVNVPHKHKHSKKEKKLMTALRLGITELLEDLGAEADDSVLVT  571

Query  1744  LVPK  1755
             LVP+
Sbjct  572   LVPR  575



>gb|ABI96950.1| putative polyphenol oxidase [Spiraea densiflora]
Length=454

 Score =   417 bits (1073),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 215/461 (47%), Positives = 290/461 (63%), Gaps = 36/461 (8%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +   P  CCPP    TK+  +++P+ ++L VRPAAH
Sbjct  1     PFAFAKPVLPPDVSKCGAADLP--TGAEPMNCCPP--PATKIIDFRLPAPNRLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD  Y+ KY  A++ MK LP  DPR+F  QA +HCAYC+GAY   G P    Q+H +W 
Sbjct  57    AVDKNYIAKYNKAMELMKALPDSDPRSFKSQAAIHCAYCDGAYDQTGFPDLELQVHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYF+E+I+  +INDP+F +PYWNWDNP GM  P +F   N  SPLYD+ RN 
Sbjct  117   FFPFHRYYLYFYEKILGKLINDPSFAIPYWNWDNPAGMQMPALF--TNPKSPLYDKLRNA  174

Query  850   DHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSG  1029
              H+  +++DL YSG D    +  +V  NL IMYR M++NA  PLLFFG+P RA  + + G
Sbjct  175   SHQPPNMIDLDYSGTDENNTNQVQVNQNLKIMYRAMVSNAKNPLLFFGQPYRAGTSPNPG  234

Query  1030  MGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKR  1209
              G++EN PH  +H W GD    N E+MGNFYSA  DP+FYS HSNVDRMW +WK LGGKR
Sbjct  235   GGSVENTPHGPIHLWAGDKTQPNFENMGNFYSAGKDPIFYSHHSNVDRMWDLWKGLGGKR  294

Query  1210  TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR----  1377
             TDI D DWL++ FLF++E    V+V V+DCLD++KLGYT+QD+ IPW   KPT  R    
Sbjct  295   TDITDSDWLNSGFLFYNENAEMVRVTVKDCLDSKKLGYTYQDVEIPWLKSKPTPIRRAEQ  354

Query  1378  -------------TVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE------  1500
                            +LS  + VPAS    P  L++ ++  V R       QEE      
Sbjct  355   KISQLAKKLGHAHAAELSAAKVVPAS--AFPLELTEKISTVVKRPQQKKRKQEEKDEEEE  412

Query  1501  -MLNLDLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSF  1620
              ++   + ++  + ++FDV++N+ +D+ +     TE+AGSF
Sbjct  413   ILVIKGIEFERDQVVKFDVYVNDVDDLPSGP-SNTEFAGSF  452



>gb|AFH00996.1| polyphenol oxidase II [Pyrus x bretschneideri]
 gb|AFH00997.1| polyphenol oxidase II [Pyrus x bretschneideri]
Length=600

 Score =   422 bits (1086),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 258/556 (46%), Positives = 328/556 (59%), Gaps = 30/556 (5%)
 Frame = +1

Query  181   IRCAASSEGRDE---NPDSLSK--AKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
             I C A++   +E    P+  S    KLDRRNVLLGLGGLYGA  L      P A A P+ 
Sbjct  53    ISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLA---QKPLAFAAPLA  109

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLEK  525
              PD+  C  A I+     V   CCPP++  TK++ +       L  RPAAH V   YL K
Sbjct  110   PPDLTKCTLAEITTGGETVA--CCPPVS--TKIKAFTPDRSIPLRTRPAAHLVTDEYLAK  165

Query  526   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYL  696
             +K A   M+ LP DDPR+  QQANVHCAYCNGAY   G P    Q+HF+W FFPFHR YL
Sbjct  166   FKNAQALMRALPEDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHRMYL  225

Query  697   YFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLD  876
             YF+ERI+  +I+DPTF LPYWNWD+P G   P I+ D    SPLYDQYRN  H+   ++D
Sbjct  226   YFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTDTT--SPLYDQYRNAGHQPPVLVD  283

Query  877   LAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRA-DNTQSSGMGTIENIP  1053
             L+Y G D    + T++  NLAIMYRQM++ A  P LFFG   RA D T  +  GTIEN P
Sbjct  284   LSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGTYAGTIENNP  343

Query  1054  HNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDW  1233
             HN++H W GDP   N EDMGNFYS+  DP+FY+ H NVDRMW IWKTLGGKR       W
Sbjct  344   HNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLGGKRKVPYRHRW  403

Query  1234  LDTEFLFFDETKTAVKVKVRDCLDNEK-LGYTFQDMPIPWKDFKPT-RKRTVKLSITESV  1407
             LD EFLF+DE    V  KVRD +   K L YT++ + +P    KPT RK   K     S 
Sbjct  404   LDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPCLFSKPTARKPRNKTKARVSD  463

Query  1408  PASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLN-------LDLVYDDTKFIRFDVFLNE  1566
                T   PA      T  V R      T++E  N        D+ ++  + ++FDVF+N+
Sbjct  464   TQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVFIND  523

Query  1567  DEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVLVTL  1746
             D + +    D++E+AGSF ++PH  + G+ T   T   L I++L++DL +E D  VLVTL
Sbjct  524   DAE-SLSRKDKSEFAGSFVHVPHKQKTGTKT--KTNLKLGITDLLEDLGVEEDSCVLVTL  580

Query  1747  VPKVGGSFVTVNNAYI  1794
             VP+V  S +TV    I
Sbjct  581   VPRVSNSPITVGGFKI  596



>gb|ACB12083.1| polyphenol oxidase [Triticum monococcum]
Length=577

 Score =   421 bits (1082),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 247/566 (44%), Positives = 324/566 (57%), Gaps = 42/566 (7%)
 Frame = +1

Query  157   ARRGDAVKIRCAASSEGRDENPDSLSKAKLDRRNVllglgglygaynlgaggSNPFALAD  336
             AR+   + I C A+  GR           +DRR V+LGLGG   A      G    A+A 
Sbjct  36    ARQPRHLSISCEATGRGR-----------VDRREVILGLGGAAAAGLATDQGRG--AIAA  82

Query  337   PVPLPDVANCGPATISFSSCKVPYRCCP-PITDTTKVEYYKIPSFSKLNVRPAAHAVDAA  513
             P+  PD+ NC   T    +      CCP P T  T  E    P+ S L VRPAAH VDA 
Sbjct  83    PIQAPDLRNC--QTPELPNTPPDTNCCPTPGTGITDFEL--PPASSPLRVRPAAHLVDAG  138

Query  514   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFH  684
             YL +Y+ A+  MK LP+DDPR+F QQ +VHCAYC+ AY   G P    QIH  W FFP+H
Sbjct  139   YLARYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDLELQIHNCWLFFPWH  198

Query  685   RWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYG  864
             R+YLYF ERI+  +I D TF LP+WNWD P GMT P I+   N+ SPLYD+ R+  H+  
Sbjct  199   RFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIY--ANRSSPLYDERRDPAHQPP  256

Query  865   HVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIE  1044
              ++DL  SG D   P   ++  NL IMYRQMI+NA   LLF G+P RA +    G G++E
Sbjct  257   VLVDLDSSGFDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAGSLE  316

Query  1045  NIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIAD  1224
             N+PH +VH W GDPR  N  DMGNF+SAA DP+F++ H N+DR+W +W+ L    TD  D
Sbjct  317   NVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVWRGLRPSNTDFTD  376

Query  1225  KDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITES  1404
              DWLD  FLF+DE    V+V+VRDCLD   L YT+QD+ +PW + +P      K S    
Sbjct  377   PDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNARP-----AKASGGTP  431

Query  1405  VPASTDVLPAPLSKNLTFYVT-----RSTSVPETQEEML---NLDLVYDDTKFIRFDVFL  1560
              PA+T  LPA L   +   VT     RS    + +EE+L    +++     KFI+FDV +
Sbjct  432   APATTGTLPATLDSTIRVTVTRPRVSRSRREKDDEEEVLVVEGIEIADHFNKFIKFDVLV  491

Query  1561  NEDE-DVNTVELDRTEY-AGSFGNLPHV---HEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             NE E  V+      T Y AGSF + PH+    E    + KT      + +L+ D+  +GD
Sbjct  492   NEPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTVA-RFGVCDLMDDIGADGD  550

Query  1726  DKVLVTLVPKVGGSFVTVNNAYINTL  1803
               V+V+LVP+ GG  VTV    I+ L
Sbjct  551   QTVVVSLVPRCGGELVTVGGVSISYL  576



>ref|XP_003567197.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Brachypodium 
distachyon]
Length=592

 Score =   421 bits (1083),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 236/574 (41%), Positives = 326/574 (57%), Gaps = 30/574 (5%)
 Frame = +1

