BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25871_g3_i2 len=2209 path=[17761:0-97 3633:98-136 3670:137-153
2632:154-174 18449:175-182 3714:183-252 838:253-273 3801:274-305
1896:306-477 2068:478-515 4036:516-542 4063:543-618 4139:619-645
18666:646-658 8920:659-760 2357:761-805 9065:806-1135 1193:1136-1162
15151:1163-1200 9459:1201-1226 9485:1227-2208]

Length=2209
                                                                      Score     E

ref|XP_009628381.1|  PREDICTED: polyphenol oxidase E, chloroplast...    536   7e-179   
sp|Q06355.1|PPOB_SOLTU  RecName: Full=Catechol oxidase B, chlorop...    528   1e-175   Solanum tuberosum [potatoes]
gb|AAA02877.1|  propolyphenol oxidase                                   528   1e-175   Solanum tuberosum [potatoes]
ref|XP_009603530.1|  PREDICTED: polyphenol oxidase E, chloroplast...    527   2e-175   
ref|XP_006355239.1|  PREDICTED: catechol oxidase B, chloroplastic       525   1e-174   
gb|AEO00529.1|  polyphenol oxidase                                      524   6e-174   
emb|CAA73103.1|  polyphenol oxidase                                     522   3e-173   Nicotiana tabacum [American tobacco]
ref|XP_004246033.1|  PREDICTED: polyphenol oxidase F, chloroplastic     519   4e-172   
ref|XP_010325653.1|  PREDICTED: polyphenol oxidase E, chloroplastic     517   3e-171   
sp|Q08307.1|PPOE_SOLLC  RecName: Full=Polyphenol oxidase E, chlor...    516   4e-171   Solanum lycopersicum
ref|XP_009590067.1|  PREDICTED: polyphenol oxidase E, chloroplast...    516   4e-171   
ref|XP_009767375.1|  PREDICTED: polyphenol oxidase E, chloroplast...    516   6e-171   
sp|Q08296.1|PPOF_SOLLC  RecName: Full=Polyphenol oxidase F, chlor...    516   6e-171   Solanum lycopersicum
gb|AAB22610.1|  polyphenoloxidase                                       515   2e-170   Solanum lycopersicum
ref|XP_009791071.1|  PREDICTED: polyphenol oxidase E, chloroplast...    515   2e-170   
gb|AGK83468.1|  polyphenol oxidase                                      514   3e-170   
ref|XP_006365391.1|  PREDICTED: polyphenol oxidase E, chloroplast...    513   2e-169   
ref|XP_004246041.1|  PREDICTED: polyphenol oxidase E, chloroplast...    511   3e-169   
gb|ADY18410.1|  chloroplast polyphenol oxidase precursor                510   1e-168   
gb|ABE96885.1|  polyphenol oxidase                                      507   1e-168   Nicotiana tabacum [American tobacco]
ref|XP_009624738.1|  PREDICTED: polyphenol oxidase E, chloroplast...    508   2e-167   
gb|ADY18412.1|  chloroplast polyphenol oxidase precursor                506   5e-167   
ref|XP_009588337.1|  PREDICTED: polyphenol oxidase E, chloroplast...    494   3e-162   
ref|XP_009771442.1|  PREDICTED: polyphenol oxidase E, chloroplast...    493   5e-162   
gb|AAA85122.1|  polyphenol oxidase                                      491   3e-161   Solanum tuberosum [potatoes]
ref|XP_009616674.1|  PREDICTED: polyphenol oxidase E, chloroplast...    491   4e-161   
ref|XP_004246032.1|  PREDICTED: polyphenol oxidase B, chloroplastic     487   1e-159   
gb|ACN78382.1|  polyphenol oxidase                                      483   1e-159   Solanum quitoense [lulo]
gb|ADY18411.1|  chloroplast polyphenol oxidase precursor                478   4e-156   
gb|ACT22523.1|  chloroplast polyphenol oxidase precursor                474   1e-154   Solanum melongena [aubergine]
gb|AFJ79639.1|  chloroplast polyphenol oxidase                          471   2e-153   
gb|AFJ79643.1|  chloroplast polyphenol oxidase                          470   5e-153   
gb|AFJ79640.1|  chloroplast polyphenol oxidase                          469   1e-152   
ref|XP_006365382.1|  PREDICTED: polyphenol oxidase B, chloroplast...    469   2e-152   
gb|AFJ79641.1|  chloroplast polyphenol oxidase                          469   2e-152   
ref|XP_006365383.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    468   8e-152   
gb|ADY18409.1|  chloroplast polyphenol oxidase precursor                466   1e-151   
pir||S34786  catechol oxidase (EC 1.10.3.1) precursor - potato (f...    462   6e-150
ref|XP_004246030.1|  PREDICTED: polyphenol oxidase D, chloroplastic     459   1e-148   
gb|AAA85121.1|  polyphenol oxidase                                      454   1e-146   Solanum tuberosum [potatoes]
gb|ADG56700.1|  chloroplast polyphenol oxidase precursor                449   1e-144   
ref|XP_004246037.1|  PREDICTED: polyphenol oxidase B, chloroplast...    447   4e-144   
gb|AAC69365.1|  polyphenol oxidase                                      438   2e-143   Diospyros kaki [Japanese persimmon]
sp|Q08306.2|PPOD_SOLLC  RecName: Full=Polyphenol oxidase D, chlor...    444   6e-143   Solanum lycopersicum
ref|XP_004246029.2|  PREDICTED: polyphenol oxidase A, chloroplast...    435   2e-139   
gb|AFJ79642.1|  chloroplast polyphenol oxidase                          429   3e-137   
ref|XP_011014565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    427   9e-137   
gb|ACR61398.1|  polyphenol oxidase                                      427   2e-136   Solanum melongena [aubergine]
ref|XP_010100574.1|  Polyphenol oxidase                                 427   2e-136   
ref|XP_010100570.1|  Polyphenol oxidase                                 427   2e-136   
gb|AAC28935.1|  polyphenol oxidase precursor                            427   3e-136   Prunus armeniaca
gb|KHN08551.1|  Polyphenol oxidase A1, chloroplastic                    427   3e-136   
ref|XP_006370120.1|  hypothetical protein POPTR_0001s39680g             425   7e-136   
sp|Q9ZP19.1|PPO1_IPOBA  RecName: Full=Polyphenol oxidase I, chlor...    422   9e-136   Ipomoea batatas [batate]
ref|XP_006370115.1|  hypothetical protein POPTR_0001s39630g             423   4e-135   
ref|XP_003541740.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    423   9e-135   
ref|XP_006370125.1|  hypothetical protein POPTR_0001s39920g             422   2e-134   
ref|XP_010245321.1|  PREDICTED: polyphenol oxidase, chloroplastic...    422   3e-134   
ref|XP_003545882.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    422   3e-134   
emb|CAC83609.1|  catechol oxidase                                       418   3e-134   Ipomoea batatas [batate]
sp|Q08303.2|PPOA_SOLLC  RecName: Full=Polyphenol oxidase A, chlor...    422   4e-134   Solanum lycopersicum
gb|AAU12256.1|  polyphenol oxidase                                      421   4e-134   Populus trichocarpa x Populus deltoides
ref|XP_008371334.1|  PREDICTED: polyphenol oxidase, chloroplastic...    421   6e-134   
ref|XP_006370118.1|  hypothetical protein POPTR_0001s39660g             420   8e-134   
ref|XP_011002749.1|  PREDICTED: polyphenol oxidase, chloroplastic...    420   8e-134   
gb|AAU12257.1|  polyphenol oxidase                                      420   9e-134   Populus trichocarpa x Populus deltoides
ref|XP_008225003.1|  PREDICTED: polyphenol oxidase, chloroplastic...    420   9e-134   
ref|XP_002316632.1|  hypothetical protein POPTR_0011s04710g             420   9e-134   Populus trichocarpa [western balsam poplar]
ref|XP_006370127.1|  hypothetical protein POPTR_0001s39940g             419   1e-133   
sp|Q9MB14.2|PPO2_IPOBA  RecName: Full=Polyphenol oxidase II, chlo...    419   2e-133   Ipomoea batatas [batate]
gb|AAW58109.2|  polyphenol oxidase                                      419   3e-133   Prunus salicina var. cordata
sp|Q08305.1|PPOC_SOLLC  RecName: Full=Polyphenol oxidase C, chlor...    419   4e-133   Solanum lycopersicum
ref|XP_004293528.1|  PREDICTED: polyphenol oxidase, chloroplastic...    419   5e-133   
ref|XP_007148200.1|  hypothetical protein PHAVU_006G188500g             417   7e-133   
ref|XP_008371333.1|  PREDICTED: polyphenol oxidase, chloroplastic...    417   2e-132   
gb|EYU34161.1|  hypothetical protein MIMGU_mgv1a003495mg                416   3e-132   
dbj|BAA92317.1|  polyphenol oxidase I                                   416   5e-132   Ipomoea batatas [batate]
ref|XP_002316852.1|  hypothetical protein POPTR_0011s10950g             414   8e-132   Populus trichocarpa [western balsam poplar]
gb|ADR78836.1|  polyphenol oxidase                                      414   1e-131   
ref|XP_007025702.1|  Uncharacterized protein TCM_029922                 414   2e-131   
ref|XP_011016645.1|  PREDICTED: polyphenol oxidase, chloroplastic...    413   2e-131   
ref|XP_007025703.1|  Larreatricin hydroxylase                           414   3e-131   
gb|AAG21983.1|AF263611_1  polyphenol oxidase PPO1                       412   3e-131   Populus trichocarpa x Populus deltoides
gb|ADC92563.1|  polyphenol oxidase                                      413   5e-131   
ref|XP_007214660.1|  hypothetical protein PRUPE_ppa003171mg             413   7e-131   
gb|AFC36521.1|  polyphenol oxidase                                      413   8e-131   
ref|XP_011083298.1|  PREDICTED: polyphenol oxidase I, chloroplast...    412   1e-130   
gb|AEL95440.1|  polyphenol oxidase                                      410   4e-130   
gb|EYU27938.1|  hypothetical protein MIMGU_mgv1a003402mg                410   4e-130   
ref|XP_009334704.1|  PREDICTED: polyphenol oxidase, chloroplastic...    411   4e-130   
ref|XP_008224998.1|  PREDICTED: polyphenol oxidase, chloroplastic       410   8e-130   
gb|AII22007.1|  polyphenol oxidase-5                                    410   1e-129   
ref|XP_003593515.1|  Polyphenol oxidase                                 410   1e-129   
ref|XP_011047843.1|  PREDICTED: polyphenol oxidase, chloroplastic...    409   1e-129   
gb|EYU34163.1|  hypothetical protein MIMGU_mgv1a003224mg                410   1e-129   
gb|AAW78869.1|  polyphenol oxidase                                      409   1e-129   Ipomoea batatas [batate]
ref|XP_010052352.1|  PREDICTED: polyphenol oxidase, chloroplastic...    410   1e-129   
ref|XP_009334541.1|  PREDICTED: polyphenol oxidase, chloroplastic...    410   1e-129   
gb|ACR61399.1|  polyphenol oxidase                                      407   2e-129   Solanum melongena [aubergine]
ref|XP_010242012.1|  PREDICTED: polyphenol oxidase, chloroplastic...    409   2e-129   
gb|AHC98007.1|  PPO                                                     409   3e-129   
ref|XP_007211392.1|  hypothetical protein PRUPE_ppa003257mg             408   3e-129   
gb|AGC54425.1|  polyphenol oxidase 1                                    409   3e-129   
ref|XP_006370117.1|  hypothetical protein POPTR_0001s39650g             406   4e-129   
emb|CAC83610.1|  catechol oxidase                                       404   6e-129   Ipomoea batatas [batate]
gb|AAK53414.1|AF368291_1  polyphenol oxidase                            405   2e-128   Populus tremuloides
ref|XP_010686568.1|  PREDICTED: polyphenol oxidase, chloroplastic...    406   2e-128   
emb|CAC29040.1|  catechol oxidase                                       403   2e-128   Ipomoea batatas [batate]
ref|XP_011096441.1|  PREDICTED: aureusidin synthase-like                405   4e-128   
gb|ADF59058.2|  polyphenol oxidase IV                                   404   9e-128   
ref|XP_004293526.1|  PREDICTED: polyphenol oxidase, chloroplastic...    404   2e-127   
gb|KHN46329.1|  Polyphenol oxidase A1, chloroplastic                    405   2e-127   
gb|AAP33165.1|  polyphenol oxidase                                      404   2e-127   Medicago sativa [alfalfa]
gb|AAW65103.1|  polyphenol oxidase                                      403   2e-127   Prunus salicina var. cordata
emb|CDP06093.1|  unnamed protein product                                402   5e-127   
emb|CDO99592.1|  unnamed protein product                                402   6e-127   
ref|XP_009334438.1|  PREDICTED: polyphenol oxidase, chloroplastic...    402   6e-127   
gb|KDP20931.1|  hypothetical protein JCGZ_21402                         402   7e-127   
gb|AGU01537.1|  polyphenol oxidase                                      403   8e-127   
ref|XP_008383785.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    402   9e-127   
ref|XP_006594327.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    404   9e-127   
ref|XP_010039984.1|  PREDICTED: polyphenol oxidase, chloroplastic...    402   1e-126   
ref|XP_007025706.1|  Larreatricin hydroxylase isoform 1                 402   1e-126   
gb|ADP89908.1|  polyphenol oxidase                                      399   1e-126   
gb|ABI96939.1|  putative polyphenol oxidase                             397   1e-126   Neillia thyrsiflora
gb|AFO55219.1|  chloroplast polyphenol oxidase III                      401   3e-126   
gb|AED02598.1|  polyphenol oxidase                                      400   4e-126   
gb|ABI96932.1|  putative polyphenol oxidase                             395   5e-126   Fallugia paradoxa
gb|ABI96925.1|  putative polyphenol oxidase                             395   5e-126   Adenostoma fasciculatum [chamise]
gb|ABI96941.1|  putative polyphenol oxidase                             395   5e-126   Physocarpus capitatus
ref|XP_007025701.1|  Uncharacterized protein TCM_029921                 400   7e-126   
gb|AFO55218.1|  chloroplast polyphenol oxidase II                       399   1e-125   
ref|XP_011098120.1|  PREDICTED: polyphenol oxidase I, chloroplast...    399   1e-125   
ref|XP_010054349.1|  PREDICTED: polyphenol oxidase, chloroplastic...    399   1e-125   
gb|AHF20575.1|  polyphenol oxidase                                      399   2e-125   
pdb|1BT1|A  Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet...    390   2e-125   
gb|ABI96928.1|  putative polyphenol oxidase                             394   2e-125   Chamaebatia foliolosa
gb|KHN46528.1|  Polyphenol oxidase A1, chloroplastic                    399   2e-125   
ref|XP_003526194.1|  PREDICTED: polyphenol oxidase, chloroplastic...    399   2e-125   
ref|XP_011098121.1|  PREDICTED: polyphenol oxidase I, chloroplast...    398   2e-125   
ref|XP_004303397.1|  PREDICTED: polyphenol oxidase, chloroplastic...    398   3e-125   
ref|XP_008364151.1|  PREDICTED: polyphenol oxidase, chloroplastic...    397   3e-125   
gb|ADI44162.1|  polyphenol oxidase 1                                    398   4e-125   
gb|ABI96926.1|  putative polyphenol oxidase                             393   4e-125   Cercocarpus betuloides
sp|Q06215.1|PPO_VICFA  RecName: Full=Polyphenol oxidase A1, chlor...    398   5e-125   Vicia faba [broad bean]
ref|XP_009408264.1|  PREDICTED: polyphenol oxidase, chloroplastic...    397   5e-125   
gb|AEY78528.1|  polyphenol oxidase                                      398   5e-125   
gb|AFH00996.1|  polyphenol oxidase II                                   397   6e-125   
gb|KCW76289.1|  hypothetical protein EUGRSUZ_D00659                     399   6e-125   
gb|KDO75857.1|  hypothetical protein CISIN_1g042556mg                   397   7e-125   
ref|XP_011082857.1|  PREDICTED: polyphenol oxidase I, chloroplast...    396   8e-125   
ref|XP_006468218.1|  PREDICTED: polyphenol oxidase, chloroplastic...    397   9e-125   
ref|XP_008349220.1|  PREDICTED: polyphenol oxidase, chloroplastic...    397   9e-125   
gb|ADI44161.1|  polyphenol oxidase 2                                    397   1e-124   
emb|CAQ76694.1|  polyphenol oxidase (chloroplast)                       396   1e-124   Taraxacum officinale [dandelion]
ref|XP_008366047.1|  PREDICTED: polyphenol oxidase, chloroplastic...    397   1e-124   
gb|AEG78292.1|  polyphenol oxidase                                      396   1e-124   
gb|ADF59059.2|  polyphenol oxidase V                                    397   1e-124   
gb|ABI96945.1|  putative polyphenol oxidase                             391   2e-124   Prunus mexicana [Mexican plum]
gb|EPS59410.1|  polyphenoloxidase                                       395   2e-124   
gb|AAO16865.1|  polyphenol oxidase                                      395   2e-124   Ananas comosus
ref|XP_006449291.1|  hypothetical protein CICLE_v10014693mg             395   3e-124   
gb|ABI96929.1|  putative polyphenol oxidase                             390   4e-124   Chamaebatiaria millefolium
gb|ABI96931.1|  putative polyphenol oxidase                             390   6e-124   Exochorda racemosa
gb|AAK56323.1|AF380300_1  polyphenol oxidase 2 precursor                394   6e-124   Malus domestica [apple tree]
gb|AFO55217.1|  chloroplast polyphenol oxidase I                        394   7e-124   
gb|AAK13244.1|  polyphenol oxidase                                      394   8e-124   Trifolium pratense [peavine clover]
ref|XP_008364152.1|  PREDICTED: polyphenol oxidase, chloroplastic...    394   8e-124   
gb|AES87890.2|  polyphenoloxidase                                       395   9e-124   
gb|ACM09905.1|  polyphenol oxidase 1/4                                  395   9e-124   Trifolium pratense [peavine clover]
ref|XP_008371330.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    394   1e-123   
ref|XP_008225000.1|  PREDICTED: polyphenol oxidase, chloroplastic...    394   1e-123   
gb|ABI96938.1|  putative polyphenol oxidase                             389   1e-123   Lyonothamnus floribundus
ref|XP_009782447.1|  PREDICTED: polyphenol oxidase, chloroplastic...    394   1e-123   
gb|ABI96943.1|  putative polyphenol oxidase                             389   1e-123   Prinsepia sinensis
gb|AAK13242.1|  polyphenol oxidase                                      394   1e-123   Trifolium pratense [peavine clover]
ref|XP_009414395.1|  PREDICTED: polyphenol oxidase, chloroplastic...    394   1e-123   
gb|ABI96944.1|  putative polyphenol oxidase                             389   2e-123   Prunus dulcis [sweet almond]
dbj|BAB64530.1|  polyphenol oxidase                                     393   2e-123   Pyrus pyrifolia [sha li]
gb|ABI96950.1|  putative polyphenol oxidase                             388   3e-123   Spiraea densiflora
gb|AHH92831.1|  polyphenol oxidase                                      393   3e-123   
gb|ABI96942.1|  putative polyphenol oxidase                             388   4e-123   Dasiphora fruticosa
gb|ABX09994.1|  chloroplast polyphenol oxidase                          393   4e-123   Taraxacum officinale [dandelion]
gb|EYU26237.1|  hypothetical protein MIMGU_mgv1a026995mg                392   4e-123   
gb|AEE61322.1|  polyphenol oxidase I                                    392   5e-123   
ref|XP_011082856.1|  PREDICTED: polyphenol oxidase I, chloroplast...    391   6e-123   
ref|XP_004293563.1|  PREDICTED: polyphenol oxidase, chloroplastic...    392   6e-123   
gb|ACM43505.1|  polyphenoloxidase                                       392   7e-123   Camellia nitidissima
emb|CDP06099.1|  unnamed protein product                                392   7e-123   
ref|XP_003593517.1|  Polyphenol oxidase A1                              392   7e-123   
ref|XP_008371328.1|  PREDICTED: polyphenol oxidase, chloroplastic...    390   2e-122   
gb|ABS88291.1|  polyphenol oxidase                                      390   3e-122   Pyrus x bretschneideri [bai li]
ref|XP_011082867.1|  PREDICTED: polyphenol oxidase I, chloroplast...    390   3e-122   
dbj|BAO79386.1|  polyphenol_oxidase                                     390   4e-122   
gb|ABI96947.1|  putative polyphenol oxidase                             385   5e-122   Rhodotypos scandens [jetbead]
gb|ABI96940.1|  putative polyphenol oxidase                             385   5e-122   Oemleria cerasiformis [Oregon plum]
gb|AEQ30073.1|  polyphenol oxidase                                      390   6e-122   
ref|XP_007211389.1|  hypothetical protein PRUPE_ppa003190mg             389   7e-122   
ref|XP_008371327.1|  PREDICTED: polyphenol oxidase, chloroplastic...    389   9e-122   
gb|AFL03159.1|  polyphenol oxidase                                      389   9e-122   
ref|XP_008346980.1|  PREDICTED: polyphenol oxidase, chloroplastic...    387   1e-121   
ref|XP_011082866.1|  PREDICTED: polyphenol oxidase I, chloroplast...    388   1e-121   
gb|ABM68051.1|  polyphenol oxidase                                      389   1e-121   Trifolium pratense [peavine clover]
ref|XP_009773173.1|  PREDICTED: polyphenol oxidase, chloroplastic...    389   2e-121   
ref|XP_008224999.1|  PREDICTED: polyphenol oxidase, chloroplastic...    388   2e-121   
ref|XP_002519016.1|  Polyphenol oxidase, chloroplast precursor, p...    388   2e-121   Ricinus communis
ref|XP_004485748.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    388   2e-121   
sp|P43311.1|PPO_VITVI  RecName: Full=Polyphenol oxidase, chloropl...    388   2e-121   Vitis vinifera
gb|EYU26238.1|  hypothetical protein MIMGU_mgv1a025156mg                387   3e-121   
ref|XP_008349252.1|  PREDICTED: polyphenol oxidase, chloroplastic...    386   3e-121   
gb|AII22006.1|  polyphenol oxidase-4                                    387   4e-121   
gb|ACN86310.1|  polyphenol oxidase                                      386   1e-120   Juglans regia
emb|CBZ41490.1|  polyphenol oxidase precursor (chloroplast)             386   1e-120   
sp|Q6UIL3.1|LAHY_LARTR  RecName: Full=(+)-larreatricin hydroxylas...    385   2e-120   Larrea tridentata
ref|XP_007159290.1|  hypothetical protein PHAVU_002G225600g             385   3e-120   
gb|ABI96949.1|  putative polyphenol oxidase                             380   5e-120   Spiraea cantoniensis
ref|XP_008442274.1|  PREDICTED: polyphenol oxidase, chloroplastic...    384   5e-120   
ref|XP_003522849.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    385   5e-120   
ref|XP_008225030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    384   5e-120   
ref|NP_001268045.1|  polyphenol oxidase, chloroplastic                  385   6e-120   
ref|XP_010647098.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    384   8e-120   
dbj|BAA21676.1|  polyphenol oxidase                                     383   2e-119   Malus domestica [apple tree]
ref|XP_010910924.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    382   2e-119   
dbj|BAO79387.1|  polyphenol_oxidase                                     383   2e-119   
ref|XP_009610962.1|  PREDICTED: polyphenol oxidase, chloroplastic...    383   2e-119   
emb|CAN61652.1|  hypothetical protein VITISV_006012                     383   3e-119   Vitis vinifera
ref|XP_008225002.1|  PREDICTED: polyphenol oxidase I, chloroplast...    382   3e-119   
ref|XP_010910928.1|  PREDICTED: polyphenol oxidase, chloroplastic...    382   4e-119   
gb|ABI96937.1|  putative polyphenol oxidase                             377   4e-119   Kageneckia oblonga
gb|ABI96951.1|  putative polyphenol oxidase                             377   5e-119   Vauquelinia californica
emb|CBZ41492.1|  polyphenol oxidase precursor (chloroplast)             382   6e-119   
gb|AHX26182.1|  polyphenol oxidase                                      380   8e-119   
gb|ABI96934.1|  putative polyphenol oxidase                             376   9e-119   Gillenia trifoliata [Bowman's root]
gb|ABI96930.1|  putative polyphenol oxidase                             376   9e-119   Crataegus monogyna
emb|CAN62983.1|  hypothetical protein VITISV_035472                     382   9e-119   Vitis vinifera
gb|ABM68052.1|  polyphenol oxidase                                      381   1e-118   Trifolium pratense [peavine clover]
ref|XP_009407067.1|  PREDICTED: polyphenol oxidase, chloroplastic...    380   1e-118   
gb|ABI96948.1|  putative polyphenol oxidase                             376   1e-118   Sorbus californica
gb|ABI96933.1|  putative polyphenol oxidase                             376   1e-118   Gillenia stipulata [American-ipecac]
emb|CDP22269.1|  unnamed protein product                                374   3e-118   
gb|AII22011.1|  polyphenol oxidase-9                                    379   4e-118   
gb|ABN13632.1|  polyphenol oxidase                                      378   4e-118   Doritis pulcherrima x Phalaenopsis hybrid cultivar
ref|XP_003567197.1|  PREDICTED: polyphenol oxidase I, chloroplast...    379   5e-118   
gb|ABI96935.1|  putative polyphenol oxidase                             374   5e-118   Heteromeles arbutifolia
gb|ABI96936.1|  putative polyphenol oxidase                             374   5e-118   Holodiscus microphyllus
gb|ABI96927.1|  putative polyphenol oxidase                             374   5e-118   Chaenomeles speciosa [boke]
ref|XP_010926766.1|  PREDICTED: polyphenol oxidase, chloroplastic...    379   6e-118   
ref|XP_006370128.1|  hypothetical protein POPTR_0001s39950g             378   7e-118   
gb|EYU34166.1|  hypothetical protein MIMGU_mgv1a003279mg                379   8e-118   
gb|ABY84850.1|  polyphenol oxidase                                      375   8e-118   Cydonia oblonga [wen po]
gb|AHX26181.1|  polyphenol oxidase                                      377   1e-117   
gb|ABI96946.1|  putative polyphenol oxidase                             374   1e-117   Pyrus communis subsp. caucasica
ref|XP_002446944.1|  hypothetical protein SORBIDRAFT_06g025570          377   1e-117   Sorghum bicolor [broomcorn]
gb|ACB12081.1|  polyphenol oxidase                                      376   4e-117   Triticum urartu
dbj|BAM15846.1|  hypothetical protein                                   376   9e-117   
ref|XP_008663490.1|  PREDICTED: polyphenol oxidase, chloroplastic...    374   1e-116   
gb|ABF19601.1|  polyphenol oxidase                                      375   2e-116   Camellia ptilophylla
ref|XP_011098119.1|  PREDICTED: polyphenol oxidase I, chloroplast...    375   2e-116   
ref|XP_004146644.1|  PREDICTED: polyphenol oxidase, chloroplastic...    374   3e-116   
ref|XP_006347083.1|  PREDICTED: polyphenol oxidase, chloroplastic...    375   3e-116   
dbj|BAM15849.1|  hypothetical protein                                   375   4e-116   
gb|ACB12082.1|  polyphenol oxidase                                      373   6e-116   Triticum monococcum subsp. aegilopoides [wild einkorn]
ref|XP_010100566.1|  Polyphenol oxidase                                 374   6e-116   
dbj|BAA21677.1|  polyphenol oxidase                                     374   7e-116   Malus domestica [apple tree]
sp|Q9FRX6.1|AS1_ANTMA  RecName: Full=Aureusidin synthase; Short=A...    372   9e-116   Antirrhinum majus [garden snapdragon]
gb|EYU34165.1|  hypothetical protein MIMGU_mgv1a003246mg                373   1e-115   
gb|ACB12083.1|  polyphenol oxidase                                      372   2e-115   Triticum monococcum [einkorn wheat]
gb|KHN46328.1|  Polyphenol oxidase A1, chloroplastic                    373   2e-115   
gb|EYU34162.1|  hypothetical protein MIMGU_mgv1a005754mg                368   2e-115   
ref|XP_008345876.1|  PREDICTED: polyphenol oxidase, chloroplastic...    372   3e-115   
ref|XP_008778193.1|  PREDICTED: polyphenol oxidase, chloroplastic...    372   3e-115   
ref|XP_003529305.2|  PREDICTED: polyphenol oxidase A1, chloroplastic    373   3e-115   
gb|ADG85002.1|  polyphenol oxidase                                      371   4e-115   
gb|ACR82078.1|  polyphenol oxidase                                      371   6e-115   Camellia sinensis [black tea]
gb|ABR10907.1|  polyphenol oxidase                                      371   6e-115   Camellia sinensis [black tea]
gb|ACF17425.1|  polyphenol oxidase                                      371   8e-115   Camellia sinensis [black tea]
gb|ACN38060.1|  polyphenol oxidase                                      371   1e-114   Camellia sinensis [black tea]
gb|AEY79824.1|  polyphenol oxidase                                      370   1e-114   
gb|ABF19602.1|  polyphenol oxidase                                      370   1e-114   Camellia sinensis var. assamica [Assam tea]
gb|AHX26180.1|  polyphenol oxidase                                      369   1e-114   
gb|ABK62804.1|  polyphenol oxidase                                      370   1e-114   
gb|ACJ04908.1|  polyphenol oxidase                                      370   2e-114   
gb|ABR57235.1|  polyphenol oxidase                                      370   2e-114   
gb|ACB12084.1|  polyphenol oxidase                                      369   3e-114   
gb|ABR24120.1|  polyphenol oxidase                                      369   4e-114   
ref|XP_002446945.1|  hypothetical protein SORBIDRAFT_06g025580          368   4e-114   
gb|ABR57236.1|  polyphenol oxidase                                      369   4e-114   
emb|CCA94610.1|  polyphenol oxidase precursor (chloroplast)             369   6e-114   
gb|ABK62801.1|  polyphenol oxidase                                      367   1e-113   
ref|XP_008779317.1|  PREDICTED: polyphenol oxidase, chloroplastic...    367   3e-113   
dbj|BAJ10871.1|  polyphenol oxidase                                     366   4e-113   
ref|XP_003528444.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    365   7e-113   
ref|XP_009773174.1|  PREDICTED: polyphenol oxidase, chloroplastic...    366   8e-113   
gb|ABK62802.1|  polyphenol oxidase                                      365   9e-113   
ref|XP_002458623.1|  hypothetical protein SORBIDRAFT_03g036870          365   1e-112   
ref|XP_010100567.1|  Polyphenol oxidase                                 365   2e-112   
ref|XP_010227274.1|  PREDICTED: LOW QUALITY PROTEIN: polyphenol o...    364   4e-112   
ref|XP_004232833.2|  PREDICTED: polyphenol oxidase, chloroplastic...    364   7e-112   
ref|XP_004972211.1|  PREDICTED: polyphenol oxidase, chloroplastic...    363   1e-111   
gb|AAS00454.1|  polyphenol oxidase                                      361   1e-111   
ref|XP_011013403.1|  PREDICTED: polyphenol oxidase, chloroplastic...    362   2e-111   
ref|XP_008236801.1|  PREDICTED: polyphenol oxidase, chloroplastic...    361   2e-111   
ref|XP_006595376.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    364   2e-111   
dbj|BAH36897.1|  polyphenol oxidase                                     360   5e-111   
gb|EYU26236.1|  hypothetical protein MIMGU_mgv1a027162mg                360   6e-111   
gb|ABK62803.1|  polyphenol oxidase                                      360   7e-111   
gb|ACB12086.1|  polyphenol oxidase                                      360   8e-111   
ref|XP_010100565.1|  Polyphenol oxidase                                 360   8e-111   
dbj|BAP82255.1|  polyphenol oxidase                                     360   9e-111   
ref|XP_010686565.1|  PREDICTED: polyphenol oxidase, chloroplastic...    360   9e-111   
dbj|BAP82254.1|  polyphenol oxidase                                     359   9e-111   
gb|AAO16863.1|  polyphenol oxidase                                      359   9e-111   
ref|XP_003541548.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    360   1e-110   
dbj|BAP82257.1|  polyphenol oxidase                                     359   1e-110   
pdb|2P3X|A  Chain A, Crystal Structure Of Grenache (Vitis Vinifer...    351   1e-110   
ref|XP_010686567.1|  PREDICTED: polyphenol oxidase, chloroplastic...    360   1e-110   
gb|AAK29782.1|AF261957_1  polyphenol oxidase                            360   2e-110   
emb|CAH66801.1|  H0215F08.12                                            356   2e-110   
gb|AAT75166.1|  polyphenol oxidase                                      358   3e-110   
gb|AII22009.1|  polyphenol oxidase-7                                    359   6e-110   
ref|XP_011098100.1|  PREDICTED: polyphenol oxidase I, chloroplast...    357   1e-109   
dbj|BAP82256.1|  polyphenol oxidase                                     357   1e-109   
ref|XP_008383783.1|  PREDICTED: polyphenol oxidase I, chloroplast...    357   1e-109   
emb|CCD61123.1|  polyphenol oxidase precursor (chloroplast)             356   7e-109   
emb|CBZ41491.1|  polyphenol oxidase precursor (chloroplast)             356   7e-109   
dbj|BAA08234.1|  polyphenol oxidase                                     355   8e-109   
dbj|BAH36896.1|  polyphenol oxidase                                     352   1e-108   
gb|ACJ04909.1|  polyphenol oxidase                                      353   4e-108   
gb|AFS28698.1|  putative polyphenol oxidase                             349   4e-108   
ref|XP_010686564.1|  PREDICTED: polyphenol oxidase, chloroplastic...    354   5e-108   
gb|AEY79826.1|  polyphenol oxidase                                      352   5e-108   
gb|AFS28697.1|  putative polyphenol oxidase                             349   6e-108   
ref|XP_002974314.1|  hypothetical protein SELMODRAFT_101213             352   7e-108   
dbj|BAA08235.1|  polyphenol oxidase                                     348   1e-107   
ref|XP_010100568.1|  Polyphenol oxidase                                 352   2e-107   
gb|EYU34157.1|  hypothetical protein MIMGU_mgv1a003435mg                351   2e-107   
gb|ABG23097.1|  polyphenol oxidase                                      351   2e-107   
gb|ABG23077.1|  polyphenol oxidase                                      351   2e-107   
gb|ABG23059.1|  polyphenol oxidase                                      351   2e-107   
gb|ACS15326.1|  polyphenol oxidase                                      350   2e-107   
gb|ABG23093.1|  polyphenol oxidase                                      350   3e-107   
gb|ABG23065.1|  polyphenol oxidase                                      350   3e-107   
gb|ACS15330.1|  polyphenol oxidase                                      350   3e-107   
gb|ACS15337.1|  polyphenol oxidase                                      350   3e-107   
ref|XP_007211883.1|  hypothetical protein PRUPE_ppa003608mg             350   3e-107   
gb|AHZ59731.1|  copper-containing polyphenol oxidase                    350   3e-107   
gb|AEY79825.1|  polyphenol oxidase                                      350   3e-107   
gb|ABA62017.1|  polyphenol oxidase                                      350   5e-107   
gb|AEM45931.1|  polyphenol oxidase                                      349   5e-107   
gb|ABG23081.1|  polyphenol oxidase                                      350   5e-107   
ref|NP_001053932.1|  Os04g0624500                                       349   6e-107   
gb|ABG23062.1|  polyphenol oxidase                                      350   7e-107   
gb|ABG23092.1|  polyphenol oxidase                                      350   7e-107   
gb|AII22005.1|  polyphenol oxidase-3                                    351   8e-107   
gb|AII22008.1|  polyphenol oxidase-6                                    351   8e-107   
gb|ACS15319.1|  polyphenol oxidase                                      348   9e-107   
ref|XP_010686675.1|  PREDICTED: polyphenol oxidase, chloroplastic...    350   9e-107   
dbj|BAH36895.1|  polyphenol oxidase                                     348   1e-106   
gb|AII22010.1|  polyphenol oxidase-8                                    350   1e-106   
gb|ABG23057.1|  polyphenol oxidase                                      349   1e-106   
ref|XP_008674942.1|  PREDICTED: polyphenol oxidase, chloroplastic...    349   1e-106   
gb|ABG23083.1|  polyphenol oxidase                                      348   2e-106   
gb|ABG23086.1|  polyphenol oxidase                                      348   2e-106   
gb|ABG23098.1|  polyphenol oxidase                                      348   2e-106   
emb|CAH66802.1|  H0215F08.13                                            348   2e-106   
gb|AEM45935.1|  polyphenol oxidase                                      347   2e-106   
ref|XP_010100571.1|  Polyphenol oxidase                                 347   3e-106   
gb|ABG23070.1|  polyphenol oxidase                                      348   3e-106   
gb|ABG23085.1|  polyphenol oxidase                                      348   3e-106   
gb|ABG23084.1|  polyphenol oxidase                                      348   3e-106   
gb|AAK13243.1|  polyphenol oxidase                                      349   3e-106   
ref|XP_009408745.1|  PREDICTED: polyphenol oxidase, chloroplastic...    346   3e-106   
gb|ACB12087.1|  truncated polyphenol oxidase                            344   4e-106   
gb|AEM45934.1|  polyphenol oxidase                                      347   4e-106   
emb|CAE03510.2|  OSJNBa0053K19.18                                       347   5e-106   
gb|AEM45933.1|  polyphenol oxidase                                      347   5e-106   
gb|AEM45936.1|  polyphenol oxidase                                      347   5e-106   
gb|ABG23075.1|  polyphenol oxidase                                      347   5e-106   
gb|ABG23047.1|  polyphenol oxidase                                      347   5e-106   
ref|XP_003605693.1|  Polyphenol oxidase A1                              343   5e-106   
ref|XP_010686566.1|  PREDICTED: polyphenol oxidase, chloroplastic...    348   6e-106   
gb|ABG23042.1|  polyphenol oxidase                                      347   8e-106   
gb|KHN08552.1|  Polyphenol oxidase A1, chloroplastic                    346   1e-105   
gb|ABG23073.1|  polyphenol oxidase                                      346   1e-105   
gb|EEC78047.1|  hypothetical protein OsI_17486                          343   2e-105   
dbj|BAP82258.1|  polyphenol oxidase                                     345   2e-105   
gb|ABG23045.1|  polyphenol oxidase                                      345   2e-105   
ref|XP_007025707.1|  Larreatricin hydroxylase isoform 2                 339   6e-105   
gb|ABG23087.1|  polyphenol oxidase                                      344   7e-105   
dbj|BAK03848.1|  predicted protein                                      344   8e-105   
gb|ABG23060.1|  polyphenol oxidase                                      344   9e-105   
dbj|BAJ10872.1|  polyphenol oxidase                                     344   1e-104   
gb|ABG23061.1|  polyphenol oxidase                                      343   1e-104   
gb|ABG23067.1|  polyphenol oxidase                                      343   1e-104   
gb|EEC78048.1|  hypothetical protein OsI_17489                          343   1e-104   
gb|ABG23066.1|  polyphenol oxidase                                      343   1e-104   
ref|XP_006653782.1|  PREDICTED: polyphenol oxidase, chloroplastic...    342   1e-104   
gb|ABG23090.1|  polyphenol oxidase                                      343   2e-104   
gb|ABG23072.1|  polyphenol oxidase                                      343   2e-104   
gb|AGC55012.1|  polyphenoloxidase                                       343   3e-104   
gb|AFW59500.1|  putative polyphenol oxidase family protein              343   5e-104   
ref|XP_006370119.1|  hypothetical protein POPTR_0001s39670g             336   7e-104   
gb|AHN09736.1|  aurone synthase                                         342   7e-104   
ref|XP_002976938.1|  hypothetical protein SELMODRAFT_175858             342   1e-103   
emb|CDP06098.1|  unnamed protein product                                341   1e-103   
ref|XP_002980542.1|  hypothetical protein SELMODRAFT_178281             341   2e-103   
ref|XP_002976812.1|  hypothetical protein SELMODRAFT_175861             340   4e-103   
ref|XP_002980680.1|  hypothetical protein SELMODRAFT_178277             340   6e-103   
gb|EMT06707.1|  Polyphenol oxidase A1, chloroplastic                    338   1e-102   
ref|XP_003552355.1|  PREDICTED: polyphenol oxidase, chloroplastic...    338   2e-102   
ref|XP_007139960.1|  hypothetical protein PHAVU_008G073200g             338   2e-102   
gb|KHN07285.1|  Polyphenol oxidase A1, chloroplastic                    337   2e-102   
ref|XP_002438681.1|  hypothetical protein SORBIDRAFT_10g024220          337   5e-102   
gb|AFW87458.1|  putative polyphenol oxidase family protein              336   7e-102   
ref|NP_001147867.1|  polyphenol oxidase precursor                       335   1e-101   
gb|AFH00998.1|  polyphenol oxidase III                                  336   2e-101   
gb|AGK88243.1|  polyphenol oxidase                                      335   4e-101   
gb|ACJ70698.1|  polyphenol oxidase                                      334   5e-101   
ref|XP_007214570.1|  hypothetical protein PRUPE_ppa019877mg             335   1e-100   
ref|XP_011076536.1|  PREDICTED: polyphenol oxidase I, chloroplast...    334   1e-100   
ref|NP_001149552.1|  polyphenol oxidase II                              330   1e-100   
gb|ADF59060.1|  polyphenol oxidase 6 precursor                          333   1e-100   
ref|XP_008225001.1|  PREDICTED: polyphenol oxidase I, chloroplast...    332   6e-100   
gb|EPS57764.1|  polyphenol oxidase                                      329   1e-99    
ref|XP_007025704.1|  Larreatricin hydroxylase                           329   2e-99    
gb|KHN03175.1|  Polyphenol oxidase, chloroplastic                       329   3e-99    
ref|XP_003551647.1|  PREDICTED: polyphenol oxidase, chloroplastic       329   6e-99    
ref|XP_009388016.1|  PREDICTED: polyphenol oxidase, chloroplastic...    328   1e-98    
emb|CCD61124.1|  polyphenol oxidase precursor (chloroplast)             326   2e-97    
ref|XP_006377743.1|  hypothetical protein POPTR_0011s10940g             320   2e-97    
gb|AFN53703.1|  putative phenol oxidase                                 320   2e-97    
ref|XP_004965883.1|  PREDICTED: aureusidin synthase-like                325   3e-97    
ref|XP_009388018.1|  PREDICTED: polyphenol oxidase, chloroplastic...    322   4e-97    
ref|XP_002982245.1|  hypothetical protein SELMODRAFT_116300             324   6e-97    
ref|XP_006644832.1|  PREDICTED: polyphenol oxidase, chloroplastic...    322   2e-96    
ref|XP_002990877.1|  hypothetical protein SELMODRAFT_132508             321   4e-96    
ref|XP_009388330.1|  PREDICTED: polyphenol oxidase, chloroplastic...    319   4e-96    
dbj|BAJ90144.1|  predicted protein                                      320   9e-96    
dbj|BAB89047.1|  putative polyphenol oxidase                            320   1e-95    
ref|XP_009388329.1|  PREDICTED: polyphenol oxidase, chloroplastic...    320   1e-95    
ref|XP_006646401.1|  PREDICTED: polyphenol oxidase, chloroplastic...    319   4e-95    
emb|CCD61125.1|  polyphenol oxidase precursor (chloroplast)             319   6e-95    
ref|XP_002990241.1|  hypothetical protein SELMODRAFT_185154             317   1e-94    
ref|XP_003567194.1|  PREDICTED: polyphenol oxidase I, chloroplast...    317   1e-94    
ref|XP_009352971.1|  PREDICTED: polyphenol oxidase, chloroplastic...    311   1e-94    
gb|EEC71623.1|  hypothetical protein OsI_04042                          316   2e-94    
gb|KHN03178.1|  Polyphenol oxidase II, chloroplastic                    310   4e-94    
ref|XP_002458568.1|  hypothetical protein SORBIDRAFT_03g035850          315   9e-94    
ref|XP_010680714.1|  PREDICTED: polyphenol oxidase, chloroplastic...    315   1e-93    
ref|XP_002990879.1|  hypothetical protein SELMODRAFT_11755              310   1e-93    
ref|XP_010263628.1|  PREDICTED: aureusidin synthase-like                314   2e-93    
ref|XP_003564367.2|  PREDICTED: polyphenol oxidase I, chloroplast...    314   3e-93    
ref|XP_002990878.1|  hypothetical protein SELMODRAFT_429255             313   4e-93    
ref|XP_002961891.1|  hypothetical protein SELMODRAFT_164684             313   5e-93    
dbj|BAM15845.1|  hypothetical protein                                   312   2e-92    
gb|EMS49817.1|  Polyphenol oxidase, chloroplastic                       310   4e-92    
emb|CCD61126.1|  polyphenol oxidase precursor (chloroplast)             312   5e-92    
gb|EMT09670.1|  Polyphenol oxidase, chloroplastic                       305   6e-92    
emb|CDM84541.1|  unnamed protein product                                309   7e-92    
ref|XP_010921586.1|  PREDICTED: polyphenol oxidase, chloroplastic...    310   7e-92    
gb|ACS15320.1|  polyphenol oxidase                                      303   4e-91    
ref|XP_010110268.1|  Polyphenol oxidase A1                              307   7e-91    
ref|XP_010680713.1|  PREDICTED: polyphenol oxidase, chloroplastic...    308   8e-91    
gb|ACS15325.1|  polyphenol oxidase                                      302   1e-90    
gb|AAT06525.1|  polyphenol oxidase                                      301   2e-90    
gb|ABJ90144.1|  polyphenol oxidase                                      305   1e-89    
ref|XP_006370123.1|  hypothetical protein POPTR_0001s39900g             296   3e-89    
ref|XP_010910148.1|  PREDICTED: polyphenol oxidase, chloroplastic...    302   7e-89    
ref|XP_010110269.1|  Polyphenol oxidase                                 299   4e-88    
gb|ABG23046.1|  polyphenol oxidase                                      299   6e-88    
gb|ABG23091.1|  polyphenol oxidase                                      298   2e-87    
ref|XP_007042162.1|  Uncharacterized protein isoform 4                  296   2e-87    
ref|XP_007042160.1|  Uncharacterized protein isoform 2                  296   5e-87    
gb|AGT28746.1|  aurone synthase                                         298   6e-87    
ref|XP_010099505.1|  Polyphenol oxidase                                 294   6e-87    
ref|XP_009380367.1|  PREDICTED: polyphenol oxidase I, chloroplast...    296   8e-87    
ref|XP_010099507.1|  Polyphenol oxidase                                 293   9e-87    
ref|XP_007042159.1|  Uncharacterized protein isoform 1                  297   9e-87    
gb|ABG23096.1|  polyphenol oxidase                                      296   1e-86    
ref|XP_010254790.1|  PREDICTED: aureusidin synthase-like                296   2e-86    
gb|ACB45128.1|  polyphenol oxidase                                      287   2e-86    
gb|AGT28745.1|  aurone synthase                                         296   3e-86    
emb|CBI37659.3|  unnamed protein product                                293   4e-86    
ref|XP_010645091.1|  PREDICTED: aureusidin synthase-like                293   1e-85    
ref|XP_002306113.2|  hypothetical protein POPTR_0004s16380g             291   6e-85    
ref|XP_011037508.1|  PREDICTED: aureusidin synthase-like                291   7e-85    
ref|XP_006384507.1|  hypothetical protein POPTR_0004s16380g             291   8e-85    
gb|AEH41425.1|  polyphenol oxidase-like protein                         291   8e-85    
dbj|BAM15847.1|  hypothetical protein                                   292   9e-85    
ref|XP_004146641.1|  PREDICTED: polyphenol oxidase, chloroplastic...    287   2e-83    
ref|XP_004295273.1|  PREDICTED: polyphenol oxidase, chloroplastic...    287   2e-83    
ref|XP_010680712.1|  PREDICTED: polyphenol oxidase, chloroplastic...    288   2e-83    
ref|XP_008446626.1|  PREDICTED: polyphenol oxidase I, chloroplast...    290   6e-83    
ref|XP_004170850.1|  PREDICTED: polyphenol oxidase, chloroplastic...    283   8e-83    
ref|XP_004292030.1|  PREDICTED: polyphenol oxidase, chloroplastic...    284   3e-82    
ref|XP_008809953.1|  PREDICTED: polyphenol oxidase, chloroplastic...    280   3e-82    
gb|ACJ76786.1|  tyrosinase polyphenol oxidase                           283   9e-82    
ref|XP_006583806.1|  PREDICTED: polyphenol oxidase II, chloroplas...    283   1e-81    
ref|XP_006583808.1|  PREDICTED: polyphenol oxidase A1, chloroplas...    283   2e-81    
ref|XP_008809956.1|  PREDICTED: polyphenol oxidase I, chloroplast...    281   6e-81    