Query  142   NPSRAARRGDAVKIRCAASSE---GRDENPDSLSKAKLDRRNVllglgglygaynlgagg  312
              P RAA R     +RC  S++   GR E+       +LDRR+VLL LG L  +   G   
Sbjct  30    KPRRAAGR-----VRCTLSTDATGGRAEH----DGPRLDRRDVLLRLGTLGASATAGLLS  80

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             S   A A PV  PD+++CG   +          CCPP ++   V++    + + L  RPA
Sbjct  81    SPRLAGAAPVATPDISSCGKPDLGLPPNANLLTCCPPPSNALPVDFSPPDASTPLRTRPA  140

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             AH+V A Y+ K   A+  MK LP++DPR+F  QA++HCAYCNG+Y + G P    Q+H +
Sbjct  141   AHSVGADYVAKLNRAMAAMKALPAEDPRSFAAQASIHCAYCNGSYGVEGFPGSDLQVHNS  200

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W F PFHR YLYFFERI+ S+I DP+F +P+WNWD P GM  P ++ D    SPL+D  R
Sbjct  201   WLFLPFHRCYLYFFERILGSLIGDPSFAMPFWNWDAPGGMRMPAMYVDPK--SPLFDPRR  258

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQS  1023
             +  H    +++L Y+G +    D  +V +NL +MYRQM++ +P P LFFG   RA +   
Sbjct  259   DARHAPPELINLDYNGREPTFTDRQQVDHNLRVMYRQMVSLSPTPSLFFGGAYRAGDEPD  318

Query  1024  SGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGG  1203
              G G +ENIPH  VH W GDP     EDMGNFYSA  DP+FY+ H N+DRMW++WK L  
Sbjct  319   QGPGPMENIPHGPVHIWCGDPNQPAGEDMGNFYSAGRDPLFYAHHGNIDRMWSVWKGLDP  378

Query  1204  KR-TDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-RKR  1377
             +R  D+ D DWLD+ FLF+DET   V+++VRD LD ++L Y FQD+P+PW   +PT   R
Sbjct  379   RRHRDLTDPDWLDSSFLFYDETPKLVRIRVRDVLDTDRLRYRFQDVPMPWTTARPTVTPR  438

Query  1378  TVKLSITESVPASTD---VLPAPLSKNLTFYVTRSTSVPET------QEEMLNLDLVYDD  1530
                     +V AS       P  L    +  V R  S   +      +EE+L +  +  D
Sbjct  439   ARSFGTPTAVAASAKKATKFPIMLDSATSVTVRRPVSSKRSKLEKSAKEEVLVIGGIEVD  498

Query  1531  TKF-IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHE-GGSATPKTTTFNLAISELIK  1704
                  +FDVF+N  +D   V     E AGSF ++PH H          T   LA++E ++
Sbjct  499   MDIAAKFDVFVNAGDDHAAVGSGGRELAGSFVSVPHRHRHDKKEKKIKTKLRLALNEQLE  558

Query  1705  DLDLEGDDKVLVTLVPKVGGSFVTVNNAYINTLD  1806
             DLD EGD+ V+VTLVP+ G   V + +  I  +D
Sbjct  559   DLDAEGDESVVVTLVPRQGKGKVKIGSVKIELID  592



>sp|P43311.1|PPO_VITVI RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Vitis vinifera]
 pir||S52629 catechol oxidase (EC 1.10.3.1) precursor - grape
 emb|CAA81798.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   421 bits (1083),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 252/574 (44%), Positives = 325/574 (57%), Gaps = 41/574 (7%)
 Frame = +1

Query  157   ARRGDAVKIRCAASSEGRDENPDSLS------KAKLDRRNVllglgglygaynlgaggSN  318
             +RR    K+ C  +S   D N DS S        KLDRRNVLLG+GGLYGA       + 
Sbjct  42    SRRFAPSKVSC--NSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGA-TK  98

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAA  495
             P A   P+  PD++ CG AT+       P  CCPP+T  TK+  +++PS  S +  RPAA
Sbjct  99    PLAFGAPIQAPDISKCGTATVP--DGVTPTNCCPPVT--TKIIDFQLPSSGSPMRTRPAA  154

Query  496   HAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGN---PYQIHFNW  666
             H V   YL KYK AI+  K LP DDPR+F QQANVHC YC GAY   G      Q+H +W
Sbjct  155   HLVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASW  214

Query  667   FFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRN  846
              F PFHR+YLYF ERI+  +I+DPTF LPYW WDNP GM  P I+   +  S LYD+ RN
Sbjct  215   LFLPFHRYYLYFNERILAKLIDDPTFALPYWAWDNPDGMYMPTIY--ASSPSSLYDEKRN  272

Query  847   QDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSS  1026
               H    V+DL Y G +   PD     +NLAIMY+Q+++ A  P LF G P RA +    
Sbjct  273   AKHLPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSGATTPKLFLGYPYRAGDAIDP  332

Query  1027  GMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGK  1206
             G GT+E+ PHN VH+W G     + EDMGNFY+A  DP+F+  H+NVDRMW IWKT+GGK
Sbjct  333   GAGTLEHAPHNIVHKWTGLADKPS-EDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGGK  391

Query  1207  -RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW-------KDFK  1362
              R D  D DWLD  F+F+DE K  VKVKV DC+D  KL Y +QD+PIPW       K   
Sbjct  392   NRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPIPWLPKNTKAKAKT  451

Query  1363  PTRKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE----------MLNL  1512
              T+     ++    +P +T        K L   +      P+              +L  
Sbjct  452   TTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVLLIK  511

Query  1513  DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              +  D   F++FDV++N DED +      +E+AGSF N+PH H     T   T    AI+
Sbjct  512   GIELDRENFVKFDVYIN-DEDYSVSRPKNSEFAGSFVNVPHKHMKEMKT--KTNLRFAIN  568

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             EL++DL  E D+ V+VT+VP+ GG  VT+    I
Sbjct  569   ELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEI  602



>gb|ABR57235.1| polyphenol oxidase [Camellia sinensis]
Length=598

 Score =   421 bits (1081),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 244/563 (43%), Positives = 334/563 (59%), Gaps = 39/563 (7%)
 Frame = +1

Query  190   AASSEGRDENPD--------SLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
              + S+ +D +P+          S  K DRRN+L+GLGGLYGA  L    ++P ALA PV 
Sbjct  43    VSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLGGLYGAAGLTD--TDPPALAAPVT  100

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLE  522
              PD++ CG A +   +   P  CCPP   T K+  +K+P  S  L VRPAAH  D  Y+ 
Sbjct  101   APDLSKCGAADLPADA--KPTNCCPP--KTNKIIEFKLPPPSNILRVRPAAHLADQKYIA  156

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             K+  A+Q MK LP DDPR+F QQ+N+HCAYC GAY   G P    Q+H +W FFPFHR+Y
Sbjct  157   KFSKAVQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFY  216

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFE+I+  +++DP F +P+WNWD+P GM  P ++ D N  SPLY++ R+  H+   ++
Sbjct  217   LYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADIN--SPLYNRLRDAKHQPPTLI  274

Query  874   DLAYSGDDIIAPDPTKVK-NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             DL Y+  D    D  K K  NL IMYRQ++     P LF G   RA +    G G++ENI
Sbjct  275   DLDYNLTDPKNVDEEKQKLRNLTIMYRQVVAGGKTPRLFLGSSYRAGDDPDPGAGSLENI  334

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+FY  H+NVDR+WT+WKTL GKR D  D D
Sbjct  335   PHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLEGKRNDFKDPD  394

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT----------RKRT  1380
             WL++EF F+DE    V VKV++ LD+ KLGY +QD+ IPW + +P+          + + 
Sbjct  395   WLNSEFTFYDENAQVVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFFRKIKNKA  454

Query  1381  VKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKF-----IR  1545
              +   TE++ ++  V P  L + +   V R T     +EE     +V +  +      ++
Sbjct  455   GRAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRREREEEEEEVVVVEGIEVERDVSVK  514

Query  1546  FDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGD  1725
             FDVF+N DED      ++TE+AGSF N+P  H+        T   L I+EL++DL+ E D
Sbjct  515   FDVFIN-DEDEAASGPEKTEFAGSFVNVPRKHKHDKKI--RTGLRLGITELLEDLEAEND  571

Query  1726  DKVLVTLVPKVGGSFVTVNNAYI  1794
             + VLVTLVP+ G   VT+    I
Sbjct  572   ESVLVTLVPRYGSDAVTIGGVKI  594



>gb|ACB12081.1| polyphenol oxidase [Triticum urartu]
Length=577

 Score =   420 bits (1079),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 227/509 (45%), Positives = 299/509 (59%), Gaps = 27/509 (5%)
 Frame = +1

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAV  504
             A+A P+  PD+ NC   T    +      CCP    T   ++   P+ S L VRPAAH V
Sbjct  79    AIAAPIQAPDLRNC--QTPELPNTPPDTNCCP-TPGTGITDFVLPPASSPLRVRPAAHLV  135

Query  505   DAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFF  675
             DA YL KY+ A+  MK LP+DDPR+F QQ +VHCAYC+ AY   G P    QIH  W FF
Sbjct  136   DAGYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDLELQIHNCWLFF  195

Query  676   PFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDH  855
             P+HR+YLYF ERI+  +I D TF LP+WNWD P GMT P I+ D +  SPLYD+ R+  H
Sbjct  196   PWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMTLPAIYADRS--SPLYDERRDPAH  253

Query  856   RYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMG  1035
             +   ++DL  SG D   P   ++  NL IMYRQMI+NA   LLF G+P RA +    G G
Sbjct  254   QPPVLVDLDSSGSDTNIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGAG  313

Query  1036  TIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTD  1215
             ++EN+PH +VH W GDPR  N  DMGNF+SAA DP+F++ H N+DR+W +W+ L    TD
Sbjct  314   SLENVPHGTVHVWTGDPRQPNLADMGNFFSAARDPIFFAHHGNIDRLWHVWRGLRPSNTD  373

Query  1216  IADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSI  1395
               D DWLD  FLF+DE    V+V+VRDCLD   L YT+QD+ +PW + +P      K S 
Sbjct  374   FTDPDWLDAAFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNARP-----AKASG  428

Query  1396  TESVPASTDVLPAPLSKNLTFYVT-----RSTSVPETQEEML---NLDLVYDDTKFIRFD  1551
                 PA+T  LPA L   +   VT     RS    + +EE+L    + +     KFI+FD
Sbjct  429   GTPAPATTGTLPATLDSTIRVTVTRPRVSRSRREKDDEEEVLVVEGIKIADHFNKFIKFD  488

Query  1552  VFLNEDE-DVNTVELDRTEY-AGSFGNLPHV---HEGGSATPKTTTFNLAISELIKDLDL  1716
             V +NE E  V+      T Y AGSF + PH+    E    + KT      + +L+ D+  
Sbjct  489   VLVNEPEGGVDGTPATATGYCAGSFAHTPHMVRPEETRKGSVKTVA-RFGVCDLMDDIGA  547

Query  1717  EGDDKVLVTLVPKVGGSFVTVNNAYINTL  1803
             +GD  V+V+LVP+ GG  VTV    I+ L
Sbjct  548   DGDQTVVVSLVPRCGGELVTVGGVSISYL  576



>gb|ABF19601.1| polyphenol oxidase [Camellia ptilophylla]
Length=595

 Score =   421 bits (1081),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 247/564 (44%), Positives = 336/564 (60%), Gaps = 40/564 (7%)
 Frame = +1

Query  190   AASSEGRDENPD--------SLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
             A+ S+ +D +P+          S  K DRRN+L+GLGGLYGA  L    ++P ALA PV 
Sbjct  39    ASCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLGGLYGAAGLTD--TDPPALAAPVT  96

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLE  522
              P ++ CG A +   +   P  CCPP   T K+  +K+P  S  L VRPAAH  D  Y+ 
Sbjct  97    APYLSKCGAANLPADA--KPTNCCPP--KTNKIIEFKLPPPSNILRVRPAAHLADEKYIA  152

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             K+  A+Q MK LP DDPR+F QQ+N+HCAYC GAY   G P    Q+H +W FFPFHR+Y
Sbjct  153   KFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFY  212

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFE+I+  +++DP F +P+WNWD+P GM  P ++ D N  SPLY++ R+  H+   ++
Sbjct  213   LYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADIN--SPLYNRLRDAKHQPPTLI  270

Query  874   DLAYSGDDIIAPDPTKVK-NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             DL Y+  D    D  K K  NL IMYRQ+++    P LF G   RA +    G G++ENI
Sbjct  271   DLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENI  330

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH   H W GD    N EDMGNFYSA  DP+FY  H+NVDR+WT+WKTLGGKR D  D D
Sbjct  331   PHGPAHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGGKRNDFKDPD  390

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-------RKRTVKL  1389
             WL++EF F+DE    V VKV++ LD+ KLGY +QD+ IPW + +P+       RK   K 
Sbjct  391   WLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNTRPSPRISNFLRKIKNKA  450

Query  1390  SI---TESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKF------I  1542
              I   TE++ ++  V P  L + +   V R T     +E+    ++V  +         +
Sbjct  451   GIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEVERDVSV  510

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FDVF+N DED      ++TE+AGSF N+P  H+        T   L I+EL++DL+ E 
Sbjct  511   KFDVFIN-DEDEAASGPEKTEFAGSFVNVPRKHKHDKKI--RTGLRLGITELLEDLEAED  567

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             D+ VLVTLVP+ G   VT+    I
Sbjct  568   DESVLVTLVPRYGSDAVTIGGVKI  591



>gb|ABR10907.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   421 bits (1081),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 246/564 (44%), Positives = 337/564 (60%), Gaps = 40/564 (7%)
 Frame = +1

Query  190   AASSEGRDENPD--------SLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
              + S+ +D +P+          S  K DRRN+++GLGGLYGA  L    ++P ALA PV 
Sbjct  43    VSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMVIGLGGLYGAAGLTD--TDPPALAAPVT  100

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLE  522
              PD++ CG A +   +   P  CCPP   T K+  +K+P  S  L VRPAAH  D  Y+ 
Sbjct  101   APDLSKCGAADLPADA--KPTNCCPP--KTNKIIEFKLPPPSNILRVRPAAHLADEKYIA  156

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             K+  A+Q MK LP DDPR+F QQ+N+HCAYC GAY   G P    Q+H +W FFPFHR+Y
Sbjct  157   KFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFY  216

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFE+I+  +++DP F +P+WNWD+P GM  P ++ D N  SPLY++ R+  H+   ++
Sbjct  217   LYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADIN--SPLYNRLRDAKHQPPTLI  274

Query  874   DLAYSGDDIIAPDPTKVK-NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             DL Y+  D    D  K K  NL IMYRQ+++    P LF G   RA +    G G++ENI
Sbjct  275   DLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENI  334

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+FY  H+NVDR+WT+WKTLGGKR D  D D
Sbjct  335   PHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGGKRNDFKDSD  394

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-------RKRTVKL  1389
              L++EF F+DE    V VKV++ LD+ KLGY +QD+ IPW + +P+       RK   K 
Sbjct  395   CLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISIFFRKIKNKA  454

Query  1390  SI---TESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKF------I  1542
              I   TE++ ++  V P  L + +   V R T     +E+    ++V  +         +
Sbjct  455   GIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSV  514

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FDVF+N DED      ++TE+AGSF N+P  H+        T+  L I+EL++DL+ E 
Sbjct  515   KFDVFIN-DEDEAASGPEKTEFAGSFVNVPRKHKHDKKI--RTSLRLGITELLEDLEAED  571

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             D+ VLVTLVP+ G   VT+    I
Sbjct  572   DESVLVTLVPRYGSDAVTIGGVKI  595



>gb|KHN46328.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=620

 Score =   421 bits (1082),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 233/529 (44%), Positives = 314/529 (59%), Gaps = 47/529 (9%)
 Frame = +1

Query  313   SNPFALAD-PVPLPDVANCG------PATISFSSCKVPYRCCPPITDTTKVEYYKIPSFS  471
             +NP A+A  P+  PD+ +C       P  +     +    CCPP + +  +++ K+P  +
Sbjct  100   TNPLAMAAAPILEPDLEHCCITDDVPPKGV----IEAQVYCCPPRSSSPPIDF-KLPKGT  154

Query  472   KLNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP--  645
              L VRP A  V   YLEKYK A+++M++LPSDDPR+F QQA++HCAYC+G Y   G P  
Sbjct  155   PLRVRPPAQFVTDEYLEKYKLALKRMRELPSDDPRSFKQQADIHCAYCDGGYKQLGFPVE  214

Query  646   --YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNP-PGMTFPGIFDDENQ  816
               +++HF+W FFPFHRWYLYF+ERI+ S+I+DPTF LPYWNWDNP  GM  P IF DE+ 
Sbjct  215   LDFKVHFSWIFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDNPDGGMVLPSIFADED-  273

Query  817   LSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGK  996
              SPLYD  RN D     ++DL Y        +P+ V+ NL +MY  +++ A    LF GK
Sbjct  274   -SPLYDPRRNPDITPTTLVDLNYGS----GKEPS-VEQNLGVMYTSVVSGAKRASLFHGK  327

Query  997   PLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRM  1176
             P  A      G GT+E  PH +VHRW GDPR  N EDMG FYSA  DP FYS H+NVDRM
Sbjct  328   PFLAGKQPELGGGTVELGPHTAVHRWTGDPRQPNKEDMGRFYSAGRDPAFYSHHANVDRM  387