>ref|XP_009628381.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   536 bits (1381),  Expect = 7e-179, Method: Compositional matrix adjust.
 Identities = 287/514 (56%), Positives = 357/514 (69%), Gaps = 26/514 (5%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAH  529
             ALASPIP P    CG A I     KPVPY+CCP  + +     YY  P  S+  VRPAAH
Sbjct  79    ALASPIPSPTLTQCGTAIIEGD--KPVPYTCCPP-IPEIKDVPYYNPPPVSRFRVRPAAH  135

Query  530   AIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFP  709
              +DD+Y+ KY  A  +MK LP+DDPR+F QQAN+HCAYCNGAY++ GK  Q+HF+WLFFP
Sbjct  136   TVDDEYIAKYNEAYSRMKALPTDDPRSFMQQANIHCAYCNGAYKVGGKELQVHFSWLFFP  195

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWY+YFYERIL SLIDDPTF LPYWNWDNP+GM LP++F D E + +Y+++RNQ HR 
Sbjct  196   FHRWYIYFYERILASLIDDPTFALPYWNWDNPKGMHLPDMF-DVEGTSIYNERRNQKHRN  254

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGT  1069
             G++ DL YAG++  A+D QK+ NNL +MYRQM+TNAPCP LFFGK  R  + +  PGMGT
Sbjct  255   GFIMDLGYAGEDVVANDLQKLVNNLTLMYRQMITNAPCPSLFFGKPYRFGS-EPSPGMGT  313

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDI  1249
             IENVPHNSIHRWVGDPR P+ E+MGNFYS+  DP F+  H+NVDRMWTIWKTLGG RKDI
Sbjct  314   IENVPHNSIHRWVGDPRQPNEEDMGNFYSSGKDPAFFSLHANVDRMWTIWKTLGGKRKDI  373

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrsk  1429
             +DPD+L TEF FYDE     +V+V D LD  KLGYTFQ M  PWK+FKP      +   K
Sbjct  374   SDPDYLDTEFFFYDEKAKPFRVRVRDCLDEKKLGYTFQPMDIPWKNFKPQ----PRKNKK  429

Query  1430  asvsasTSVLPAT-------LNKITTFCVTRSPTSKTPGKEELLDLHLAF-----DDTQF  1573
                    SV PA+       L+K  TF V R    +T  ++E  +  L F     D  +F
Sbjct  430   NVKIDPNSVPPASQVFPIKKLDKTVTFSVARPKRLRTKKEKEDEEELLTFKNVELDVRKF  489

Query  1574  IRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelled  1753
             +RFDVF+NED+DV   E+DR E+ GSF+NL H+H D         K P FSLAI+ELLED
Sbjct  490   VRFDVFLNEDNDVIANEIDRTEFVGSFANLPHIHDDPKKE-----KFPEFSLAINELLED  544

Query  1754  lrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             L+LE DD ++VTLVP++GG  V++     +++ C
Sbjct  545   LKLEGDDLVVVTLVPKSGGENVSIEAVEIQLVPC  578



>sp|Q06355.1|PPOB_SOLTU RecName: Full=Catechol oxidase B, chloroplastic; AltName: Full=Polyphenol 
oxidase; Short=PPO; Flags: Precursor, partial [Solanum 
tuberosum]
 gb|AAA02879.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=588

 Score =   528 bits (1360),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 302/579 (52%), Positives = 392/579 (68%), Gaps = 32/579 (6%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       RR    K+ C A ++ G     D +L    +DRRNVLLGLGGLYGA N
Sbjct  33    QLFLH------GRRNQSFKVSCNANNNVGEH---DKNLD--TVDRRNVLLGLGGLYGAAN  81

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +A    P A ASPIPPP+ KSCG A ++   G  V YSCCP    D  S  YYK P  +K
Sbjct  82    LA----PLASASPIPPPDLKSCGVAHVTE--GVDVTYSCCPPVPDDIDSVPYYKFPPMTK  135

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L +RP AHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  
Sbjct  136   LRIRPPAHAADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGGKEL  195

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LY
Sbjct  196   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DREGSSLY  254

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D KRNQ HR G + DL + GQE      Q + NNL +MYRQM+TNAPCP  FFG A    
Sbjct  255   DDKRNQNHRNGTIIDLGHFGQEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLG  314

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
             T +  PGMGTIEN+PH  +H W GD PR  + ENMGNFYSA +DP+FYCHH+NVDRMW  
Sbjct  315   T-EPSPGMGTIENIPHTPVHIWTGDSPRQKNGENMGNFYSAGLDPIFYCHHANVDRMWDE  373

Query  1217  WKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             WK +GG R+D+++ DWL +EF FYDE +   +VKV D LD+ K+G+++  MPTPW++FKP
Sbjct  374   WKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFSYAPMPTPWRNFKP  433

Query  1397  TrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDLH-LAF  1558
              RK  A   + AS++  T V P A L++  +F +TR  +S+T      +EE+L  + +A+
Sbjct  434   IRKTTAGKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKVAY  493

Query  1559  DDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAIS  1738
             DDT+++RFDVF+N D  VN  ELD+ E+AGS+++L HVH + +    S     TF LAI+
Sbjct  494   DDTKYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHVTSV----TFKLAIT  549

Query  1739  elledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             ELLED  LE++D I VTLVP+ GG  V++     ++ DC
Sbjct  550   ELLEDNGLEDEDTIAVTLVPKVGGEGVSIESVEIKLEDC  588



>gb|AAA02877.1| propolyphenol oxidase, partial [Solanum tuberosum]
Length=583

 Score =   528 bits (1359),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 303/579 (52%), Positives = 395/579 (68%), Gaps = 32/579 (6%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       RR    K+ C A ++ G     D +L    +DRRNVLLGLGGLYGA N
Sbjct  28    QLFLH------GRRNQSFKVSCNANNNVGEH---DKNLD--AVDRRNVLLGLGGLYGAAN  76

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +A    P A ASPIPPP+ KSCG A +    G  V YSCCP    D  S  YYK PS +K
Sbjct  77    LA----PLASASPIPPPDLKSCGVAHVKE--GVDVSYSCCPPVPDDIDSVPYYKFPSMTK  130

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L +RP AHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  
Sbjct  131   LRIRPPAHAADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGGKEL  190

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LY
Sbjct  191   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DREGSSLY  249

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D KRNQ HR G + DL + G+E      Q + NNL +MYRQM+TNAPCP  FFG A    
Sbjct  250   DDKRNQNHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLG  309

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
             T +  PG GTIEN+PH  +H W GD PR  + ENMGNFYSA +DP+FYCHH+NVDRMW  
Sbjct  310   T-EPSPGQGTIENIPHTPVHIWTGDKPRQKNGENMGNFYSAGLDPLFYCHHANVDRMWDE  368

Query  1217  WKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             WK +GG R+D+++ DWL +EF FYDE +   +VKV DSLD+ K+G+++  MPTPW++FKP
Sbjct  369   WKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDSLDSKKMGFSYAPMPTPWRNFKP  428

Query  1397  TrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDL-HLAF  1558
              RK  A + + AS++  T V P A L++  +F +TR  +S+T      +EE+L    +A+
Sbjct  429   IRKTTAGIVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFKKIAY  488

Query  1559  DDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAIS  1738
             DDTQ++RFDVF+N D  VN  ELD+ E+AGS+++L HVH + +  A S     TF++AI+
Sbjct  489   DDTQYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHATSV----TFTVAIT  544

Query  1739  elledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             ELLED+ LE++D I VTLVP+ GG  V++     ++ DC
Sbjct  545   ELLEDIGLEDEDTIAVTLVPKVGGEGVSIESVEIKLEDC  583



>ref|XP_009603530.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=578

 Score =   527 bits (1358),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 287/514 (56%), Positives = 357/514 (69%), Gaps = 26/514 (5%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAH  529
             ALASPIP P    CG A I      PV Y+CCP  + D      Y +P  S   VRPAA 
Sbjct  79    ALASPIPSPTITQCGTAFIDPK--IPVCYTCCPP-IPDKKDVPCYDLPLVSGFRVRPAAQ  135

Query  530   AIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFP  709
              +DD+Y+ KY  A  +MK LP+DDPR+F QQAN+HCAYCNGAY++ GK  Q+HF+WLFFP
Sbjct  136   TVDDEYIAKYNEAYSRMKALPTDDPRSFMQQANIHCAYCNGAYKVGGKELQVHFSWLFFP  195

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWYLYF+ERIL SLI DPTF LPYWNWD+P+GM LP++F D E + +Y+++RNQ HR 
Sbjct  196   FHRWYLYFHERILASLIGDPTFALPYWNWDHPKGMHLPDMF-DVEGTSIYNERRNQKHRN  254

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGT  1069
             G++ DL YAG++  A+D QK+ NNLAIMYRQM+TNAPCPLLFFGK  R  +  + PGMGT
Sbjct  255   GFIMDLGYAGEDVVANDLQKMVNNLAIMYRQMITNAPCPLLFFGKPYRLGSKPS-PGMGT  313

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDI  1249
             IENVPHNSIHRWVGDPR P+ E+MGNFYS+  DP F+  H+NVDRMWTIWKTLGG RKDI
Sbjct  314   IENVPHNSIHRWVGDPRQPNQEDMGNFYSSGKDPAFFSLHANVDRMWTIWKTLGGKRKDI  373

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrsk  1429
             +DPD+L TEF FYDE     +V+V+D LD  KLGYTFQ M TPWK+FKP      +  +K
Sbjct  374   SDPDYLDTEFFFYDEKAKPFRVRVQDCLDEKKLGYTFQPMDTPWKNFKPL----LRKNTK  429

Query  1430  asvsasTSVLPAT-------LNKITTFCVTRSPTSKTPGKEELLDLHLAF-----DDTQF  1573
                    SV PA+       L+KI TF V R    +T  ++E  +  L F     D  +F
Sbjct  430   NVKIDPNSVPPASQVFPIKKLDKIVTFSVARPKKLRTKKEKEDEEELLTFKNVELDVRKF  489

Query  1574  IRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelled  1753
             +RFDVF+NED+DV   E+DR E+ GSF+NL H+H D         K P FSLAI+ELLED
Sbjct  490   VRFDVFLNEDNDVIANEIDRTEFVGSFANLPHIHDDPKKE-----KFPEFSLAINELLED  544

Query  1754  lrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             L+LE DD ++VTLVP+ GG  V++     +++ C
Sbjct  545   LKLEGDDLVVVTLVPKIGGDNVSIEAVEIQLVPC  578



>ref|XP_006355239.1| PREDICTED: catechol oxidase B, chloroplastic [Solanum tuberosum]
Length=589

 Score =   525 bits (1353),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 302/580 (52%), Positives = 391/580 (67%), Gaps = 34/580 (6%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGR-ENPADSSLSEAKLDRRNVllglgglygay  322
             Q+FL+       RR    K+ C   ++ G  E   D+      +DRRNVLLGLGGLYGA 
Sbjct  34    QLFLH------GRRNQSFKVSCNVNNNVGEHEKNLDA------VDRRNVLLGLGGLYGAA  81

Query  323   niaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFS  502
             N+A    P A ASPIPPP+ KSCG A +    G  V YSCCP    D  S  YYK P  +
Sbjct  82    NLA----PLASASPIPPPDLKSCGVAHVKE--GVDVLYSCCPPVPDDIDSVPYYKFPPMT  135

Query  503   KLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKP  676
             KL +RP AHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK 
Sbjct  136   KLRIRPPAHAADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGGKE  195

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S L
Sbjct  196   LQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DREGSSL  254

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD KRNQ HR G + DL + G+E      Q + NNL +MYRQM+TNAPCP  FFG A   
Sbjct  255   YDDKRNQNHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPL  314

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWT  1213
              T  + PGMGTIEN+PH  +H W GD PR  + ENMGNFYSA +DP+FYCHH+NVDRMW 
Sbjct  315   GTKPS-PGMGTIENIPHTPVHIWTGDTPRQKNGENMGNFYSAGLDPIFYCHHANVDRMWD  373

Query  1214  IWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
              WK +GG R+D+++ DWL +EF FYDE +   +VKV DSLD+ K+G+++  MPTPW++FK
Sbjct  374   EWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDSLDSKKMGFSYAPMPTPWRNFK  433

Query  1394  PTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDLH-LA  1555
             P RK  A   + AS++  T V P A L++  +F +TR  +S+T      +EE+L  + +A
Sbjct  434   PIRKTTAGKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKIA  493

Query  1556  FDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAI  1735
             +DDTQ++RFDVF+N D  VN  ELD+ E+AGS+++L HVH + +    S I    F LAI
Sbjct  494   YDDTQYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHVTSVI----FKLAI  549

Query  1736  SelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             +ELLED  LE++D I VTLVP+ GG  V++     ++ DC
Sbjct  550   TELLEDNGLEDEDTIAVTLVPKVGGEGVSIESVEIKLEDC  589



>gb|AEO00529.1| polyphenol oxidase [Nicotiana benthamiana]
Length=588

 Score =   524 bits (1349),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 300/582 (52%), Positives = 395/582 (68%), Gaps = 37/582 (6%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       +R    K  C A SSE      D +L    +DRRNVLLGLGGLYGA N
Sbjct  32    QLFLH------GKRNQNFKFSCNANSSE-----TDKNLD--AVDRRNVLLGLGGLYGAAN  78

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +A    P A A+PIPPP+ KSC  A I++   + V YSCCP    D  S  YYK PS  K
Sbjct  79    LA----PLATAAPIPPPDLKSCSKAHINDQ--EEVSYSCCPPIPSDMDSVPYYKFPSMPK  132

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L +RPAAHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  
Sbjct  133   LRIRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKEL  192

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LY
Sbjct  193   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMF-DREGSSLY  251

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D +RNQ+HR G + DL + G E   +  Q++ NNL IMYRQM+TNAPCPLLFFG+     
Sbjct  252   DARRNQSHRNGTIIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLG  311

Query  1040  TGDTGPGMGTIENVPHNSIHRWVG----DPRSPHNENMGNFYSAAIDPVFYCHHSNVDRM  1207
             T D  PGMGTIEN+PH  +H WVG    +    H E+MGNFYSA +DP+FY HH+NVDRM
Sbjct  312   T-DPSPGMGTIENIPHTPVHIWVGSRPNENNVSHGEDMGNFYSAGLDPLFYSHHANVDRM  370

Query  1208  WTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKD  1387
             W+ WK LGG R+D+T+ DWL +EF FYDE +   +VKV D L + K+G+ +  MPTPW++
Sbjct  371   WSEWKALGGKRRDLTNKDWLNSEFFFYDENRNPFRVKVRDCLHSKKMGFDYAPMPTPWRN  430

Query  1388  FKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDL-H  1549
             FKPTRK  A   + +SV  ++ V P + L++  +F + R  +S+T      +EE+L   +
Sbjct  431   FKPTRKSNAGKVNLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNN  490

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSL  1729
             + +DD+++IRFDVF+N D  VN  ELD+ EYAGS+++L HVH D +T   S     TF L
Sbjct  491   IKYDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNATHVTSV----TFQL  546

Query  1730  AISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             AI+ELLED+ LE++D I VT+VP+ GG  +++     +++DC
Sbjct  547   AITELLEDIGLEDEDAIAVTVVPKTGGEEISIQGVEIKLVDC  588



>emb|CAA73103.1| polyphenol oxidase [Nicotiana tabacum]
Length=592

 Score =   522 bits (1344),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 308/615 (50%), Positives = 411/615 (67%), Gaps = 37/615 (6%)
 Frame = +2

Query  47    AMATSTHPISSTKNISFIstnsssprnfsrrpsQIFLNPNPSRAARRGDVIKIRCAAASS  226
             A ++ST P+ + K  S   TN+++  +F  +PSQ+FL+       +R    K  C A S 
Sbjct  3     ASSSSTLPLCANKTPSSSFTNTNTNSSFFAKPSQLFLH------GKRNQNFKFSCNANSG  56

Query  227   EGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATI  406
             E  +N          +DRRNVLLGLGGLYGA N+A    P A A+PIPPP+ KSC  A I
Sbjct  57    EHDKN-------LDAVDRRNVLLGLGGLYGAANLA----PLATAAPIPPPDLKSCSKAHI  105

Query  407   SNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKD  586
             ++   + V YSCCP    D  S  YYK PS  KL +RPAAHA D++Y+ KY+ A  +M++
Sbjct  106   NDK--EEVSYSCCPPIPSDMDSVPYYKFPSMPKLRIRPAAHAADEEYIAKYQLATSRMRE  163

Query  587   LPSD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHRWYLYFYERILQSLI  760
             L  D  DP  F QQAN+HCAYCNGAY++ GK  Q+HF+WLFFPFHRWYLYFYERIL SLI
Sbjct  164   LDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLI  223

Query  761   DDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASD  940
             +DPTF LPYWNWD+P+GM +P +F D E S LYD +RNQ+HR G + DL + G E   + 
Sbjct  224   NDPTFGLPYWNWDHPKGMGIPPMF-DREGSSLYDARRNQSHRNGTIIDLGFFGTEVQTTQ  282

Query  941   FQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVG---  1111
              Q++ NNL IMYRQM+TNAPCPLLFFG+     T D  PGMGTIEN+PH  +H WVG   
Sbjct  283   LQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGT-DPSPGMGTIENIPHTPVHIWVGSRP  341

Query  1112  -DPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFY  1288
              +    H E+MGNFYSA +DP+FY HH+NVDRMW+ WK LGG R+D+T  DWL +EF FY
Sbjct  342   DENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEWKALGGKRRDLTHKDWLNSEFFFY  401

Query  1289  DETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTSVLP-A  1465
             DE +   +VKV D LD+ K+G+ +  MPTPW++FKP RK  A   + +SV  ++ V P +
Sbjct  402   DENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSNAGKVNLSSVPPASKVFPLS  461

Query  1466  TLNKITTFCVTRSPTSKTPG----KEELLDL-HLAFDDTQFIRfdvfvnedddvnTKELD  1630
              L++  +F + R  +S+T      +EE+L   ++ +DD+++IRFDVF+N D  VN  ELD
Sbjct  462   KLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDSKYIRFDVFLNVDKTVNADELD  521

Query  1631  RVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGG  1810
             + EYAGS+++L HVH D  +   S     TF LAI+ELLED+ LE++D I VT+VP+ GG
Sbjct  522   KAEYAGSYTSLPHVHGDNVSHVTSV----TFQLAITELLEDIGLEDEDTIAVTVVPKTGG  577

Query  1811  SFVTVNKAYTEIIDC  1855
               +++     +++DC
Sbjct  578   EEISIEGVEIKLVDC  592



>ref|XP_004246033.1| PREDICTED: polyphenol oxidase F, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   519 bits (1336),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 292/572 (51%), Positives = 388/572 (68%), Gaps = 29/572 (5%)
 Frame = +2

Query  167   PSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNP  346
             P    RR    K+ C            D +L    +DRRNVLLGLGG YGA N+A    P
Sbjct  36    PFLHGRRCQSFKVSCNVGEH-------DKNLD--AVDRRNVLLGLGGFYGAANLA----P  82

Query  347   FALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
              A A+PIPPP+ KSCG A I +  G  V YSCCP    D  S  YYK P  +KL +RP A
Sbjct  83    LASAAPIPPPDLKSCGVAHIDDK-GTEVSYSCCPPVPDDIDSVPYYKFPPMTKLRIRPPA  141

Query  527   HAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWL  700
             HA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  Q+HF+WL
Sbjct  142   HAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWL  201

Query  701   FFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQA  880
             FFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LYD+KRNQ 
Sbjct  202   FFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DREGSSLYDEKRNQN  260

Query  881   HRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPG  1060
             HR G + DL + G++      Q + NNL +MYRQM+TNAPCP  FFG A    + D  PG
Sbjct  261   HRNGTIIDLGHFGKDVETPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLGS-DPEPG  319

Query  1061  MGTIENVPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN  1237
             MGTIEN+PH  +H W GD PR  H E+MGNFYSA +DP+FYCHH+NVDRMW  WK +GG 
Sbjct  320   MGTIENIPHTPVHIWTGDSPRQGHGEDMGNFYSAGLDPLFYCHHANVDRMWNEWKLIGGK  379

Query  1238  RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrak  1417
             R+D+++ DWL +EF FYDE +   +VKV D LD+ K+G+ +  MPTPW++FKP R+  + 
Sbjct  380   RRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRRSSSG  439

Query  1418  lrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDLH-LAFDDTQFIR  1579
               + AS++  + V P A L++  +F +TR  +S+T      +EE+L  + +A+DDT+++R
Sbjct  440   KVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKMAYDDTKYVR  499

Query  1580  fdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlr  1759
             FDVF+N D  VN +ELD+ E+AGS+++L HVH +     ++ +K  TF+LAI+ELLED+ 
Sbjct  500   FDVFLNVDKTVNAEELDKAEFAGSYTSLPHVHGNN----DNHVKDVTFTLAITELLEDIG  555

Query  1760  lenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             LE++D I VTLVP+ GG  V++     ++ DC
Sbjct  556   LEDEDTIAVTLVPKVGGEGVSIESVEIKLEDC  587



>ref|XP_010325653.1| PREDICTED: polyphenol oxidase E, chloroplastic [Solanum lycopersicum]
Length=587

 Score =   517 bits (1331),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 296/579 (51%), Positives = 389/579 (67%), Gaps = 36/579 (6%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       RR    K+ C A + +  +NP         +DRRNVLLGLGGLYGA N
Sbjct  36    QLFLH------GRRNQSFKVSCNANNVD--KNPD-------AVDRRNVLLGLGGLYGAAN  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +A    P A A+PIPPP+ KSCG A +    G  V YSCCP    D  S  YYK PS +K
Sbjct  81    LA----PLATAAPIPPPDLKSCGTAHVKE--GVDVIYSCCPPVPDDIDSVPYYKFPSMTK  134

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L +RP AHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  
Sbjct  135   LRIRPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKVGGKEL  194

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LY
Sbjct  195   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DREGSSLY  253

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D+KRNQ HR G + DL + G+E      Q + NNL +MYRQM+TNAPCP  FFG A    
Sbjct  254   DEKRNQNHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLG  313

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
             + +  PG GTIEN+PH  +H W GD PR  + E+MGNFYSA +DP+FYCHH+NVDRMW  
Sbjct  314   S-EPSPGQGTIENIPHTPVHIWTGDKPRQKNGEDMGNFYSAGLDPIFYCHHANVDRMWNE  372

Query  1217  WKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             WK +GG R+D+TD DWL +EF FYDE +   +VKV D LD+ K+G+ +  MPTPW++FKP
Sbjct  373   WKLIGGKRRDLTDKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPMPTPWRNFKP  432

Query  1397  TrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDLH-LAF  1558
              RK  +   + AS++  + V P A L++  +F +TR  +S+T      +EE+L  + +++
Sbjct  433   IRKSSSGKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKISY  492

Query  1559  DDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAIS  1738
             DD  ++RFDVF+N D  VN  ELD+ E+AGS+++L HVH   +    S     TF LAI+
Sbjct  493   DDRNYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGSNTNHVTSV----TFKLAIT  548

Query  1739  elledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             ELLED+ LE++D I VTLVP+AGG  V++     ++ DC
Sbjct  549   ELLEDIGLEDEDTIAVTLVPKAGGEEVSIESVEIKLEDC  587



>sp|Q08307.1|PPOE_SOLLC RecName: Full=Polyphenol oxidase E, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78299.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=587

 Score =   516 bits (1330),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 296/579 (51%), Positives = 389/579 (67%), Gaps = 36/579 (6%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       RR    K+ C A + +  +NP         +DRRNVLLGLGGLYGA N
Sbjct  36    QLFLH------GRRNQSFKVSCNANNVD--KNPD-------AVDRRNVLLGLGGLYGAAN  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +A    P A A+PIPPP+ KSCG A +    G  V YSCCP    D  S  YYK PS +K
Sbjct  81    LA----PLATAAPIPPPDLKSCGTAHVKE--GVDVIYSCCPPVPDDIDSVPYYKFPSMTK  134

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L +RP AHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  
Sbjct  135   LRIRPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKVGGKEL  194

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LY
Sbjct  195   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DREGSSLY  253

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D+KRNQ HR G + DL + G+E      Q + NNL +MYRQM+TNAPCP  FFG A    
Sbjct  254   DEKRNQNHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYPLG  313

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
             + +  PG GTIEN+PH  +H W GD PR  + E+MGNFYSA +DP+FYCHH+NVDRMW  
Sbjct  314   S-EPSPGQGTIENIPHTPVHIWTGDKPRQKNGEDMGNFYSAGLDPIFYCHHANVDRMWNE  372

Query  1217  WKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             WK +GG R+D+TD DWL +EF FYDE +   +VKV D LD+ K+G+ +  MPTPW++FKP
Sbjct  373   WKLIGGKRRDLTDKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYAPMPTPWRNFKP  432

Query  1397  TrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDLH-LAF  1558
              RK  +   + AS++  + V P A L++  +F +TR  +S+T      +EE+L  + +++
Sbjct  433   IRKSSSGKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKISY  492

Query  1559  DDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAIS  1738
             DD  ++RFDVF+N D  VN  ELD+ E+AGS+++L HVH   +    S     TF LAI+
Sbjct  493   DDRNYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGSNTNHVTSL----TFKLAIT  548

Query  1739  elledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             ELLED+ LE++D I VTLVP+AGG  V++     ++ DC
Sbjct  549   ELLEDIGLEDEDTIAVTLVPKAGGEEVSIESVEIKLEDC  587



>ref|XP_009590067.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   516 bits (1330),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 298/582 (51%), Positives = 393/582 (68%), Gaps = 39/582 (7%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       +R    K  C A S        D +  EA +DRRNVLLGLGGLYGA N
Sbjct  34    QLFLH------GKRNQNFKFSCNANS--------DKNNLEA-VDRRNVLLGLGGLYGAAN  78

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +A    P A A+PIPPP+ KSC  A I++     V YSCCP    D  S  YYK  S  K
Sbjct  79    LA----PLATAAPIPPPDLKSCSKAHINDKT--EVSYSCCPPIPSDMDSVPYYKFSSMPK  132

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L +RPAAHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  
Sbjct  133   LRIRPAAHAADEEYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKEL  192

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LY
Sbjct  193   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMF-DREGSSLY  251

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D+KRNQ+HR G + DL + GQE   +  Q++ NNL IMYRQM+TNAPCPLLFFG+     
Sbjct  252   DEKRNQSHRNGTIIDLGHFGQEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLG  311

Query  1040  TGDTGPGMGTIENVPHNSIHRWVG----DPRSPHNENMGNFYSAAIDPVFYCHHSNVDRM  1207
             T D  PGMGTIEN+PH  +H WVG    +  + H E+MGNFYSA +DP+FY HH+NVDRM
Sbjct  312   T-DPSPGMGTIENIPHTPVHIWVGSRLDENNTKHGEDMGNFYSAGLDPLFYSHHANVDRM  370

Query  1208  WTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKD  1387
             W+ WK LGG R+D+T  DWL +EF FYDE +   +VKV D LD+ K+G+ +  MPTPW++
Sbjct  371   WSEWKALGGKRRDLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRN  430

Query  1388  FKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDL-H  1549
             FKP RK  A   + +SV  ++ V P + L++  +F + R  +S+T      +EE+L   +
Sbjct  431   FKPIRKSNAGKVNLSSVPPASRVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNN  490

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSL  1729
             + +DD+++IRFDVF+N D  VN  ELD+ EYAGS+++L HVH D  +   S     TF L
Sbjct  491   IKYDDSKYIRFDVFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSV----TFQL  546

Query  1730  AISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             AI+ELLED+ LE++D I VT+VP+ GG  +++     ++++C
Sbjct  547   AITELLEDIGLEDEDTIAVTVVPKKGGEEISIEAVEIKLVNC  588



>ref|XP_009767375.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=591

 Score =   516 bits (1329),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 306/615 (50%), Positives = 409/615 (67%), Gaps = 37/615 (6%)
 Frame = +2

Query  47    AMATSTHPISSTKNISFIstnsssprnfsrrpsQIFLNPNPSRAARRGDVIKIRCAAASS  226
             A ++ST P+ + K  S   TN+++  +F  +PSQ+FL+       +R    K  C A S 
Sbjct  2     ASSSSTLPLCANKTPSSSFTNTNTNSSFFAKPSQLFLH------GKRNQNFKFSCNANSG  55

Query  227   EGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATI  406
             E  +N          +DRRNVLLGLGGLYGA N+A    P A A+PIP P+ KSC  A I
Sbjct  56    EHDKN-------LDAVDRRNVLLGLGGLYGAANLA----PLATAAPIPSPDLKSCSKAHI  104

Query  407   SNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKD  586
             ++   + V YSCCP    D  S   YK PS  KL +RPAAHA D++Y+ KY+ A  +M++
Sbjct  105   NDK--EEVSYSCCPPIPSDMDSVPCYKFPSMPKLRIRPAAHAADEEYIAKYQLATSRMRE  162

Query  587   LPSD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHRWYLYFYERILQSLI  760
             L  D  DP  F QQAN+HCAYCNGAY++ GK  Q+HF+WLFFPFHRWYLYFYERIL SLI
Sbjct  163   LDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLI  222

Query  761   DDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASD  940
             +DPTF LPYWNWD+P+GM +P +F D E S LYD +RNQ+HR G + DL + G E   + 
Sbjct  223   NDPTFGLPYWNWDHPKGMRIPPMF-DREGSSLYDARRNQSHRNGTIIDLGFFGTEVQTTQ  281

Query  941   FQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVG---  1111
              Q++ NNL IMYRQM+TNAPCPLLFFG+     T D  PGMGTIEN+PH  +H WVG   
Sbjct  282   LQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGT-DPSPGMGTIENIPHTPVHIWVGSRP  340

Query  1112  -DPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFY  1288
              +    H E+MGNFYSA +DP+FY HH+NVDRMW+ WK LGG R+D+T  DWL +EF FY
Sbjct  341   DENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEWKALGGKRRDLTHKDWLNSEFFFY  400

Query  1289  DETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTSVLP-A  1465
             DE +   +VKV D LD+ K+G+ +  MPTPW++FKP RK  A   + +SV  ++ V P +
Sbjct  401   DENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSNAGKVNLSSVPPASKVFPLS  460

Query  1466  TLNKITTFCVTRSPTSKTPG----KEELLDL-HLAFDDTQFIRfdvfvnedddvnTKELD  1630
              L++  +F + R  +S+T      +EE+L   ++ +DD+++IRFDVF+N D  VN  ELD
Sbjct  461   KLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDSKYIRFDVFLNVDKTVNADELD  520

Query  1631  RVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGG  1810
             + EYAGS+++L HVH D  +   S     TF LAI+ELLED+ LE++D I VT+VP+ GG
Sbjct  521   KAEYAGSYTSLPHVHGDNVSHVTSV----TFQLAITELLEDIGLEDEDTIAVTVVPKTGG  576

Query  1811  SFVTVNKAYTEIIDC  1855
               +++     +++DC
Sbjct  577   EEISIEGVEIKLVDC  591



>sp|Q08296.1|PPOF_SOLLC RecName: Full=Polyphenol oxidase F, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78300.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=585

 Score =   516 bits (1329),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 290/572 (51%), Positives = 387/572 (68%), Gaps = 31/572 (5%)
 Frame = +2

Query  167   PSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNP  346
             P    RR    K+ C            D +L    +DRRNVLLGLGG YGA N+A    P
Sbjct  36    PFLHGRRCQSFKVSCNVGEH-------DKNLD--AVDRRNVLLGLGGFYGAANLA----P  82

Query  347   FALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
              A A+PIPPP+ KSCG A I +  G  V YSCCP    D  S  YYK P  +KL +RP A
Sbjct  83    LASAAPIPPPDLKSCGVAHIDDK-GTEVSYSCCPPVPDDIDSVPYYKFPPMTKLRIRPPA  141

Query  527   HAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWL  700
             HA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  Q+HF+WL
Sbjct  142   HAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWL  201

Query  701   FFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQA  880
             FFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LYD+KRNQ 
Sbjct  202   FFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DREGSSLYDEKRNQN  260

Query  881   HRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPG  1060
             HR G + DL + G++      Q + NNL +MYRQM+TNAPCP  FFG  +     D  PG
Sbjct  261   HRNGTIIDLGHFGKDVRTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAPL---GSDPEPG  317

Query  1061  MGTIENVPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN  1237
             MGTIEN+PH  +H W GD PR  H E+MGNFYSA +DP+FYCHH+NVDRMW  WK +GG 
Sbjct  318   MGTIENIPHTPVHIWTGDSPRQGHGEDMGNFYSAGLDPLFYCHHANVDRMWNEWKLIGGK  377

Query  1238  RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrak  1417
             R+D+++ DWL +EF FYDE +   +VKV D LD+ K+G+ +  MPTPW++FKP R+  + 
Sbjct  378   RRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFDYPPMPTPWRNFKPIRRSSSG  437

Query  1418  lrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDLH-LAFDDTQFIR  1579
               + AS++  + V P A L++  +F +TR  +S+T      ++E+L  + +A+DDT+++R
Sbjct  438   KVNTASIAPVSKVFPLAKLDRAISFSLTRPASSRTTQEKNEQQEILTFNKMAYDDTKYVR  497

Query  1580  fdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlr  1759
             FDVF+N D  VN +ELD+ E+AGS+++L HVH +     ++ +K  TF+LAI+ELLED+ 
Sbjct  498   FDVFLNVDKTVNAEELDKAEFAGSYTSLPHVHGNN----DNHVKDVTFTLAITELLEDIG  553

Query  1760  lenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             LE++D I VTLVP+ GG  V++     ++ DC
Sbjct  554   LEDEDTIAVTLVPKVGGEGVSIESVEIKLEDC  585



>gb|AAB22610.1| polyphenoloxidase (chloroplast) [Solanum lycopersicum]
Length=587

 Score =   515 bits (1326),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 295/579 (51%), Positives = 388/579 (67%), Gaps = 36/579 (6%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       RR    K+ C A + +  +NP         +DRRNVLLGLGGLYGA N
Sbjct  36    QLFLH------GRRNQSFKVSCNANNVD--KNPD-------AVDRRNVLLGLGGLYGAAN  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +A    P A A+PIPPP+ KSCG A +    G  V YSCCP    D  S  YYK PS +K
Sbjct  81    LA----PLATAAPIPPPDLKSCGTAHVKE--GVDVIYSCCPPVPDDIDSVPYYKFPSMTK  134

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L +RP AHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  
Sbjct  135   LRIRPPAHAADEEYVAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKVGGKEL  194

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LY
Sbjct  195   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DREGSSLY  253

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D+KRNQ HR G + DL + G+E      Q + NNL +MYRQM+TNAPCP  FFG A    
Sbjct  254   DEKRNQNHRNGTIIDLGHFGKEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYL-W  312

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
               +  PG GTIEN+PH  +H W GD PR  + E+MGNFYSA +DP+FYCHH+NVDRMW  
Sbjct  313   VLNPSPGQGTIENIPHTPVHIWTGDKPRQKNGEDMGNFYSAGLDPIFYCHHANVDRMWNE  372

Query  1217  WKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             WK +GG R+D+TD DWL +EF FYDE +   +VKV D LD+ K+G+ +  MPTPW++FKP
Sbjct  373   WKLIGGKRRDLTDKDWLNSEFFFYDENRNPYRVKVRDVLDSKKMGFDYAPMPTPWRNFKP  432

Query  1397  TrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDLH-LAF  1558
              RK  +   + AS++  + V P A L++  +F +TR  +S+T      +EE+L  + +++
Sbjct  433   IRKSSSGKVNTASIAPVSKVFPLAKLDRAISFSITRPASSRTTQEKNEQEEILTFNKISY  492

Query  1559  DDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAIS  1738
             DD  ++RFDVF+N D  VN  ELD+ E+AGS+++L HVH   +    S     TF LAI+
Sbjct  493   DDRNYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGSNTNHVTSV----TFKLAIT  548

Query  1739  elledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             ELLED+ LE++D I VTL+P+AGG  V++     ++ DC
Sbjct  549   ELLEDIGLEDEDTIAVTLIPKAGGEGVSIESVEIKLEDC  587



>ref|XP_009791071.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=600

 Score =   515 bits (1327),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 306/582 (53%), Positives = 381/582 (65%), Gaps = 30/582 (5%)
 Frame = +2

Query  161   PNPSRAARRGD---VIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+   RG      K+ C    S G EN    ++    +DRRNVLLGLGGLYGA N+ 
Sbjct  32    PKPSQLFLRGKRNHSFKVSCKV--SNGDEN---KTVEANSVDRRNVLLGLGGLYGASNVV  86

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTL-MDTASADYYKIPSFSKL  508
                 P A A+PIP P T SC     +   G PVPYSCCP  L +D     YYK P+ SKL
Sbjct  87    ----PLASATPIPAPTT-SCSKTGATIKPGVPVPYSCCPPPLKIDPKDIPYYKFPTGSKL  141

Query  509   NVRPAAHAIDDDYLEKYKTAIQKMKDLP---SDDPRNFYQQANVHCAYCNGAYQLAGKPY  679
              +RPA+HA+D++Y+ KY  AI KMK+L     DDPR F  QA +HCAYCNGAY +AGK  
Sbjct  142   RIRPASHAVDEEYMAKYNLAITKMKELDVTDPDDPRGFTAQAKIHCAYCNGAYTVAGKEL  201

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESP-L  856
             QIHF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM LP +FD     P L
Sbjct  202   QIHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRLPHMFDQPNVYPDL  261

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD +RNQ HR   + DL + GQ+   +D Q + NNL +MYRQM+TN+PCP LFFGK    
Sbjct  262   YDPRRNQEHRGSVIMDLGHFGQDVKGTDLQMMSNNLTLMYRQMITNSPCPQLFFGKPYCT  321

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHN----ENMGNFYSAAIDPVFYCHHSNVDR  1204
             E G   PG G IEN+PH  +H WVG   + +N    E+MGNFYSA  DP FY HH+NVDR
Sbjct  322   EVGPK-PGQGAIENIPHTPVHIWVGSKPNENNCKNGEDMGNFYSAGKDPAFYSHHANVDR  380

Query  1205  MWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWK  1384
             MWTIWKTLGG RKDI  PD+L TEF FYDE K    VKV D LDN K+GY FQ MPTPW+
Sbjct  381   MWTIWKTLGGKRKDINKPDYLNTEFFFYDEKKNPYLVKVRDCLDNKKMGYDFQAMPTPWR  440

Query  1385  DFKPTrkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTP----GKEELLD-LH  1549
             +FKP +K ++K+ +++  SA+ +   A ++K  TF + R  + +T      KEE+L  L 
Sbjct  441   NFKPLKKSKSKVNARSVQSATQTFPIAKIDKPITFSIKRETSGRTQQEKDAKEEMLTFLE  500

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSL  1729
             L  D  + IRFDVF+N D + N  ELDR E+AGS++ L HVH D S    + +    F L
Sbjct  501   LNIDQRKHIRFDVFINADANSNWHELDRAEFAGSYTALPHVHSDPSKPHVAPVA--KFQL  558

Query  1730  AISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             AI+ELLE++ LE++D I+VTLVP+ GG FV +  A   +  C
Sbjct  559   AITELLEEIGLEDEDDIVVTLVPKTGGEFVAIKSAVITLEAC  600



>gb|AGK83468.1| polyphenol oxidase [Nicotiana tabacum]
Length=590

 Score =   514 bits (1324),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 306/613 (50%), Positives = 408/613 (67%), Gaps = 37/613 (6%)
 Frame = +2

Query  53    ATSTHPISSTKNISFIstnsssprnfsrrpsQIFLNPNPSRAARRGDVIKIRCAAASSEG  232
             ++ST P+ + K  S   TN+++  +F  +PSQ+FL+       +R    K    A S E 
Sbjct  3     SSSTLPLCANKTPSSSFTNTNTNSSFFAKPSQLFLH------GKRNQNFKFSRNANSGEH  56

Query  233   RENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISN  412
              +N          +DRRNVLLGLGGLYGA N+A    P A A+PIPPP+ KSC  A I++
Sbjct  57    DKN-------LDAVDRRNVLLGLGGLYGAANLA----PLATAAPIPPPDLKSCSKAHIND  105

Query  413   SNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLP  592
                + V YSCCP    D  S  YYK PS  KL +RPAAHA D++Y+ KY+ A  +M++L 
Sbjct  106   K--EEVSYSCCPPIPSDMDSVPYYKFPSMPKLRIRPAAHAADEEYIAKYQLATSRMRELD  163

Query  593   SD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHRWYLYFYERILQSLIDD  766
              D  DP  F QQAN+HCAYCNGAY++ GK  Q+HF+WLFFPFHRWYLYFYERIL SLI+D
Sbjct  164   KDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWLFFPFHRWYLYFYERILGSLIND  223

Query  767   PTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQ  946
             PTF LPYWNWD+P+GM +P +F D E S LYD +RNQ+HR G + DL + G E   +  Q
Sbjct  224   PTFGLPYWNWDHPKGMRIPPMF-DREGSSLYDARRNQSHRNGTIIDLGFFGTEVQTTQLQ  282

Query  947   KVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVG----D  1114
             ++ NNL IMYRQM+TNAPCPLLFFG+     T D  PGMGTIEN+PH   H WVG    +
Sbjct  283   QMTNNLTIMYRQMITNAPCPLLFFGQPYPLGT-DPSPGMGTIENIPHTPAHIWVGSRPDE  341

Query  1115  PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDE  1294
                 H E+MGNFYSA +DP+FY HH+NVDRMW+ WK LGG R+D+T  DWL +EF FYDE
Sbjct  342   NNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEWKALGGKRRDLTHKDWLNSEFFFYDE  401

Query  1295  TKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTSVLP-ATL  1471
              +   +VKV D LD+ K+G+ +  MPTPW++FKP RK  A   + +SV  ++ V P + L
Sbjct  402   NRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSNAGKVNLSSVPPASKVFPLSKL  461

Query  1472  NKITTFCVTRSPTSKTPG----KEELLDL-HLAFDDTQFIRfdvfvnedddvnTKELDRV  1636
             ++  +F + R  +S+T      +EE+L   ++ +DD+++IRFDVF+N D  VN  ELD+ 
Sbjct  462   DRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDSKYIRFDVFLNVDKTVNADELDKA  521

Query  1637  EYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSF  1816
             EYAGS+++L HVH D  +   S     TF LAI+ELLED+ LE++D I VT+VP+ GG  
Sbjct  522   EYAGSYTSLPHVHGDNVSHVTSV----TFQLAITELLEDIGLEDEDTIAVTVVPKTGGEE  577

Query  1817  VTVNKAYTEIIDC  1855
             +++     +++DC
Sbjct  578   ISIEGVEIKLVDC  590



>ref|XP_006365391.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Solanum 
tuberosum]
Length=604

 Score =   513 bits (1320),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 293/543 (54%), Positives = 379/543 (70%), Gaps = 18/543 (3%)
 Frame = +2

Query  263   EAKLDRRNVllglgglygayniaggSN-PFALASPIPPPETKSCGPATISNSNGKPVPYS  439
               KLDRRNVLLGLGGLYGA N+ G +N PFAL +P+PPP+  +C  A++ +  G  VP+S
Sbjct  66    RGKLDRRNVLLGLGGLYGASNLIGVTNEPFALGAPVPPPDFSTCSTASLPD--GSQVPFS  123

Query  440   CCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQ  619
             CCP    D  +   YK+P+ SK+ +RPAAH +  +Y+ KY TAIQKMK L  DDP +F Q
Sbjct  124   CCPPLPKDLTNIPTYKLPNVSKVKIRPAAHNVTQEYITKYNTAIQKMKSLDKDDPLSFIQ  183

Query  620   QANVHCAYCNGAYQ---LAGKPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYW  790
             QAN+HCAYCN  Y+     G P Q+HF+WLFFPFHRWYLYF+ERIL SLI D TF LP+W
Sbjct  184   QANIHCAYCNSGYKELGFPGVPLQVHFSWLFFPFHRWYLYFFERILGSLIGDDTFALPFW  243

Query  791   NWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAI  970
             N+D+  GM  P +++D   S LYD  RNQ H    V DL +   +  ASD QK+ NNL +
Sbjct  244   NYDSQVGMQFPSLYNDVNSS-LYDPNRNQNHFPPNVIDLGFTTIDLDASDQQKINNNLTM  302

Query  971   MYRQMLTNAPCPLLFFGKAIRKETGDTGP--GMGTIENVPHNSIHRWVGDPRSPHNENMG  1144
             MYRQMLTNAPCP LFFG  IR   G   P  GMGTIENVPHNS+HRWVG+P +   ENMG
Sbjct  303   MYRQMLTNAPCPQLFFGNPIR---GGEQPIRGMGTIENVPHNSVHRWVGNPNNKFRENMG  359

Query  1145  NFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVE  1324
              FYSAA DP+FY HH+NVDRMWTIWKTLGGNR+D  D DWL + FLFYDE +TLVKV V+
Sbjct  360   TFYSAARDPIFYAHHANVDRMWTIWKTLGGNRRDFNDRDWLDSAFLFYDENRTLVKVTVQ  419

Query  1325  DSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTSVLPATLNKITTFCVTRS  1504
             D ++N KLGY ++ +P PWK++KP  +++   ++  +V  ST + P+TL K  +F + R 
Sbjct  420   DCINNEKLGYKYENVPIPWKNYKPVPRKQKLKKNPKNVKPSTEIFPSTLKKTLSFSIKRP  479

Query  1505  PTSKTPG----KEELLDL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAH  1669
               S+T      +EELL   ++ FD+ ++IRFDVF+NED+ V +K LDR EY GSF+NL H
Sbjct  480   KISRTQQDKDIEEELLVFNNMTFDENEYIRFDVFINEDEGVKSKVLDRTEYVGSFANLPH  539

Query  1670  VHKDTSTTANSTIKTP-TFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
             VH   + T +S+  TP   SLAISE+LEDL LE++++I+V +VP+ GG  +T+     + 
Sbjct  540   VHAAGNNTGSSSSGTPAVMSLAISEILEDLGLEDEEEIVVVVVPKFGGKEITIASVEIDT  599

Query  1847  IDC  1855
             + C
Sbjct  600   LAC  602



>ref|XP_004246041.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Solanum 
lycopersicum]
Length=589

 Score =   511 bits (1317),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 303/583 (52%), Positives = 395/583 (68%), Gaps = 27/583 (5%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLS-EAKLDRRNVllglgglygay  322
             +IF+ P      +R D  K+ C   +S    +  +   S   KLDRRNVLLGLGGLYGA 
Sbjct  19    KIFIRP------KRIDNFKVNCEIKNSNTINDDDNEGKSFPGKLDRRNVLLGLGGLYGAS  72

Query  323   niaggSN-PFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSF  499
             N+ G  N PFAL +P+PPP+  +C  A++ +  G  VP+SCCP    D  +   YK+P+ 
Sbjct  73    NLIGVPNEPFALGAPVPPPDFSTCSTASLPD--GSQVPFSCCPPLPKDLTNIPTYKLPNV  130

Query  500   SKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQ---LAG  670
             SK+ +RPAAH +  +Y+ KY TAIQKMK L  DDP +F QQAN+HCAYCN  Y+     G
Sbjct  131   SKVKIRPAAHNVTQEYITKYNTAIQKMKSLDKDDPLSFIQQANIHCAYCNSGYKELGFPG  190

Query  671   KPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEES  850
              P Q+HF+WLFFPFHRWYLYF+ERIL SLI D TF LP+WN+D+  GM LP +++D   S
Sbjct  191   VPLQVHFSWLFFPFHRWYLYFFERILGSLIGDDTFALPFWNYDSQVGMQLPSLYND-VNS  249

Query  851   PLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAI  1030
             PLYD  RNQ H    V DL +   +  ASD QK+ NNL +MYRQMLTNAPCP LFFG  I
Sbjct  250   PLYDPNRNQNHFPPNVVDLGFTTIDLDASDQQKINNNLTMMYRQMLTNAPCPQLFFGNPI  309

Query  1031  RKETGDTGP--GMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDR  1204
             R   G   P  GMGTIENVPHNS+HRWVG+P +   ENMG FYSAA DP+FY HH+NVDR
Sbjct  310   R---GGEQPIRGMGTIENVPHNSVHRWVGNPNNKFRENMGTFYSAARDPIFYAHHANVDR  366

Query  1205  MWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWK  1384
             MWTIWKTLGGNR+D  D DWL + FLFYDE +TLVKV V+D ++N KLGY +Q +P PWK
Sbjct  367   MWTIWKTLGGNRRDYNDRDWLDSAFLFYDENRTLVKVTVQDCINNEKLGYKYQNVPIPWK  426

Query  1385  DFKPTrkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPG----KEELLDL-H  1549
             ++KP  +++   ++  +V  ST + P+TL K  +F + R   S+T      +EELL   +
Sbjct  427   NYKPVPRKQKVKKNPKNVKPSTEIFPSTLKKTLSFSIKRPNISRTQQDKDIEEELLVFNN  486

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTP-TFS  1726
             + FD+ ++IRFDVF+NED+ V  K LDR EY GSF+NL HVH   + +++S+  TP   S
Sbjct  487   MTFDENEYIRFDVFINEDEGVKAKVLDRTEYVGSFANLPHVH--AAGSSSSSSGTPAVMS  544

Query  1727  LAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             L ISE+LEDL LE++++I+V +VP++GG  +T+       + C
Sbjct  545   LGISEILEDLGLEDEEEIVVVVVPQSGGKEITIGSVEINTLAC  587



>gb|ADY18410.1| chloroplast polyphenol oxidase precursor, partial [Solanum melongena]
Length=584

 Score =   510 bits (1313),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 261/504 (52%), Positives = 346/504 (69%), Gaps = 20/504 (4%)
 Frame = +2

Query  377   ETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEK  556
             E K+CG A ++++ G+ V YSCCP    D  S  YYK PS +KL +RP AHA+D++Y+ K
Sbjct  90    ELKTCGRAVVNDTTGELVKYSCCPPIPDDIDSVPYYKFPSMTKLRIRPPAHAVDEEYIAK  149

Query  557   YKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHRWYLY  730
             Y+ A  +M++L  D   P  F QQAN+HCAYCNGAY+  GK  Q+HF+WLFFPFHRWYLY
Sbjct  150   YQLATSQMRELDKDPFGPIGFKQQANIHCAYCNGAYKAGGKELQVHFSWLFFPFHRWYLY  209

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYERIL SLI+DPTF LPYWNWD+P+GM LP +FD  E S LYD KRNQ+HR G + DL 
Sbjct  210   FYERILGSLINDPTFALPYWNWDHPKGMRLPPMFDV-EGSSLYDAKRNQSHRNGKIIDLG  268

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHN  1090
             + GQET  ++ Q + NNL +MYRQM+TNAPCPLLFFG      T D  PGMGTIEN+PH 
Sbjct  269   FFGQETETTELQTMTNNLTLMYRQMVTNAPCPLLFFGNPYPLGT-DPKPGMGTIENIPHT  327

Query  1091  SIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWL  1267
              +H W GD PR P+ E+MGNFYSA +DPVFYCHH+NVDRMW  WK +GG R+D+ D DWL
Sbjct  328   PVHIWTGDSPRQPNGEDMGNFYSAGLDPVFYCHHANVDRMWNEWKAIGGKRRDLADKDWL  387

Query  1268  QTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsas  1447
              +EF FYDE +   KVKV D LD+ K+G+ +  MPTPW++FKP R+  +   +  S+  +
Sbjct  388   NSEFFFYDENRNPFKVKVRDCLDSKKMGFDYAPMPTPWRNFKPVRRTTSGKANTRSIPPA  447

Query  1448  TSVLPATLNKITTFCVTRSPT----SKTPGKEELLDL---HLAFDDTQFIRfdvfvnedd  1606
             + V P    + + F   R  +    SK    E+  D     + +DD+Q++RFDVF+N D 
Sbjct  448   SKVFPTCETRQSDFIFHRQTSFVKDSKAEKNEQEGDTNIRQIQYDDSQYVRFDVFLNVDK  507

Query  1607  dvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTP-TFSLAISelledlrlenddKIL  1783
              V   ELD+ E+AGS+++L HVH D         + P TF LAI+ELLED  LE+++ I+
Sbjct  508   TVKALELDQPEFAGSYTSLPHVHGDKD-------RAPVTFKLAITELLEDNNLEDEESIV  560

Query  1784  VTLVPRAGGSFVTVNKAYTEIIDC  1855
             +TL+P+AGG  +++  A  +++DC
Sbjct  561   ITLIPKAGGDGISIQNAVIDLVDC  584



>gb|ABE96885.1| polyphenol oxidase [Nicotiana tabacum]
Length=502

 Score =   507 bits (1305),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 267/510 (52%), Positives = 353/510 (69%), Gaps = 20/510 (4%)
 Frame = +2

Query  362   PIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDD  541
             PIPPP+ KSC  A I++     V YSCCP    D  S  YYK PS  KL +RPAAHA D+
Sbjct  1     PIPPPDLKSCSKAHINDK--AEVSYSCCPPIPSDMDSVPYYKFPSMPKLRIRPAAHAADE  58

Query  542   DYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFH  715
             +Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  Q+HF+WLFFPFH
Sbjct  59    EYIAKYQLATSRMRELDKDPFDPLGFKQQANIHCAYCNGAYKIGGKELQVHFSWLFFPFH  118

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             RWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LYD +RNQ+HR G 
Sbjct  119   RWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRIPPMF-DREGSSLYDARRNQSHRNGT  177

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIE  1075
             + DL + G E   +  Q++ NNL IMYRQM+TNAPCPLLFFG+     T D  PGMGTIE
Sbjct  178   IIDLGFFGTEVQTTQLQQMTNNLTIMYRQMITNAPCPLLFFGQPYPLGT-DPSPGMGTIE  236

Query  1076  NVPHNSIHRWVG----DPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRK  1243
             N+PH  +H WVG    +    H E+MGNFYSA +DP+FY HH+NVDRMW+ WK LGG R+
Sbjct  237   NIPHTPVHIWVGSRPDENNVKHGEDMGNFYSAGLDPLFYSHHANVDRMWSEWKALGGKRR  296

Query  1244  DITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklr  1423
             D+T  DWL +EF FYDE +   +VKV D LD+ K+G+ +  MPTPW++FKP RK  A   
Sbjct  297   DLTHKDWLNSEFFFYDENRNPFRVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKSNAGKV  356

Query  1424  skasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDL-HLAFDDTQFIRfd  1585
             + +SV  ++ V P + L++  +F + R  +S+T      +EE+L   ++ +DD+++IRFD
Sbjct  357   NLSSVPPASKVFPLSKLDRAISFSIDRPSSSRTQQEKNEQEEMLTFNNIKYDDSKYIRFD  416

Query  1586  vfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrle  1765
             VF+N D  VN  ELD+ EYAGS+++L HVH D  +   S     TF LAI+ELLED+ LE
Sbjct  417   VFLNVDKTVNADELDKAEYAGSYTSLPHVHGDNVSHVTSV----TFQLAITELLEDIGLE  472

Query  1766  nddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             ++D I VT+VP+ GG  +++     +++DC
Sbjct  473   DEDTIAVTVVPKTGGEEISIEGVEIKLVDC  502



>ref|XP_009624738.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=601

 Score =   508 bits (1307),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 301/582 (52%), Positives = 378/582 (65%), Gaps = 29/582 (5%)
 Frame = +2

Query  161   PNPSRAARRGD---VIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+   RG      K+ C    S G EN   S  +   +DRRNVLLGLGGLYGA N+ 
Sbjct  32    PKPSQLFLRGKRNHSFKVSCKV--SNGDEN--QSVETNNSVDRRNVLLGLGGLYGAANVV  87

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTL-MDTASADYYKIPSFSKL  508
                 P A A+PIP P T SC     +   G PVPYSCCP  L +D     +Y  P+ SKL
Sbjct  88    ----PLASATPIPAPTT-SCSKTGATIKPGLPVPYSCCPPPLKIDPKDIPHYTFPTGSKL  142

Query  509   NVRPAAHAIDDDYLEKYKTAIQKMKDLP---SDDPRNFYQQANVHCAYCNGAYQLAGKPY  679
              +RPA+HA+D++Y+ KY  AI KMK+L     DDPR F  QA +HCAYCNGAY +AGK  
Sbjct  143   RIRPASHAVDEEYMAKYNLAITKMKELDVTDPDDPRGFAAQAKIHCAYCNGAYTVAGKEL  202

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESP-L  856
             QIHF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM LP +FD     P L
Sbjct  203   QIHFSWLFFPFHRWYLYFYERILGSLINDPTFGLPYWNWDHPKGMRLPHMFDQPNVYPDL  262

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD +RNQ HR   + DL + GQ+   +D Q + NNL +MYRQM+TN+PCP LFFGK    
Sbjct  263   YDPRRNQEHRGSVIMDLGHFGQDVKGTDLQMMSNNLTLMYRQMITNSPCPQLFFGKPYCT  322

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHN----ENMGNFYSAAIDPVFYCHHSNVDR  1204
             E G   PG G IEN+PH  +H WVG   + +N    E+MGNFYSA  DP FY HH+NVDR
Sbjct  323   EVGPK-PGQGAIENIPHTPVHIWVGSKPNENNCKNGEDMGNFYSAGKDPAFYSHHANVDR  381

Query  1205  MWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWK  1384
             MWTIWKTLGG RKDI  PD+L +EF FYDE K    VKV D LDN K+GY FQ MPTPW+
Sbjct  382   MWTIWKTLGGKRKDINKPDYLNSEFFFYDEKKNPFLVKVRDCLDNKKMGYDFQAMPTPWR  441

Query  1385  DFKPTrkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTP----GKEELLD-LH  1549
             +FKP +K ++K+ +++    + +   A ++K  TF + R  + +T      +EE+L  L 
Sbjct  442   NFKPLKKSKSKVNARSVPPVTQTFPIAKIDKAITFSIKRETSGRTQQEKDAEEEMLTFLE  501

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSL  1729
             L  D  + IRFDVF+N D + N  ELDR E+AGS++ L HVH D +    + I    F L
Sbjct  502   LNIDQRKHIRFDVFINADANSNWYELDRAEFAGSYTALPHVHSDPTKPHVAPIA--KFQL  559

Query  1730  AISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             AI+ELLE++ LE++D I+VTLVP+ GG FV +  A   +  C
Sbjct  560   AITELLEEIGLEDEDDIVVTLVPKTGGEFVAIKSAVITLEAC  601



>gb|ADY18412.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=584

 Score =   506 bits (1302),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 264/506 (52%), Positives = 352/506 (70%), Gaps = 17/506 (3%)
 Frame = +2

Query  365   IPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD  544
             IP P+ KSC  A I  +  K VPYSCCP    D  S  YYK P  +KL +RP AHA+D++
Sbjct  87    IPSPDPKSCSKAHIKPN--KEVPYSCCPPPPQDIDSVPYYKFPPMTKLRIRPPAHAVDEE  144

Query  545   YLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHR  718
             Y+ KY+ A  +M++L  D  DP  F QQAN+HC+YC GAY++ GK  Q+H +WLFFPFHR
Sbjct  145   YIAKYQLATSRMRELDKDPFDPLGFKQQANIHCSYCCGAYKVGGKVLQVHSSWLFFPFHR  204

Query  719   WYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYV  898
             W+LYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LYD+KRNQ HR G +
Sbjct  205   WFLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DHEGSSLYDEKRNQNHRNGKI  263

Query  899   TDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIEN  1078
              +L ++ +ET  ++ Q + NNL +MYRQM+TNAPCPLLFFG      T D  PGMGTIEN
Sbjct  264   INLGFSCKETQTTELQTMTNNLTLMYRQMVTNAPCPLLFFGNPYPLGT-DPKPGMGTIEN  322

Query  1079  VPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITD  1255
             +PHN++H W GD PR P+ E+MG FYSA +DPVFY HH+NVDRMW  WK +GG R+D+ D
Sbjct  323   IPHNAVHNWTGDQPRQPNGEHMGTFYSAGLDPVFYSHHANVDRMWNEWKAIGGKRRDLAD  382

Query  1256  PDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskas  1435
              DWL +EF FYDE +   KVKV D LD+ K+G+ +  MPTPW++FKP RK  +   +  S
Sbjct  383   KDWLNSEFFFYDENRNPFKVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKTTSGKANIGS  442

Query  1436  vsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDLH-LAFDDTQFIRfdvfvn  1597
             +  ++ V P A L++  +F + RS +S+T      +EE+L  + + +DD+Q +RFDVF+N
Sbjct  443   IPPASKVFPIAKLDRAISFSINRSASSRTQAEKNEQEEILTFNKVQYDDSQCVRFDVFLN  502

Query  1598  edddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddK  1777
              D  VN  ELD+ E+AGS+++L HVH D +T   S     TF L I+ELLED+ LE++D 
Sbjct  503   VDKTVNADELDKPEFAGSYTSLPHVHGDNNTHVTSV----TFKLVITELLEDIGLEDEDT  558

Query  1778  ILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             I VTLVP+ GG  +++  A   ++DC
Sbjct  559   IAVTLVPKEGGEGISIENAEIVLMDC  584



>ref|XP_009588337.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=596

 Score =   494 bits (1271),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 286/575 (50%), Positives = 375/575 (65%), Gaps = 30/575 (5%)
 Frame = +2

Query  179   ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALA  358
              +R    K+ C   + E   N  D+ + E  +DRRNVLLGLGGLYGA N+A    P A A
Sbjct  35    GKRNQCFKVSC---TGEHDGNQLDA-IKEGAVDRRNVLLGLGGLYGAANLA----PLASA  86

Query  359   SPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAID  538
             +P+PPP+ KSCG ATI++  G  VPYSCCP    D  S  YYKIP  SKL  RPAA  + 
Sbjct  87    APVPPPDQKSCGTATITD--GPAVPYSCCPPKPDDMDSVPYYKIPRMSKLRKRPAAQNVT  144

Query  539   DDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPF  712
             ++Y+ KY+ A  KMK+L  D  DP  F QQAN+HCAYCN AY +  +  Q+H +WLFFPF
Sbjct  145   EEYIAKYQLATSKMKELDKDQFDPLGFKQQANIHCAYCNDAYTMGDQKLQVHESWLFFPF  204

Query  713   HRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRG  892
             HRWYLYFYERIL SLIDDPTF LPYWNWD+P GM LP +F D E S LYD +RN   R G
Sbjct  205   HRWYLYFYERILGSLIDDPTFALPYWNWDHPSGMRLPPMF-DVEGSSLYDARRNPQVRNG  263

Query  893   YVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTI  1072
              + DL + G E   ++ Q + NNL +MYRQM+TNAPCPLLFFG+  R  +    PG GTI
Sbjct  264   TIIDLGFFGDEVKTNEIQMITNNLLLMYRQMITNAPCPLLFFGEPYRFGS-KPNPGQGTI  322

Query  1073  ENVPHNSIHRWVGDPR--------SPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL  1228
             EN+PH  +H W G  R          + E+MGNFYSA +DPVFYCHH+NVDRMW  WK L
Sbjct  323   ENIPHTPVHIWTGTVRDTDLGNGVKSYGEDMGNFYSAGLDPVFYCHHANVDRMWNEWKAL  382

Query  1229  GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkr  1408
             GG R+D+TD DWL +EF FYDE +   +VKV D LD+ K+GY ++   TPW++FKP +K 
Sbjct  383   GGKRRDLTDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPTSTPWRNFKPGKKS  442

Query  1409  raklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPGKEELLDLHLAF-----DDTQ  1570
                  + +S+  ++ V P + L++   F + R  TS++  +++ L+  L F     DD++
Sbjct  443   TEGKVNLSSIKPASKVFPLSNLDRAICFSIERPATSRSQQEKDELEEILTFKGVKYDDSK  502

Query  1571  FIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelle  1750
             +IRFDVF+N D  VN  ++++ EYAGS+++L HVH   + T     K   F LAI+ELLE
Sbjct  503   YIRFDVFLNADKTVNADDINKREYAGSYTSLPHVHGPNNAT--HEFKPKEFKLAITELLE  560

Query  1751  dlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             D  LE++D I VT+VP+ GG  V+++    E+ DC
Sbjct  561   DCGLEDEDIIAVTVVPKKGGEVVSIDNVEIELKDC  595



>ref|XP_009771442.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
sylvestris]
Length=596

 Score =   493 bits (1270),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 291/586 (50%), Positives = 378/586 (65%), Gaps = 36/586 (6%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
              +FLN       +     K+ C   + E   N  D+ + E  +DRRNVLLGLGGLYGA N
Sbjct  30    HLFLN------GKGNQSFKVSC---TGEHDGNQLDA-VKEGAVDRRNVLLGLGGLYGATN  79

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +A    P A A+P+PPP+ KSCGPATI++  G  VPYSCCP T  D  S  YYKIP  SK
Sbjct  80    LA----PLASAAPVPPPDLKSCGPATITD--GPTVPYSCCPPTPDDMDSVPYYKIPRMSK  133

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L  RP A  + ++Y+ KY+ A  KM++L  D  DP  F QQAN+HCAYCN AY +  +  
Sbjct  134   LRKRPPAQDVSEEYIAKYQLATSKMRELDKDPFDPLGFKQQANIHCAYCNDAYTMGDQKL  193

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+H +WLFFPFHRWYLYFYERIL SLIDDPTF LPYWNWD+P GM LP +F D E S LY
Sbjct  194   QVHQSWLFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDHPSGMRLPAMF-DVEGSSLY  252