Query  1177  WTIWKTL-GGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWK  1353
             W IWKT+  GKR D  ++DWL+T F F+DE KT V+VKV+D LD  K+GY +QD+ IPW 
Sbjct  388   WNIWKTIPSGKRRDFKNRDWLETSFFFYDENKTLVRVKVKDSLDTNKMGYVYQDVAIPWL  447

Query  1354  DFKPTR------KRTVKLSITESVPASTDVLPAPLSK--------NLTFYVTRSTSV---  1482
             + KP        K+         + A+      P SK         +T  V R   +   
Sbjct  448   EKKPKPKRTRKAKKVAFAQQFGGIGAAMAAETGPSSKFPLTLLDSKVTLLVKRPKQLRSK  507

Query  1483  --PETQEEMLNLDLV-YDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGS  1653
                E +EE+L +D + +D    ++FDV++  DEDV  +  + TE+AGSF  L H H   +
Sbjct  508   RDKEEEEEVLVIDGIEFDGDDDVKFDVYIT-DEDVEDIGPESTEFAGSFSTLGHSHSNMN  566

Query  1654  ATPKT-TTFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
                K  T+  L I++L++DLD E DD VLVTLVP+     +T+ N  I 
Sbjct  567   MDKKIKTSLTLGITDLLEDLDAENDDSVLVTLVPRSENVSITIQNIKIE  615



>gb|ACF17425.1| polyphenol oxidase [Camellia sinensis]
 gb|ACS88249.1| polyphenol oxidase [Camellia sinensis]
 gb|AFU35561.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   420 bits (1080),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 246/564 (44%), Positives = 337/564 (60%), Gaps = 40/564 (7%)
 Frame = +1

Query  190   AASSEGRDENPD--------SLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
              + S+ +D +P+          S  K DRRN+++GLGGLYGA  L    ++P ALA PV 
Sbjct  43    VSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMVIGLGGLYGAAGLTD--TDPPALAAPVT  100

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLE  522
              PD++ CG A +   +   P  CCPP   T K+  +K+P  S  L VRPAAH  D  Y+ 
Sbjct  101   APDLSKCGAADLPADA--KPTNCCPP--KTNKIIEFKLPPPSNILRVRPAAHLADEKYIA  156

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             K+  A+Q MK LP DDPR+F QQ+N+HCAYC GAY   G P    Q+H +W FFPFHR+Y
Sbjct  157   KFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFY  216

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFE+I+  +++DP F +P+WNWD+P GM  P ++ D N  SPLY++ R+  H+   ++
Sbjct  217   LYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADIN--SPLYNRLRDAKHQPPTLI  274

Query  874   DLAYSGDDIIAPDPTKVK-NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             DL Y+  D    D  K K  NL IMYRQ+++    P LF G   RA +    G G++ENI
Sbjct  275   DLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENI  334

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+FY  H+NVDR+WT+WKTLGGKR D  D D
Sbjct  335   PHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGGKRNDFKDSD  394

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-------RKRTVKL  1389
              L++EF F+DE    V VKV++ LD+ KLGY +QD+ IPW + +P+       RK   K 
Sbjct  395   CLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISNFFRKIKNKA  454

Query  1390  SI---TESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKF------I  1542
              I   TE++ ++  V P  L + +   V R T     +E+    ++V  +         +
Sbjct  455   GIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSV  514

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FDVF+N DED      ++TE+AGSF N+P  H+        T+  L I+EL++DL+ E 
Sbjct  515   KFDVFIN-DEDEAASGPEKTEFAGSFVNVPRKHKHDKKI--RTSLRLGITELLEDLEAED  571

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             D+ VLVTLVP+ G   VT+    I
Sbjct  572   DESVLVTLVPRYGSDAVTIGGVKI  595



>gb|ACN38060.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   420 bits (1080),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 247/564 (44%), Positives = 337/564 (60%), Gaps = 40/564 (7%)
 Frame = +1

Query  190   AASSEGRDENPD--------SLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
              + S+ +D +P+          S  K DRRN+L+GLGGLYGA  L    ++P ALA PV 
Sbjct  43    VSCSKAKDSDPNLTPPSQNTRTSLGKFDRRNMLIGLGGLYGAAGLTD--TDPPALAAPVT  100

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLE  522
              PD++ CG A +   +   P  CCPP   T K+  +K+P  S  L VRPAAH  D  Y+ 
Sbjct  101   APDLSKCGAADLPADA--KPTNCCPP--KTNKIIEFKLPPPSNILRVRPAAHLADEKYIA  156

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             K+  A+Q MK LP DDPR+F QQ+N+HCAYC GAY   G P    Q+H +W FFPFHR+Y
Sbjct  157   KFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFY  216

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFE+I+  +++DP F +P+WNWD+P GM  P ++ D N  SPLY++ R+  H+   ++
Sbjct  217   LYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADIN--SPLYNRLRDAKHQPPTLI  274

Query  874   DLAYSGDDIIAPDPTKVK-NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             DL Y+  D    D  K K  NL IMYRQ+++    P LF G   RA +    G G++ENI
Sbjct  275   DLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENI  334

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+FY  H+NVDR+WT+WKTLGGKR D  D D
Sbjct  335   PHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGGKRNDFKDSD  394

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-------RKRTVKL  1389
              L++EF F+DE    V VKV++ LD+ KLGY +QD+ IPW + +P+       RK   K 
Sbjct  395   CLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISNFFRKIKNKA  454

Query  1390  SI---TESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKF------I  1542
              I   TE++ ++  V P  L + +   V R T     +E+    ++V  +         +
Sbjct  455   GIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSV  514

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FDVF+N DED      ++TE+AGSF N+P  H+        T+  L I+EL++DL+ E 
Sbjct  515   KFDVFIN-DEDEAASGPEKTEFAGSFVNVPRKHKHDKKI--RTSLRLGITELLEDLEAED  571

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             D+ VLVTLVP+ G   VT+    I
Sbjct  572   DESVLVTLVPRYGSDAVTIGGVKI  595



>ref|XP_011098121.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=585

 Score =   419 bits (1078),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 241/546 (44%), Positives = 330/546 (60%), Gaps = 31/546 (6%)
 Frame = +1

Query  157   ARRGDAVKIRCAASSEGRDENPDSLSK-AKLDRRNVllglgglygaynlgaggSNPFALA  333
             A+R + +++ CA + + ++ + D  +   K+DRRN+LLGLGG   +         P A A
Sbjct  31    AKRSNRLRVSCADAQKKKEASRDVETPIGKVDRRNMLLGLGGGLYSAANLI--PTPGASA  88

Query  334   DPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAA  513
             +P+  P++  CG AT   +  K+   CCPP ++   +  Y++P   ++ VRP+AH V   
Sbjct  89    NPIKAPELDKCGVATNLNTGEKLDMNCCPPTSEN--IADYQLPPVVQMKVRPSAHRVSPE  146

Query  514   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFH  684
             Y+ KY  AI +MK LP DDPRNF QQAN+HCAYCNGAY   G      Q+H +W FFPFH
Sbjct  147   YIFKYNMAIDRMKRLPKDDPRNFMQQANIHCAYCNGAYDQPGQGTLDLQVHNSWLFFPFH  206

Query  685   RWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYG  864
             RWYLYF+ERIM  +I DPTF LP+WNWDNP GMT P +F D    S LYD  RNQD+   
Sbjct  207   RWYLYFYERIMGKLIGDPTFALPFWNWDNPKGMTIPPMFLDPK--SALYDSKRNQDNLKA  264

Query  865   HVLDLAYSGDDIIAPDPTKV-KNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTI  1041
              VLDL  +G+     DP +V  NNL IM+ +M+        F GKP R  +  + G G+ 
Sbjct  265   -VLDLGMTGNK----DPLQVVSNNLTIMHTEMVRGNASVYDFMGKPYREGDKVNPGPGSA  319

Query  1042  ENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTL-----GGK  1206
             E   H +VH +VGDPR  + ED+GNFYSA  DP+FY  H+NVDRMWT+WK         +
Sbjct  320   ERGSHTAVHVFVGDPREPSGEDLGNFYSAGRDPLFYCHHANVDRMWTLWKYFLPSNKVPE  379

Query  1207  RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP---TRKR  1377
             RT I D D+L+T FLF+DE    V+V V+DC+DN ++GY F+ + +PW D++P   T   
Sbjct  380   RT-ITDPDFLNTSFLFYDENAQLVRVTVKDCVDNLRMGYDFERIDLPWLDYRPPPQTAGA  438

Query  1378  TVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKFIRFDVF  1557
              VK +   +  A T V P  L K +   V + T      E ++  D+  D TKF++FDVF
Sbjct  439   KVKRTRKSAENAET-VFPLKLDKIVRVLVPK-TRKGVADEVLVIEDITVDTTKFLKFDVF  496

Query  1558  LNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEGDDKVL  1737
             +N DED N  ELD+  YAG++  +PH     +A   TT+  L + EL +D+D+  DD VL
Sbjct  497   VN-DEDDNVEELDKAAYAGTYAQVPHKTNNKTA---TTSIRLKLKELYEDMDVADDDTVL  552

Query  1738  VTLVPK  1755
             VTLVP+
Sbjct  553   VTLVPR  558



>ref|XP_010926766.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=592

 Score =   420 bits (1079),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 238/523 (46%), Positives = 321/523 (61%), Gaps = 22/523 (4%)
 Frame = +1

Query  232   SKAKLDRRNVllglgglygaynlgaggSNPFALADPVPLPDVANCGPATISFSSCKVPYR  411
             S  KLDRR++L+GLGGLYGA        N  AL  P+  PDV+ CGPA +   S   P  
Sbjct  66    SSGKLDRRDMLIGLGGLYGAATGLGV--NRKALGLPIEAPDVSKCGPADLP--SGATPTD  121

Query  412   CCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQ  588
             CCPP   T+K+  +K+P  S  L +R AAH VD+ YL KY  A++ MK LP+DDPRNF Q
Sbjct  122   CCPP--STSKIIDFKLPPRSDPLRIRSAAHLVDSEYLAKYAKAVELMKALPADDPRNFTQ  179

Query  589   QANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWYLYFFERIMQSMINDPTFTLPYW  759
             QANVHCAYC+G+Y   G P    Q+H +W FFP+HR+YLYF E+I+  +I D TF LP+W
Sbjct  180   QANVHCAYCDGSYDQIGFPDIELQVHNSWIFFPWHRFYLYFHEKILGKLIGDETFALPFW  239

Query  760   NWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVLDLAYSGDDIIAPDPTKVKNNLA  939
             NWD P GM  P I+ D +  S LY++ R+  H+  +++DL ++G D       ++  NL 
Sbjct  240   NWDAPAGMQMPSIYTDPS--SSLYNKLRDAKHQPPYLIDLDFNGQDPSFTYDQQIDYNLK  297

Query  940   IMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNF  1119
             IMYRQ+ITN     LF G P RA +  + G G++EN+PH +VH W GD    N EDMG  
Sbjct  298   IMYRQVITNGKTAQLFMGSPYRAGDQPNPGAGSLENVPHGTVHVWTGDRNQPNGEDMGTL  357

Query  1120  YSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDC  1299
             YSAA D +FY+ HSNVDRMW +WK LGGK  D  DKDWL++ FLF+DE    V+VKV++C
Sbjct  358   YSAARDAIFYAHHSNVDRMWNVWKMLGGKHKDFEDKDWLNSSFLFYDENADLVRVKVKNC  417

Query  1300  LDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSI-TESVPASTDV-LPAPLSKNLTFYVTR-  1470
             LD + L YT+QD+ IPW   +PT K T        S+ A T+   P  L  +++  V R 
Sbjct  418   LDTQGLRYTYQDVEIPWLKTRPTPKGTAAAKKGARSLRAVTEATFPVTLDSSVSATVRRP  477

Query  1471  -----STSVPETQEEMLNLDLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPH  1635
                       + +E ++   + +D   FI+F V++N  E+ + V+   TE+AGSF N+PH
Sbjct  478   KVSRSRKEKEDEEEVLVVEGIEFDRDMFIKFAVYINTPEE-DGVDPGSTEFAGSFVNVPH  536

Query  1636  VHEGGSATPKT-TTFNLAISELIKDLDLEGDDKVLVTLVPKVG  1761
              +       K  T   L I++L++DL  E DD VLVTLVP+ G
Sbjct  537   KNSHSKKEKKVRTALRLGITDLLEDLGAEADDSVLVTLVPRKG  579



>gb|ABI96947.1| putative polyphenol oxidase [Rhodotypos scandens]
Length=447

 Score =   414 bits (1065),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 215/446 (48%), Positives = 286/446 (64%), Gaps = 32/446 (7%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +  VP  CCPP   +TK+  ++ P+ S+L VR AAH
Sbjct  1     PFAFAKPVLPPDVSECGAADLP--TGAVPTNCCPP--PSTKIIDFRPPTPSRLRVRQAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGN----PYQIHFNW  666
             AVD AY++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G       Q+H +W
Sbjct  57    AVDRAYIDKYTKALELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGTDPKVELQVHNSW  116

Query  667   FFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRN  846
              FFPFHR+YLYF+E+I+ S+INDPTF LP+WNWD+P GM  P IF + N  SPLYD++RN
Sbjct  117   LFFPFHRYYLYFYEKILGSLINDPTFALPFWNWDSPAGMEMPKIFANPN--SPLYDKFRN  174

Query  847   QDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSS  1026
              +H+  +++DL Y+G D      T++  NL IMYRQM++NA  PLLFFG P RA +    
Sbjct  175   ANHQPPNLVDLDYNGTDENVSKETQINANLKIMYRQMVSNAKNPLLFFGNPYRAGDEPDP  234

Query  1027  GMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKT-LGG  1203
             G G+IE  PH  +H W GD    N EDMGNFYSA  DP+FYS HSNVDRMWTIWKT LGG
Sbjct  235   GGGSIEGTPHGPIHLWCGDNTHPNFEDMGNFYSAGRDPIFYSHHSNVDRMWTIWKTKLGG  294

Query  1204  KRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKR--  1377
             KRTDI D DWL++ FLF++E    V+VKV+D L  E LGY +Q++ IPW + KPT +R  
Sbjct  295   KRTDITDSDWLNSGFLFYNEKAELVRVKVKDSLQTETLGYVYQEVDIPWLESKPTPRRAK  354

Query  1378  ------TVKLSITESVPASTD------VLPAPLSKNLTFYVTR------STSVPETQEEM  1503
                     KL +  +   S+         P  L   ++  V R      +    E +EE+
Sbjct  355   LAMSKIAKKLGVARAAETSSSKIVASTAFPINLETKISTVVKRPQQKKRNKKQKEDEEEI  414

Query  1504  LNLDLV-YDDTKFIRFDVFLNEDEDV  1578
             L ++ + +D    ++FDV++N+ +D+
Sbjct  415   LVIEGIEFDRDVAVKFDVYVNDVDDL  440



>gb|ACJ04908.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   419 bits (1078),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 247/564 (44%), Positives = 336/564 (60%), Gaps = 40/564 (7%)
 Frame = +1

Query  190   AASSEGRDENPD--------SLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
              + S+ +D +P+          S  K DRRN+L+GLGGLYGA  L    ++P ALA PV 
Sbjct  43    VSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMLIGLGGLYGAAGLTD--TDPPALAAPVT  100

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLE  522
              PD++ CG A +   +   P  CCPP   T K+  +K+P  S  L VRPAAH  D  Y+ 
Sbjct  101   APDLSKCGAADLPADA--KPTNCCPP--KTNKIIEFKLPPPSNILRVRPAAHLADEKYIA  156

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             K+  A+Q MK LP DDPR+F QQ+N+HCAYC GAY   G P    Q+H +W FFPFHR+Y
Sbjct  157   KFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFY  216

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFE+I+  + +DP F +P+WNWD+P GM  P ++ D N  SPLY++ R+  H+   ++
Sbjct  217   LYFFEKILGMLPDDPAFAIPFWNWDSPAGMKIPAMYADIN--SPLYNRLRDAKHQPPTLI  274

Query  874   DLAYSGDDIIAPDPTKVK-NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             DL Y+  D    D  K K  NL IMYRQ+++    P LF G    A +    G G++ENI
Sbjct  275   DLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYCAGDDPDPGAGSLENI  334

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+FY  H+NVDR+WT+WKTLGGKR D  D D
Sbjct  335   PHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGGKRNDFKDSD  394

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-------RKRTVKL  1389
             WL++EF F+DE    V VKV++ LD+ KLGY +QD+ IPW + +P+       RK   K 
Sbjct  395   WLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSSRISNFFRKIKNKA  454

Query  1390  SI---TESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKF------I  1542
              I   TE++ ++  V P  L + +   V R T     +E+    ++V  +         +
Sbjct  455   GIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSV  514

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FDVF+N DED      ++TE+AGSF N+P  H+        T+  L I+EL++DL+ E 
Sbjct  515   KFDVFIN-DEDEAASGPEKTEFAGSFVNVPRKHKHDKKI--RTSLRLGITELLEDLEAED  571

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             D+ VLVTLVP+ G   VT+    I
Sbjct  572   DESVLVTLVPRYGSDAVTIGGVKI  595



>dbj|BAM15849.1| hypothetical protein [Portulaca oleracea]
Length=614

 Score =   420 bits (1079),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 239/576 (41%), Positives = 338/576 (59%), Gaps = 50/576 (9%)
 Frame = +1

Query  178   KIRCAASSEGRDENP-----DSLSKAKLDRRNVllglgglygaynlgaggSNPFALADPV  342
             KI C+A+ +  D+NP     D  +  KLDRRN+L+GLGGLYGA     G   P + A P+
Sbjct  48    KISCSAA-KNDDQNPRSNTHDGNANNKLDRRNMLIGLGGLYGAATNLGGA--PASFAAPI  104