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D +RN   R G + DL + G E   ++ Q + NNL +MYRQM+TNAPCPLLFFG+  R  
Sbjct  253   DARRNPHVRNGTIIDLGFFGDEVKTNEIQMITNNLILMYRQMITNAPCPLLFFGEPYRFG  312

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGDPRS--------PHNENMGNFYSAAIDPVFYCHHSN  1195
             +    PG GTIEN+PH  +H W G  R          + E+MGNFYSA +DPVFY HH+N
Sbjct  313   S-KPNPGQGTIENIPHTPVHIWTGTVRCTDLGNCVPSYGEDMGNFYSAGLDPVFYSHHAN  371

Query  1196  VDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPT  1375
             VDRMW  WK LGG R+D+TD DWL +EF FYDE +   +VKV D LD+ K+GY ++   T
Sbjct  372   VDRMWNEWKALGGKRRDLTDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPKAT  431

Query  1376  PWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPGK----EELL  1540
             PW++FKP +K      +  SV  ++ V P + L++   F + R  TS++       EE+L
Sbjct  432   PWRNFKPGKKTTPGKVNLRSVKPASKVFPLSNLDRAICFSIERPATSRSQQDKDEFEEVL  491

Query  1541  DL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTP  1717
                +L +DD+++I+FDVFVN D  VN  ++D+ EYAGS+++L HVH   S   N  ++  
Sbjct  492   TFKNLKYDDSKYIKFDVFVNADKTVNADDIDKKEYAGSYTSLPHVHGPNS--GNHAVEVQ  549

Query  1718  TFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
              F LAI+ELLED  LE++D I VT+VP+ GG  V++N    E+ DC
Sbjct  550   EFKLAITELLEDCGLEDEDIIAVTVVPKTGGEVVSINSVLIELKDC  595



>gb|AAA85122.1| polyphenol oxidase [Solanum tuberosum]
Length=599

 Score =   491 bits (1265),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 283/586 (48%), Positives = 379/586 (65%), Gaps = 36/586 (6%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C  ++S G +N    ++    +DRRNVLLGLGGLYG  N  
Sbjct  29    PKPSQLFLHGKRNKTFKVSCKVSNS-GDQN---QNIETNSVDRRNVLLGLGGLYGVANAI  84

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTL-MDTASADYYKIPSFSKL  508
               +   A A+PIP P+ K+CG ATIS+  G  VPY+CCP  +  +  +  YYK PS +KL
Sbjct  85    PLA---ASATPIPSPDLKTCGRATISD--GPLVPYTCCPPPMPTNFDTIPYYKFPSMTKL  139

Query  509   NVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPY  679
              +RP AHA+D++Y+ KY  AI +MKDL   DP N   F QQAN+HCAYCNGAY + GK  
Sbjct  140   RIRPPAHAVDEEYIAKYNLAISRMKDLDKTDPLNPLGFKQQANIHCAYCNGAYIIGGKEL  199

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+H +WLFFPFHRWYLYFYERIL  LIDDPTF LPYWNWD+P+GM LP +F D E + +Y
Sbjct  200   QVHNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWNWDHPKGMRLPPMF-DREGTSIY  258

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D++RNQ  R G V DL   G +   +  Q + NNL +MYRQM+TNAPCPLLFFG      
Sbjct  259   DERRNQQVRNGTVMDLGSFGDKVQTTQLQLMSNNLTLMYRQMVTNAPCPLLFFGAPY--V  316

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGDPR--------SPHNENMGNFYSAAIDPVFYCHHSN  1195
              G+     GTIEN+PH  +H W G  R        + + E+MGNFYSA +DPVFYCHH N
Sbjct  317   LGNNVEAPGTIENIPHIPVHIWAGTVRGSTFPNGDTSYGEDMGNFYSAGLDPVFYCHHGN  376

Query  1196  VDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPT  1375
             VDRMW  WK +GG R+D+++ DWL +EF FYDE K   +VKV D LD  K+GY +  MPT
Sbjct  377   VDRMWNEWKAIGGKRRDLSEKDWLNSEFFFYDENKKPYRVKVRDCLDAKKMGYDYAPMPT  436

Query  1376  PWKDFKPTrkrraklrskasvsasTSVLPAT-LNKITTFCVTRSPTSKTPG----KEELL  1540
             PW++FKP  K      +  ++     V P T ++K  +F + R  +S+T      +EE+L
Sbjct  437   PWRNFKPKTKASVGKVNTTTLPPVNKVFPLTKMDKAISFSINRPASSRTQQEKNEQEEML  496

Query  1541  DL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTP  1717
                ++ +D+  +IRFDVF+N D++VN  ELD+ E+AGS+++L HVH+      N    T 
Sbjct  497   TFDNIKYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHR---VGENDHTATV  553

Query  1718  TFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             TF LAI+ELLED+ LE+++ I VTLVP+ GG  +++     +++DC
Sbjct  554   TFQLAITELLEDIGLEDEETIAVTLVPKKGGEGISIENVEIKLLDC  599



>ref|XP_009616674.1| PREDICTED: polyphenol oxidase E, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=595

 Score =   491 bits (1264),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 288/586 (49%), Positives = 376/586 (64%), Gaps = 37/586 (6%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FLN       +R    K+ C      G  +    ++ E  +DRRNVLLGLGGLYGA N
Sbjct  30    QLFLN------GKRNQSFKVSCT-----GEHDGNLDAIKEGVVDRRNVLLGLGGLYGAAN  78

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +     P A A+P+PPP   SCG ATI++  G  VPYSCCP    D  S  YYKIP  SK
Sbjct  79    LV----PLASAAPVPPPNLNSCGTATITD--GPAVPYSCCPPKPDDMDSVPYYKIPRMSK  132

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L  RPAA  + ++Y+ KY+ A  KMK+L  D  DP  F QQAN+HCAYCN AY +  K  
Sbjct  133   LRKRPAAQNVTEEYIAKYQLATSKMKELDKDQLDPLGFKQQANIHCAYCNDAYTMGDKKL  192

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+H +WLFFPFHRWYLYFYERIL SLIDDPTF LPYWNWDNP GM LP +F D E S LY
Sbjct  193   QVHESWLFFPFHRWYLYFYERILGSLIDDPTFALPYWNWDNPSGMRLPYMF-DVEGSSLY  251

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D +RN   R G + DL + G E   ++ Q + NNL +MYRQM+TNAPCPLLFFG+  R  
Sbjct  252   DARRNPHVRNGTIIDLGFFGDEVKTNELQMITNNLILMYRQMITNAPCPLLFFGEPYRFG  311

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGDPRS--------PHNENMGNFYSAAIDPVFYCHHSN  1195
             + +  PGMGTIEN+PHN +H W G  R          + E+MGNFYS A+DPVF+CHH+N
Sbjct  312   S-NPEPGMGTIENIPHNPVHIWTGTVRGTDLGNGAKSYGEDMGNFYSTALDPVFFCHHAN  370

Query  1196  VDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPT  1375
             VDR+W  WK LGG R+D+ D DWL +EF FYDE +   +VKV D LD+ K+GY ++   T
Sbjct  371   VDRLWNEWKALGGKRRDLRDNDWLNSEFFFYDENRDPWRVKVRDCLDSKKMGYDYEPTAT  430

Query  1376  PWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPGK----EELL  1540
             PW++FKP +K  A   + +SV  ++ V P   L++   F + R  TS++  +    EE+L
Sbjct  431   PWRNFKPGKKSTAGKVNLSSVKPASKVFPLLNLDRAICFSIERPATSRSQQEKDEFEEIL  490

Query  1541  DLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTP  1717
                 + +DD+++IRFDVF+N D  VN  ++++ EYAGS+++L HVH   + T     K  
Sbjct  491   TFKGVKYDDSKYIRFDVFLNADKTVNADDINKREYAGSYTSLPHVHGPNNAT--HEFKPK  548

Query  1718  TFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
              F LAI+ELLED  LE++D I VT+VP+ GG  V+++     + DC
Sbjct  549   EFKLAITELLEDCGLEDEDIIAVTVVPKKGGEVVSIHSVEIVLKDC  594



>ref|XP_004246032.1| PREDICTED: polyphenol oxidase B, chloroplastic [Solanum lycopersicum]
 sp|Q08304.1|PPOB_SOLLC RecName: Full=Polyphenol oxidase B, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78296.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=596

 Score =   487 bits (1254),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 282/586 (48%), Positives = 376/586 (64%), Gaps = 38/586 (6%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C   ++ G ++  +S      +DRRNVLLGLGGLYG  N  
Sbjct  28    PKPSQLFLHGKRNKTFKVSCKVINNNGNQDETNS------VDRRNVLLGLGGLYGVANAI  81

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTL-MDTASADYYKIPSFSKL  508
               +   A A+PIP P+ K+CG ATIS+  G  VPYSCCP  +  +  +  YYK PS +KL
Sbjct  82    PLA---ASATPIPSPDLKTCGRATISD--GPLVPYSCCPPPMPTNFDTIPYYKFPSMTKL  136

Query  509   NVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPY  679
              +R  AHA+D++Y+ KY  AI +M+DL   +P N   F QQAN+HCAYCNGAY + GK  
Sbjct  137   RIRTPAHAVDEEYIAKYNLAISRMRDLDKTEPLNPLGFKQQANIHCAYCNGAYIIGGKEL  196

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+H +WLFFPFHRWYLYFYERIL  LIDDPTF LPYWNWD+P+GM LP +F D E S LY
Sbjct  197   QVHNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWNWDHPKGMRLPPMF-DREGSSLY  255

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D++RNQ  R G V DL   G +   +  Q + NNL +MYRQM+TNAPCPLLFFG      
Sbjct  256   DERRNQQVRNGTVLDLGSFGDKVETTQLQLMSNNLTLMYRQMVTNAPCPLLFFGAPY--V  313

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGDPRS--------PHNENMGNFYSAAIDPVFYCHHSN  1195
              G+     GTIE +PH  +H W G  R          + E+MGNFYSA +DPVFYCHH N
Sbjct  314   LGNNVEAPGTIETIPHIPVHIWAGTVRGSKFPNGDVSYGEDMGNFYSAGLDPVFYCHHGN  373

Query  1196  VDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPT  1375
             VDRMW  WK +GG R+DI++ DWL +EF FYDE K   +VKV D LD  K+GY +  MPT
Sbjct  374   VDRMWNEWKAIGGKRRDISEKDWLNSEFFFYDEHKNPYRVKVRDCLDTKKMGYDYAPMPT  433

Query  1376  PWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELL  1540
             PW++FKP  K      + +++  +  V P A ++K  +F + R  +S+T      +EE+L
Sbjct  434   PWRNFKPKSKASVGKVNTSTLPPANEVFPLAKMDKTISFAINRPASSRTQQEKNEQEEML  493

Query  1541  DL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTP  1717
                ++ +D+  +IRFDVF+N D++VN  ELD+ E+AGS+++L HVH+      N  I   
Sbjct  494   TFNNIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHR---AGENDHIAKV  550

Query  1718  TFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
              F LAI+ELLED+ LE++D I VTLVP+ GG  +++     +++DC
Sbjct  551   NFQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIENVEIKLVDC  596



>gb|ACN78382.1| polyphenol oxidase [Solanum quitoense]
Length=472

 Score =   483 bits (1242),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 253/469 (54%), Positives = 329/469 (70%), Gaps = 15/469 (3%)
 Frame = +2

Query  428   VPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--D  601
             V YSCCP    D  S  YYK PS +KL +RP AHA+D++Y+ KY+ A  +M+ L  D  D
Sbjct  10    VTYSCCPPIPEDIDSVPYYKFPSMTKLRIRPPAHAVDEEYIAKYQLATSRMRGLDKDPFD  69

Query  602   PRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTL  781
             P  F QQAN+HCAYCNGAY++ GK  Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF L
Sbjct  70    PLGFKQQANIHCAYCNGAYKVGGKELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFAL  129

Query  782   PYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNN  961
             PYWNWD+P+GM +P +FD  E S LYD+KRNQ HR G + DL + G+ET  +  Q + NN
Sbjct  130   PYWNWDHPKGMRIPPMFDV-EGSSLYDEKRNQNHRNGKIIDLGFFGKETQTTQLQTMTNN  188

Query  962   LAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENM  1141
             L +MYRQM+TNAPCP LFFG      T D  PGMGTIEN+PHN++H WVGDPR P+ E+M
Sbjct  189   LTLMYRQMITNAPCPSLFFGNPYPLGT-DPSPGMGTIENIPHNAVHVWVGDPRQPNGEDM  247

Query  1142  GNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKV  1321
             GNFYS+ ++P F+CHHSNVDRMW  WK +GG R+D+ D DWL TEFLFYDE + L +V+V
Sbjct  248   GNFYSSGLEPAFFCHHSNVDRMWNEWKAIGGKRRDLADKDWLNTEFLFYDENRKLFRVRV  307

Query  1322  EDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTS-VLPA-TLNKITTFCV  1495
              D LD+ K+G+ +  MPTPW++FKP+ ++    +   S     S V P   L++  +F +
Sbjct  308   RDCLDSKKMGFDYAPMPTPWRNFKPSIRKTTAGKLNTSSIPPVSKVFPIPKLDRPISFSI  367

Query  1496  TRSPTSKTPG----KEELLDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSN  1660
              R  +S+T      +EE+L  H +  +D  ++RFDVF+N D  VN  ELD+ E+AGS+++
Sbjct  368   NRPASSRTQAEKNEQEEMLTFHKIQHNDRLYVRFDVFLNVDKTVNALELDQPEFAGSYTS  427

Query  1661  LAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAG  1807
             L HVH D    A S     T SLAI+ELLED  LE+++ I+VTLVP+ G
Sbjct  428   LPHVHGDDKPHATSA----TLSLAITELLEDNNLEDEETIVVTLVPKVG  472



>gb|ADY18411.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=586

 Score =   478 bits (1229),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 259/502 (52%), Positives = 346/502 (69%), Gaps = 18/502 (4%)
 Frame = +2

Query  377   ETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEK  556
             + KSC  A I+    K V YSC P    D  S  YYK P  +KL +RP AHA+D++Y+ K
Sbjct  94    DLKSCSKAHINPD--KEVTYSCRPPIPQDIDSVPYYKFPPMTKLRIRPPAHAVDEEYIAK  151

Query  557   YKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHRWYLY  730
             Y+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++  K  Q+HF+WLFFPFH  ++ 
Sbjct  152   YQLATSRMRELGKDPFDPLGFKQQANIHCAYCNGAYKVGEKELQVHFSWLFFPFHMVFV-  210

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYERIL SLI+DPTF LPYWNWD+P+GM +P +FD  E S LYD+KRNQ HR G + DL 
Sbjct  211   FYERILGSLINDPTFALPYWNWDHPKGMRIPPMFDR-EGSSLYDEKRNQNHRNGKIIDLG  269

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHN  1090
             + G ET  ++ Q + NNL  MYRQM+TNAPCPLLFFG      T D  PGMGTIEN+PHN
Sbjct  270   FFGTETQTTELQTMTNNLTYMYRQMVTNAPCPLLFFGNPYPLGT-DPSPGMGTIENIPHN  328

Query  1091  SIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWL  1267
              +H W GD PR P+ E+MGNFYSA +DPVFYCHH+NVDRMW  WK +GG R+D+ D DWL
Sbjct  329   PVHIWTGDSPRQPNGEDMGNFYSAGLDPVFYCHHANVDRMWNEWKAIGGKRRDLADKDWL  388

Query  1268  QTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsas  1447
              +E  FYDE +   KVKV D LD+ K+G+ +  MPTPW++FKP RK  +   +  S+  +
Sbjct  389   NSESFFYDENRNPFKVKVRDCLDSKKMGFDYAPMPTPWRNFKPIRKTTSGKANIGSIPPA  448

Query  1448  TSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLDLH-LAFDDTQFIRfdvfvneddd  1609
             + V P A L++  +F + R  +S+T      +EE+L  + + +DD+Q++RFDVF+N D  
Sbjct  449   SKVFPIAKLDRAISFSINRPASSRTQAEKNEQEEILTFNKVKYDDSQYVRFDVFLNVDKT  508

Query  1610  vnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVT  1789
             VN  ELD+ E+AGS+++L HVH D +T   S     TF+LAI+ELLED+ LE++D I +T
Sbjct  509   VNADELDKAEFAGSYTSLPHVHGDNNTHVTSV----TFNLAITELLEDIGLEDEDTIALT  564

Query  1790  LVPRAGGSFVTVNKAYTEIIDC  1855
             LVP+ GG  ++++ A   ++DC
Sbjct  565   LVPKQGGEGISIDNAEIVLVDC  586



>gb|ACT22523.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=600

 Score =   474 bits (1221),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 281/620 (45%), Positives = 387/620 (62%), Gaps = 38/620 (6%)
 Frame = +2

Query  50    MATSTHPISSTKNISFIstnsssprnfsrrpsQIFLNPNPSRAARRGDVIKIRCAAASSE  229
             MA+  H  ++T   SFI + +S          Q+FL+       +R    K+ C   ++ 
Sbjct  1     MASVCHTSTATLKSSFIPSPNSLGSTPKPS--QLFLH------GKRNQAFKVSCKVTNNN  52

Query  230   GRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATIS  409
             G +N   + +    +DRRNVLLGLGGLYG  N    +   A A+PIP P   SCG ATIS
Sbjct  53    GDQN--QNVVDTNSVDRRNVLLGLGGLYGVANAIPLA---ASATPIPAPNAPSCGTATIS  107

Query  410   NSNGKPVPYSCCPSTL-MDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKD  586
             +  G  VPY+CCP  +  D     YYK PS +KL +R  AHA+D++ + KY  AI KM++
Sbjct  108   D--GPEVPYTCCPPGMPEDIEKILYYKFPSATKLRIRQPAHAVDEELIAKYNLAISKMRE  165

Query  587   LPSDD---PRNFYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHRWYLYFYERILQSL  757
             L + D   P  F QQAN+HCAYCNGAY++ GK  Q+H +WLFFPFHRWYLYFYERIL  L
Sbjct  166   LDTTDHFSPLAFKQQANIHCAYCNGAYKIGGKELQVHNSWLFFPFHRWYLYFYERILGKL  225

Query  758   IDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSAS  937
             IDDPTF LPYWNWD+P+GM LP IF D + + LYD++R+   R G V DL   G +   +
Sbjct  226   IDDPTFALPYWNWDHPKGMRLPPIF-DRQGTALYDERRSTQVRNGTVMDLGSFGDKVQTT  284

Query  938   DFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDP  1117
               Q + NNL +MYRQM+TNAPCPL    + +R       P   T+E +PH  +H WVG  
Sbjct  285   QLQLMSNNLTLMYRQMVTNAPCPLFILWRTLRSWEITLKP-QETVEVIPHIPVHIWVGTA  343

Query  1118  R--------SPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQT  1273
             R        + + E+MGNFYSA +DPVFYCHHSNVDRMW  WK +GG R+DI+  DWL +
Sbjct  344   RGSKFPDGSTSYGEDMGNFYSAGLDPVFYCHHSNVDRMWNEWKQIGGKRRDISQRDWLNS  403

Query  1274  EFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTS  1453
             EF F+DE K   +V+V D LD   +GY +  MPTPW++FKP  K  +   + ++   ++ 
Sbjct  404   EFFFFDENKNPYRVRVRDCLDTKTMGYDYAPMPTPWRNFKPKTKASSGKANTSAFPPASQ  463

Query  1454  VLP-ATLNKITTFCVTRSPTSKTPG----KEELLDL-HLAFDDTQFIRfdvfvnedddvn  1615
             V P A ++K+ TF + R  +S+T      KEE+L   ++ +D+ +++RFDVF+N D++VN
Sbjct  464   VFPLAKMDKVITFSIKRPASSRTQQEKNEKEEMLTFNNIKYDNREYVRFDVFLNVDNNVN  523

Query  1616  TKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLV  1795
               ELD+ E+AGS+++L HVH+ + T     + T T  LAI+ELLED+ LE++D I VTLV
Sbjct  524   ANELDKAEFAGSYTSLPHVHRASQT---DHVATATLQLAITELLEDIGLEDEDTIAVTLV  580

Query  1796  PRAGGSFVTVNKAYTEIIDC  1855
             P+ GG  +++      + DC
Sbjct  581   PKKGGEGISIEGVEISLADC  600



>gb|AFJ79639.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=594

 Score =   471 bits (1211),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 275/585 (47%), Positives = 371/585 (63%), Gaps = 32/585 (5%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C  +++ G +N   + + +  +DRRNVLLGLGG+YGA N A
Sbjct  22    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQN--QNEVEKNSVDRRNVLLGLGGMYGAANFA  79

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               +   A   P    +  SC  A I+ +  + V YSCC  T  D     YYK PS +KL 
Sbjct  80    PLAASAAPTPPP---DLSSCSIAKITET--EEVSYSCCAPTPDDLNKIPYYKFPSMTKLR  134

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQ  682
             +R  AHA D++Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY++  K  Q
Sbjct  135   IRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQ  194

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYFYERIL S+IDDPTF LPYWNWD+P+GM +P +F D E + LYD
Sbjct  195   VHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMF-DGEGTALYD  253

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKET  1042
             + RNQ+HR G V DL   G E   ++ Q + NNL +MYRQM+TNAPCP +FFG       
Sbjct  254   QVRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQMVTNAPCPRMFFGAPYV--L  311

Query  1043  GDTGPGMGTIENVPHNSIHRWVG--------DPRSPHNENMGNFYSAAIDPVFYCHHSNV  1198
             G+     GTIE +PH  +H W G        + R+ H ENMG+FYSA +DPVF+CHHSNV
Sbjct  312   GNNVEAPGTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHSNV  371

Query  1199  DRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTP  1378
             DRMW+ WK +GG R+DI+  DWL +EF FYDE     +VKV D LD  K+GY +  MPTP
Sbjct  372   DRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMPTP  431

Query  1379  WKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLD  1543
             W++FKP  K        +S+   + V P A L+K  +F + R  +S+T      +EE+L 
Sbjct  432   WRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEMLT  491

Query  1544  L-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
               ++ +D+  ++RFDVF+N D +VN  ELD+ E+AGS++NL HVH+    T +  + T T
Sbjct  492   FNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDH--VATAT  549

Query  1721  FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
               LAI+ELLED+ LE++D I VTLVP+ GG  +++  A   + DC
Sbjct  550   LQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  594



>gb|AFJ79643.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=595

 Score =   470 bits (1209),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 275/585 (47%), Positives = 370/585 (63%), Gaps = 32/585 (5%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C  ++S G +N   + + +  +DRRNVLLGLGG+YGA N A
Sbjct  23    PKPSQLFLHGKRKQTFKVSCKVSNSNGDQN--QNEVEKNSVDRRNVLLGLGGMYGAANFA  80

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               +   A   P    +  SC  A I+ +  + V YSCC  T  D     YYK PS +KL 
Sbjct  81    PLAASAAPTPPP---DLSSCSIAKITET--EEVSYSCCAPTPDDLNKIPYYKFPSMTKLR  135

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQ  682
             +R  AHA D++Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY++  K  Q
Sbjct  136   IRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQ  195

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYFYERIL S+IDDPTF LPYWNWD+P+GM +P +F D E + LYD
Sbjct  196   VHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMF-DGEGTALYD  254

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKET  1042
             + RNQ+HR G V DL   G E   ++ Q + NNL +MYRQM+TNAPCP +FFG       
Sbjct  255   QVRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQMVTNAPCPRMFFGAPYV--L  312

Query  1043  GDTGPGMGTIENVPHNSIHRWVG--------DPRSPHNENMGNFYSAAIDPVFYCHHSNV  1198
             G+     GTIE +PH  +H W G        + R+ H ENMG+FYSA +DPVF+CHHSNV
Sbjct  313   GNNVEAPGTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHSNV  372

Query  1199  DRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTP  1378
             DRMW+ WK +GG R+DI+  DWL +EF FYDE     +VKV D LD  K+GY +  MP P
Sbjct  373   DRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMPRP  432

Query  1379  WKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLD  1543
             W++FKP  K        +S+   + V P A L+K  +F + R  +S+T      +EE+L 
Sbjct  433   WRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEMLT  492

Query  1544  L-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
               ++ +D+  ++RFDVF+N D +VN  ELD+ E+AGS++NL HVH+    T +  + T T
Sbjct  493   FNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDH--VATAT  550

Query  1721  FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
               LAI+ELLED+ LE++D I VTLVP+ GG  +++  A   + DC
Sbjct  551   LQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  595



>gb|AFJ79640.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=595

 Score =   469 bits (1207),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 274/585 (47%), Positives = 370/585 (63%), Gaps = 32/585 (5%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C  +++ G +N   + + +  +DRRNVLLGLGG+YGA N A
Sbjct  23    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQN--QNEVEKNSVDRRNVLLGLGGMYGAANFA  80

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               +   A   P    +  SC  A I+ +  + V YSCC  T  D     YYK PS +KL 
Sbjct  81    PLAASAAPTPPP---DLSSCSIAKITET--EEVSYSCCAPTPDDLNKIPYYKFPSMTKLR  135

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQ  682
             +R  AHA D++Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY++  K  Q
Sbjct  136   IRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQ  195

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYFYERIL S+IDDPTF LPYWNWD+P+GM +P +F D E + LYD
Sbjct  196   VHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMF-DGEGTALYD  254

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKET  1042
             + RNQ+HR G V DL   G E   ++ Q + NNL +MYRQM+TNAPCP +FFG       
Sbjct  255   QVRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQMVTNAPCPRMFFGALYV--L  312

Query  1043  GDTGPGMGTIENVPHNSIHRWVG--------DPRSPHNENMGNFYSAAIDPVFYCHHSNV  1198
             G+     GTIE +PH  +H W G        + R+ H ENMG+FYSA +DPVF+CHHSNV
Sbjct  313   GNNVEAPGTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHSNV  372

Query  1199  DRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTP  1378
             DRMW+ WK +GG R+DI+  DWL +EF FYDE     +VKV D LD  K+GY +  MP P
Sbjct  373   DRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMPRP  432

Query  1379  WKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLD  1543
             W++FKP  K        +S+   + V P A L+K  +F + R  +S+T      +EE+L 
Sbjct  433   WRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEMLT  492

Query  1544  L-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
               ++ +D+  ++RFDVF+N D +VN  ELD+ E+AGS++NL HVH+    T +  + T T
Sbjct  493   FNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDH--VATAT  550

Query  1721  FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
               LAI+ELLED+ LE++D I VTLVP+ GG  +++  A   + DC
Sbjct  551   LQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  595



>ref|XP_006365382.1| PREDICTED: polyphenol oxidase B, chloroplastic-like [Solanum 
tuberosum]
Length=598

 Score =   469 bits (1206),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 277/586 (47%), Positives = 373/586 (64%), Gaps = 37/586 (6%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R  + K+ C   ++ G +N   +S+     DRRNVLLGLGGLYG  N  
Sbjct  29    PKPSQLFLHGKRNQMFKVSCKVTNNNGDQNVETNSV-----DRRNVLLGLGGLYGVANAI  83

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTL-MDTASADYYKIPSFSKL  508
               +   A   P    + K+CG ATIS+  G  V Y+CCP  +  +  +  YYK PS +KL
Sbjct  84    PLAASAAPTPPP---DLKTCGKATISD--GPLVGYTCCPPPMPTNFDNIPYYKFPSMTKL  138

Query  509   NVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPY  679
              +R  AHA+D++Y+ KY  AI +MKDL   +P N   F QQAN+HCAYCNGAY    K  
Sbjct  139   RIRSPAHAVDEEYIAKYNLAISRMKDLDKTEPLNPLGFKQQANIHCAYCNGAYVFGDKVL  198

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+H +WLFFPFHRWYLYFYERIL  LIDDPTF LPYWNWD+P+GM LP +F D E + +Y
Sbjct  199   QVHNSWLFFPFHRWYLYFYERILGKLIDDPTFALPYWNWDHPKGMRLPPMF-DREGTSIY  257

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D++RNQ  R G V DL   G +   +  Q + NNL +MYRQM+TNAPCPLLFFG      
Sbjct  258   DERRNQQVRNGTVMDLGSFGDKVETTQLQLMSNNLTLMYRQMVTNAPCPLLFFGAPYV--  315

Query  1040  TGDTGPGMGTIENVPHNSIHRWVGDPR--------SPHNENMGNFYSAAIDPVFYCHHSN  1195
              G+     GTIEN+PH  +H W G  R        + + E+MGNFYSA +D VFYCHH N
Sbjct  316   LGNNVEAPGTIENIPHIPVHIWAGTVRGSTFPNGDTSYGEDMGNFYSAGLDSVFYCHHGN  375

Query  1196  VDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPT  1375
             VDRMW  WK +GG R+D+++ DWL +EF FYDE K   +VKV D LD  K+GY +  MPT
Sbjct  376   VDRMWNEWKAIGGKRRDLSEKDWLNSEFFFYDENKKPYRVKVRDCLDAKKMGYDYAPMPT  435

Query  1376  PWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELL  1540
             PW++FKP  K  A   + +S+     V P A ++K+ +F + R  +S+T      +EE+L
Sbjct  436   PWRNFKPKTKVSAGKVNTSSLPPVNEVFPLAKMDKVISFSINRPASSRTQQEKNEQEEML  495

Query  1541  DL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTP  1717
                ++ +D+  +IRFDVF+N D++VN  ELD+VE+AGS+++L HVH+      N    T 
Sbjct  496   TFDNIKYDNRGYIRFDVFLNVDNNVNANELDKVEFAGSYTSLPHVHR---VGENDHTATV  552

Query  1718  TFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             TF LAI+ELLED+ LE+++ I VTLVP+ GG  +++     +++DC
Sbjct  553   TFQLAITELLEDIGLEDEETIAVTLVPKKGGEGISIENVEIKLLDC  598



>gb|AFJ79641.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=594

 Score =   469 bits (1206),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 274/585 (47%), Positives = 370/585 (63%), Gaps = 32/585 (5%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C  +++ G +N   + + +  +DRRNVLLGLGG+YGA N A
Sbjct  22    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQN--QNEVEKNSVDRRNVLLGLGGMYGAANFA  79

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               +   A   P    +  SC  A I+ +  + V YSCC  T  D     YYK PS +KL 
Sbjct  80    PLAASAAPTPPP---DLSSCSIAKITET--EEVSYSCCAPTPDDLNKIPYYKFPSMTKLR  134

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQ  682
             +R  AHA D++Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY++  K  Q
Sbjct  135   IRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQ  194

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYFYERIL S+IDDPTF LPYWNWD+P+GM +P +F D E + LYD
Sbjct  195   VHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMF-DGEGTALYD  253

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKET  1042
             + RNQ+HR G V DL   G E   ++ Q + NNL +MYRQM+TNAPCP +FFG       
Sbjct  254   QVRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQMVTNAPCPRMFFGAPYV--L  311

Query  1043  GDTGPGMGTIENVPHNSIHRWVG--------DPRSPHNENMGNFYSAAIDPVFYCHHSNV  1198
             G+     GTIE +PH  +H W G        + R+ H ENMG+FYSA +DPVF+CHHSNV
Sbjct  312   GNNVEAPGTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHSNV  371

Query  1199  DRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTP  1378
             DRMW+ WK +GG R+DI+  DWL +EF FYDE     +VKV D LD  K+GY +  MP P
Sbjct  372   DRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMPRP  431

Query  1379  WKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEELLD  1543
             W++FKP  K        +S+   + V P A L+K  +F + R  +S+T      +EE+L 
Sbjct  432   WRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEMLT  491

Query  1544  L-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
               ++ +D+  ++RFDVF+N D +VN  ELD+ E+AGS++NL HVH+    T +  + T T
Sbjct  492   FNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDH--VATAT  549

Query  1721  FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
               LAI+ELLED+ LE++D I VTLVP+ GG  +++  A   + DC
Sbjct  550   LQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  594



>ref|XP_006365383.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase D, chloroplastic-like 
[Solanum tuberosum]
Length=631

 Score =   468 bits (1205),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 275/574 (48%), Positives = 370/574 (64%), Gaps = 38/574 (7%)
 Frame = +2

Query  194   VIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPP  373
             + K+ C   ++ G +N    ++    +DRRNVLLGLGGLYG  N    +   A ASP PP
Sbjct  41    MFKVSCKVTNNNGDQN---QNVETNSVDRRNVLLGLGGLYGVANAIPLA---ASASPTPP  94

Query  374   PETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLE  553
             P+  SC  ATI+ +    VPYSCC     D     YYK PS +KL VR  AH  +++Y+ 
Sbjct  95    PDLSSCSKATINETT--VVPYSCCAPKPDDMEKVPYYKFPSMTKLRVRQPAHEANEEYIA  152

Query  554   KYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHRWY  724
             KY  A+ KM+DL    P N   F QQAN+HCAYCNGAY++ GK  Q+H +WLFFPFHRWY
Sbjct  153   KYNLAVSKMRDLDKTQPLNPIGFKQQANIHCAYCNGAYRIGGKELQVHNSWLFFPFHRWY  212

Query  725   LYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTD  904
             LYFYERI+  LIDDPTF LPYWNWD+P+GM  P ++ D E + L+D  R+Q+HR G V D
Sbjct  213   LYFYERIVGKLIDDPTFALPYWNWDHPKGMRFPAMY-DREGTSLFDVTRDQSHRNGAVID  271

Query  905   LAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVP  1084
             + + G E   +  Q + NNL +MYRQM+TNAPCP +FFG     + G      GTIEN+P
Sbjct  272   IGFFGNEVETTQLQLMSNNLTLMYRQMVTNAPCPRMFFGGPY--DLGSNVELPGTIENIP  329

Query  1085  HNSIHRWVGDPRS--------PHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNR  1240
             H  +H W G  R          + ENMG+FYSA +DPVF+CHHSNVDRMW+ WK  GG R
Sbjct  330   HGPVHIWSGTVRGSTLPNGAISNGENMGHFYSAGLDPVFFCHHSNVDRMWSEWKATGGKR  389

Query  1241  KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP-Trkrrak  1417
              DIT  DWL +EF FYDE+    KVKV D LD  K+GY ++ MPTPW++FKP T+    K
Sbjct  390   TDITHKDWLNSEFFFYDESGNPFKVKVRDCLDTKKMGYDYEPMPTPWRNFKPKTKASAGK  449

Query  1418  lrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTP----GKEELLDLH-LAFDDTQFIR  1579
               + +S+   + V P A L+K  +F + R  +S+T      +EE+L  + + +D+  +IR
Sbjct  450   KVNTSSIPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEMLTFNEIKYDNRDYIR  509

Query  1580  fdvfvnedddvnTKELDRVEYAGSFSNLAHVHK--DTSTTANSTIKTPTFSLAISelled  1753
             FDVF+N D++VN  ELD+ E+AGS+++L HVH+  DT+ TA +T++     LAI+ELLED
Sbjct  510   FDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDTNHTATATLQ-----LAITELLED  564

Query  1754  lrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             + LE+D+ I VTLVP+ GG  +++     ++ DC
Sbjct  565   IGLEDDETIAVTLVPKKGG--ISIGGVEIKLADC  596



>gb|ADY18409.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=590

 Score =   466 bits (1200),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 267/546 (49%), Positives = 358/546 (66%), Gaps = 29/546 (5%)
 Frame = +2

Query  272   LDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPS  451
             +DRRNVLLGLGGL  A      +N    A+P PPP+ K+CG ATI+ ++G PVPY+CC  
Sbjct  56    VDRRNVLLGLGGLGAANLAPLTAN----AAPSPPPDFKTCGIATIT-ADGPPVPYTCCHL  110

Query  452   TL-MDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQ  619
              +  +  +  YYK+PS +K+ +R  AH +D++++ KY  AI +MK+L   +P N   F Q
Sbjct  111   PMPSNVNTIPYYKLPSMTKVRIRQPAHTVDEEFIAKYNLAISRMKELDEKEPLNPLGFKQ  170

Query  620   QANVHCAYCNGAYQLAGKPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWD  799
             QAN+HCAYCNGAY++  K  Q+H +WLFFPFHRWYLYFYER+L  LIDDPTF LPYWNWD
Sbjct  171   QANIHCAYCNGAYKIGEKVLQVHQSWLFFPFHRWYLYFYERMLGKLIDDPTFALPYWNWD  230

Query  800   NPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYR  979
              P+GM LP +F D E SPLYD++RN   R G V DL   G +   ++ Q + NNL +MYR
Sbjct  231   LPKGMRLPPMF-DREGSPLYDERRNPQVRNGTVMDLGSFGDQVQTTELQLMSNNLTLMYR  289

Query  980   QMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVG--------DPRSPHNE  1135
              M+TNA CPLLFFG   R   G T    GTIE +PH  +H WVG        + +  + E
Sbjct  290   HMVTNASCPLLFFGG--RYVLGSTQGVQGTIEKIPHTPVHIWVGTKKDSILPNGKKSYGE  347

Query  1136  NMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKV  1315
             +MGNFYSAA+DPVFYCHHSNVDRMW  WK +GG R+D++  DWL +EF FYDE K    V
Sbjct  348   DMGNFYSAALDPVFYCHHSNVDRMWNEWKQIGGKRRDLSQKDWLDSEFFFYDENKNPYLV  407

Query  1316  KVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTSVLPA-TLNKITTFC  1492
             KV D LD  K+GY +    T W++FKP +K      +  S+ ++T + P   L+K  +F 
Sbjct  408   KVRDCLDTKKMGYDYAPSSTVWRNFKPNKKNTDGKVNTGSLPSATKIFPIFKLDKAISFS  467

Query  1493  VTRSPTSKTPG----KEELLDL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFS  1657
             + R  +S+T      +EELL   ++ +D+ ++IRFDVFVN D +V   ELD++EYAGS++
Sbjct  468   INRPASSRTQQEKNEQEELLTFSYIKYDNREYIRFDVFVNVDKNVKADELDKIEYAGSYT  527

Query  1658  NLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAY  1837
             +L HVHKD        I T T  LA++ELLED+ LEN++ I VTLVP+ GG  +++    
Sbjct  528   SLPHVHKDGD---KDHIATATLQLALTELLEDIGLENEETIAVTLVPKKGGEGLSIGCVE  584