Query  343   PLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAHAVDAAYLE  522
               PD++ C PA +  S+      CCPP+   T +  Y   + S L VRP AHAVDA YL 
Sbjct  105   ATPDLSKCEPADLP-SNAIDRSNCCPPVA--TNIIDYTPSASSTLRVRPPAHAVDATYLA  161

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             K+  AI  MK LPS DPR+F QQA VHCAYC+G Y   G P    Q+H +W F PFHR+Y
Sbjct  162   KFNKAIAAMKALPSTDPRSFIQQARVHCAYCDGGYNQVGFPNLDLQVHGSWLFLPFHRYY  221

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFERI+ S+INDPTF +P+WNWD+P GM  P I+   N  SPLYD+ R+  H+   V+
Sbjct  222   LYFFERILGSLINDPTFAIPFWNWDHPDGMKMPSIY--TNTSSPLYDRRRDAAHQPPTVI  279

Query  874   DLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENIP  1053
             DL Y G D    D   +  NL +MY+Q++ NA  P LF G+P RA +    G G++EN+P
Sbjct  280   DLNYDGSDDSTSDNALINANLTVMYQQIVRNASTPRLFLGQPYRAGDASPGGSGSLENVP  339

Query  1054  HNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRT--DIADK  1227
             H  VH W GD    N+EDMG FY+AA DP+FY+ H+NVDRMW++WK+     T  +  D 
Sbjct  340   HGPVHVWTGDRNQPNNEDMGTFYTAAKDPIFYAHHANVDRMWSVWKSRRSNPTAPEFTDT  399

Query  1228  DWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLSITESV  1407
             DWL+  F+F+DE K AV+V+V+DCLD +KLGYT+Q++ +PW + +PT + +   +++ ++
Sbjct  400   DWLNASFIFYDENKQAVRVRVKDCLDTKKLGYTYQNVDLPWLNSRPTSRASRVTTLSSTI  459

Query  1408  PASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTK-----------------  1536
             P + +    P   + +  VT     P+  +  + +D+                       
Sbjct  460   PKTANAAKPPSKPSSSSNVT----FPKRLDSAITIDVKRPKKSRSKKEKKGEEEVLVVEI  515

Query  1537  ------FIRFDVFLNEDEDVNTVELDR--TEYAGSFGNLP-HVHEGGSATPKTTT-FNLA  1686
                    + FDVF+N+++DV + + +R   E+ GSF N+P H H       K  T F + 
Sbjct  516   EIQRDVHVNFDVFVNDEDDVPS-KKNRAFVEHVGSFVNVPHHQHRNNEHGKKMKTFFRVG  574

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             ++E I+DL  + D+ + VTLVP+ GG  V +    I
Sbjct  575   LNEAIEDLGADDDEGITVTLVPRTGGDAVVIKGLKI  610



>gb|ABI96943.1| putative polyphenol oxidase [Prinsepia sinensis]
Length=457

 Score =   414 bits (1064),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 221/462 (48%), Positives = 288/462 (62%), Gaps = 35/462 (8%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +   P  CCPP   TTK+  +++P+ S L VRPAAH
Sbjct  1     PFAFAKPVLPPDVSKCGAADLP--TGAEPMNCCPP--PTTKIIDFRLPAPSGLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AVD AY++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QIH +W 
Sbjct  57    AVDKAYIDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF LP+WNWD P GM  P IF D    SPLYD+ RN 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFALPFWNWDAPAGMQIPAIFADPK--SPLYDKLRNA  174

Query  850   DHR---YGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             +H+     +++D  Y+G D        +  NL IMYRQM++N+  PLLFFG P RA +  
Sbjct  175   NHQPTSAANLIDHDYNGTDENISKQATINANLKIMYRQMVSNSKNPLLFFGNPYRAGDEP  234

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G+IENIPH  +H W GD    N E+MGNFYSA  DP+FYS HSNVDRMW IWKTLG
Sbjct  235   DPGGGSIENIPHGPIHIWTGDNTQPNLENMGNFYSAGKDPIFYSHHSNVDRMWNIWKTLG  294

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKP-----  1365
             GKRTD+ D DWL++ FLF++E    V+VKV+D LD++KLGY +QD+ IPW + KP     
Sbjct  295   GKRTDLTDSDWLNSGFLFYNENAELVRVKVKDSLDSKKLGYVYQDVDIPWLESKPVPLVR  354

Query  1366  ----TRKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD------  1515
                   K   KL +  +   S+  + A     L      ST V   Q++  N        
Sbjct  355   GKQAVNKLARKLGVAHAAELSSSKVVAESEFPLDLVTKISTVVKRPQQKKRNKKEKEDEE  414

Query  1516  --LVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSF  1620
               LV +  +F     ++FDV++N+ +++ +   + TE+AGSF
Sbjct  415   EVLVIEGIEFERDVAVKFDVYVNDVDELPSGPAN-TEFAGSF  455



>gb|ABM68052.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   419 bits (1077),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 225/521 (43%), Positives = 298/521 (57%), Gaps = 35/521 (7%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             +N  A   PVP+PD+  C    I      V   CCPP +    +  +K PSF KL VRPA
Sbjct  89    NNSLAFGAPVPIPDLTKC---VIPPEKSPVSSSCCPPFS--ADIIDFKFPSFEKLRVRPA  143

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             A  V+  Y  KY  A++ M+ LP DDPR+F+QQAN+HCAYC G Y   G P     +H +
Sbjct  144   AQLVNDDYFRKYDEALKLMRALPDDDPRSFFQQANIHCAYCVGGYTQKGYPGLELSVHKS  203

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W F  FHRWY+YF+ERI+ S+INDPTF +P+WNWD P GM  P IF + N  S LYD  R
Sbjct  204   WLFLAFHRWYIYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPN--SSLYDPKR  261

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPT-----------KVKNNLAIMYRQMITNAPCPLLFF  990
             +  H+   ++DL YS       DP            ++K+NL +MY+QMITN+   + F 
Sbjct  262   DPKHQPPTIIDLNYSKSKEDPTDPNYDPNFPPSAEQQIKDNLTLMYKQMITNSKTCIQFH  321

Query  991   GKPLRADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVD  1170
             G P RA      G G +E  PHN +H W GDP   N EDMG+FYS+  DP+FY+LH+NVD
Sbjct  322   GSPYRAGQAPDPGAGQLEINPHNHIHVWCGDPNQKNREDMGHFYSSGRDPLFYALHANVD  381

Query  1171  RMWTIWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW  1350
             R+W+IWKTLGGKR D  D DWL+TEFLF+DE K  VKVKV+D LD EKLGY +QD  +PW
Sbjct  382   RLWSIWKTLGGKRKDPTDDDWLETEFLFYDENKNLVKVKVKDGLDGEKLGYVYQDRDLPW  441

Query  1351  KDFKPTRKRTV----KLSITESVPASTDVLPAPLSKNLTFYVTR-STSVPETQEEMLNLD  1515
             K+ KP     V    KL          D  P  L   ++  V R   S    ++E     
Sbjct  442   KNCKPEPSSRVKSKGKLLTQRPSRKFVDKFPIVLDSVVSTIVKRPKKSRSSKEKEDEEEI  501

Query  1516  LVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPH---VHEGGSATPKTT  1671
             LV D  +F     ++FDV +N DED   + +  TE+AG+F +L H              T
Sbjct  502   LVIDGIEFDSNIEVKFDVIVN-DEDDKVIGVGNTEFAGTFVSLLHGHNHENNKKKKNTVT  560

Query  1672  TFNLAISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
                L +++L++DL  + DD ++VTL+P+ GG  V ++   I
Sbjct  561   CLRLGLTDLLEDLKADDDDSIVVTLIPRYGGDGVKISGIKI  601



>gb|ABR24120.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   419 bits (1076),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 245/564 (43%), Positives = 337/564 (60%), Gaps = 40/564 (7%)
 Frame = +1

Query  190   AASSEGRDENPD--------SLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
              + S+ +D +P+          S  K DRRN+++GLGGLYGA  L    ++P ALA PV 
Sbjct  43    VSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMVIGLGGLYGAAGLTD--TDPPALAAPVT  100

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLE  522
              PD++ CG A +   +   P  CCPP   T K+  +K+P  S  L VRPAAH  D  ++ 
Sbjct  101   APDLSKCGAADLPADA--KPTNCCPP--KTNKIIEFKLPPPSNILRVRPAAHLADEKHIA  156

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             K+  A+Q MK LP DDPR+F QQ+N+HCAYC GAY   G P    Q+H +W FFPFHR+Y
Sbjct  157   KFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFY  216

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFE+I+  +++DP F +P+WNWD+P GM  P ++ D N  SPLY++ R+  H+   ++
Sbjct  217   LYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADIN--SPLYNRLRDAKHQPPTLI  274

Query  874   DLAYSGDDIIAPDPTKVK-NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             DL Y+  D    D  K K  NL IMYRQ+++    P LF G   RA +    G G++ENI
Sbjct  275   DLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENI  334

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+FY  H+NVDR+WT+WKTLGGKR D  D D
Sbjct  335   PHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGGKRNDFKDSD  394

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-------RKRTVKL  1389
              L++EF F+DE    V VKV++ LD+ KLGY +QD+ IPW + +P+       RK   K 
Sbjct  395   CLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPRISNFFRKIKNKA  454

Query  1390  SI---TESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKF------I  1542
              I   TE++ ++  V P  L + +   V R T     +E+    ++V  +         +
Sbjct  455   GIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSV  514

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FDVF+N DED      ++TE+AGSF N+P  H+        T+  L I+EL++DL+ E 
Sbjct  515   KFDVFIN-DEDEAASGPEKTEFAGSFVNVPRKHKHDKKI--RTSLRLGITELLEDLEAED  571

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             D+ VLVTLVP+ G   VT+    I
Sbjct  572   DESVLVTLVPRYGSDAVTIGGVKI  595



>gb|ABI96931.1| putative polyphenol oxidase [Exochorda racemosa]
Length=459

 Score =   414 bits (1063),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 224/464 (48%), Positives = 290/464 (63%), Gaps = 37/464 (8%)
 Frame = +1

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPAAH  498
             PFA A PV  PDV+ CG A +   +   P  CCPP    TK+  +++P+ + L VRPAAH
Sbjct  1     PFAFAKPVLPPDVSKCGAADLP--TGAEPMNCCPP--PATKIIDFRLPAPNSLRVRPAAH  56

Query  499   AVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWF  669
             AV+ AY++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QIH +W 
Sbjct  57    AVNKAYIDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQIGFPDLELQIHNSWL  116

Query  670   FFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQ  849
             FFPFHR+YLYFFE+I+  +INDPTF LPYWNWD P GM  P IF D    SPLYD+ RN 
Sbjct  117   FFPFHRYYLYFFEKILGKLINDPTFALPYWNWDAPAGMQIPAIFADPR--SPLYDKLRNA  174

Query  850   DHR---YGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQ  1020
             +H+     +++DL ++G D        V  NL IMYRQM++NA  PLLFFG P RA +  
Sbjct  175   NHQPTSAANLIDLDFNGTDENISKQATVNANLKIMYRQMVSNAKNPLLFFGNPYRAGDEP  234

Query  1021  SSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLG  1200
               G G+IENIPH  +H W GD    N E+MGNFYSA  DP+FYS HSNVDRMW IWKTLG
Sbjct  235   DPGGGSIENIPHGPIHIWTGDNTQPNLENMGNFYSAGKDPIFYSHHSNVDRMWNIWKTLG  294

Query  1201  GKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT----  1368
             GKRTD+ D DWL++ FLF++E    V+VKV+D LD++KLGY +QD+ IPW + KP     
Sbjct  295   GKRTDLTDSDWLNSGFLFYNENAELVRVKVKDSLDSKKLGYVYQDVDIPWLESKPVPLVR  354

Query  1369  --RKRTV-----KLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLD----  1515
                K+TV     KL +   V  S+    A     L      ST V   Q++  N      
Sbjct  355   AKVKQTVSKLARKLGVAHGVELSSSKAVAESEFPLDLVTKISTVVKRPQQKKRNKKEKED  414

Query  1516  ----LVYDDTKF-----IRFDVFLNEDEDVNTVELDRTEYAGSF  1620
                 LV +  +F     ++FDV++N+ +++ +   + TE+AGSF
Sbjct  415   EEEILVIEGIEFERDVAVKFDVYVNDVDELPSGPAN-TEFAGSF  457



>gb|ABR57236.1| polyphenol oxidase [Camellia sinensis]
Length=599

 Score =   419 bits (1076),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 245/564 (43%), Positives = 336/564 (60%), Gaps = 40/564 (7%)
 Frame = +1

Query  190   AASSEGRDENPD--------SLSKAKLDRRNVllglgglygaynlgaggSNPFALADPVP  345
              + S+ +D +P+          S  K DRRN+++GLGGLYGA  L    ++P ALA PV 
Sbjct  43    VSCSKAKDSDPNLTPPSQNTQTSLGKFDRRNMVIGLGGLYGAAGLTD--TDPPALAAPVT  100

Query  346   LPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSK-LNVRPAAHAVDAAYLE  522
              PD++ CG A +   +   P  CCPP   T K+  +K+P  S  L VRPAAH  D  Y+ 
Sbjct  101   APDLSKCGAADLPADA--KPTNCCPP--KTNKIIEFKLPPPSNILRVRPAAHLADEKYIA  156

Query  523   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFFFPFHRWY  693
             K+  A+Q MK LP DDPR+F QQ+N+HCAYC GAY   G P    Q+H +W FFPFHR+Y
Sbjct  157   KFSKALQLMKSLPDDDPRSFKQQSNIHCAYCEGAYHQVGFPSTELQVHNSWLFFPFHRFY  216

Query  694   LYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQDHRYGHVL  873
             LYFFE+I+  +++DP F +P+WNWD+P GM  P ++ D N  SPLY++ R+  H+   ++
Sbjct  217   LYFFEKILGMLLDDPAFAIPFWNWDSPAGMKIPAMYADIN--SPLYNRLRDAKHQPPTLI  274

Query  874   DLAYSGDDIIAPDPTKVK-NNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGMGTIENI  1050
             DL Y+  D    D  K K  NL IMYRQ+++    P LF G   RA +    G G++ENI
Sbjct  275   DLDYNLTDPKNVDEEKQKLRNLTIMYRQVVSGGKTPRLFLGSSYRAGDDPDPGAGSLENI  334

Query  1051  PHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRTDIADKD  1230
             PH  VH W GD    N EDMGNFYSA  DP+FY  H+NVDR+WT+WKTLGGKR D  D D
Sbjct  335   PHGPVHIWCGDRTQPNLEDMGNFYSAGRDPIFYGHHANVDRIWTVWKTLGGKRNDFKDSD  394

Query  1231  WLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPT-------RKRTVKL  1389
              L++EF F+DE    V VKV++ LD+ KLGY +QD+ IPW + +P+       RK   K 
Sbjct  395   CLNSEFTFYDENAQLVTVKVKESLDHRKLGYVYQDVEIPWLNARPSPPISNFFRKIKNKA  454

Query  1390  SI---TESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEEMLNLDLVYDDTKF------I  1542
              I   TE++ ++  V P  L + +   V R T     +E+    ++V  +         +
Sbjct  455   GIAMATETLDSAAIVFPRKLDEVVKVVVKRPTKSRSEREKEEEEEVVVVEGIEMERDVSV  514

Query  1543  RFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAISELIKDLDLEG  1722
             +FDVF+N DED      ++TE+AG F N+P  H+        T+  L I+EL++DL+ E 
Sbjct  515   KFDVFIN-DEDEAASGPEKTEFAGCFVNVPRKHKHDKKI--RTSLRLGITELLEDLEAED  571

Query  1723  DDKVLVTLVPKVGGSFVTVNNAYI  1794
             D+ VLVTLVP+ G   VT+    I
Sbjct  572   DESVLVTLVPRYGSDAVTIGGVKI  595



>gb|AAK13244.1| polyphenol oxidase [Trifolium pratense]
Length=599

 Score =   417 bits (1073),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 227/516 (44%), Positives = 304/516 (59%), Gaps = 31/516 (6%)
 Frame = +1

Query  313   SNPFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSFSKLNVRPA  492
             +N  A   PVP+PD+  C    I  S   VP  CCPP +    +  +K PSF KL VRPA
Sbjct  89    NNSLAFGAPVPIPDLTKC---VIPPSGAPVPINCCPPFS--KDIIDFKYPSFEKLRVRPA  143

Query  493   AHAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFN  663
             A  VD  Y  KY  A++ M+ LP DDPR+F QQA +HCAYC G Y   G P     +H +
Sbjct  144   AQLVDDDYFAKYNKALELMRALPDDDPRSFSQQAKIHCAYCVGGYKQLGYPEIELSVHNS  203

Query  664   WFFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYR  843
             W F  FHRWY+YF+ERI+ S+INDPTF +P+WN+D P GM  P IF + N  S LYD  R
Sbjct  204   WLFLAFHRWYIYFYERILGSLINDPTFAIPFWNFDAPDGMQIPSIFTNPN--SSLYDLKR  261

Query  844   NQDHRYGHVLDLAYSGDDIIAPDPT-------KVKNNLAIMYRQMITNAPCPLLFFGKPL  1002
             +  H+   ++DL Y+  D   P P        ++K+NL +M++QMITN+   +LF G P 
Sbjct  262   DSRHQPPRIIDLNYN-KDTEDPGPNYPPSAEQQIKDNLTLMHKQMITNSKTCILFHGSPY  320