Query  1838  TEIIDC  1855
              ++ DC
Sbjct  585   IKLEDC  590



>pir||S34786 catechol oxidase (EC 1.10.3.1) precursor - potato (fragment)
Length=588

 Score =   462 bits (1188),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 279/590 (47%), Positives = 371/590 (63%), Gaps = 54/590 (9%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       RR    K+ C A ++ G     D +L    +DRRNVLLGLGGLYGA N
Sbjct  33    QLFLH------GRRNQSFKVSCNANNNVGEH---DKNLD--TVDRRNVLLGLGGLYGAAN  81

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +A    P A ASPIPPP+ KSCG A ++   G  V YSCCP    D  S  YYK P  +K
Sbjct  82    LA----PLASASPIPPPDLKSCGVAHVTE--GVDVTYSCCPPVPDDIDSVPYYKFPPMTK  135

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGKPY  679
             L +RP AHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK  
Sbjct  136   LRIRPPAHAADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGGKEL  195

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S LY
Sbjct  196   QVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRIPPMF-DREGSSLY  254

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D KRNQ HR G + DL + GQE      Q + NNL +MYRQM+TNAPCP  FFG A    
Sbjct  255   DDKRNQNHRNGTIIDLGHFGQEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYLWG  314

Query  1040  TGDTGPGM------------GTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYC  1183
                    +            G +  +   ++  WV   +              +DP+FYC
Sbjct  315   LNQVQEWVLLRTSLIPRAISGLVIVLDKKTVKTWVISIQH------------GLDPIFYC  362

Query  1184  HHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQ  1363
             HH+NVDRMW  WK +GG R+D+++ DWL +EF FYDE +   +VKV D LD+ K+G+++ 
Sbjct  363   HHANVDRMWDEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFSYA  422

Query  1364  KMPTPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----K  1528
              MPTPW++FKP RK  A   + AS++  T V P A L++  +F +TR  +S+T      +
Sbjct  423   PMPTPWRNFKPIRKTTAGKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTQEKNEQ  482

Query  1529  EELLDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANST  1705
             EE+L  + +A+DDT+++RFDVF+N D  VN  ELD+ E+AGS+++L HVH + +    S 
Sbjct  483   EEILTFNKVAYDDTKYVRFDVFLNVDKTVNADELDKAEFAGSYTSLPHVHGNNTNHVTSV  542

Query  1706  IKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
                 TF LAI+ELLED  LE++D I VTLVP+ GG  V++     ++ DC
Sbjct  543   ----TFKLAITELLEDNGLEDEDTIAVTLVPKVGGEGVSIESVEIKLEDC  588



>ref|XP_004246030.1| PREDICTED: polyphenol oxidase D, chloroplastic [Solanum lycopersicum]
Length=591

 Score =   459 bits (1180),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 273/587 (47%), Positives = 364/587 (62%), Gaps = 40/587 (7%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       +R    K+ C   ++ G ++  +S      +DRRNVLLGLGGLYG  N
Sbjct  28    QLFLH------GKRNKAFKVSCKVTNTNGNQDETNS------VDRRNVLLGLGGLYGVAN  75

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
                 +   A   P    +  SC  A I  +  + V YSCC     D     YYK PS +K
Sbjct  76    AIPLAASAAPTPPP---DLSSCSIARIDEN--QVVSYSCCAPKPDDMEKVPYYKFPSMTK  130

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKP  676
             L VR  AH  D++Y+ KY  A+ KM+DL    P N   F QQAN+HCAYCNGAY++ GK 
Sbjct  131   LRVRQPAHEADEEYIAKYNLAVSKMRDLDKTQPLNPIGFKQQANIHCAYCNGAYRIGGKE  190

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+H +WLFFPFHRWYLYFYERI+  LIDDPTF LPYWNWD+P+GM  P ++ D E + L
Sbjct  191   LQVHNSWLFFPFHRWYLYFYERIVGKLIDDPTFALPYWNWDHPKGMRFPAMY-DREGTFL  249

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             +D+ R+Q+HR G V DL + G E   +  Q + NNL +MYRQM+TNAPCP +FFG     
Sbjct  250   FDETRDQSHRNGTVIDLGFFGNEVETTQLQMMSNNLTLMYRQMVTNAPCPRMFFGGPYDL  309

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRS--------PHNENMGNFYSAAIDPVFYCHHS  1192
              T    P  GTIEN+PH  +H W G  R          + ENMG+FYSA +DPVF+CHHS
Sbjct  310   GTNVELP--GTIENIPHGPVHIWSGTVRGSTLPNGAISNGENMGHFYSAGLDPVFFCHHS  367

Query  1193  NVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMP  1372
             NVDRMW+ WK  GG R DIT  DWL +EF FYDE +   +VKV D LD  K+GY ++ M 
Sbjct  368   NVDRMWSEWKATGGKRTDITHKDWLNSEFFFYDENENPYRVKVRDCLDTKKMGYDYKPMA  427

Query  1373  TPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTP----GKEEL  1537
             TPW++FKP  K  A   + +S+   +   P A L+K  +F + R  +S+TP     +EE+
Sbjct  428   TPWRNFKPLTKASAGKVNTSSIPPVSQAFPLAKLDKAVSFSINRPTSSRTPQEKNAQEEM  487

Query  1538  LDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKT  1714
             L  + + +D+  +IRFDVF+N D++VN  ELD+ E+AGS+++L HVH+   T   + I T
Sbjct  488   LTFNSIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRAGET---NHIAT  544

Query  1715  PTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
               F LAI+ELLED+ LE++D I VTLVP+ GG  +++  A   + DC
Sbjct  545   VDFQLAITELLEDIGLEDEDTIAVTLVPKRGGEGISIENATISLADC  591



>gb|AAA85121.1| polyphenol oxidase [Solanum tuberosum]
Length=597

 Score =   454 bits (1168),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 272/585 (46%), Positives = 364/585 (62%), Gaps = 34/585 (6%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R  + K+ C   ++ G +N    ++    +DRRNVLLGLGGLYG  N  
Sbjct  27    PKPSQLFIHGKRNQMFKVSCKVTNNNGDQN---QNVETNSVDRRNVLLGLGGLYGVANAI  83

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               +   A A P    +  SC  A I+ +  + VPYSCC     D     YYK PS +KL 
Sbjct  84    PLAASAAPAPPP---DLSSCSIARINEN--QVVPYSCCAPKPDDMEKVPYYKFPSMTKLR  138

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQ  682
             VR  AH  +++Y+ KY  AI +MKDL    P N   F QQAN+HCAYCNGAY++ GK  Q
Sbjct  139   VRQPAHEANEEYIAKYNLAISRMKDLDKTQPLNPIGFKQQANIHCAYCNGAYRIGGKELQ  198

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYF+ERI+   IDDPTF LPYWNWD+P+GM  P ++ D E + L+D
Sbjct  199   VHNSWLFFPFHRWYLYFHERIVGKFIDDPTFALPYWNWDHPKGMRFPAMY-DREGTSLFD  257

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKET  1042
               R+Q+HR G V DL + G E   +  Q + NNL +MYRQM+TNAPCP +FFG       
Sbjct  258   VTRDQSHRNGAVIDLGFFGNEVETTQLQLMSNNLTLMYRQMVTNAPCPRMFFGGPYDLGV  317

Query  1043  GDTGPGMGTIENVPHNSIHRWVGDPRS--------PHNENMGNFYSAAIDPVFYCHHSNV  1198
                 P  GTIEN+PH  +H W G  R          + ENMG+FYSA +DPVF+CHHSNV
Sbjct  318   NTELP--GTIENIPHGPVHIWSGTVRGSTLPNGAISNGENMGHFYSAGLDPVFFCHHSNV  375

Query  1199  DRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTP  1378
             DRMW+ WK  GG R DIT  DWL +EF FYDE +   +VKV D LD  K+GY ++ + TP
Sbjct  376   DRMWSEWKATGGKRTDITHKDWLNSEFFFYDENENPYRVKVRDCLDTKKMGYDYKPIATP  435

Query  1379  WKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTP----GKEELLD  1543
             W++FKP  K  A   + AS+  +++V P A L+K  +F + R  +S+T      +EE+L 
Sbjct  436   WRNFKPLTKASAGKVNTASLPPASNVFPLAKLDKAISFSINRPTSSRTQQEKNAQEEMLT  495

Query  1544  L-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
                + +D+  +IRFDVF N D++VN  ELD+ E+AGS+++L HVH+   T   + I T  
Sbjct  496   FSSIRYDNRGYIRFDVFSNVDNNVNANELDKAEFAGSYTSLPHVHRAGET---NHIATVD  552

Query  1721  FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             F LAI+ELLED+ LE++D I VTLVP+ GG  +++  A   + DC
Sbjct  553   FQLAITELLEDIGLEDEDTIAVTLVPKRGGEGISIEGATISLADC  597



>gb|ADG56700.1| chloroplast polyphenol oxidase precursor [Solanum melongena]
Length=601

 Score =   449 bits (1154),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 270/587 (46%), Positives = 367/587 (63%), Gaps = 34/587 (6%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C  +++ G +N   + + +  +DRRNVLLGLGG+YGA N A
Sbjct  27    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQN--QNEVEKNSVDRRNVLLGLGGMYGAANFA  84

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               +   A   P    +  SC  A I+ +  + V YSCC  T  D     YYK PS +KL 
Sbjct  85    PLAASAAPTPPP---DLSSCSIAKITET--EEVSYSCCAPTPDDLNKIPYYKFPSMTKLR  139

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQ  682
             +R  AHA D++Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY++  K  Q
Sbjct  140   IRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQ  199

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYFYERIL S+IDDPTF LPYWNWD+P+GM +P +F D E + LYD
Sbjct  200   VHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMF-DREGTALYD  258

Query  863   KKRNQAHR-RGYVTDLAY-AGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             + RNQ+HR R  V D  +    +   +  Q + N L +MYRQM+TNAPCP +FFG     
Sbjct  259   QVRNQSHRPREGVMDFWFLLVMKVQTTKLQLMSNTLTLMYRQMVTNAPCPRMFFGAPYV-  317

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVG--------DPRSPHNENMGNFYSAAIDPVFYCHHS  1192
               G+     GTIE +PH  +H W G        + R+ H ENMG+FYSA +DPVF+CHHS
Sbjct  318   -LGNNVEAPGTIEVIPHGPVHVWTGTVPGTTLPNGRTSHGENMGHFYSAGLDPVFFCHHS  376

Query  1193  NVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMP  1372
             NVDRMW+ WK +GG R+DI+  DWL +EF FYDE     +VKV D LD  K+GY +  MP
Sbjct  377   NVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPMP  436

Query  1373  TPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEEL  1537
             TPW++FKP  K        +S+   + V P A L+K  +F + R  +S+T      +EE+
Sbjct  437   TPWRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEEM  496

Query  1538  LDL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKT  1714
             L   ++ +D+  ++RFDVF+N D +VN  ELD+ E+AGS++NL HVH+    T +  + T
Sbjct  497   LTFNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDH--VAT  554

Query  1715  PTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
              T  LAI+ELLED+ LE++D I VTLVP+ GG  +++      + DC
Sbjct  555   ATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGVEISLADC  601



>ref|XP_004246037.1| PREDICTED: polyphenol oxidase B, chloroplastic-like [Solanum 
lycopersicum]
Length=599

 Score =   447 bits (1151),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 275/591 (47%), Positives = 359/591 (61%), Gaps = 44/591 (7%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAA--SSEGRENPADSSLSEAKLDRRNVllglgglyga  319
             Q+FL+       RR     + C A   SSE  +N  D  +     DRRNVLLGLGGLY A
Sbjct  32    QVFLH------GRRSQSFNVSCNANNNSSEHEKNNVDDVV-----DRRNVLLGLGGLYSA  80

Query  320   yniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTL-MDTASADYYKIPS  496
              N+A    P A A+P P P+ KSC   TI+   G  V Y+CCP  L  DT++  +Y+ P 
Sbjct  81    TNLA----PLATAAPSPSPDFKSCSTTTITG--GPAVKYTCCPPPLPKDTSTIPFYEFPP  134

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPS---DDPRNFYQQANVHCAYCNGAYQLA  667
              +KL +R  AH +D++Y+ KY  AI +MK L     D P  F QQAN+HCAYCNGAY + 
Sbjct  135   MNKLRMRSPAHLVDEEYIAKYNLAISRMKALDKTEPDKPLGFKQQANIHCAYCNGAYNIG  194

Query  668   GKPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
             GK  Q+H +WLFFPFHRWYLYFYERIL  LID PTF LPYWNWDNP+GM LP +F D E 
Sbjct  195   GKELQVHNSWLFFPFHRWYLYFYERILGKLIDHPTFALPYWNWDNPKGMRLPPMF-DREG  253

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             + LYD++RN   R G V DL   G     +      NNL +MY QM++NAPCPLLFFG  
Sbjct  254   TSLYDERRNPQVRNGTVMDLGTFGDTVDTTQLLLQTNNLILMYHQMVSNAPCPLLFFGGR  313

Query  1028  IRKETGDTGPGMGTIENVPHNSIHRWVGDPRS--------PHNENMGNFYSAAIDPVFYC  1183
                 T    P  GTIE +PH  +H W G  R          + E+MGNFYSA +DPVFYC
Sbjct  314   YVLGTNIEAP--GTIEKIPHIPVHIWTGTVRDVNAPKGKPKYGEDMGNFYSAGLDPVFYC  371

Query  1184  HHSNVDRMWTIWKTLGGNRKD-ITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF  1360
             HH NVDRMW  WKTLGG R D +T+PD + +EF FYDE K    VKV D LD  K+GY +
Sbjct  372   HHGNVDRMWNEWKTLGGKRTDLVTEPDLMNSEFFFYDENKKPYLVKVGDCLDTKKMGYDY  431

Query  1361  QKMPTPWKDFKPTrkrraklrskasvsasTSVLPA-TLNKITTFCVTRSPTSKTP----G  1525
              K PTPW+DFKP +   +     +SV  ++ + P   L+  T+F + R  + +T      
Sbjct  432   VKSPTPWRDFKPNKNYSSGKLDTSSVPPASKIFPIFKLDVNTSFSLDRPASLRTQVEKDN  491

Query  1526  KEELLDL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANS  1702
             KEE+L   ++ +D  ++IRFDV++N D +V  ++L++ EYA S+++L H HK      + 
Sbjct  492   KEEILTFSYIKYDSREYIRFDVYLNADKNVKPEDLNQTEYAESYTSLPHTHKPGD---DD  548

Query  1703  TIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
              + T T  LAI+ELL++  LE +DKI+VTLVPR GG  + +      ++DC
Sbjct  549   YVSTATLQLAITELLKENGLEKEDKIVVTLVPRKGGEGLAIGCVEIALVDC  599



>gb|AAC69365.1| polyphenol oxidase [Diospyros kaki]
Length=393

 Score =   438 bits (1126),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 221/394 (56%), Positives = 286/394 (73%), Gaps = 11/394 (3%)
 Frame = +2

Query  500   SKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSD--DPRNFYQQANVHCAYCNGAYQLAGK  673
             +KL +RP AHA D++Y+ KY+ A  +M++L  D  DP  F QQAN+HCAYCNGAY++ GK
Sbjct  2     TKLRIRPPAHAADEEYVAKYQLATSRMRELDKDSFDPLGFKQQANIHCAYCNGAYKVGGK  61

Query  674   PYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESP  853
               Q+HF+WLFFPFHRWYLYFYERIL SLI+DPTF LPYWNWD+P+GM +P +F D E S 
Sbjct  62    ELQVHFSWLFFPFHRWYLYFYERILGSLINDPTFALPYWNWDHPKGMRMPPMF-DREGSS  120

Query  854   LYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIR  1033
             LYD KRNQ HR G + DL Y GQE      Q + NNL +MYRQM+TNAPCP  FFG A  
Sbjct  121   LYDDKRNQNHRNGTIIDLGYFGQEVDTPQLQIMTNNLTLMYRQMVTNAPCPSQFFGAAYP  180

Query  1034  KETGDTGPGMGTIENVPHNSIHRWVGD-PRSPHNENMGNFYSAAIDPVFYCHHSNVDRMW  1210
               T +  PGMGTIEN+PH  +H W GD PR  + ENMGNFYSA +DP+FYCHH+NVDRMW
Sbjct  181   LGT-EPSPGMGTIENIPHTPVHIWTGDSPRQKNGENMGNFYSAGLDPIFYCHHANVDRMW  239

Query  1211  TIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDF  1390
               WK +GG R+D+++ DWL +EF FYDE +   +VKV D LD+ K+G+++  MPTPW++F
Sbjct  240   DEWKLIGGKRRDLSNKDWLNSEFFFYDENRNPYRVKVRDCLDSKKMGFSYAPMPTPWRNF  299

Query  1391  KPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSK-TPGK---EELLDLH-L  1552
             KP RK  A   + AS++  T V P A L++  +F +TR  +S+ TP K   EE+L  + +
Sbjct  300   KPIRKTTAGKVNTASIAPVTKVFPLAKLDRAISFSITRPASSRTTPEKNEQEEILTFNKV  359

Query  1553  AFDDTQFIRfdvfvnedddvnTKELDRVEYAGSF  1654
             A+DDT+++RFDVF+N D  VN  ELD+ E+AGS+
Sbjct  360   AYDDTKYVRFDVFLNVDKTVNADELDKAEFAGSY  393



>sp|Q08306.2|PPOD_SOLLC RecName: Full=Polyphenol oxidase D, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78298.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=591

 Score =   444 bits (1141),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 268/587 (46%), Positives = 360/587 (61%), Gaps = 40/587 (7%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       +R    K+ C   ++ G ++  +S      +DRRNVLLGLGGLYG  N
Sbjct  28    QLFLH------GKRNKAFKVSCKVTNTNGNQDETNS------VDRRNVLLGLGGLYGVAN  75

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
                 +   A   P    +  SC  A I  +  + V YSCC     D     YYK PS +K
Sbjct  76    AIPLAASAAPTPPP---DLSSCSIARIDEN--QVVSYSCCAPKPDDMEKVPYYKFPSMTK  130

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKP  676
             L VR  AH  D++Y+ KY  ++ KM+DL    P N   F QQAN+HCAYCNGAY++ GK 
Sbjct  131   LRVRQPAHEADEEYIAKYNVSVTKMRDLDKTQPLNPIGFKQQANIHCAYCNGAYRIGGKE  190

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+H +WLFFPFHRWYLYFYE     LIDDPTF LPYWNWD+P+GM  P ++ D E + L
Sbjct  191   LQVHNSWLFFPFHRWYLYFYESNAGKLIDDPTFALPYWNWDHPKGMRFPAMY-DREGTFL  249

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             +D+ R+Q+HR G V DL + G E   +  Q + NNL +MYRQM+TNAPCP +FFG  +  
Sbjct  250   FDETRDQSHRNGTVIDLGFFGNEVETTQLQMMSNNLTLMYRQMVTNAPCPRMFFGDLMI-  308

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNEN--------MGNFYSAAIDPVFYCHHS  1192
              +G T    GTIEN+PH  +H W G  R     N         G+FYSA +DPVF+CHHS
Sbjct  309   -SGITLNSPGTIENIPHGPVHIWSGTVRGSTLPNGAISKRGEYGHFYSAGLDPVFFCHHS  367

Query  1193  NVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMP  1372
             NVDRMW+ WK  GG R DIT  DWL +EF FYDE +   +VKV D LD  K+GY ++ M 
Sbjct  368   NVDRMWSEWKATGGKRTDITHKDWLNSEFFFYDENENPYRVKVRDCLDTKKMGYDYKPMR  427

Query  1373  TPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTP----GKEEL  1537
             TPW++FKP  K  A   + +S+   +   P A L+K  +F + R  +S+TP     +EE+
Sbjct  428   TPWRNFKPLTKASAGKVNTSSIPPVSQAFPLAKLDKAVSFSINRPTSSRTPQEKNAQEEM  487

Query  1538  LDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKT  1714
             L  + + +D+  +IRFDVF+N D++VN  ELD+ E+AGS+++L HVH+   T   + I T
Sbjct  488   LTFNSIRYDNRGYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRAGET---NHIAT  544

Query  1715  PTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
               F LAI+ELLED+ LE++D I VTLVP+ GG  +++  A   + DC
Sbjct  545   VDFQLAITELLEDIGLEDEDTIAVTLVPKRGGEGISIENATISLADC  591



>ref|XP_004246029.2| PREDICTED: polyphenol oxidase A, chloroplastic-like [Solanum 
lycopersicum]
Length=606

 Score =   435 bits (1119),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 266/589 (45%), Positives = 360/589 (61%), Gaps = 46/589 (8%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       +R    K+ C   ++ G ++  +S      +DRRNVLLGLGGLYG  N
Sbjct  45    QLFLH------GKRNKTFKVSCKVTNTNGNQDETNS------VDRRNVLLGLGGLYGVAN  92

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
                 +   A   P    +  SC    I+ +    VPY CC     D +   YYK PS +K
Sbjct  93    AIPLAASAAPTPPP---DLSSCNKPKINATT--EVPYFCCAPKPDDMSKVPYYKFPSVTK  147

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPS---DDPRNFYQQANVHCAYCNGAYQLAGKP  676
             L +RP AHA+D+ Y+ KY  AI +MKDL     D+P  F QQAN+HCAYCNG Y + GK 
Sbjct  148   LRIRPPAHALDEAYIAKYNLAISRMKDLDKTQPDNPIGFKQQANIHCAYCNGGYSIDGKV  207

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+H +WLFFPFHRWYLYFYERIL SLIDDPTF LP+WNWD+P+GM  P +F D   + L
Sbjct  208   LQVHNSWLFFPFHRWYLYFYERILGSLIDDPTFGLPFWNWDHPKGMRFPPMF-DVPGTAL  266

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD++R      G   DL   G +   +  Q + NNL +MYRQ++TN+PCPL+FFG     
Sbjct  267   YDERRGDQIHNGNFIDLGSFGDQVETTQLQLMTNNLTLMYRQLVTNSPCPLMFFGGPY--  324

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVG--------DPRSPHNENMGNFYSAAIDPVFYCHHS  1192
               G T    GT+EN+PH+ +H WVG        D +  + E+MGNFYSA +DP+FYCHHS
Sbjct  325   TLGSTVEAAGTVENIPHSPVHIWVGTRRGSVLPDGKISNGEDMGNFYSAGLDPLFYCHHS  384

Query  1193  NVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMP  1372
             NVDRMW  WK  GG R DI + DWL +EF FYDE     KV+V D LD  K+GY +Q   
Sbjct  385   NVDRMWNEWKATGGKRTDIQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYQPTA  444

Query  1373  TPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTP----GKEEL  1537
             TPW++FKP  K  A   +  S+   + V P A L+K  +F + R  +S+T      +EE+
Sbjct  445   TPWRNFKPKTKASAGKVNTGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEV  504

Query  1538  LDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHK--DTSTTANSTI  1708
             L  + + +D+  +IRFDVF+N D++VN  ELD+ E+AGS+++L HVH+  D   TA +T+
Sbjct  505   LTFNAIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDPKHTATATL  564

Query  1709  KTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             +     LAI+ELLED+ LE++D I VTLVP+ G   +++     ++ DC
Sbjct  565   R-----LAITELLEDIGLEDEDTIAVTLVPKKGD--ISIGGVEIKLADC  606



>gb|AFJ79642.1| chloroplast polyphenol oxidase [Solanum melongena]
Length=590

 Score =   429 bits (1103),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 264/588 (45%), Positives = 361/588 (61%), Gaps = 39/588 (7%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C  +++ G +N   + + +  +DRRNVLLGLGG+YGA N A
Sbjct  19    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQN--QNEVEKNSVDRRNVLLGLGGMYGAANFA  76

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               +   A   P    +  SC  A I+ +  + V YSCC  T  D     YYK PS +KL 
Sbjct  77    PLAASAAPTPPP---DLSSCSIAKITET--EEVSYSCCAPTPDDLNKIPYYKFPSMTKLR  131

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQ  682
             +R  AHA D++Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY++  K  Q
Sbjct  132   IRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQ  191

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYFYERIL S+IDDPTF LPYWNWD+P+GM +P +FD  E + LYD
Sbjct  192   VHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDR-EGTALYD  250

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCP------LLFFGK  1024
             + RNQ+HR G V DL   G E   ++ Q + NNL +MYRQ    APCP      L F G 
Sbjct  251   QVRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQWYY-APCPRMFLARLTFLGI  309

Query  1025  AIR-----KETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHH  1189
              ++     K +       G ++      +     + R+ H ENMG+FYSA +DPVF+CHH
Sbjct  310   TLKPQEPLKSSLTVLSTFGLVQCQVQPCL-----NGRTSHGENMGHFYSAGLDPVFFCHH  364

Query  1190  SNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKM  1369
             SNVDRMW+ WK +GG R+DI+  DWL +EF FYDE     +VKV D LD  K+GY +  M
Sbjct  365   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  424

Query  1370  PTPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEE  1534
             PTPW++FKP  K        +S+   + V P A L+K  +F + R  +S+T      +EE
Sbjct  425   PTPWRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEE  484

Query  1535  LLDL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIK  1711
             +L   ++ +D+  ++RFDVF+N D +VN  ELD+ E+AGS++NL HVH+    T +  + 
Sbjct  485   MLTFNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDH--VA  542

Query  1712  TPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             T T  LAI+ELLED+ LE++D I VTLVP+ GG  +++  A   + DC
Sbjct  543   TATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  590



>ref|XP_011014565.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   427 bits (1099),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 273/587 (47%), Positives = 350/587 (60%), Gaps = 54/587 (9%)
 Frame = +2

Query  161   PNPSRAAR-----RGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             P  +R +R     R D+  + C +  ++  +NPA          RR++L+GLGGLYGA  
Sbjct  23    PKTNRVSRIKKPNRLDIPIVSCKSGKNDHEQNPAT---------RRDLLIGLGGLYGATR  73

Query  326   iaggSNPFALASPIPPPETKSCGPATI-SNSNGKPVPYSCCPSTLMDTASADYYKIPSFS  502
             +   S+PFA A+PI PP+   C   T+ S SN    P +CCP T   +     ++ PS S
Sbjct  74    L---SDPFAYANPIAPPDLTQCELVTLPSESN----PTNCCPQT---STKIKNFEFPSAS  123

Query  503   K-LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP-  676
               + +RPAAH +D  Y+ KY  AI  MK LP DDPR+F  QANVHCAYC+GAY  AG P 
Sbjct  124   SPMRIRPAAHLVDKAYVAKYAKAIALMKSLPDDDPRSFKNQANVHCAYCDGAYHQAGFPD  183

Query  677   --YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEES  850
                QIHF+WLFFP+HR YLY++ERIL  LIDDPTF LP+WNWD P GM +P IF D  +S
Sbjct  184   LDLQIHFSWLFFPWHRAYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTD-PQS  242

Query  851   PLYDKKRNQAHRRGYVTDLAYAGQETS---ASDFQKVKNNLAIMYRQMLTNAPCPLLFFG  1021
             PLYD  R+  H+   + DL YA  + +   A   +   +NL +MYRQM++ A  P LFFG
Sbjct  243   PLYDPLRDANHQPPTLLDLNYAKGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFG  302

Query  1022  KAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVD  1201
             K  R    D  PGMGTIE  PH  IH W GDP     ENMGNFYSA  DP+FYCHHSNVD
Sbjct  303   KPYRA-GDDPSPGMGTIETTPHTEIHIWTGDPNQTKGENMGNFYSAGRDPIFYCHHSNVD  361

Query  1202  RMWTIWKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTP  1378
             RMW +WK + GG RKDI DPDWL +EFLF++E K LV+VKV+D+LD  KL Y FQ +P P
Sbjct  362   RMWDLWKKIPGGKRKDIEDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIP  421

Query  1379  WKDFKPTrkrraklrskasvsasT-----SVLPATLNKITTFCV-----TRSPTSKTPGK  1528
             W   +PT K   + + + +   S      S  P  L+K+ +  V     +RS T K    
Sbjct  422   WLKTRPTPKLTRQEKLRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEA  481

Query  1529  EELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTI  1708
             E L+   + +++ Q I+FDV VN++ D      D+ E+AGSF N+ H H   S T     
Sbjct  482   EVLVIEGIEYEENQLIKFDVLVNDEPDSPGGP-DKSEFAGSFVNVPHKHAKKSKT-----  535

Query  1709  KTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
                   L I+ LLEDL  E DD ++VTLVPR GG FVTV     E +
Sbjct  536   ---NLVLGITGLLEDLEAEGDDTLVVTLVPRTGGDFVTVANVKIEFV  579



>gb|ACR61398.1| polyphenol oxidase [Solanum melongena]
Length=593

 Score =   427 bits (1099),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 263/588 (45%), Positives = 360/588 (61%), Gaps = 39/588 (7%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C  +++ G +N   + + +  +DRRNVLLGLGG+YGA N A
Sbjct  22    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQN--QNEVEKNSVDRRNVLLGLGGMYGAANFA  79

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               +   A   P    +  SC  A I+ +  + V YSCC  T  D     YYK PS +KL 
Sbjct  80    PLAASAAPTPPP---DLSSCSIAKITET--EEVSYSCCAPTPDDLNKIPYYKFPSMTKLR  134

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQ  682
             +R  AHA D++Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY++  K  Q
Sbjct  135   IRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQ  194

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYFYERIL S+IDDPTF LPYWNWD+P+GM +P +FD  E + LYD
Sbjct  195   VHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDG-EGTALYD  253

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCP------LLFFGK  1024
             + RNQ+HR G V DL   G E   ++ Q + NNL +MYRQ    APCP      L F G 
Sbjct  254   QVRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQWYY-APCPRMFLARLTFLGI  312

Query  1025  AIR-----KETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHH  1189
              ++     K +       G ++      +     + R+ H ENMG+FYSA +DPVF+CHH
Sbjct  313   TLKPQEPLKSSLTVLSTFGLVQCQVQPCL-----NGRTSHGENMGHFYSAGLDPVFFCHH  367

Query  1190  SNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKM  1369
             SNVDRMW+ WK +GG R+DI+  DWL +EF FYDE     +VKV D LD  K+GY +  M
Sbjct  368   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  427

Query  1370  PTPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEE  1534
             P PW++FKP  K        +S+   + V P A L+K  +F + R  +S+T      +EE
Sbjct  428   PRPWRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEE  487

Query  1535  LLDL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIK  1711
             +L   ++ +D+  ++RFDVF+N D +VN  ELD+ E+AGS++NL HVH+    T +  + 
Sbjct  488   MLTFNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDH--VA  545

Query  1712  TPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIIDC  1855
             T T  LAI+ELLED+ LE++D I VTLVP+ GG  +++  A   + DC
Sbjct  546   TATLQLAITELLEDIGLEDEDTIAVTLVPKKGGEGISIEGATISLADC  593



>ref|XP_010100574.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82817.1| Polyphenol oxidase [Morus notabilis]
Length=601

 Score =   427 bits (1099),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 248/570 (44%), Positives = 348/570 (61%), Gaps = 37/570 (6%)
 Frame = +2

Query  200   KIRCAAASSEGRENPAD---SSLSEAKLDRRNVllglgglygayniaggSNPFALASPIP  370
             K+ C A +++   +P +   S  S  KLDRRNVLLGLG L G   +   ++PFA A+PI 
Sbjct  48    KLSCKANNNDHDLSPTNDVASKTSNPKLDRRNVLLGLGSLGGLAGLR--ADPFAFAAPIS  105

Query  371   PPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIP-SFSKLNVRPAAHAIDDDY  547
              P+   CG A   +      P +CCP     +A    +K+P S  KL VRP AHA+D  Y
Sbjct  106   APDISQCGAADFPSGVD---PVNCCPPV---SAQIVDFKLPASPGKLRVRPPAHAVDSAY  159

Query  548   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHR  718
               K+K A + MK LP  DPR+F QQA++HCAYC+GAY+  G P    Q+H +WLFFPFHR
Sbjct  160   TAKFKRAFELMKALPDSDPRSFKQQASIHCAYCDGAYEQIGFPDLDIQVHNSWLFFPFHR  219

Query  719   WYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYV  898
             WYLYF+ERIL  LIDDP+F +P+WNWD P GM +P I+ D   SPLYD+ RN++H+   +
Sbjct  220   WYLYFFERILGKLIDDPSFAMPFWNWDAPAGMQIPAIYAD-RRSPLYDQFRNKSHQPPSL  278

Query  899   TDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD-TGPGMGTIE  1075
              DL + G++ S S+  ++++NL IMYRQM++N+    +F G++ R   GD T PG G+ E
Sbjct  279   VDLDFNGRDESISNQAQIQSNLTIMYRQMVSNSRSARIFMGESYR--AGDETDPGPGSFE  336

Query  1076  NVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITD  1255
             N+PH S+H W GD   P+ E+MGNFYSA  DP+F+ HHSN+DRMW +WKTLGG R+D TD
Sbjct  337   NIPHGSVHTWTGDNTQPYGEDMGNFYSAGRDPIFFAHHSNIDRMWNVWKTLGGKRQDFTD  396

Query  1256  PDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP--------Trkrr  1411
             PDWL   FLFYDE   LV+VKV DSLD+ KLGYT+Q +  PW + +P         ++  
Sbjct  397   PDWLDASFLFYDENSQLVRVKVRDSLDSRKLGYTYQDIELPWLNTRPRPRRVVDKVKRAF  456

Query  1412  aklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvf  1591
             A++    +    T+  P TL+K     V+R   S++  +++  D  L     +F R    
Sbjct  457   ARIGVARADEYPTANFPLTLDKPVKTLVSRPKKSRSKKEKDEADEVLVIQGIEFDRNVPI  516

Query  1592  vnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlr  1759
               +    +  +     D+ E+AGSF ++ H HK + T  N+ ++     L I+ELLEDL 
Sbjct  517   KFDVFINDEDDALTGPDKSEFAGSFVSVPHRHK-SKTKMNTGLR-----LDITELLEDLD  570

Query  1760  lenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              E D+ ++VTLVP+ G   V++     E +
Sbjct  571   AEEDENVVVTLVPKVGIGHVSIGGLKIEFV  600



>ref|XP_010100570.1| Polyphenol oxidase [Morus notabilis]
 gb|EXB82813.1| Polyphenol oxidase [Morus notabilis]
Length=592

 Score =   427 bits (1098),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 257/587 (44%), Positives = 347/587 (59%), Gaps = 46/587 (8%)
 Frame = +2

Query  167   PSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNP  346
             PS A ++      R    S+  + +  D      KLDRRN+L+GLGGLYG     G S+P
Sbjct  25    PSFAGKKSHAPNHRYKGQSTTCKGSREDDQSPLGKLDRRNLLIGLGGLYGTAAGLG-SDP  83

Query  347   FALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVR  517
              ALA+P+ PP+   CGPA          P +CCP   S ++D      YK+P  SKL VR
Sbjct  84    LALANPVAPPDLSKCGPADFPPGA---TPTNCCPPISSKIID------YKLPPVSKLRVR  134

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PA H +D+ Y+ KY  A+Q MKDLP  DPR+F QQ+++HCAYC+G+Y   G P    Q+H
Sbjct  135   PATHTVDEAYIAKYNRAVQLMKDLPDSDPRSFSQQSDIHCAYCDGSYDQVGFPNLELQVH  194

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFPFHRWYLYFYERIL  LIDDPTF LP+WNWD+P GM  P ++ +  +SPLYDK 
Sbjct  195   ESWLFFPFHRWYLYFYERILGKLIDDPTFALPFWNWDSPPGMQFPALYAN-AKSPLYDKL  253

Query  869   RNQAHRRGYVTDLAY----AGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             R+  H+     DL Y    AG  T++ D Q V  NL IMYRQ++ N     LF G+  R 
Sbjct  254   RDANHQPPVTVDLDYSKADAGVPTTSKDVQ-VSANLKIMYRQIIANGKNARLFLGEPYR-  311

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
             E  D  PG G++ENVPH  +H W GD   P+ ENMGNFYSAA DP+F+ HHSN+DR+W++
Sbjct  312   EGDDPSPGPGSLENVPHGPVHLWTGDSTQPNFENMGNFYSAARDPIFFSHHSNIDRLWSV  371

Query  1217  WKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             WKTLGG R D TDPDWL + FLFYDE K LV+V+V D LD+ KLGY +Q +  PW   KP
Sbjct  372   WKTLGGKRNDFTDPDWLNSGFLFYDENKQLVRVRVGDCLDSKKLGYVYQDVDIPWLQTKP  431

Query  1397  TrkrraklrskasvsasTSVL-------------PATLNKITTFCVTRSPTSKTPGKEEL  1537
             T  R  +  +++S +   + L             P  L+K+ +  V+R   S++  +++ 
Sbjct  432   TPLRTKRAVARSSSTLVGAALAADTKKTTTRVKFPIKLDKVISTVVSRPKKSRSKNEKDD  491

Query  1538  LDLHLAFDDTQFIRfdvfvnedddvnTKEL--DRVEYAGSFSNLAHVHK-DTSTTANSTI  1708
              +  L  +  +F R +    +    +  E   +  E+AGSF N+ H  K D  T  N   
Sbjct  492   EEEVLVIEGIEFDRNNPVKFDVYVNDEDESGPENSEFAGSFVNVPHKKKGDNKTRTN---  548

Query  1709  KTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
                   L I++LLE+L  E+DD ++VTLVP+ G   VT++    + I
Sbjct  549   ----LRLGITDLLEELEAEDDDSVVVTLVPKFGKGLVTISGIKIDFI  591



>gb|AAC28935.1| polyphenol oxidase precursor [Prunus armeniaca]
Length=597

 Score =   427 bits (1098),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 268/534 (50%), Positives = 340/534 (64%), Gaps = 30/534 (6%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
              KLDRRN+L+GLGGLYGA  +     PFA A PI PP+  +C PA I+    + VP  CC
Sbjct  73    GKLDRRNILIGLGGLYGATTLD--RKPFAFADPIAPPDLTTCKPAEITPGGSETVP--CC  128

Query  446   P--STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQ  619
             P  +T + T   D   IP    L   PAAH + D+YL K+K A   M+ LP DDPR+  Q
Sbjct  129   PPVTTKIKTFKPDL-SIP----LRTSPAAHQVTDEYLAKFKKAQAAMRALPDDDPRSMVQ  183