Query  1003  RADNTQSSGMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWT  1182
             RA      G G +E  PHN+VH W GD +    EDMGNFYS+  DP+FY+LH+NVDR+W+
Sbjct  321   RAGQAPGKGHGALEMSPHNNVHIWSGDAKQPYREDMGNFYSSGRDPLFYALHANVDRLWS  380

Query  1183  IWKTLGGKRTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFK  1362
             IWKTLGGKR D  D DWL++EFLF+DE K  VKVKV+D LD +KLGY +Q + IPW + K
Sbjct  381   IWKTLGGKRKDPTDDDWLESEFLFYDENKNLVKVKVKDGLDGKKLGYDYQKVDIPWINSK  440

Query  1363  PT-RKRTVKLSITESVPAS-TDVLPAPLSKNLTFYVTR-STSVPETQEEMLNLDLVYDDT  1533
             P    R V+       P    D  P  L   ++  V R   S    ++E     LV D  
Sbjct  441   PKPASRRVQSKGKLLTPRKFVDKFPIVLDSVVSTIVKRPKKSRSSKEKEDEEEILVIDGI  500

Query  1534  KF-----IRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPK----TTTFNLA  1686
             +F     ++FDV +N DED   + +  TE+AG+F NL H H   ++T K     T   L 
Sbjct  501   EFDSNIEVKFDVIVN-DEDDKVIGVGNTEFAGTFVNLLHGHNHENSTNKKKNIVTCMRLG  559

Query  1687  ISELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             +++L++DL  + DD +LVT +P+ GG  V ++   I
Sbjct  560   LTDLLEDLKADDDDSILVTFIPRYGGDSVKISGIKI  595



>ref|NP_001268045.1| polyphenol oxidase, chloroplastic [Vitis vinifera]
 gb|AAB41022.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   418 bits (1074),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 250/574 (44%), Positives = 324/574 (56%), Gaps = 41/574 (7%)
 Frame = +1

Query  157   ARRGDAVKIRCAASSEGRDENPDSLS------KAKLDRRNVllglgglygaynlgaggSN  318
             +RR    K+ C  +S   D N DS S        KLDRRNVLLG+GGLYGA       + 
Sbjct  42    SRRFAPSKVSC--NSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGA-TK  98

Query  319   PFALADPVPLPDVANCGPATISFSSCKVPYRCCPPITDTTKVEYYKIPSF-SKLNVRPAA  495
             P A   P+  PD++ CG AT+       P  CCPP+T  TK+  +++PS  S +  RPAA
Sbjct  99    PLAFGAPIQAPDISKCGTATVP--DGVTPTNCCPPVT--TKIIDFQLPSSGSPMRTRPAA  154

Query  496   HAVDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGN---PYQIHFNW  666
             H V   YL KYK AI+  K LP DDPR+F QQANVHC YC GAY   G      Q+H +W
Sbjct  155   HLVSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASW  214

Query  667   FFFPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRN  846
              F PFHR+YLYF ERI+  +I+DPT  L YW WDNP GM  P I+   +  S LYD+ RN
Sbjct  215   LFLPFHRYYLYFNERILAKLIDDPTIALAYWAWDNPDGMYMPTIY--ASSPSSLYDEKRN  272

Query  847   QDHRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSS  1026
               H    V+DL Y G +   PD     +NLAIMY+Q+++ A  P LF G P RA +    
Sbjct  273   AKHLPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSGATTPKLFLGYPYRAGDAIDP  332

Query  1027  GMGTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGK  1206
             G GT+E++PHN VH+W G     + EDMGNFY+A  DP+F+  H+NVDRMW IWKT+GGK
Sbjct  333   GAGTLEHVPHNIVHKWTGLADKPS-EDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGGK  391

Query  1207  -RTDIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPW-------KDFK  1362
              R D  D DWLD  F+F+DE K  VKVKV DC+D  KL Y +QD+PIPW       K   
Sbjct  392   NRKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPIPWLPKKTKAKAKT  451

Query  1363  PTRKRTVKLSITESVPASTDVLPAPLSKNLTFYVTRSTSVPETQEE----------MLNL  1512
              T+     ++    +P +T        K L   +      P+              +L  
Sbjct  452   TTKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVLLIK  511

Query  1513  DLVYDDTKFIRFDVFLNEDEDVNTVELDRTEYAGSFGNLPHVHEGGSATPKTTTFNLAIS  1692
              +  D   F++FDV++N DED +      +E+AGSF N+PH H     T   T    AI+
Sbjct  512   GIELDRENFVKFDVYIN-DEDYSVSRPKNSEFAGSFVNVPHKHMKEMKT--KTNLRFAIN  568

Query  1693  ELIKDLDLEGDDKVLVTLVPKVGGSFVTVNNAYI  1794
             EL++DL  E D+ V+VT+VP+ GG  VT+    I
Sbjct  569   ELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEI  602



>gb|ABK62804.1| polyphenol oxidase [Triticum aestivum]
Length=577

 Score =   417 bits (1071),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 226/507 (45%), Positives = 296/507 (58%), Gaps = 27/507 (5%)
 Frame = +1

Query  325   ALADPVPLPDVANCGPATISFSSCKVPYRCCP-PITDTTKVEYYKIPSFSKLNVRPAAHA  501
             A+A P+  PD++NC   T +  +      CCP P T  T  E    P+ S L VRPAAH 
Sbjct  79    AIAAPIQAPDLSNC--QTPALPNTPPDTNCCPTPGTGITDFEL--PPASSPLRVRPAAHL  134

Query  502   VDAAYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYLLNGNP---YQIHFNWFF  672
             VDA YL KY+ A+  MK LP+DDPR+F QQ +VHCAYC+ AY   G P    QIH  W F
Sbjct  135   VDAEYLAKYERAVALMKQLPADDPRSFEQQWHVHCAYCDAAYDQVGFPDLELQIHNCWLF  194

Query  673   FPFHRWYLYFFERIMQSMINDPTFTLPYWNWDNPPGMTFPGIFDDENQLSPLYDQYRNQD  852
             FP+HR+YLYF ERI+  +I D TF LP+WNWD P GM  P I+   N+ SPLYD+ R+  
Sbjct  195   FPWHRFYLYFHERILGKLIGDDTFALPFWNWDAPAGMKLPVIY--ANRSSPLYDERRDPA  252

Query  853   HRYGHVLDLAYSGDDIIAPDPTKVKNNLAIMYRQMITNAPCPLLFFGKPLRADNTQSSGM  1032
             H+   ++DL YSG D   P   ++  NL IMYRQMI+NA   LLF G+P RA +    G 
Sbjct  253   HQPPVLVDLDYSGTDANIPRDQQIDENLKIMYRQMISNAKKTLLFLGQPYRAGDQPDPGA  312

Query  1033  GTIENIPHNSVHRWVGDPRSANHEDMGNFYSAANDPVFYSLHSNVDRMWTIWKTLGGKRT  1212
             G++EN+PH  VH W GDPR  N EDMGNFYSAA DP+F++ H N+DR+W +W+ L    T
Sbjct  313   GSVENVPHGPVHNWTGDPRQPNGEDMGNFYSAARDPIFFAHHGNIDRLWHVWRGLRPSNT  372

Query  1213  DIADKDWLDTEFLFFDETKTAVKVKVRDCLDNEKLGYTFQDMPIPWKDFKPTRKRTVKLS  1392
             D  D DWLD  FLF+DE    V+V+VRDCLD   L YT+QD+ +PW + +P      K S
Sbjct  373   DFTDPDWLDAGFLFYDEEARPVRVRVRDCLDPAALRYTYQDVGLPWLNARP-----AKAS  427

Query  1393  ITESVPASTDVLPAPLSKNLTFYVT--------RSTSVPETQEEMLNLDLVYDDTKFIRF  1548
                  PA+T  LPA L + +   VT        R     E    +  +++     KF++F
Sbjct  428   GGTPAPATTGTLPATLDRTIRVTVTRPRVSRSRREKDEEEEVLVVEGIEIADHFNKFVKF  487

Query  1549  DVFLNEDE-DVNTVELDRTEY-AGSFGNLPHV--HEGGSATPKTTTFNLAISELIKDLDL  1716
             DV +NE E  V       T Y AGSF + PH+   E     P  T     + +L+ D+  
Sbjct  488   DVLVNEPEGGVGGTPATATGYCAGSFAHTPHMVRPEEMRKGPVKTVARFGVCDLMDDIGA  547

Query  1717  EGDDKVLVTLVPKVGGSFVTVNNAYIN  1797
             +GD  V+V+LVP+ GG  VT+    I+
Sbjct  548   DGDQTVVVSLVPRCGGDLVTIGGVSIS  574



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6504825089772