Query  620   QANVHCAYCNGAYQLAG---KPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYW  790
             QA VHCAYCNGAY   G      Q+HF+WLFFPFHR YLYFYERIL  LIDDPTF LPYW
Sbjct  184   QAKVHCAYCNGAYPQVGFTDNDIQVHFSWLFFPFHRMYLYFYERILGKLIDDPTFALPYW  243

Query  791   NWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAI  970
             NWD+P G  +P+I+ D   SPLYD+ RN  H+   + DL+Y G++    +  ++  NLAI
Sbjct  244   NWDSPVGFPIPDIYTD-TSSPLYDQYRNADHQPPVLVDLSYGGKDDDVDEQTRIDENLAI  302

Query  971   MYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNF  1150
             MYRQM++ A  P LFFG A R    +TG   GTIEN+PHN+IH WVGDP   H E+MGNF
Sbjct  303   MYRQMVSGAKTPDLFFGHAYRAGNLNTGKYPGTIENMPHNNIHIWVGDPSQTHQEDMGNF  362

Query  1151  YSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDS  1330
             YSA  DP+FY HH+NVDRMW IWKTLGG RKDITD DWL  EFLFYDE   LV+VKV DS
Sbjct  363   YSAGRDPLFYAHHANVDRMWNIWKTLGGKRKDITDTDWLDAEFLFYDENAELVRVKVRDS  422

Query  1331  LDNVK-LGYTFQKMPTPWKDFKPTrkrra-klrskasvsasTSVLPATLNKITTFCVTRS  1504
             L+  K L Y ++ +  PW   KPT ++   K ++K + +  TS  PATL ++TT  V R 
Sbjct  423   LEPEKQLRYNYEPVSLPWLFTKPTARKTKNKTKAKVAATQLTSKFPATLVEVTTVEVARP  482

Query  1505  PTSKTPGK-----EELLDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLA  1666
                K   K     EELL +  + F+ T+ ++FDVF+N+D +  ++  D+ E+AGSF    
Sbjct  483   KPRKRSKKEKVDEEELLIIKDIEFEGTEAVKFDVFINDDAESLSRR-DKSEFAGSF---V  538

Query  1667  HVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVN  1828
             HV +  +T A +        L I++LLEDL  E+D  +LVTLVPR   S +T+ 
Sbjct  539   HVPQGKTTKAKTKT---NLKLGITDLLEDLGAEDDSSVLVTLVPRVSNSPITIG  589



>gb|KHN08551.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   427 bits (1097),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 255/580 (44%), Positives = 347/580 (60%), Gaps = 39/580 (7%)
 Frame = +2

Query  170   SRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPF  349
             +R  +R  + +  C+   +    NP++  LS     RRNVLLGLGGL GA  +   +NPF
Sbjct  39    NRKPKRHHIPRTTCSENQNNPTPNPSEGELSHIVGHRRNVLLGLGGLCGAVTLN--NNPF  96

Query  350   ALASPIPPPETKSCGPA-TISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
             A A+PI PP+  +CGP  T + +N    P +CCP +   +   D+   PS   L VRPAA
Sbjct  97    AFAAPISPPDLNTCGPPDTPAGAN----PTNCCPPS---SKIIDFKFPPSNQPLRVRPAA  149

Query  527   HAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTW  697
             H ++D+YL KYK A+  MK LPSDDPRNF QQANVHCAYC+GAY   G P    QIH +W
Sbjct  150   HLVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQIHNSW  209

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LFFPFHRWYLYFYE+IL SLI+DPTF LP+WNWD P GM LP I+ D  +SPLYD  RN 
Sbjct  210   LFFPFHRWYLYFYEKILGSLINDPTFALPFWNWDAPDGMQLPSIYAD-PKSPLYDTLRNA  268

Query  878   AHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-G  1054
              H+   + DL +  ++  ++   K+ NNL IMYRQ+++N   P LF G   R   GD   
Sbjct  269   NHQPPTLVDLDFNLEDPISNG--KISNNLTIMYRQVVSNGKTPTLFLGNPYR--AGDEPD  324

Query  1055  PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG  1234
             PG G++ENVPH S+H W GD   P+ E+MG FYSAA DP+F+ HHSN+DRMW+IWKTLGG
Sbjct  325   PGFGSVENVPHGSVHLWTGDINQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIWKTLGG  384

Query  1235  NRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrra  1414
              RKD TD DWL++ FLFYDE K LV+VKV+D LD  KLGY +Q +  PW + +PT +R  
Sbjct  385   KRKDFTDSDWLESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDVDIPWLNSRPTPRRSR  444

Query  1415  klrskasvsasTSV-----------LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFD  1561
               +   + +                 P  L+ + +  V R   S++  ++E  +  L  +
Sbjct  445   VQKVALAQNFGVGAARAAETSRNVKFPLVLDSVVSTMVKRPNKSRSKKEKEEEEEVLVIE  504

Query  1562  DTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSL  1729
               +F R      +    +  +     D  E+AGSF ++ H HK  +    + ++     L
Sbjct  505   GIEFERNTPVKFDVFINDEDDKQIRPDNTEFAGSFVSVPHSHKHKNKDIITCLR-----L  559

Query  1730  AISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              +++LLE+L  E+DD + VTLVPR G   V +     +++
Sbjct  560   GLTDLLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKIKLL  599



>ref|XP_006370120.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
 gb|ERP66689.1| hypothetical protein POPTR_0001s39680g [Populus trichocarpa]
Length=581

 Score =   425 bits (1093),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 252/522 (48%), Positives = 318/522 (61%), Gaps = 35/522 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             S+PFA A+PI PP+   C   T+   +    P +CCP T   +     ++ PS S  + +
Sbjct  75    SDPFAYANPIAPPDITQCELVTLPTESD---PSNCCPPT---STKIKNFEFPSASSPMRI  128

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAH +D  Y+ KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY  AG P    QI
Sbjct  129   RPAAHLVDKAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQI  188

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             HF+WLFFP+HR YLY++ERIL  LIDDPTF LP+WNWD P GM +P IF D  ESPLYD 
Sbjct  189   HFSWLFFPWHRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTD-PESPLYDP  247

Query  866   KRNQAHRRGYVTDLAYAGQETS---ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
              R+  H+   + DL YA  + +   A   +   +NL +MYRQM++ A  P LFFGK  R 
Sbjct  248   LRDANHQPPTLLDLNYAKGDANPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
                D  PGMGTIE  PH  IH W GDP   + ENMGNFYSA  DP+FYCHHSNVDRMW +
Sbjct  308   -GDDPSPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDL  366

Query  1217  WKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             WK + GG RKDI DPDWL +EFLF+DE K LV+VKV+D+LD  KL Y FQ +P PW   +
Sbjct  367   WKKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTR  426

Query  1394  PTrkrraklrskasvsasT-----SVLPATLNKITTFCV-----TRSPTSKTPGKEELLD  1543
              T K   + +S+ +   S      S  P  L+K+ +  V     +RS T K    E L+ 
Sbjct  427   ATPKLTRQEKSRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVI  486

Query  1544  LHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTF  1723
               + +++ Q I+FDV VN++ D      D+ E+AGSF N+ H H   S T        T 
Sbjct  487   EGIEYEENQSIKFDVLVNDEPDSPGGP-DKSEFAGSFVNVPHKHAKKSKT--------TM  537

Query  1724  SLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              L I+ LLEDL  E DD ++VTLVPR GG FVTV     E +
Sbjct  538   VLGITGLLEDLEAEGDDTLVVTLVPRTGGDFVTVANVKIEFV  579



>sp|Q9ZP19.1|PPO1_IPOBA RecName: Full=Polyphenol oxidase I, chloroplastic; Short=PPO-I; 
AltName: Full=Catechol oxidase I [Ipomoea batatas]
 emb|CAA06855.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   422 bits (1085),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 244/505 (48%), Positives = 302/505 (60%), Gaps = 42/505 (8%)
 Frame = +2

Query  359   SPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAID  538
             +PI  PE   C         G  V  +CCP    +      YK+P+ + + VRPAAH +D
Sbjct  1     APIQAPEISKCVVPPADLPPGAVVD-NCCPPVASNIVD---YKLPAVTTMKVRPAAHTMD  56

Query  539   DDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFP  709
              D + K+  A++ MK LP+DDPRNFYQQA VHCAYCNG Y     P    Q+H +WLFFP
Sbjct  57    KDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFP  116

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWYLYFYERIL  LI DP+F LP+WNWDNP GM+LP+ F +D  S LYD  RNQ+H  
Sbjct  117   FHRWYLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPD-FLNDSTSSLYDSNRNQSHLP  175

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMG  1066
               V DL Y G +T  +D Q++ +NLA+MY+QM+TNA    LF GKA R   GD   PG G
Sbjct  176   PVVVDLGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYR--AGDAPSPGAG  233

Query  1067  TIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN--R  1240
             +IE  PH  IHRWVGDPR+ +NE+MGNFYSA  D  FYCHHSNVDRMWTIW+ L G   +
Sbjct  234   SIETSPHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWTIWQQLAGKPRK  293

Query  1241  KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-rkrrak  1417
             +D TD DWL   FLFYDE    VKV++ DSLDN K+GY + K P PW D KP   K++  
Sbjct  294   RDYTDSDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKPVPTKKKGG  353

Query  1418  lrskasvsasTSVLPATLNKITTFCVTRSPTSKTP-------------GKEELLDLHLAF  1558
               SK+      SV P TL+K+    V R   S++              G E  +D +  F
Sbjct  354   YASKSKAPFVASVFPVTLDKVVQVKVARPKKSRSAEEKEAEEEILLIVGIEVEIDKYAKF  413

Query  1559  DDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAIS  1738
             D             D D  +   D+ EYAGSF++L H HK         I+T T SL ++
Sbjct  414   D---------VYLNDSDDPSGGKDKAEYAGSFAHLPHKHK-----GMKKIRT-TLSLGLN  458

Query  1739  elledlrlenddKILVTLVPRAGGS  1813
             E LEDL  E+DD ILVTL P+ GG 
Sbjct  459   EPLEDLGAEDDDTILVTLAPKVGGG  483



>ref|XP_006370115.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
 gb|ERP66684.1| hypothetical protein POPTR_0001s39630g [Populus trichocarpa]
Length=581

 Score =   423 bits (1088),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 269/573 (47%), Positives = 345/573 (60%), Gaps = 47/573 (8%)
 Frame = +2

Query  185   RGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASP  364
             R ++  + C +  ++  +NPA          RR+VL+GLGGLYGA ++   S+PFA A+P
Sbjct  36    RHNIPIVSCKSGKNDHEQNPAT---------RRDVLIGLGGLYGATSL---SDPFAYANP  83

Query  365   IPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDD  541
             I PP+   C   T+   +    P +CCP T   +     ++ PS S  + +RPAAH +D 
Sbjct  84    IAPPDITQCELVTLPTESD---PSNCCPPT---STKIKNFEFPSASSPMRIRPAAHLVDK  137

Query  542   DYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPF  712
              YL KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY  AG P    QIHF+WLFFP+
Sbjct  138   AYLAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPW  197

Query  713   HRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRG  892
             HR YLY++ERIL  LIDDPTF LP+WNWD P GM +P IF D  +SPLYD  R+  H+  
Sbjct  198   HRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTD-PKSPLYDPLRDANHQPP  256

Query  893   YVTDLAYAGQETS---ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGM  1063
              + DL YA  + +   A   +   +NL +MYRQM++ A  P LFFGK  R    D  PGM
Sbjct  257   TLLDLNYAKGDANPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRA-GDDPSPGM  315

Query  1064  GTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL-GGNR  1240
             GTIE  PH  IH W GDP   + ENMGNFYSA  DP+FYCHHSNVDRMW +WK + GG R
Sbjct  316   GTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKR  375

Query  1241  KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrakl  1420
             KDI DPDWL +EFLF+DE K LV+VKV+D+LD  KL Y FQ +P PW   + T K   + 
Sbjct  376   KDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKARATPKFTRQE  435

Query  1421  rskasvsasT-----SVLPATLNKITTFCV-----TRSPTSKTPGKEELLDLHLAFDDTQ  1570
             +S+ S   S      S  P  L+K+ +  V     +RS T K    E L+   + +++ Q
Sbjct  436   KSRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQ  495

Query  1571  FIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelle  1750
              I+FDV VN++ D      D+ E+AGSF N+ H H   S T        T  L I+ LLE
Sbjct  496   LIKFDVLVNDEPDSPGGP-DKSEFAGSFINVPHKHAKKSKT--------TMVLGITGLLE  546

Query  1751  dlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
             DL  E DD ++VTLVPR GG  VTV     E +
Sbjct  547   DLEAEGDDTLVVTLVPRTGGDSVTVANVKIEFV  579



>ref|XP_003541740.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=601

 Score =   423 bits (1087),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 255/580 (44%), Positives = 347/580 (60%), Gaps = 39/580 (7%)
 Frame = +2

Query  170   SRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPF  349
             +R  +R  + +  C+   +    NP++  LS     RRNVLLGLGGL GA  +   +NPF
Sbjct  39    NRKPKRHHIPRTTCSENQNNPTPNPSEGELSHIVGHRRNVLLGLGGLCGAVTLN--NNPF  96

Query  350   ALASPIPPPETKSCGPA-TISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
             A A+PI PP+  +CGP  T + +N    P +CCP +   +   D+   PS   L VRPAA
Sbjct  97    AFAAPISPPDLNTCGPPDTPAGAN----PTNCCPPS---SKIIDFKFPPSNQPLRVRPAA  149

Query  527   HAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTW  697
             H ++D+YL KYK A+  MK LPSDDPRNF QQANVHCAYC+GAY   G P    QIH +W
Sbjct  150   HLVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQIHNSW  209

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LFFPFHRWYLYFYE+IL SLI+DPTF LP+WNWD P GM LP I+ D  +SPLYD  RN 
Sbjct  210   LFFPFHRWYLYFYEKILGSLINDPTFALPFWNWDAPDGMQLPSIYAD-PKSPLYDTLRNA  268

Query  878   AHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-G  1054
              H+   + DL +  ++  ++   K+ NNL IMYRQ+++N   P LF G   R   GD   
Sbjct  269   NHQPPTLVDLDFNLEDPISNG--KISNNLTIMYRQVVSNGKTPTLFLGNPYR--AGDEPD  324

Query  1055  PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG  1234
             PG G++ENVPH S+H W GD   P+ E+MG FYSAA DP+F+ HHSN+DRMW+IWKTLGG
Sbjct  325   PGFGSVENVPHGSVHLWTGDINQPNIEDMGTFYSAARDPIFFSHHSNIDRMWSIWKTLGG  384

Query  1235  NRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrra  1414
              RKD TD DWL++ FLFYDE K LV+VKV+D LD  KLGY +Q +  PW + +PT +R  
Sbjct  385   KRKDFTDSDWLESGFLFYDENKNLVRVKVKDCLDERKLGYVYQDVDIPWLNSRPTPRRSR  444

Query  1415  klrskasvsasTSV-----------LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFD  1561
               +   + +                 P  L+ + +  V R   S++  ++E  +  L  +
Sbjct  445   VQKVALAQNFGVGAARAAETSRNVKFPLVLDSVVSTMVKRPNKSRSRKEKEEEEEVLVIE  504

Query  1562  DTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSL  1729
               +F R      +    +  +     D  E+AGSF ++ H HK  +    + ++     L
Sbjct  505   GIEFERNTPVKFDVFINDEDDKQIRPDNTEFAGSFVSVPHSHKHKNKDIITCLR-----L  559

Query  1730  AISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              +++LLE+L  E+DD + VTLVPR G   V +     +++
Sbjct  560   GLTDLLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKIKLL  599



>ref|XP_006370125.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
 gb|ERP66694.1| hypothetical protein POPTR_0001s39920g [Populus trichocarpa]
Length=581

 Score =   422 bits (1084),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 254/523 (49%), Positives = 315/523 (60%), Gaps = 37/523 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATI-SNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LN  511
             S+PFA A+PI PP+   C   T+ S SN    P +CCP T   +     ++ PS S  + 
Sbjct  75    SDPFAYANPIAPPDITQCELVTLPSESN----PTNCCPQT---STKIKNFEFPSASSPMR  127

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQ  682
             +RPAAH +D   L KY  AI  MK LP DDPR+F  QANVHCAYC+GAY  AG P    Q
Sbjct  128   IRPAAHLVDKASLAKYAKAIALMKSLPDDDPRSFKSQANVHCAYCDGAYHQAGFPDLELQ  187

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             IHF+WLFFP+HR YLY++ERIL  LIDDPTF LP+WNWD P GM +P IF D  +SPLYD
Sbjct  188   IHFSWLFFPWHRAYLYYFERILGKLIDDPTFALPFWNWDAPAGMQIPAIFTD-PKSPLYD  246

Query  863   KKRNQAHRRGYVTDLAYAGQETS---ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIR  1033
               R+  H+   + DL YA  + +   A   +   +NL +MYRQM++ A  P LFFGK  R
Sbjct  247   PLRDANHQPPTLFDLNYATGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYR  306

Query  1034  KETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWT  1213
                 D  PGMGTIE  PH  IH W GDP     ENMGNFYSA  DP+FYCHHSNVDRMW 
Sbjct  307   A-GDDPSPGMGTIETTPHTQIHIWTGDPNQTKGENMGNFYSAGRDPIFYCHHSNVDRMWD  365

Query  1214  IWKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDF  1390
             +WK + GG RKDI DPDWL +EFLF+DE K LV+VKV+D+LD  KLGY FQ +P PW   
Sbjct  366   LWKKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQDVPIPWLTT  425

Query  1391  KPTrkrraklrskasvsasT-----SVLPATLNKITTFCV-----TRSPTSKTPGKEELL  1540
             + T K   + +S  +   S      S  P  L+K+ +  V     +RS T K    E L+
Sbjct  426   RATPKLTRQEKSSRAAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLV  485

Query  1541  DLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
                + +++ Q I+FDV VN++ D      D  E+AGSF N+ H H   S T        T
Sbjct  486   IEGIEYEENQLIKFDVLVNDEPDSPGGP-DMSEFAGSFVNVPHKHAKKSKT--------T  536

Query  1721  FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
               L I+ LLEDL  E DD ++VT VPR GG  VTV     E +
Sbjct  537   MVLGITGLLEDLEAEGDDTLVVTFVPRTGGDSVTVANVKIEFV  579



>ref|XP_010245321.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=597

 Score =   422 bits (1084),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 258/563 (46%), Positives = 335/563 (60%), Gaps = 36/563 (6%)
 Frame = +2

Query  194   VIKIRCAAASSEGRENPADSSLSEA---KLDRRNVllglgglygayniaggSNPFALASP  364
             V K+ C A  ++G + P  S   E    +LDRRNVL+GLGGLYGA  +   ++  A  +P
Sbjct  45    VRKVSCEA--TDGEKKPTRSGNEEGSLGRLDRRNVLIGLGGLYGATGLG--ADRLAFGAP  100

Query  365   IPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDD  541
             I PP+   CG A +  +  KP   +CCP    +      +K+PS S+ + VRPAAH +D+
Sbjct  101   IMPPDLSKCGAANLP-AGAKPT--NCCPPASSEIVD---FKLPSSSEPMRVRPAAHMVDE  154

Query  542   DYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPF  712
             +Y+ KY  AI  MK LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +WLFFPF
Sbjct  155   EYIAKYSKAIALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLELQVHNSWLFFPF  214

Query  713   HRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRG  892
             HR+YLYFYER+L  LIDDPTF LPYWNWD P GM +P ++ +   SPLYDK R+  H+  
Sbjct  215   HRYYLYFYERMLGKLIDDPTFALPYWNWDAPAGMKMPTMYAN-PNSPLYDKLRDAKHQPP  273

Query  893   YVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGT  1069
              + DL Y  Q+T+ +  Q +KNNLA MYRQ+++N     LF G   R   GD   PG G+
Sbjct  274   TMIDLNYNVQDTTMTPEQLLKNNLATMYRQVVSNGSTAQLFLGSPYR--AGDQPDPGFGS  331

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDI  1249
             +ENVPH  +H W GD   P+ ENMGNFYSAA DP+FY HHSNVDRMWTIWK LGG RKD 
Sbjct  332   LENVPHGPVHLWAGDRTQPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLGGRRKDF  391

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrsk  1429
              DPDWL   FL YDE K LV+VKV D LD  KL Y++Q +  PW   +PT  +      K
Sbjct  392   KDPDWLNAGFLLYDENKQLVRVKVRDCLDEKKLRYSYQDVEIPWMKTRPTPGKLMAAAQK  451

Query  1430  --------asvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfd  1585
                          + S  P  L+      V R   S++  ++E  +  L  D  +  R  
Sbjct  452   LKITDRGLKKKKPTVSEFPKELDAPFKVVVKRPRKSRSKKEKEDEEEILVIDQVELERDT  511

Query  1586  vfvnedddvnTKEL--DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlr  1759
             V   +    +  E   D+ E+AGSF N+ H H    +   + ++       ISELLEDL 
Sbjct  512   VVKFDVYINDEDEPSPDKSEFAGSFVNVPHKHGKKMSKLKTCLR-----FGISELLEDLE  566

Query  1760  lenddKILVTLVPRAGGSFVTVN  1828
              E+DD+++VT+VPR GG  VT+ 
Sbjct  567   AEDDDEVVVTIVPRIGGDLVTIG  589



>ref|XP_003545882.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=602

 Score =   422 bits (1084),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 238/523 (46%), Positives = 314/523 (60%), Gaps = 35/523 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             +NPFA A+PI PP+  +CGP  +        P +CCP +   +   D+   PS   L VR
Sbjct  94    NNPFAFAAPISPPDLNTCGPPDLP---AGVKPTNCCPPS---SKIIDFKFSPSNQPLRVR  147

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH ++D+YL KYK A+  MK LPSDDPRNF QQANVHCAYC+GAY   G P    Q+H
Sbjct  148   PAAHLVNDEYLAKYKKALDLMKKLPSDDPRNFTQQANVHCAYCDGAYHQVGFPDLDLQVH  207

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFPFHRWYLYFYERIL SLI+DPTF LP+WNWD P+GM LP I+ D  +SPLYD  
Sbjct  208   NSWLFFPFHRWYLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYAD-PKSPLYDTL  266

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             RN  H+   + DL +  ++  ++   K+ NNL IMYRQ+++N   P LF G   R   GD
Sbjct  267   RNANHQPPTLVDLDFNLEDPISNG--KISNNLTIMYRQVVSNGKTPTLFLGNPYR--AGD  322

Query  1049  T-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
                PG G++ENVPH  +H W GD   P+ ENMG FYSAA DP+FY HHSN+DRMW+IWKT
Sbjct  323   EPDPGFGSVENVPHGPVHLWTGDINQPNIENMGTFYSAARDPIFYSHHSNIDRMWSIWKT  382

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrk  1405
             LGG R+D TD DWL++ FLFYDE K LV+VKV+DSLD  KLGY +Q +  PW + KPT +
Sbjct  383   LGGKRRDFTDSDWLESAFLFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIPWLNSKPTPR  442

Query  1406  rraklrskasvsasTSV-----------LPATLNKITTFCVTRSPTSKTPGKEELLDLHL  1552
             R    +   + +                 P  L+ + +  V R   S++  ++E  +  L
Sbjct  443   RSRVQKVALAQNFGVGAAHAAETSRNVKFPLVLDSVVSTMVKRPNKSRSKKEKEEEEEVL  502

Query  1553  AFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
               +  +F R      +    +  +     D  E+AGSF ++ H H       N  I T  
Sbjct  503   VIEGIEFERNTPVKFDVFINDEDDKQIRPDNTEFAGSFVSVPHSH----MHKNKDIIT-C  557

Query  1721  FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
               L +++LLE+L  E+DD + VTLVPR G   V +     E++
Sbjct  558   LRLGLTDLLEELEAEDDDSVRVTLVPRYGKGRVKIRGIKIELL  600



>emb|CAC83609.1| catechol oxidase [Ipomoea batatas]
Length=496

 Score =   418 bits (1074),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 243/510 (48%), Positives = 300/510 (59%), Gaps = 42/510 (8%)
 Frame = +2

Query  359   SPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAID  538
             +PI  PE   C         G  V  +CCP    +      YKIP  + + VRPAAH +D
Sbjct  1     APIQAPEISKCVVPPADLPPGAVVD-NCCPPVASNIVD---YKIPVVTTMKVRPAAHTMD  56

Query  539   DDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFP  709
              D + K+  A+  M+ LP DDPRNFYQQA VHCAYCNG Y     P    Q+H +WLFFP
Sbjct  57    KDAIAKFARAVDLMRALPGDDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFP  116

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWYLYFYERIL  LI DP+F LP+WNWDNP GM+LP+ F +D  S LYD  RNQ+H  
Sbjct  117   FHRWYLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPD-FLNDSTSSLYDSNRNQSHLP  175

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMG  1066
               V DL Y G +T  +D Q++ +NLA+MY+QM+TNA    LF GKA R   GD   PG G
Sbjct  176   PVVVDLGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYR--AGDAPSPGAG  233

Query  1067  TIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN--R  1240
             +IE  PH  IHRWVGDPR+ +NE+MGNFYSA  D  FYCHHSNVDRMW IW+ L G   +
Sbjct  234   SIETSPHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWAIWQQLAGKPRK  293

Query  1241  KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-rkrrak  1417
             +D TD DWL   FLFYDE    VKV++ DSLDN K+GY + K P PW D KP   K++  
Sbjct  294   RDYTDSDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKPVPTKKKGG  353

Query  1418  lrskasvsasTSVLPATLNKITTFCVTRSPTSKT-------------PGKEELLDLHLAF  1558
               SK+      SV P TL+K+    V R   S++              G E  +D +  F
Sbjct  354   YASKSKAPFVASVFPVTLDKVVQVKVARPKKSRSAEEKEAEEEILLIEGVEVEIDKYAKF  413

Query  1559  DDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAIS  1738
             D             D D  +   D+ EYAGS ++L H HK         I+T T SL ++
Sbjct  414   D---------VYLNDSDDPSGGKDKAEYAGSSAHLPHKHK-----GMKKIRT-TLSLGLN  458

Query  1739  elledlrlenddKILVTLVPRAGGSFVTVN  1828
             E LEDL  E+DD ILV L P+ GG  V+V+
Sbjct  459   EPLEDLGAEDDDTILVALAPKVGGGVVSVD  488



>sp|Q08303.2|PPOA_SOLLC RecName: Full=Polyphenol oxidase A, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78295.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=630

 Score =   422 bits (1086),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 261/573 (46%), Positives = 349/573 (61%), Gaps = 44/573 (8%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       +R    K+ C   ++ G ++  +S      +DRRNVLLGLGGLYG  N
Sbjct  32    QLFLH------GKRNKTFKVSCKVTNTNGNQDETNS------VDRRNVLLGLGGLYGVAN  79

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
                 +   A   P    +  SC    I+ +    VPY CC     D +   YYK PS +K
Sbjct  80    AIPLAASAAPTPPP---DLSSCNKPKINATT--EVPYFCCAPKPDDMSKVPYYKFPSVTK  134

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPS---DDPRNFYQQANVHCAYCNGAYQLAGKP  676
             L +RP AHA+D+ Y+ KY  AI +MKDL     D+P  F QQAN+HCAYCNG Y + GK 
Sbjct  135   LRIRPPAHALDEAYIAKYNLAISRMKDLDKTQPDNPIGFKQQANIHCAYCNGGYSIDGKV  194

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+H +WLFFPFHRWYLYFYERIL SLIDDPTF LP+WNWD+P+GM  P +F D   + L
Sbjct  195   LQVHNSWLFFPFHRWYLYFYERILGSLIDDPTFGLPFWNWDHPKGMRFPPMF-DVPGTAL  253

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD++R      G   DL Y G +   +  Q + NNL +MYRQ++TN+PCPL+        
Sbjct  254   YDERRGDQIHNGNGIDLGYFGDQVETTQLQLMTNNLTLMYRQLVTNSPCPLMSLVDLTL-  312

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRS--------PHNENMGNFYSAAIDPVFYCHHS  1192
               G T    GT+EN+PH+ +H WVG  R          + E+MGNFYSA +DP+FYCHHS
Sbjct  313   -FGSTVEDAGTVENIPHSPVHIWVGTRRGSVLPVGKISNGEDMGNFYSAGLDPLFYCHHS  371

Query  1193  NVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMP  1372
             NVDRMW  WK  GG R DI + DWL +EF FYDE     KV+V D LD  K+GY +    
Sbjct  372   NVDRMWNEWKATGGKRTDIQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYHATA  431

Query  1373  TPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTP----GKEEL  1537
             TPW++FKP  K  A   +  S+   + V P A L+K  +F + R  +S+T      +EE+
Sbjct  432   TPWRNFKPKTKASAGKVNTGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEV  491

Query  1538  LDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHK--DTSTTANSTI  1708
             L  + + +D+  +IRFDVF+N D++VN  ELD+ E+AGS+++L HVH+  D   TA +T+
Sbjct  492   LTFNAIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDPKHTATATL  551

Query  1709  KTPTFSLAISelledlrlenddKILVTLVPRAG  1807
             +     LAI+ELLED+ LE++D I VTLVP+ G
Sbjct  552   R-----LAITELLEDIGLEDEDTIAVTLVPKKG  579



>gb|AAU12256.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=581

 Score =   421 bits (1081),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 251/522 (48%), Positives = 317/522 (61%), Gaps = 35/522 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             S+PFA A+PI PP+   C   T+   +    P +CCP T   +     ++ PS S  + +
Sbjct  75    SDPFAYANPIAPPDITQCELVTLPTESD---PSNCCPPT---STKIKNFEFPSASSPMRI  128

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAH +D  YL KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY  AG P    QI
Sbjct  129   RPAAHLVDKAYLAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQI  188

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             HF+WLFFP+HR YLY++ERIL  LIDDPTF LP+W+WD P GM +P IF D  +SPLYD 
Sbjct  189   HFSWLFFPWHRLYLYYFERILGKLIDDPTFALPFWSWDAPAGMQMPAIFTD-PKSPLYDP  247

Query  866   KRNQAHRRGYVTDLAYAGQETS---ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
              R+  H+   + DL YA  + +   A   +   +NL +MYRQM++ A  P LFFGK  R 
Sbjct  248   LRDANHQPPTLLDLNYAKGDANPDPAKAGELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
                D  PGMGTIE  PH  IH W GDP   + ENMGNFYSA  DP+FYCHHSNVDRMW +
Sbjct  308   -GDDPSPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDL  366

Query  1217  WKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             WK + GG RKDI DPDWL +EFLF+DE K LV+VKV+D+LD  KL Y FQ +P PW   +
Sbjct  367   WKKIPGGKRKDIEDPDWLNSEFLFWDENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKAR  426

Query  1394  PTrkrraklrskasvsasT-----SVLPATLNKITTFCV-----TRSPTSKTPGKEELLD  1543
              T K   + +S+ S   S      S  P  L+K+ +  V     +RS T K    E L+ 
Sbjct  427   ATPKFTRQEKSRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVI  486

Query  1544  LHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTF  1723
               + +++ Q I+FDV VN++ D      D+ E+AGSF N+ H H   S T        T 
Sbjct  487   EGIEYEENQLIKFDVLVNDEPDSPGGP-DKSEFAGSFINVPHKHAKKSKT--------TM  537

Query  1724  SLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              L I+ LLEDL  E DD ++VTLVPR GG  VTV     E +
Sbjct  538   VLGITGLLEDLEAEGDDTLVVTLVPRTGGDSVTVANVKIEFV  579



>ref|XP_008371334.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08582.1| polyphenol oxidase IIb [Malus domestica]
Length=600

 Score =   421 bits (1082),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 272/557 (49%), Positives = 347/557 (62%), Gaps = 34/557 (6%)
 Frame = +2

Query  203   IRCAAAS---SEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPP  373
             I C A +   +E +  P  SS    KLDRRNVL+GLGGLYGA  +A    P A A+P+ P
Sbjct  53    ISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLIGLGGLYGATTLA--QKPLAFATPLAP  110

Query  374   PETKSCGPATISNSNGKPVPYSCCP--STLMDTASADYYKIPSFSKLNVRPAAHAIDDDY  547
             P+   C  A I+ + G+ V  +CCP  ST + T + D   IP    L  RPAAH + D+Y
Sbjct  111   PDLTKCTLAEIT-TGGETV--ACCPPVSTKIKTFTXDQ-SIP----LRTRPAAHLVTDEY  162

Query  548   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHR  718
             L K+K A   M+ LP DDPR+  QQA VHCAYCNGAY   G P    Q+HF+WLFFPFHR
Sbjct  163   LAKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHR  222

Query  719   WYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYV  898
              YLYFYERIL  LIDDPTF LPYWNWD+P G  +P+I+ D   SPLYD+ R+  H+   +
Sbjct  223   MYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTD-TTSPLYDQYRHAGHQPPVL  281

Query  899   TDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIEN  1078
              DL+Y G +    D  ++  NLAIMYRQM++ A  P LFFG   R     TG   GTIEN
Sbjct  282   VDLSYGGTDDDVDDQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGETTTGKYAGTIEN  341

Query  1079  VPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDP  1258
              PHN+IH W GDP  P+ E+MGNFYSA  DP+FY HH NVDRMW IWKTLGG RKD TD 
Sbjct  342   NPHNNIHLWCGDPNQPNKEDMGNFYSAGRDPLFYAHHCNVDRMWNIWKTLGGKRKDPTDT  401

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVK-LGYTFQKMPTPWKDFKPTrkr-raklrska  1432
             DWL  EFLFYDE   LV  KV DS+   K L YT++ +  PW   KPT ++ R K ++K 
Sbjct  402   DWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAKV  461

Query  1433  svsasTSVLPATLNKITTFCVTRSPTSKTPGKEE------LLDLHLAFDDTQFIRfdvfv  1594
             S +  T+  PAT +  TT  V R    K   KE+      L+   + F+  + ++FDVF+
Sbjct  462   SATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVFI  521

Query  1595  nedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlendd  1774
             N+D +  +++ D+ E+AGSF ++ H  K T T   + +K     L I++LLEDL +E+D 
Sbjct  522   NDDAESLSRK-DKSEFAGSFVHVPHNQK-TGTKTKTNLK-----LGITDLLEDLGVEDDS  574

Query  1775  KILVTLVPRAGGSFVTV  1825
              +LVTLVPR   S +TV
Sbjct  575   SVLVTLVPRVSNSPITV  591



>ref|XP_006370118.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
 gb|ERP66687.1| hypothetical protein POPTR_0001s39660g [Populus trichocarpa]
Length=581

 Score =   420 bits (1079),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 249/522 (48%), Positives = 318/522 (61%), Gaps = 35/522 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             S+PFA A+PI PP+   C    + + +    P +CCP T  +  +   ++ PS S  + +
Sbjct  75    SDPFAYANPIAPPDITQCELVPLPSESD---PSNCCPPTSTEIKN---FEFPSASSPMRI  128

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAH +D  Y+ KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY  AG P    QI
Sbjct  129   RPAAHLVDQAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLELQI  188

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             HF+WLFFP+HR YLY++ERIL  LIDDPTF LP+WNWD P GM +P IF D  ESPLYD 
Sbjct  189   HFSWLFFPWHRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTD-PESPLYDP  247

Query  866   KRNQAHRRGYVTDLAYAGQETS---ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
              R+  H+   + DL YA  + +   A   +   +NL +MYRQM++ A  P LFFGK  R 
Sbjct  248   LRDANHQPPTLLDLNYAKGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
                D  PGMGTIE  PH  IH W GDP   + ENMGNFYSA  DP+FYCHHSNVDRMW +
Sbjct  308   -GDDPSPGMGTIETTPHTQIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDL  366

Query  1217  WKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             WK + GG R+DI D DWL +EFLF+DE K LV+VKV+D+LD  KLGY FQ +P PW   +
Sbjct  367   WKKIPGGKREDIEDSDWLNSEFLFWDENKELVRVKVKDTLDTKKLGYGFQDVPIPWLTTR  426

Query  1394  PTrkrraklrskasvsasT-----SVLPATLNKITTFCV-----TRSPTSKTPGKEELLD  1543
              T K   + +S+ +   S      S  P  L+K+ +  V     +RS T K    E L+ 
Sbjct  427   ATPKLTRQEKSRRAAEKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVI  486

Query  1544  LHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTF  1723
               + +++ Q I+FDV VN++ D      D  E+AGSF N+ H H   S T        T 
Sbjct  487   EGIEYEENQLIKFDVLVNDEPDSPGGP-DNSEFAGSFVNVPHKHAKKSKT--------TM  537

Query  1724  SLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              L I+ LLEDL  E DD ++VTLVPR+GG  VTV     E +
Sbjct  538   VLGITGLLEDLEAEGDDTLVVTLVPRSGGDSVTVANVKIEFV  579



>ref|XP_011002749.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=581

 Score =   420 bits (1079),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 247/522 (47%), Positives = 318/522 (61%), Gaps = 35/522 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             S+PFA A+PI  P+   C   T+ + +    P +CCP T   +     ++ PS S  + +
Sbjct  75    SDPFAYANPIAAPDITQCELVTLPSESD---PSNCCPPT---STKIKNFEFPSASSPMRI  128

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAH +D  Y+ KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY  AG P    QI
Sbjct  129   RPAAHLVDKAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQI  188

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             HF+WLFFP+HR YLY++ERIL  LIDDPTF LP+WNWD P GM +P IF D  +SPLYD 
Sbjct  189   HFSWLFFPWHRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTD-PQSPLYDP  247

Query  866   KRNQAHRRGYVTDLAYAGQETS---ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
              R+  H+   + DL YA  + +   A   +   +NL +MYRQM++ A  P LFFGK  R 
Sbjct  248   LRDANHQPPTLLDLNYAKGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRA  307

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
                D  PGMGTIE  PH  IH W GDP   + ENMGNFYSA  DP+FYCHHSNVDRMW +
Sbjct  308   -GDDPSPGMGTIETTPHTEIHYWTGDPNQTNGENMGNFYSAGRDPIFYCHHSNVDRMWDL  366

Query  1217  WKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             WK + GG RKDI DPDWL +EFLF++E K LV+VKV+D+LD  KL Y FQ +P PW   +
Sbjct  367   WKKIPGGKRKDIEDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTR  426

Query  1394  PTrkrraklrskasvsasT-----SVLPATLNKITTFCV-----TRSPTSKTPGKEELLD  1543
             PT K   + + + +   S      S  P  L+K+ +  V     +RS T K    E L+ 
Sbjct  427   PTPKLTRQEKLRRAAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKENEDEVLVI  486

Query  1544  LHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTF  1723
               + +++ Q I+FDV VN++ D      D+ E+AGSF N+ H H   S T        T 
Sbjct  487   EGIEYEENQLIKFDVLVNDEPDSPGGP-DKSEFAGSFVNVPHKHAKKSKT--------TM  537

Query  1724  SLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              L I+ LLEDL  E DD ++VT VPR+GG  VTV     E++
Sbjct  538   VLGITGLLEDLEAEGDDTLVVTFVPRSGGDSVTVANVKIELV  579



>gb|AAU12257.1| polyphenol oxidase [Populus trichocarpa x Populus deltoides]
Length=590

 Score =   420 bits (1080),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 244/527 (46%), Positives = 323/527 (61%), Gaps = 38/527 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             S+PFA A+P+  P+   CG A +     +    +CCP  +  T   D+ + PS + L VR
Sbjct  75    SDPFAFAAPVSAPDISKCGRADLPTGANE---TNCCPP-VPSTKILDFKRPPSNAPLRVR  130

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH  D DY+ KYK AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H
Sbjct  131   PAAHLADKDYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVH  190

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFPFHR+YLYFYE+IL  LIDDPTF LP+WNWD+P GM LP ++ D   SPLYD  
Sbjct  191   NSWLFFPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYAD-PHSPLYDSL  249

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             RN+ H+   + DL ++G +T  S+ +++ +NL IMYRQM++N   P LFFG A R   GD
Sbjct  250   RNKNHQPPTLLDLDWSGTDTPTSNEEQLSSNLTIMYRQMVSNGKTPRLFFGGAYR--AGD  307

Query  1049  T-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
               GP  G IEN+PH  +H W GD   P++E+MGNFYSAA DP+F+CHHSNVDRMW++WKT
Sbjct  308   EPGPEPGPIENIPHGPVHIWTGDNTQPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVWKT  367

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT--  1399
             LGG R D+TDPDWL   F FYDE    V+VKV D LD+  LGY +Q +  PW   +PT  
Sbjct  368   LGGRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDVEIPWLQSRPTPR  427

Query  1400  -------------rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE--  1534
                           K       K +     +  P  LNK+ +  V R   S++  ++E  
Sbjct  428   RSAKKVASNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARPKKSRSKKEKEDE  487

Query  1535  ---LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANST  1705
                L+   L FD T+ ++FDV++N++DD  +   D+ E+AGSF N+ H HK      +  
Sbjct  488   EELLVIQGLEFDKTKALKFDVYINDEDDSLSAP-DKTEFAGSFVNVPHKHK------HGK  540

Query  1706  IKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
               T  F LA+++LLEDL +E DD ++VTLVPR G     +     E 
Sbjct  541   KMTTCFRLALTDLLEDLDVEGDDSLIVTLVPRYGKGLAKIGGIKIEF  587



>ref|XP_008225003.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=597

 Score =   420 bits (1080),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 267/534 (50%), Positives = 335/534 (63%), Gaps = 30/534 (6%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
              KLDRRN+L+GLGGLYGA  +     PFA A PI PP+  +C PA I+    + VP  CC
Sbjct  73    GKLDRRNILVGLGGLYGATALD--PKPFAFADPIAPPDLSTCKPAEITPGGSETVP--CC  128

Query  446   P--STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQ  619
             P  +T + T   D   IP    L  RPAAH + D+YL K+K A   M+ LP DDPR+  Q
Sbjct  129   PPVTTKIKTFKPDL-SIP----LRTRPAAHQVTDEYLAKFKKAQAAMRALPDDDPRSMVQ  183

Query  620   QANVHCAYCNGAYQLAG---KPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYW  790
             QA VHCAYCNGAY   G      Q+H++WLFFPFHR YLYFYERIL  LIDDPTF LPYW
Sbjct  184   QAKVHCAYCNGAYPQVGFTDNDIQVHYSWLFFPFHRMYLYFYERILGKLIDDPTFALPYW  243

Query  791   NWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAI  970
             NWD+P G  +P+I+ D   SPLYD+ RN  H+   + DL+Y G +    +  ++  NLAI
Sbjct  244   NWDSPVGFPIPDIYTD-TSSPLYDQYRNADHQPPVLVDLSYGGTDDDVDEQTRIDENLAI  302

Query  971   MYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNF  1150
             MYRQM++ A  P LFFG A R    +T    GTIEN+PHN IH WVGDP   H+E+MGNF
Sbjct  303   MYRQMVSGAKTPDLFFGHAYRAGDLNTQKYPGTIENMPHNDIHIWVGDPTQTHHEDMGNF  362

Query  1151  YSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDS  1330
             YSA  DP+FY HH NVDRMW IWKTLGG RKDITD DWL  EFLFYDE   LV  KV DS
Sbjct  363   YSAGRDPLFYAHHCNVDRMWNIWKTLGGKRKDITDTDWLDAEFLFYDENAELVNCKVRDS  422

Query  1331  LDNVK-LGYTFQKMPTPWKDFKPTrkrra-klrskasvsasTSVLPATLNKITTFCVTRS  1504
             L+  K L Y ++  P PW   KPT ++   K ++K + +  TS  PATL+  TT  V R 
Sbjct  423   LEPEKQLRYNYEPAPLPWLFTKPTARKTKNKTKAKVAATQLTSKFPATLDSKTTVEVARP  482

Query  1505  PTSKTPGK-----EELLDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLA  1666
                K   K     EELL +  + F+ T+ ++FDVF+N+D +  ++  D+ E+AGSF    
Sbjct  483   KPRKRSKKEKVDEEELLIIKDIEFEGTEAVKFDVFINDDAESLSRR-DKSEFAGSF---V  538

Query  1667  HVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVN  1828
             HV +  +T A +        L I++LLEDL  E+D  +LVTLVPR   S +T+ 
Sbjct  539   HVPQGKTTKAKTKT---NLKLGITDLLEDLGAEDDSSVLVTLVPRVSNSPITIG  589



>ref|XP_002316632.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
 gb|EEE97244.1| hypothetical protein POPTR_0011s04710g [Populus trichocarpa]
Length=590

 Score =   420 bits (1080),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 244/527 (46%), Positives = 323/527 (61%), Gaps = 38/527 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             S+PFA A+P+  P+   CG A +     +    +CCP  +  T   D+ + PS + L VR
Sbjct  75    SDPFAFAAPVSAPDISKCGRADLPTGANE---TNCCPP-VPSTKILDFKRPPSNAPLRVR  130

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH  D DY+ KYK AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H
Sbjct  131   PAAHLADKDYIAKYKKAIELMKALPEDDPRSFMQQADVHCAYCNGAYDQVGFPNLEIQVH  190

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFPFHR+YLYFYE+IL  LIDDPTF LP+WNWD+P GM LP ++ D   SPLYD  
Sbjct  191   NSWLFFPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYAD-PNSPLYDSL  249

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             RN+ H+   + DL ++G +T  S+ +++ +NL IMYRQM++N   P LFFG A R   GD
Sbjct  250   RNKNHQPPTLLDLDWSGTDTPTSNEEQLSSNLTIMYRQMVSNGKTPRLFFGGAYR--AGD  307

Query  1049  T-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
               GP  G IEN+PH  +H W GD   P++E+MGNFYSAA DP+F+CHHSNVDRMW++WKT
Sbjct  308   EPGPEPGPIENIPHGPVHIWTGDNTQPNSEDMGNFYSAARDPIFFCHHSNVDRMWSVWKT  367

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT--  1399
             LGG R D+TDPDWL   F FYDE    V+VKV D LD+  LGY +Q +  PW   +PT  
Sbjct  368   LGGRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDSRNLGYVYQDVEIPWLQSRPTPR  427

Query  1400  -------------rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE--  1534
                           K       K +     +  P  LNK+ +  V R   S++  ++E  
Sbjct  428   RSAKKVASNIFGHEKEAIAAEKKKNALTPITAFPLVLNKVISVKVARPKKSRSKKEKEDE  487

Query  1535  ---LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANST  1705
                L+   L FD T+ ++FDV++N++DD  +   D+ E+AGSF N+ H HK      +  
Sbjct  488   EELLVIQGLEFDKTKALKFDVYINDEDDSLSAP-DKTEFAGSFVNVPHKHK------HGK  540

Query  1706  IKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
               T  F LA+++LLEDL +E DD ++VTLVPR G     +     E 
Sbjct  541   KMTTCFRLALTDLLEDLDVEGDDSLIVTLVPRYGKGLAKIGGIKIEF  587



>ref|XP_006370127.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
 gb|ERP66696.1| hypothetical protein POPTR_0001s39940g [Populus trichocarpa]
Length=575

 Score =   419 bits (1078),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 249/522 (48%), Positives = 317/522 (61%), Gaps = 35/522 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             S+PFA A+PI PP+   C   T+   +    P +CCP T   +     ++ PS S  + +
Sbjct  69    SDPFAYANPIAPPDITQCELVTLPTESD---PSNCCPPT---STKIKNFEFPSASSPMRI  122

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAH +D  Y+ KY  AI  MK LP DDPR+F  QA+VHCAYC+GAY  AG P    QI
Sbjct  123   RPAAHLVDKAYVAKYAKAIALMKSLPDDDPRSFKSQADVHCAYCDGAYHQAGFPDLDLQI  182

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             HF+WLFFP+HR YLY++ERIL  LIDDPTF LP+WNWD P GM +P IF D  +SPLYD 
Sbjct  183   HFSWLFFPWHRLYLYYFERILGKLIDDPTFALPFWNWDAPAGMQMPAIFTD-PKSPLYDP  241

Query  866   KRNQAHRRGYVTDLAYAGQETS---ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
              R+  H+   + DL YA  + +   A   +   +NL +MYRQM++ A  P LFFGK  R 
Sbjct  242   LRDANHQPPILLDLNYATGDANPDPAKAEELYASNLNVMYRQMVSGATKPTLFFGKPYRA  301

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
                D  PGMGTIE  PH  IH W GDP   + ENMGNFYSA  DP+F+CHHSNVDRMW +
Sbjct  302   -GDDPSPGMGTIETTPHTEIHFWTGDPNQTNGENMGNFYSAGRDPIFFCHHSNVDRMWDL  360

Query  1217  WKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             WK + GG RKD  DPDWL +EFLF++E K LV+VKV+D+LD  KL Y FQ +P PW   +
Sbjct  361   WKKIPGGKRKDFKDPDWLNSEFLFWNENKELVRVKVKDTLDTKKLRYGFQDVPIPWLKTR  420

Query  1394  PTrkrraklrskasvsasT-----SVLPATLNKITTFCV-----TRSPTSKTPGKEELLD  1543
             PT K   + +S+ S   S      S  P  L+K+ +  V     +RS T K    E L+ 
Sbjct  421   PTPKLTRQEKSRRSAKKSVVLTPISAFPVVLDKVISVEVSRPKKSRSATEKEDEDEVLVI  480

Query  1544  LHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTF  1723
               + +++ Q I+FDV VN++ D      D+ E+AGSF N+ H H   S T        T 
Sbjct  481   EGIEYEENQLIKFDVLVNDEPDSPGGP-DKSEFAGSFVNVPHKHAKKSKT--------TM  531

Query  1724  SLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              L I+ LLEDL  E DD ++VTLVPR GG  VTV     E +
Sbjct  532   VLGITGLLEDLEAEGDDTLVVTLVPRTGGDSVTVANVKIEFV  573



>sp|Q9MB14.2|PPO2_IPOBA RecName: Full=Polyphenol oxidase II, chloroplastic; Short=PPO-II; 
AltName: Full=Catechol oxidase II; Flags: Precursor [Ipomoea 
batatas]
Length=588

 Score =   419 bits (1077),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 265/584 (45%), Positives = 350/584 (60%), Gaps = 64/584 (11%)
 Frame = +2

Query  161   PNPSR----AARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayni  328
             P PS+     A+R    K+ C A + +          S+ KLDRR+VLLGLGGL GA ++
Sbjct  31    PKPSQIHIATAKRTHHFKVSCNAPNGD----------SQPKLDRRDVLLGLGGLAGAASL  80

Query  329   aggSNPFALASPIPPPETKSCGPATISNSNGKP--VPYSCCPSTLMDTASADYYKIP--S  496
                +NP A A PI  PE   C    +   +  P  +  +CCP    +      YK+P  S
Sbjct  81    I--NNPLAFAEPIHAPEISKC---VVPPKDLPPDAIVDNCCPPLATNVIP---YKVPKTS  132

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              S + +RPA H +D +Y+ K++ AI+ MK+LP+DDPRNFYQQA VHCAYCNG Y     P
Sbjct  133   PSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYP  192

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHRWYLYFYERIL  LI DPTF LP+WNWD P GM++P+ F  ++ 
Sbjct  193   DKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYF-RNQN  251

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             SPLYD+ RNQ+H    V DL YAG +T  +D +++ NNLA+MY+ M+TNA    LF GK 
Sbjct  252   SPLYDENRNQSHLP-LVMDLGYAGTDTDVTDQERISNNLALMYKSMVTNAGTAELFLGKP  310

Query  1028  IRKETGDTGPGMGTIENVPHNSIHRWVGD--PRSPHNENMGNFYSAAIDPVFYCHHSNVD  1201
              +        G G+IEN+PH  +HRWVGD  PR+ + E+MGNFYSA  D +FYCHHSNVD
Sbjct  311   YKAGDDPVNKGGGSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVD  370

Query  1202  RMWTIWKTLGGN--RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPT  1375
             RMWTIW+ LGG   R+D TD DWL   F+FYDE K  V+V+V D+LDN KLGY ++    
Sbjct  371   RMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNL  430

Query  1376  PWKDFKPT-rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTP----------  1522
             PW + KP   K++  L +++     T V P TL+K+    V R   S++           
Sbjct  431   PWLNSKPLPTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEIL  490

Query  1523  ---GKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTT  1693
                G E  +D +  FD           +ED+    KE  + EYAGSF++L H H     T
Sbjct  491   EIQGIEVAIDQYAKFD-------VYLNDEDEPEAGKE--KAEYAGSFAHLPHKH-----T  536

Query  1694  ANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTV  1825
              +  I+T + SL ++E LEDL  E+DD +LVTL P+ GG  VTV
Sbjct  537   GSKKIRT-SLSLGLNEPLEDLGAEDDDAVLVTLAPKVGGGVVTV  579



>gb|AAW58109.2| polyphenol oxidase [Prunus salicina var. cordata]
Length=597

 Score =   419 bits (1077),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 262/532 (49%), Positives = 329/532 (62%), Gaps = 26/532 (5%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
              K DRRN+L+GL GLYGA  +     PFA A PI PP+  +C PA I+    + VP  CC
Sbjct  73    GKFDRRNILIGLSGLYGATALD--PKPFAFADPIAPPDLSTCKPAEITPGGSETVP--CC  128

Query  446   PSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQA  625
             P  +    +   +K      L  RPAAH + D+YL K+K A   M+ LP DDPR+  QQA
Sbjct  129   PPVMTKIKT---FKPDLSIPLRTRPAAHQVTDEYLAKFKKAQAAMRALPDDDPRSMVQQA  185

Query  626   NVHCAYCNGAYQLAG---KPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNW  796
              VHCAYCNGAY   G      Q+HF+WLFFPFHR YLYFYERIL  LIDDPTF LPYWNW
Sbjct  186   KVHCAYCNGAYPQVGFTDNDIQVHFSWLFFPFHRMYLYFYERILGKLIDDPTFALPYWNW  245

Query  797   DNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMY  976
             D+P G  +P+I+ D   SPLYDK RN  H+   + DL+Y G      +  ++  NLAIMY
Sbjct  246   DSPVGFPIPDIYTD-PSSPLYDKYRNADHQPPVLVDLSYGGTNDDVDEQTRIDENLAIMY  304

Query  977   RQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYS  1156
             RQM++ A  P LFFG A R    +T    GTIEN+PHN+IH WVGDP   H+E+MGNFYS
Sbjct  305   RQMVSGAKNPDLFFGHAYRAGDLNTQKYPGTIENMPHNNIHIWVGDPTQTHHEDMGNFYS  364

Query  1157  AAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLD  1336
             A  DP+FY HH NVDRMW IWKTLGG RKDITD DWL  EFLFYDE   LV  KV DSL+
Sbjct  365   AGRDPLFYAHHCNVDRMWNIWKTLGGKRKDITDTDWLDAEFLFYDENAELVNCKVRDSLE  424

Query  1337  NVK-LGYTFQKMPTPWKDFKPTrkrra-klrskasvsasTSVLPATLNKITTFCVTRSPT  1510
               K L Y ++  P PW   KPT ++   K ++K + +  TS  PATL+  TT  V R   
Sbjct  425   PEKQLRYNYEPAPLPWLFTKPTARKTKNKTKAKVAATQLTSKFPATLDSKTTVEVARPKP  484

Query  1511  SKTPGK-----EELLDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHV  1672
              K   K     EELL +  + F+ T+ ++FDVF+N+D +  ++  D+ E+AGSF    HV
Sbjct  485   RKRSKKEKVDEEELLIIKDIEFEGTEAVKFDVFINDDAESLSRR-DKSEFAGSF---VHV  540

Query  1673  HKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVN  1828
              +  +  A +        L I++LLEDL  E+D  +LVTLVPR   S +T+ 
Sbjct  541   PQGKTKKAKTKT---NLKLGITDLLEDLGAEDDSSVLVTLVPRISNSPITIG  589



>sp|Q08305.1|PPOC_SOLLC RecName: Full=Polyphenol oxidase C, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Solanum lycopersicum]
 emb|CAA78297.1| polyphenol oxidase precursor [Solanum lycopersicum]
Length=626

 Score =   419 bits (1078),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 265/573 (46%), Positives = 352/573 (61%), Gaps = 44/573 (8%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FL+       +R    K+ C   ++ G ++  +S      +DRRNVLLGLGGLYG  N
Sbjct  28    QLFLH------GKRNKAFKVSCKVTNTNGNQDETNS------VDRRNVLLGLGGLYGVAN  75

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
                 +   A A+P PPP+  SC  A I  +  + V YSCC     D     YYK PS +K
Sbjct  76    AIPLA---ASAAPTPPPDLSSCSIARIDEN--QVVSYSCCAPKPDDMEKVPYYKFPSMTK  130

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPS---DDPRNFYQQANVHCAYCNGAYQLAGKP  676
             L VR  AH  D++Y+ KY  A+ KMKDL     D+P  F QQAN+HCAYCNG Y + GK 
Sbjct  131   LRVRQPAHEADEEYIAKYNCAVTKMKDLDKTQPDNPIGFKQQANIHCAYCNGGYSIDGKV  190

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+H +WLFFPFHRWYLYFYERIL SLIDDPTF LP+WNWD+P+GM  P +F D   + L
Sbjct  191   LQVHNSWLFFPFHRWYLYFYERILGSLIDDPTFGLPFWNWDHPKGMRFPPMF-DVPGTAL  249

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD++R      G   DL Y G +   +  Q + NNL +MYRQ++TN+PCPL+        
Sbjct  250   YDERRGDQIHNGNGIDLGYFGDQVETTQLQLMTNNLTLMYRQLVTNSPCPLMSLVDLTL-  308

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRS--------PHNENMGNFYSAAIDPVFYCHHS  1192
               G T    GT+EN+PH+ +H WVG  R          + E+MGNFYSA +DP+FYCHHS
Sbjct  309   -FGSTVEDAGTVENIPHSPVHIWVGTRRGSVLPVGKISNGEDMGNFYSAGLDPLFYCHHS  367

Query  1193  NVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMP  1372
             NVDRMW  WK  GG R DI + DWL +EF FYDE     KV+V D LD  K+GY +    
Sbjct  368   NVDRMWNEWKATGGKRTDIQNKDWLNSEFFFYDENGNPFKVRVRDCLDTKKMGYDYHATA  427

Query  1373  TPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTP----GKEEL  1537
             TPW++FKP  K  A   +  S+   + V P A L+K  +F + R  +S+T      +EE+
Sbjct  428   TPWRNFKPKTKASAGKVNTGSIPPESQVFPLAKLDKAISFSINRPASSRTQQEKNAQEEV  487

Query  1538  LDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHK--DTSTTANSTI  1708
             L  + + +D+  +IRFDVF+N D++VN  ELD+ E+AGS+++L HVH+  D   TA +T+
Sbjct  488   LTFNAIKYDNRDYIRFDVFLNVDNNVNANELDKAEFAGSYTSLPHVHRVGDPKHTATATL  547

Query  1709  KTPTFSLAISelledlrlenddKILVTLVPRAG  1807
             +     LAI+ELLED+ LE++D I VTLVP+ G
Sbjct  548   R-----LAITELLEDIGLEDEDTIAVTLVPKKG  575



>ref|XP_004293528.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=607

 Score =   419 bits (1076),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 256/581 (44%), Positives = 340/581 (59%), Gaps = 50/581 (9%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAK-----LDRRNVllglgglygayniaggSNPFALASP  364
             ++ C A +S+  +NP+++S ++A+     LDRRNVLLGLGGLYG   +   ++PFA A P
Sbjct  47    RVSCKATNSD--QNPSNNS-NDAQPLGRTLDRRNVLLGLGGLYGVAGLG--TDPFAFAKP  101

Query  365   IPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD  544
             + PP+   CG A +     K     CCP           +++P  SKL VRPAAHA+D  
Sbjct  102   VAPPDVSKCGAADLPTGAQK---TDCCPPVAKKIFD---FQLPPQSKLRVRPAAHAVDKA  155

Query  545   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFH  715
             Y+EKY  AI+ MK LP DDPR+F QQAN+HCAYC+GAY  AG P    QIH +WLFFPFH
Sbjct  156   YIEKYSKAIELMKALPDDDPRSFKQQANIHCAYCDGAYDQAGFPDLELQIHGSWLFFPFH  215

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             R+YLYFYERIL  LI+DP+F LP+WNWD P GM LP +F +  +SPLYDK RN  H+   
Sbjct  216   RYYLYFYERILGKLINDPSFALPFWNWDAPAGMQLPGMFAN-PKSPLYDKFRNANHQPPK  274

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTI  1072
             + DL Y  ++ + SD  ++  NL IMYRQM++NA  P LFFG   R   GD   PG G I
Sbjct  275   LIDLNYNLKDANVSDETQINTNLKIMYRQMVSNAKNPKLFFGNPYR--AGDEPSPGGGAI  332

Query  1073  ENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDIT  1252
             E  PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDR+WT+WKTLGG R+D T
Sbjct  333   ETTPHGPVHIWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWTVWKTLGGKREDFT  392

Query  1253  DPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-----------  1399
             D DWL + FLFYDE   +V+VKV D LD+ KLGY +Q +  PW   KPT           
Sbjct  393   DSDWLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDVDIPWTSHKPTPRRVKDVIKKF  452

Query  1400  -----rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLH-LAFD  1561
                      A     ++   + +  P +L    +  V R    K   KE+  +   L   
Sbjct  453   GHKLHGHGVAHAAETSTKVVAGAHFPISLASKISIAVARPQQKKRSQKEKDHEEEVLVIQ  512

Query  1562  DTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSL  1729
               +F R      +    +  +L    D+ E+AGSF ++ H HK T    N+ ++     L
Sbjct  513   GIEFDRDVGVKFDVYVNDEDDLPSGPDKSEFAGSFVSVPHRHKHTKKI-NTVLR-----L  566

Query  1730  AISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
              +++LLEDL  E+D+ I+VTL+PR G   V +     E  D
Sbjct  567   GLTDLLEDLDAEDDETIVVTLIPRYGAEHVKIGGIKIEFAD  607



>ref|XP_007148200.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
 gb|ESW20194.1| hypothetical protein PHAVU_006G188500g [Phaseolus vulgaris]
Length=576

 Score =   417 bits (1073),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 231/533 (43%), Positives = 316/533 (59%), Gaps = 32/533 (6%)
 Frame = +2

Query  170   SRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPF  349
             +R  +   + ++ C    +    NP++  L     +RRNVLLGLGGL GA  +   +NPF
Sbjct  38    TRKPKHNHIPRVTCRGNPNHQTPNPSEEQLPHIVENRRNVLLGLGGLCGAVTLN--NNPF  95

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAH  529
             A A+P+ PP+  +CGP  ++       P +CCP +   +   D+   PS   L VRPAAH
Sbjct  96    AFAAPVLPPDLTTCGPPDLAEGVK---PINCCPPS---SKIIDFKFPPSNQPLRVRPAAH  149

Query  530   AIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWL  700
              + DDYL KYK A+  MK LPS+DPR+F QQANVHCAYC+GAY   G P    Q+H +WL
Sbjct  150   LVTDDYLAKYKKALDLMKKLPSNDPRSFMQQANVHCAYCDGAYHQVGFPDLDLQVHNSWL  209

Query  701   FFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQA  880
             FFPFHRWYLYFYERIL SLI+DPTF LP+WNWD P+GM LP I+ D  +SPLYD  RN  
Sbjct  210   FFPFHRWYLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYAD-PKSPLYDPLRNSN  268

Query  881   HRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GP  1057
             H+   + DL +  ++  A    K+ +NL IMYRQ+++N   P LF G A R   GD   P
Sbjct  269   HQPPTLVDLDFDIEDPDADG--KISSNLTIMYRQVVSNGKTPRLFLGNAYR--AGDEPDP  324

Query  1058  GMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN  1237
             G G++ENVPH  +H W GD   P+ ENMG FYSAA DP+F+ HHSN+DRMW+IWKTLGG 
Sbjct  325   GGGSVENVPHGPVHVWTGDIDQPNIENMGTFYSAARDPIFFSHHSNIDRMWSIWKTLGGK  384

Query  1238  RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrak  1417
             R+D +D DWL++  LFYDE K LV+VKV+D LD  KLGY +Q +  PW + +PT  +   
Sbjct  385   RRDFSDSDWLESGLLFYDEDKNLVRVKVKDCLDTTKLGYVYQDVDVPWLNSRPTPVKSRA  444

Query  1418  lrskasvsasTSV-----------LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDD  1564
              +   + +                 P  L+ + +  V R   S++   +E  +  L  + 
Sbjct  445   RKVAVTQNFGVGAARAAETSRNVKFPLVLDSVVSTRVQRPKKSRSKKAKEEEEEVLVIEG  504

Query  1565  TQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIK  1711
              +F R      +    +  +     D  E+AGSF ++AH HK  + +  + ++
Sbjct  505   IEFDRNTPVKFDVFVNDEDDKVIRPDNTEFAGSFVSVAHTHKHKNKSMKTCLR  557



>ref|XP_008371333.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08581.1| polyphenol oxidase IIa [Malus domestica]
Length=600

 Score =   417 bits (1071),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 269/563 (48%), Positives = 342/563 (61%), Gaps = 32/563 (6%)
 Frame = +2

Query  179   ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALA  358
             ARR   I  +    +    ++   SS    KLDRRNVL+GLGGLYGA  +A    P A A
Sbjct  49    ARRSS-ISCKATNPNYNNEQDQQQSSNLLGKLDRRNVLIGLGGLYGATTLA--PKPLAFA  105

Query  359   SPIPPPETKSCGPATISNSNGKPVPYSCCP--STLMDTASADYYKIPSFSKLNVRPAAHA  532
             +P+ PP+   C PA I+ + G+ V   CCP  ST + T + D   IP    L  RPAAH 
Sbjct  106   NPLAPPDLTKCKPAEIT-TGGETV--ECCPPVSTKIKTFTPDR-SIP----LRTRPAAHL  157

Query  533   IDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLF  703
             + D+YL K+K A   M+ LP DDPR+  QQA VHCAYCNGAY   G P    QIHF+WLF
Sbjct  158   VTDEYLAKFKKAQALMRALPEDDPRSMVQQAKVHCAYCNGAYPQVGFPDIDIQIHFSWLF  217

Query  704   FPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAH  883
             FPFHR YLYFYERIL  LIDDPTF LPYWNWD+P G  +P+I+ D   SPLYD+ RN  H
Sbjct  218   FPFHRMYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTD-TTSPLYDQYRNADH  276

Query  884   RRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGM  1063
             +   + DL+Y G +    D  ++  NLAIMY QM++ A  P LFFG   R     TG   
Sbjct  277   QPPVLVDLSYGGTDDDVDDQTRIDENLAIMYXQMVSGAKTPHLFFGHEYRAGDTTTGTYA  336

Query  1064  GTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRK  1243
             GTIEN PHN+IH W GDP   H E+MGNFYSA  DP+FY HH NVDRMW +WKTLGG RK
Sbjct  337   GTIENSPHNNIHLWCGDPNQTHQEDMGNFYSAGRDPLFYAHHCNVDRMWNVWKTLGGKRK  396

Query  1244  DITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVK-LGYTFQKMPTPWKDFKPTrkr-rak  1417
             D TD DWL  EFLFYDE   LV  KV DSL   K L YT++ +  PW   KPT ++ ++K
Sbjct  397   DPTDTDWLDAEFLFYDENAELVSCKVRDSLKPEKDLRYTYEPVSVPWLFTKPTARKPKSK  456

Query  1418  lrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE------LLDLHLAFDDTQFIR  1579
              ++K   +  T+  PAT +  TT  V R    K   KE+      L+   + F+  + ++
Sbjct  457   TKAKVGATQLTTKFPATFDSKTTVEVARPKPRKRTKKEKIDEEEVLIIKDIEFESNEAVK  516

Query  1580  fdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlr  1759
             FDVF+N+D +  +++ D+ E+AGSF ++ H  K        T K     L I++LLEDL 
Sbjct  517   FDVFINDDAESLSRK-DKSEFAGSFVHVPHNQK------TGTKKKTNLKLGITDLLEDLG  569

Query  1760  lenddKILVTLVPRAGGSFVTVN  1828
             +E+D  +LVTLVPR   S +T+ 
Sbjct  570   VEDDSSVLVTLVPRVSNSPITIG  592



>gb|EYU34161.1| hypothetical protein MIMGU_mgv1a003495mg [Erythranthe guttata]
Length=581

 Score =   416 bits (1069),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 270/564 (48%), Positives = 360/564 (64%), Gaps = 38/564 (7%)
 Frame = +2

Query  167   PSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNP  346
             P+   RR  + ++ C       ++NP   S SE K+DRRN+LLGLGGLYGA N+   +  
Sbjct  32    PAGRHRRSHLFQVSCK------QQNPPPPS-SEGKVDRRNMLLGLGGLYGAANLIPTNPE  84

Query  347   FALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
              A ASPI PPE K+CG A    S G  +  +CCP T       D+   P  +KL VRP A
Sbjct  85    AATASPIEPPEFKACGAARDVQS-GDLLNINCCPPT--SDKIVDFKLPPPPAKLRVRPPA  141

Query  527   HAIDDDYLEKYKTAIQKMKDL----PSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             H +  +YL K++ AI++MK L    PSD PR F QQAN+HCAYCNGA+   G      Q+
Sbjct  142   HRVSKEYLAKFEEAIRRMKALDKSDPSD-PRGFMQQANIHCAYCNGAHDQVGYKDLDLQV  200

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHRWYLYFYERIL SLIDDPTF LP+WNWDNP+GM +P+IF D+  SPLYD 
Sbjct  201   HNSWLFFPFHRWYLYFYERILGSLIDDPTFVLPFWNWDNPKGMQMPKIF-DNSGSPLYDA  259

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              RNQ +R   + DL ++G   +  D Q V NNL +MY +M+ +    L F G+  +   G
Sbjct  260   NRNQKNRPPAIIDLGFSG---ATEDLQVVVNNLTVMYSEMIRSVNSTLDFMGQPYK--AG  314

Query  1046  DTG-PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PGMG+ E   H + H WVGDPR+ ++E+MGNFYSA  D +FYCHH+NVDRMW++W+
Sbjct  315   DAASPGMGSSERGSHVAAHVWVGDPRNKYSEDMGNFYSAGRDVLFYCHHANVDRMWSVWR  374

Query  1223  TLGGNR-KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TL  +  KDI DPD+L   FLFYDE K LV+VKV D LD+ K+GY F+K+ TPW ++KPT
Sbjct  375   TLKTDVPKDIKDPDYLNAAFLFYDENKQLVRVKVGDCLDHKKMGYEFEKVDTPWLNYKPT  434

Query  1400  rkrraklrskasvsasT--SVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQF  1573
             +K       K +  A T  ++ P  L KIT   V +S  +K    E L+  ++  D T+F
Sbjct  435   KKAAKAKILKIAAGAETVEALFPLNLKKITRVLVNKS--AKGKADEVLVLENIETDTTKF  492

Query  1574  IRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelled  1753
             I+FDVFVN++DD +  ELD+ EYAG+F+ + H  KD    +       T SL ++EL ED
Sbjct  493   IKFDVFVNDEDDGSV-ELDKAEYAGTFAQVPHKTKDKKGKS-------TISLRLTELYED  544

Query  1754  lrlenddKILVTLVPRAGGSFVTV  1825
             + + +DD ++VTL+PR+ G  VT+
Sbjct  545   VDVADDDTVVVTLIPRSNGDDVTI  568



>dbj|BAA92317.1| polyphenol oxidase I [Ipomoea batatas]
Length=588

 Score =   416 bits (1068),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 265/578 (46%), Positives = 358/578 (62%), Gaps = 52/578 (9%)
 Frame = +2

Query  161   PNPSR----AARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayni  328
             P PS+     A+R    K+ C A + +          S+ KLDRR+VLLGLGGL GA ++
Sbjct  31    PKPSQIHIATAKRTHHFKVSCNAPNGD----------SQPKLDRRDVLLGLGGLAGAASL  80

Query  329   aggSNPFALASPIPPPETKSCGPATISNSNGKP--VPYSCCPSTLMDTASADYYKIP--S  496
                +NP A A PI  PE   C    +   +  P  +  +CCP    +      YK+P  S
Sbjct  81    I--NNPLAFAEPIHAPEISKC---VVPPKDLPPDAIVDNCCPPLATNVIP---YKVPKTS  132

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              S + +RPA H +D +Y+ K++ AI+ MK+LP+DDPRNFYQQA VHCAYCNG Y     P
Sbjct  133   PSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYP  192

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHRWYLYFYERIL  LI DPTF LP+WNWD P GM++P+ F  ++ 
Sbjct  193   DKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFGLPFWNWDTPAGMLIPQYF-RNQN  251

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             SPLYD+ RNQ+H    V DL YAG +T  +D +++ NNLA+MY+ M+TNA    LF GK 
Sbjct  252   SPLYDENRNQSH-LPLVMDLGYAGTDTDVTDQERISNNLALMYKSMVTNAGTAELFLGKP  310

Query  1028  IRKETGDTGPGMGTIENVPHNSIHRWVGD--PRSPHNENMGNFYSAAIDPVFYCHHSNVD  1201
              +        G G+IEN+PH  +HRWVGD  PR+ + E+MGNFYSA  D +FYCHHSNVD
Sbjct  311   YKAGDDPVNKGGGSIENIPHTPVHRWVGDVKPRTQNGEDMGNFYSAGRDILFYCHHSNVD  370

Query  1202  RMWTIWKTLGGN--RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPT  1375
             RMWTIW+ LGG   R+D TD DWL   F+FYDE K  V+V+V D+LDN KLGY ++    
Sbjct  371   RMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAVRVRVGDALDNQKLGYKYEFTNL  430

Query  1376  PWKDFKPT-rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTP-------GKE  1531
             PW + KP   K++  L +++     T V P TL+K+    V R   S++           
Sbjct  431   PWLNSKPLPTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEIL  490

Query  1532  ELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIK  1711
             E+  + +A D  Q+ +FDV++N++D+    + ++ EYAGSF++L H H     T +  I+
Sbjct  491   EIEGIEVAID--QYAKFDVYLNDEDEPEAGK-EKAEYAGSFAHLPHKH-----TGSKKIR  542

Query  1712  TPTFSLAISelledlrlenddKILVTLVPRAGGSFVTV  1825
             T + SL ++E LEDL  E+DD +LVTL P+ GG  VTV
Sbjct  543   T-SLSLGLNEPLEDLGAEDDDAVLVTLAPKVGGGVVTV  579



>ref|XP_002316852.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
 gb|EEE97464.1| hypothetical protein POPTR_0011s10950g [Populus trichocarpa]
Length=563

 Score =   414 bits (1064),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 242/500 (48%), Positives = 314/500 (63%), Gaps = 35/500 (7%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCC---PSTLMDTASADYYKIPS-FSKLNVR  517
             A A PI PP+   C    + N      P +CC   P  ++D      ++ PS FS L  R
Sbjct  65    AFAKPITPPDLTKCELVDLPNPEN---PSNCCTPLPKKIID------FRPPSPFSPLRTR  115

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
              AAH +D+DY+ KY  AI  MK LP DDPRNFYQQANVHCAYCNGAY+  G P     +H
Sbjct  116   RAAHLVDEDYVAKYAEAISLMKSLPEDDPRNFYQQANVHCAYCNGAYEQVGFPKLEIDVH  175

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
               W FFP+HR+YLYFYERIL  LI+DPTF LP+WNWD+P GM +P IF D  +SPLYD+ 
Sbjct  176   SCWFFFPWHRYYLYFYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTD-PKSPLYDQF  234

Query  869   RNQAHRRGYVTDLAY-AGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
             R+Q H+   + DL Y AG     +  Q   +NL +MY+QM++ A  P LFFGK+ R    
Sbjct  235   RDQNHQPPILLDLDYGAGYPNPTNANQLYSSNLTVMYKQMVSGAAKPTLFFGKSYRAGE-  293

Query  1046  DTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
             DT PG GTIE  PHN+IHRW GDP   +NE+MGNFYSAA DP+F+CHHSNVDRMWTIWKT
Sbjct  294   DTSPGAGTIETTPHNNIHRWTGDPTQENNEDMGNFYSAARDPIFFCHHSNVDRMWTIWKT  353

Query  1226  L-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-  1399
             + GG R+DI+DPDWL +EFLFY+E   LV+ KV D LDN  L YT+Q +  PW + KP  
Sbjct  354   IPGGTRRDISDPDWLNSEFLFYNENAELVRCKVSDCLDNTGLRYTYQNVEIPWLESKPIP  413

Query  1400  rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE-----LLDLHLAFDD  1564
             R+   K     +     +  P  L+K     V+R   S++  ++E     L+   + +D 
Sbjct  414   RRLGKKAAETKTALTPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDK  473

Query  1565  TQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
              +F++FDVF+N+D ++ +K  +  E+AGSF N++H H   S T           L I+EL
Sbjct  474   GKFVKFDVFINDDVEMPSKP-ENTEFAGSFVNVSHKHAKKSKT--------RLILGITEL  524

Query  1745  ledlrlenddKILVTLVPRA  1804
             LEDL  + DD I+V LVPR+
Sbjct  525   LEDLESDGDDSIVVALVPRS  544



>gb|ADR78836.1| polyphenol oxidase [Ziziphus jujuba]
Length=594

 Score =   414 bits (1065),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 254/580 (44%), Positives = 340/580 (59%), Gaps = 44/580 (8%)
 Frame = +2

Query  170   SRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPF  349
             S A +   + K R +  +++G ++P        K DRRNVL+GLGGLYG   +   SN F
Sbjct  34    SFAPKLNRLSKRRVSCKATKGDQSPL------GKFDRRNVLIGLGGLYGVNGLG--SNSF  85

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAH  529
             ++A+P+ PP+  +CGP  +  S  KP    CCP         D+   P  ++L VRPAAH
Sbjct  86    SIAAPVAPPDLSNCGPPDLP-SGAKPT--DCCPPK--SDKIIDFKLPPQSNQLRVRPAAH  140

Query  530   AIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWL  700
              +D +Y+EKY  AI  MK LP DDPRNF QQAN+HCAYC+ AY   G P    Q+H  WL
Sbjct  141   VVDKNYIEKYSKAIALMKALPEDDPRNFTQQANIHCAYCDAAYDQVGFPDLELQVHNCWL  200

Query  701   FFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQA  880
             FFP HR+YLYFYE+IL  LI+DPTF LP+WNWD+P GM LP ++ +  +SPLYD  RN  
Sbjct  201   FFPCHRYYLYFYEKILGKLINDPTFALPFWNWDSPPGMQLPALYAN-LKSPLYDTLRNAG  259

Query  881   HRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPG  1060
             H+   + DL Y G + + +   ++ +NL IMYRQ+++N   P LFFG A R    +  PG
Sbjct  260   HQPPTLLDLDYNGTDETTTKRDQLTSNLTIMYRQVVSNGKNPKLFFGGAFRSGE-EPDPG  318

Query  1061  MGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNR  1240
              G+IEN+P+  +H W GD   P+ ENMGNFYSAA DP+F+ HHSNVDRMWTIWKTLGG R
Sbjct  319   AGSIENIPYGPVHLWSGDNTQPNLENMGNFYSAARDPMFFAHHSNVDRMWTIWKTLGGKR  378

Query  1241  KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-------  1399
             KDITDPDWL   FLFYDE K LV+VKV D LD  KLGY +Q +  PW   +PT       
Sbjct  379   KDITDPDWLNAGFLFYDENKQLVRVKVRDCLDEKKLGYVYQDVDIPWLKTRPTPRKSKLS  438

Query  1400  ------rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLH--LA  1555
                   R       + +  + +T+  P  L+ +    V R P  K   K+E  +    L 
Sbjct  439   KVASAVRALGVAQAAVSKKTVTTTDFPVILDSVIRTVVDR-PKKKRRSKQEKEEEEEVLV  497

Query  1556  FDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTF  1723
              D  +F R      +    +  +L    D+ E+AGSF ++    K+        +KT   
Sbjct  498   IDGIEFDRDLPVKFDVYVNDEDDLPSGPDKSEFAGSFVSVPRKQKN-----QKKLKT-CL  551

Query  1724  SLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTE  1843
              L +++LLEDL  E+DD ++VTLVPR G   V++ +   E
Sbjct  552   RLGLTDLLEDLEAEDDDSVVVTLVPRTGKGLVSIGELKIE  591



>ref|XP_007025702.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
 gb|EOY28324.1| Uncharacterized protein TCM_029922 [Theobroma cacao]
Length=600

 Score =   414 bits (1064),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 250/571 (44%), Positives = 344/571 (60%), Gaps = 40/571 (7%)
 Frame = +2

Query  182   RRGDVIKIRCAAASSEGRENPADSS-----LSEAKLDRRNVllglgglygayniaggSNP  346
             RR + +    +  ++ G +NP+ S+      S  K DRR+VL+GLGGLYGA ++   + P
Sbjct  37    RRRNFVSRAVSCKATNGDQNPSPSTKNVEECSLNKFDRRDVLVGLGGLYGATSL---NGP  93

Query  347   FALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
              A A+P+ PP+   CG A +  +  KPV  +CCP     T   D+   PS S   +RPA 
Sbjct  94    LAFAAPVSPPDVTKCGKADLP-AGAKPV--NCCPPP--STKILDFKLRPSNSPPRIRPAV  148

Query  527   HAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTW  697
             H +D +YL K+  A++ MK LP DDPR+F QQANVHCAYC+GAY   G P    Q+H +W
Sbjct  149   HLVDKEYLAKFSRALELMKALPEDDPRSFTQQANVHCAYCDGAYHQIGFPDLDLQVHNSW  208

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LFFPFHR+YLYF+E+IL  LIDDPTF +P+WNWD+P GM +P I+ +   SPLYD+ RN 
Sbjct  209   LFFPFHRYYLYFFEKILGKLIDDPTFAIPFWNWDSPAGMQMPAIYAN-PNSPLYDENRNP  267

Query  878   AHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-G  1054
              H+   + DL + G E S+S   ++ +NL +MYRQM++N     LF G A R   GD   
Sbjct  268   NHQPPTLLDLDFNGTEESSSTRDQISSNLNVMYRQMVSNGKTAKLFLGNAYR--AGDQPD  325

Query  1055  PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG  1234
             PG G++EN+PH  IH W GD R P+ E+MGNFYSA  DP+FY HHSNVDRMW++WKTLGG
Sbjct  326   PGAGSLENIPHGPIHIWCGDNRQPNLEDMGNFYSAGRDPIFYAHHSNVDRMWSVWKTLGG  385

Query  1235  NRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrra  1414
              R D TD DWL + FLFYDE   LV+VKV D LD  K+GY +QK+  PW   KPT +R A
Sbjct  386   KRTDFTDSDWLDSGFLFYDENANLVRVKVRDCLDTRKMGYDYQKVDIPWLRAKPTPRRIA  445

Query  1415  klrskasvsasTS----------VLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDD  1564
                ++A   A  +            P  LN + +  V+R   S++  ++E  +  L  ++
Sbjct  446   SKVARALGVAHAAETKKKVLSDVQFPLVLNNVVSLEVSRPKKSRSKAEKEEEEEVLVIEN  505

Query  1565  TQFIRfdvfv----nedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLA  1732
              +F R  +        D+D  T   D  E+AGSF N+ H H+  +        T    L 
Sbjct  506   IEFDRDQLVKFDVYINDEDDTTIGPDNTEFAGSFINVPHKHRHGNKM------TTCLRLG  559

Query  1733  ISelledlrlenddKILVTLVPRAGGSFVTV  1825
             +++LLE+L  E+DD ++VTLVP++G     +
Sbjct  560   LTDLLEELGAEDDDGVVVTLVPKSGKGLAKI  590



>ref|XP_011016645.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=560

 Score =   413 bits (1061),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 241/502 (48%), Positives = 319/502 (64%), Gaps = 35/502 (7%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCC---PSTLMDTASADYYKIPS-FSKLNVR  517
             A A PI PP+  +C    + N      P +CC   P  ++D      ++ PS F  L  R
Sbjct  62    AYAKPITPPDLTNCELVDLPNPEN---PTNCCSPLPKKIID------FRPPSPFFPLRTR  112

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
              AAH +D+DY+ KY  AI  MK LP DDPRNFYQQANVHCAYCNGAY+  G P     +H
Sbjct  113   RAAHLVDEDYVAKYAEAISLMKSLPEDDPRNFYQQANVHCAYCNGAYEQVGFPKLELDVH  172

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
             F WLFFP+HR+YLYFYERIL  LI+DPTF LP+WNWD+P GM +P IF D  +SPLYD+ 
Sbjct  173   FCWLFFPWHRYYLYFYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTD-PKSPLYDQF  231

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKV-KNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
             R+Q H+   + DL YA  + + ++  KV  +NL +MY+QM++ A  P LFFGK  R    
Sbjct  232   RDQNHQPPVLLDLDYAAGDPNPTNANKVYSSNLRVMYKQMVSGAAKPTLFFGKPYRA-GD  290

Query  1046  DTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
             D+ PG GTIEN PHN+IHRW GDP   + E+MGNFYSAA DP+F+CHHSNVDRMWT+WKT
Sbjct  291   DSRPGAGTIENSPHNNIHRWTGDPTQENTEDMGNFYSAARDPIFFCHHSNVDRMWTLWKT  350

Query  1226  L-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-  1399
             + GG R+DI+DPDWL +EFLFY+E   LV+ KV D LDN +L YT+Q +  PW   KP  
Sbjct  351   IPGGIRRDISDPDWLNSEFLFYNENAELVRCKVRDCLDNRRLRYTYQNVEIPWLKSKPIP  410

Query  1400  rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE-----LLDLHLAFDD  1564
             R+   K     +     +  P  L+K     V+R   S++  ++E     L+   + +D 
Sbjct  411   RRLGKKAAETKTALTPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDK  470

Query  1565  TQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
              +F++FDVF+N+D ++ +K  +  E+AGSF N++H H   S T           L I+EL
Sbjct  471   GKFVKFDVFINDDLEMPSKP-ENTEFAGSFVNVSHKHAKKSKT--------RLILGITEL  521

Query  1745  ledlrlenddKILVTLVPRAGG  1810
             LEDL  ++DD I+V LVPR+  
Sbjct  522   LEDLETDDDDSIVVALVPRSNS  543



>ref|XP_007025703.1| Larreatricin hydroxylase [Theobroma cacao]
 gb|EOY28325.1| Larreatricin hydroxylase [Theobroma cacao]
Length=605

 Score =   414 bits (1064),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 268/569 (47%), Positives = 351/569 (62%), Gaps = 41/569 (7%)
 Frame = +2

Query  218   ASSEGRENPADSSLSEA-----KLDRRNVllglgglygayniaggSNPFALASPIPPPET  382
             A++ G +NP  SS S+      + DRR++L+GLGGLYGA N+A  ++PFALA+PI  P+ 
Sbjct  51    ATNNGNQNPTPSSNSKGDSALNRFDRRDLLIGLGGLYGATNLA--NDPFALAAPIAAPDL  108

Query  383   KSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYK  562
               CG A IS + G+             T +   YK PSFSKL  RP AH +D DYL K+ 
Sbjct  109   TLCGNAVISETTGE-----TTYCCPPTTTTITDYKPPSFSKLRYRPPAHLVDADYLAKFT  163

Query  563   TAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYF  733
              A+  MK+LPSDDPR+F QQA VHCAYCNGAY   G P    Q+HF+WLFFPFHRWYLYF
Sbjct  164   KAMNLMKELPSDDPRSFMQQAYVHCAYCNGAYDQVGFPDQDLQVHFSWLFFPFHRWYLYF  223

Query  734   YERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAY  913
             YERIL  LI DP F +P+WNWD P GM +P I+ +  +SPLYD KRN  H+   + DL Y
Sbjct  224   YERILGKLIGDPDFVMPFWNWDAPAGMPIPAIYVN-PQSPLYDDKRNVNHQPPKLADLDY  282

Query  914   AGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTG-PGMGTIENVPHN  1090
              G +   +D +++  NL +MY+QM++NA    LF GK  R   GD G PG G++E   H 
Sbjct  283   NGTDKDITDAEQIAINLKLMYKQMVSNATTATLFHGKPYR--AGDAGSPGGGSVELGCHT  340

Query  1091  SIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL-GGNRKDITDPDWL  1267
             +IHRWVGDPR  +NE+MGNFYSA  DPVFY HH NVDRMW+IWKTL G  R D +D DWL
Sbjct  341   AIHRWVGDPRQTYNEDMGNFYSAGRDPVFYAHHGNVDRMWSIWKTLPGTKRNDFSDTDWL  400

Query  1268  QTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsas  1447
                F+FYDE   LV+VKV D +D+  LGY +Q +  PW   KPT ++ AK   KA  SA 
Sbjct  401   DASFVFYDENANLVRVKVRDCVDSKNLGYDYQPVDNPWLKTKPTARKFAKKGGKARGSAM  460

Query  1448  TS----------VLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQF-----IRf  1582
              +            P  L+K  +  + R   S++  ++E  +  L  +  Q      ++F
Sbjct  461   AAEIKSKNVVRNAFPIVLDKTVSIEIPRPRKSRSKREKEEDEEVLVLEGIQLATQAAVKF  520

Query  1583  dvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrl  1762
             D+++N++DD      +  E+AGSF+N+ H H     T    + T TFSLAIS++LEDL +
Sbjct  521   DIYINDEDDEAPSGPEDAEFAGSFTNIPHSH-----THAKKLNT-TFSLAISDVLEDLDV  574

Query  1763  enddKILVTLVPRAGGSFVTVNKAYTEII  1849
             E DD I+VTLVPR G   V+V     + I
Sbjct  575   EGDDNIVVTLVPREGKGLVSVGNIKVDYI  603



>gb|AAG21983.1|AF263611_1 polyphenol oxidase PPO1 [Populus trichocarpa x Populus deltoides]
Length=563

 Score =   412 bits (1060),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 241/500 (48%), Positives = 314/500 (63%), Gaps = 35/500 (7%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCC---PSTLMDTASADYYKIPS-FSKLNVR  517
             A A PI PP+   C    + N      P +CC   P  ++D      ++ PS FS L  R
Sbjct  65    AFAKPITPPDLTKCELVDLPNPEN---PSNCCTPLPKKIID------FRPPSPFSPLRTR  115

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
              AAH +D+DY+ KY  AI  MK LP +DPRNFYQQANVHCAYCNGAY+  G P     +H
Sbjct  116   RAAHLVDEDYVAKYAEAISLMKSLPENDPRNFYQQANVHCAYCNGAYEQVGFPKLEIDVH  175

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
               W FFP+HR+YLYFYERIL  LI+DPTF LP+WNWD+P GM +P IF D  +SPLYD+ 
Sbjct  176   SCWFFFPWHRYYLYFYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTD-PKSPLYDQF  234

Query  869   RNQAHRRGYVTDLAY-AGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
             R+Q H+   + DL Y AG     +  Q   +NL +MY+QM++ A  P LFFGK+ R    
Sbjct  235   RDQNHQPPILLDLDYGAGDPNPTNANQLYSSNLTVMYKQMVSGAAKPTLFFGKSYRAGE-  293

Query  1046  DTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
             DT PG GTIE  PHN+IHRW GDP   +NE+MGNFYSAA DP+F+CHHSNVDRMWTIWKT
Sbjct  294   DTSPGAGTIETTPHNNIHRWTGDPTQENNEDMGNFYSAARDPIFFCHHSNVDRMWTIWKT  353

Query  1226  L-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-  1399
             + GG R+DI+DPDWL +EFLFY+E   LV+ KV D LDN  L YT+Q +  PW + KP  
Sbjct  354   IPGGTRRDISDPDWLNSEFLFYNENAELVRCKVSDCLDNTGLRYTYQNVEIPWLESKPIP  413

Query  1400  rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE-----LLDLHLAFDD  1564
             R+   K     +     +  P  L+K     V+R   S++  ++E     L+   + +D 
Sbjct  414   RRLGKKAAETKTALTPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDK  473

Query  1565  TQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
              +F++FDVF+N+D ++ +K  +  E+AGSF N++H H   S T           L I+EL
Sbjct  474   GKFVKFDVFINDDVEMPSKP-ENTEFAGSFVNVSHKHAKKSKTR--------LILGITEL  524

Query  1745  ledlrlenddKILVTLVPRA  1804
             LEDL  + DD I+V LVPR+
Sbjct  525   LEDLESDGDDSIVVALVPRS  544



>gb|ADC92563.1| polyphenol oxidase [Nelumbo nucifera]
Length=597

 Score =   413 bits (1062),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 256/563 (45%), Positives = 332/563 (59%), Gaps = 36/563 (6%)
 Frame = +2

Query  194   VIKIRCAAASSEGRENPADSSLSEA---KLDRRNVllglgglygayniaggSNPFALASP  364
             V K+ C A  ++G + P  S   E    +LDRRNVL+GLGGLYGA  +   +   A  +P
Sbjct  45    VRKVSCEA--TDGEKKPTRSGNEEGSLGRLDRRNVLIGLGGLYGATGLC--AGRLAFGAP  100

Query  365   IPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDD  541
             I PP+   CG A +  +  KP   + CP    +      +K+PS S+ + VRPAAH +D+
Sbjct  101   IMPPDLSKCGAANLP-AGAKPT--NRCPPASSEIVD---FKLPSSSEPMRVRPAAHMVDE  154

Query  542   DYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPF  712
             +Y+ KY  AI  MK LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +WLFF F
Sbjct  155   EYIAKYSKAIALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLELQVHNSWLFFSF  214

Query  713   HRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRG  892
             HR+YLYFYER+L  LIDDPTF LPYWNWD P GM +P ++ +   SPLYDK R+  H+  
Sbjct  215   HRYYLYFYERMLGKLIDDPTFALPYWNWDAPAGMKMPTMYAN-PNSPLYDKLRDAKHQPP  273

Query  893   YVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGT  1069
              + DL Y  Q+T+ +  Q +KNNLA MYRQ+++N     LF G   R   GD   PG G+
Sbjct  274   TMIDLNYNVQDTTMTPEQLLKNNLATMYRQVVSNGSTAQLFLGSPYR--AGDQPDPGFGS  331

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDI  1249
             +ENVPH  +H W GD   P+ ENMGNFYSAA DP+FY HHSNVDRMWTIWK LGG RKD 
Sbjct  332   LENVPHGPVHLWAGDRTQPNIENMGNFYSAARDPIFYAHHSNVDRMWTIWKKLGGRRKDF  391

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrsk  1429
              DPDWL   FL YDE K LV+VKV D LD  KL Y++Q +  PW   +PT  +      K
Sbjct  392   KDPDWLNAGFLLYDENKQLVRVKVRDCLDEKKLRYSYQDVEIPWMKTRPTPGKLMAAAQK  451

Query  1430  --------asvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfd  1585
                          + S  P  L+      V R   S++  ++E  +  L  D  +  R  
Sbjct  452   LKITDRGLKKKKPTVSEFPKELDAPFKVVVKRPRKSRSKKEKEDEEEILVIDQVELERDT  511

Query  1586  vfvnedddvnTKEL--DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlr  1759
             V   +    +  E   D+ E+AGSF N+ H H    +   + ++       ISELLEDL 
Sbjct  512   VVKFDVYINDEDEPSPDKSEFAGSFVNVPHKHGKKMSKLKTCLR-----FGISELLEDLE  566

Query  1760  lenddKILVTLVPRAGGSFVTVN  1828
              E+DD+++VT+VPR GG  VT+ 
Sbjct  567   AEDDDEVVVTIVPRIGGDLVTIG  589



>ref|XP_007214660.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
 gb|AFI08585.1| polyphenol oxidase II [Prunus persica]
 gb|EMJ15859.1| hypothetical protein PRUPE_ppa003171mg [Prunus persica]
Length=596

 Score =   413 bits (1061),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 264/534 (49%), Positives = 325/534 (61%), Gaps = 31/534 (6%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
              KLDRRN+L+GLGGLYGA  +     PFA A PI PP+   C  A I+ + G+ VP  CC
Sbjct  73    GKLDRRNILIGLGGLYGATTLD--PKPFAFADPIAPPDLTKCQLAEIT-TGGETVP--CC  127

Query  446   P--STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQ  619
             P  +T + T   D   IP    L  RPAA  + D+YL K+K A   M+ LP DDPR+  Q
Sbjct  128   PPVTTKIKTFKPDL-SIP----LRTRPAAQQVTDEYLAKFKKAQAAMRALPDDDPRSMVQ  182

Query  620   QANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYW  790
             QA VHCAYCNGAY   G P    Q+HF+WLFFPFHR YLYFYERIL  LIDDPTF LPYW
Sbjct  183   QAKVHCAYCNGAYPQVGFPDNDLQVHFSWLFFPFHRMYLYFYERILGKLIDDPTFALPYW  242

Query  791   NWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAI  970
             NWD+P G  +P+I+ D   SPLYD+ RN  H+   + DL Y        D  ++  NLAI
Sbjct  243   NWDSPAGFPIPDIYTD-TSSPLYDQYRNSDHQPPVLVDLGYGKTNDDVDDQTRIDENLAI  301

Query  971   MYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNF  1150
             MYRQM++ A  P LFFG A R    +T    GTIEN+PHN+IH WVGDP   H E+MGNF
Sbjct  302   MYRQMVSGAKTPDLFFGHAYRAGDLNTKKYPGTIENMPHNNIHLWVGDPNQTHQEDMGNF  361

Query  1151  YSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDS  1330
             YSA  DP+FY HH NVDRMWTIWKTLGG R+DITD DWL  EFLFYDE   LV  KV DS
Sbjct  362   YSAGRDPLFYAHHCNVDRMWTIWKTLGGKRQDITDTDWLDAEFLFYDENAELVNCKVRDS  421

Query  1331  LDNVK-LGYTFQKMPTPWKDFKPTrkrraklrskasvsas-TSVLPATLNKITTFCVTRS  1504
             LD  K L Y ++    PW   KPT ++          +   TS  PAT +  TT  V R 
Sbjct  422   LDTAKQLRYNYEPASLPWLFTKPTARKTKNKTKAKVAATQLTSKFPATFDSKTTVEVARP  481

Query  1505  PTSKTPGK-----EELLDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLA  1666
                K   K     EELL +  + F+  + ++FDVF+N+D +  ++  D+ E+AGSF    
Sbjct  482   KPRKRSKKEKVDEEELLIIKDIEFEGNEAVKFDVFINDDAESLSRR-DKSEFAGSF---V  537

Query  1667  HVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVN  1828
             HV +  +T A +        L I++LLEDL  E+D  +LVTLVPR   S +T+ 
Sbjct  538   HVPQGKTTKAKTKT---NLKLGITDLLEDLGAEDDSSVLVTLVPRVSNSPITIG  588



>gb|AFC36521.1| polyphenol oxidase [Gossypium hirsutum]
Length=598

 Score =   413 bits (1061),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 263/562 (47%), Positives = 347/562 (62%), Gaps = 33/562 (6%)
 Frame = +2

Query  218   ASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSC-G  394
             AS+  + N   SSL+    DRR++LLGLG LYGA N+   S+PFALA+ I  P+   C  
Sbjct  50    ASNGNQNNEGSSSLNS--FDRRDILLGLGSLYGATNLV--SDPFALAALIAAPDLSLCEN  105

Query  395   PATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQ  574
                 S+S+G  +   CCP     T +   +K P FS + +RPAAH +D +YLEK+  AI+
Sbjct  106   STVTSSSSGTSISVPCCPPK---TTNILDFKPPRFSTIRLRPAAHLVDANYLEKFTKAIE  162

Query  575   KMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERI  745
              MK LP DDPR+F QQANVHCAYCNGAY   G P    Q+HF+WLFFPFHR YLYFYERI
Sbjct  163   LMKALPDDDPRSFKQQANVHCAYCNGAYDQVGFPDQQLQVHFSWLFFPFHRLYLYFYERI  222

Query  746   LQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQE  925
             L  LI DP F +P+WNWD+P GM +P+I+ D   SPLYD+KRN  H+   + DL YAG E
Sbjct  223   LGKLIGDPNFAMPFWNWDSPPGMAIPKIYVD-PNSPLYDEKRNVNHQPPNMLDLDYAGTE  281

Query  926   TSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRW  1105
                S   ++K+NL++MYRQM+T     L FFG A R    D  PGMG+IEN PH ++HRW
Sbjct  282   EELSKRDQIKSNLSVMYRQMVTYKTASL-FFGAAYRA-GDDPSPGMGSIENNPHTAVHRW  339

Query  1106  VGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL-GGNRKDITDPDWLQTEFL  1282
             VGD R P +E+MGNFYSA  DP+F+ HHSNVDR+W+IW+TL G  R D TD DWL + FL
Sbjct  340   VGDKRQPFSEDMGNFYSAGRDPLFFAHHSNVDRLWSIWRTLPGKKRTDFTDTDWLDSSFL  399

Query  1283  FYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT--------rkrraklrskasv  1438
             FYDE   LV+VKV DSL+    GY +QK   PW   KP            +A      ++
Sbjct  400   FYDENANLVRVKVRDSLNMKTFGYDYQKANIPWLKNKPNPRKSGRGKSGGQAVAAETKNI  459

Query  1439  sasTSVLPATLNKITTFCVTRSPTSKT----PGKEELLDLH-LAFDDTQFIRfdvfvned  1603
             +  ++  P  L+K+    V R   S+T      +EE+L L  +  D    ++FDV++N++
Sbjct  460   TPISNAFPIALDKLVRVEVPRPKKSRTKLEKEDEEEVLVLQNIQLDRDAAVKFDVYINDE  519

Query  1604  ddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKIL  1783
             DD    E +  E+AGSF+NL H H  T    N+ +  P     +++LLEDL +E D+ IL
Sbjct  520   DDETPTEPEDSEFAGSFTNLPHNHHKTGMKLNTNLTLP-----LTDLLEDLNVEGDESIL  574

Query  1784  VTLVPRAGGSFVTVNKAYTEII  1849
             VTLVP+ G   V++     + I
Sbjct  575   VTLVPKEGKGLVSIGNIKIDYI  596



>ref|XP_011083298.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=579

 Score =   412 bits (1058),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 243/531 (46%), Positives = 336/531 (63%), Gaps = 30/531 (6%)
 Frame = +2

Query  260   SEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYS  439
             ++ K+DRRN+LLGL GLYGA N+   S+P A A+PI  PE K+CG A    + G  +  +
Sbjct  57    ADGKVDRRNMLLGLSGLYGAANLV--SDPQAYAAPIEAPEFKACGEAR-DVATGDLLDVN  113

Query  440   CCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDP---RN  610
             CCP   + +     YK+P  +K+ +RPAAH +  +YL K++ AI++MK L  DDP   R 
Sbjct  114   CCP---LPSDKIIDYKLPPVNKMRIRPAAHKVTKEYLAKFEEAIRRMKALDKDDPTDPRG  170

Query  611   FYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTL  781
             F QQAN+HCAYCNGA+   G      Q+H +WLFFPFHRWYLYFYERIL  LIDDPTF L
Sbjct  171   FMQQANIHCAYCNGAHDQVGYKNLDIQVHNSWLFFPFHRWYLYFYERILGKLIDDPTFVL  230

Query  782   PYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNN  961
             P+WNWDNP+GM +P+IF D+  SPLY+  RNQA+R   + DL ++G   ++ D QKV NN
Sbjct  231   PFWNWDNPKGMQMPKIF-DNTGSPLYNANRNQANRPPAIIDLGFSG---ASDDLQKVVNN  286

Query  962   LAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENM  1141
             L +MY +M+ +    + F G+  R     + PGMG+ E   H + H WVG+P++ + E+M
Sbjct  287   LTVMYSEMIRSVNSTIDFMGQPYRAGNSPS-PGMGSSERGSHVAAHVWVGNPKNKYREDM  345

Query  1142  GNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNR-KDITDPDWLQTEFLFYDETKTLVKVK  1318
             GNFYSA  D +FYCHH+NVDRMW+IW+TL  +  KDITDPD+L   FLFYDE K LV+VK
Sbjct  346   GNFYSAGRDTLFYCHHANVDRMWSIWRTLKTDVPKDITDPDFLNAAFLFYDENKQLVRVK  405

Query  1319  VEDSLDNVKLGYTFQKMPTPWKDFKP--TrkrraklrskasvsasTSVLPATLNKITTFC  1492
             V D LD+ ++GY F+++  PW ++KP     +               + P  L KIT   
Sbjct  406   VADCLDHRRMGYDFERVDIPWLNYKPPRKAAKAKVETISQGAQKPEDLFPLNLKKITRVL  465

Query  1493  VTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHV  1672
             V +S  +K    E L+  ++  D T+FI+       D+D N +ELD+ EYAG+F+ + H 
Sbjct  466   VPKS--AKGKADEVLVLENIETDTTKFIK-FDVFVNDEDDNAEELDKAEYAGTFAQVPHK  522

Query  1673  HKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTV  1825
              KD    +       T SL ++EL ED+ + +DD I+VTL+PR+ G  VT+
Sbjct  523   TKDKKGKS-------TISLRLTELYEDIDVADDDTIVVTLIPRSNGDDVTI  566



>gb|AEL95440.1| polyphenol oxidase [Populus euphratica]
Length=590

 Score =   410 bits (1055),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 244/527 (46%), Positives = 322/527 (61%), Gaps = 38/527 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             S+PFA A+P+  P+   C  A +     +    +CCP  +  T   D+ +  S + L VR
Sbjct  75    SDPFAFAAPVSAPDISKCSRADLPTGVNE---TNCCPP-VPSTKILDFKRPSSNAPLRVR  130

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH  D DY+ KY  AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H
Sbjct  131   PAAHLADKDYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVH  190

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFPFHR+YLYFYE+IL  LIDDPTF LP+WNWD+P GM LP ++ D   SPLYD  
Sbjct  191   NSWLFFPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYAD-PNSPLYDSL  249

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             RN+ H+   + DL ++G +T  S+ +++ +NL IMYRQM++N   P LFFG + R   GD
Sbjct  250   RNKNHQPPTLLDLDWSGTDTPTSNREQISSNLTIMYRQMVSNGKTPRLFFGGSYR--AGD  307

Query  1049  T-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
               GP  G IEN+PH  +H W GD   P+ E+MGNFYSAA DP+F+CHHSNVDRMW++WKT
Sbjct  308   EPGPEAGPIENIPHGPVHIWTGDNTQPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVWKT  367

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrk  1405
             LGG R D+TDPDWL   F FYDE    V+VKV D LD  KLGY +Q +  PW   +PT +
Sbjct  368   LGGRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDVEIPWLRSRPTPR  427

Query  1406  rraklrskasvsasTSVL---------------PATLNKITTFCVTRSPTSKTPGKEE--  1534
             R AK  +    S     L               P  LN++ +  V R   S++  ++E  
Sbjct  428   RSAKKVASNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARPKKSRSKKEKEDE  487

Query  1535  ---LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANST  1705
                L+   L FD T+ ++FDV++N++DD  +   D+ E+AGSF N+ H HK         
Sbjct  488   EELLVIQGLEFDKTKALKFDVYINDEDDSLSAP-DKTEFAGSFVNVPHKHKH-----GKK  541

Query  1706  IKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
             I T  F LA+++LLEDL +E DD ++VTLVPR G     +     E 
Sbjct  542   INT-CFRLALTDLLEDLDVEGDDSVIVTLVPRYGEGLAKIGGIKIEF  587



>gb|EYU27938.1| hypothetical protein MIMGU_mgv1a003402mg [Erythranthe guttata]
Length=587

 Score =   410 bits (1055),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 251/569 (44%), Positives = 343/569 (60%), Gaps = 43/569 (8%)
 Frame = +2

Query  203   IRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPET  382
             I C + ++  +E PA       K DRR+VL+GLGGLYGA  ++  ++PFA A+PI  P+ 
Sbjct  43    ISCKSTNNHDQE-PA------GKFDRRDVLIGLGGLYGATTLS--ASPFAFAAPISAPDV  93

Query  383   KSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDDDYLEKY  559
               CGPA +        P +CCP     TA+   YK P  S  + VRPAAH  D  Y+ K+
Sbjct  94    TKCGPADLPQGAA---PTNCCPPP---TATIVDYKFPPPSTTMRVRPAAHLADKAYVAKF  147

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               A++ M+ LP DDPR+F QQA VHCAYC+GAY  AG P    Q+H +WLFFPFHR+YL+
Sbjct  148   NRAMELMRALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPNLELQVHNSWLFFPFHRYYLF  207

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             F+ERIL  LIDDPTF +PYWN+D+P GM +P ++ +   SPLYDK RNQ H+   + DL 
Sbjct  208   FFERILGKLIDDPTFAMPYWNYDSPAGMTIPAMYTN-PSSPLYDKLRNQGHQPPALIDLN  266

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHN  1090
             ++G  T  ++ Q+VK NL +MYRQM++N+  P LFFG A R+   D  PG G++EN+PH 
Sbjct  267   FSGSGTITAE-QQVKRNLTVMYRQMVSNSKTPRLFFGSAYRRGE-DPNPGSGSVENIPHG  324

Query  1091  SIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQ  1270
              +H W GDP  P+ ENMGNFYSA  DP+FY HHSN+DR+W++WK LGG R+DITDPD+L 
Sbjct  325   PVHVWTGDPTQPNGENMGNFYSAGRDPIFYAHHSNIDRLWSLWKGLGGRRQDITDPDFLD  384

Query  1271  TEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasT  1450
               FLFYDE   +V+VK  D LDN KLGYT+Q +  PW   +PT K  + L+    +  + 
Sbjct  385   ASFLFYDENGQMVRVKTRDCLDNTKLGYTYQDVEIPWLKSRPTPKVSSVLKKLKKLGKAK  444

Query  1451  -----------SVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfv-  1594
                         VLPA L+K+    V R    ++  +++ L+  L     +  R      
Sbjct  445   AAAAETHRPPKEVLPAKLDKVLKIMVKRPKKKRSKKEKDELEEILIIQGIELERDVYAKF  504

Query  1595  ---nedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrle  1765
                  D+D  T   +  E+AGSF N+ H HK                L+I+++LEDL  E
Sbjct  505   DVYINDEDDETSTEENTEFAGSFVNVPHKHKHGKKIKTQ------LRLSITDILEDLDAE  558

Query  1766  nddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             +D+ +LVTLVP   G  +T++    E+ D
Sbjct  559   DDEHVLVTLVPTNAGDSITIHGVKIELDD  587



>ref|XP_009334704.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   411 bits (1056),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 281/612 (46%), Positives = 362/612 (59%), Gaps = 41/612 (7%)
 Frame = +2

Query  50    MATSTHPISSTKNI----SFIstnsssprnfsrrpsQIFLNPNPSRAARRGDVIKIRCAA  217
             MAT+  P  ST  +    S I + +S       +    F   +    +RR     I C A
Sbjct  1     MATAPSPTGSTTTMGTYSSLIISTNSYSAFLPNKSQLSFSGKSKQYVSRRS---SISCKA  57

Query  218   AS---SEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKS  388
              +   +E +  P  SS    KLDRRNVLLGLGGLYGA  +A    P A A+P+ PP+   
Sbjct  58    TNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLA--QKPLAFAAPLAPPDLTK  115

Query  389   CGPATISNSNGKPVPYSCCP--STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYK  562
             C  A I+ + G+ V  +CCP  ST +   + D   IP    L  RPAAH + D+YL K+K
Sbjct  116   CTLAEIT-TGGETV--ACCPPVSTKIKAFTPDR-SIP----LRTRPAAHLVTDEYLAKFK  167

Query  563   TAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYF  733
              A   M+ LP DDPR+  QQANVHCAYCNGAY   G P    Q+HF+WLFFPFHR YLYF
Sbjct  168   KAQALMRALPEDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHRMYLYF  227

Query  734   YERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAY  913
             YERIL  LIDDPTF LPYWNWD+P    +P+I+ D   SPLYD+ RN  H+   + DL+Y
Sbjct  228   YERILGKLIDDPTFALPYWNWDSPVCFPIPDIYTD-TTSPLYDQYRNAGHQPPVLVDLSY  286

Query  914   AGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNS  1093
              G +    +  ++  NLAIMYRQM++ A  P LFFG   R     TG   GTIEN PHN+
Sbjct  287   GGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGNYAGTIENNPHNN  346

Query  1094  IHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQT  1273
             IH W GDP  P+ E+MGNFYS+  DP+FY HH NVDRMW IWKTLGG RKD TD DWL  
Sbjct  347   IHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLGGKRKDPTDTDWLDA  406

Query  1274  EFLFYDETKTLVKVKVEDSLDNVK-LGYTFQKMPTPWKDFKPTrkr-raklrskasvsas  1447
             EFLFYDE   LV  KV DS+   K L YT++ +  PW   KPT ++ R K ++K S +  
Sbjct  407   EFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAKVSATQL  466

Query  1448  TSVLPATLNKITTFCVTRSPTSKTPGKEE------LLDLHLAFDDTQFIRfdvfvneddd  1609
             T+  PAT +  TT  V R    K   KE+      L+   + F+  + ++FDVF+N+D +
Sbjct  467   TTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVFINDDAE  526

Query  1610  vnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVT  1789
               +++ D+ E+AGSF ++ H  K  + T  +        L I++LLEDL +E D  +LVT
Sbjct  527   SLSRK-DKSEFAGSFVHVPHKQKTGTKTKTN------LKLGITDLLEDLGVEEDSCVLVT  579

Query  1790  LVPRAGGSFVTV  1825
             LVPR   S +TV
Sbjct  580   LVPRVSNSPITV  591



>ref|XP_008224998.1| PREDICTED: polyphenol oxidase, chloroplastic [Prunus mume]
Length=589

 Score =   410 bits (1053),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 251/562 (45%), Positives = 337/562 (60%), Gaps = 50/562 (9%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++ C A +S+ + + A     + KLDRRNVLLGLGGLYG   +   ++PFA A P+ PP+
Sbjct  41    RVSCKAKNSDNQNDQA-----QTKLDRRNVLLGLGGLYGVAGLG--TDPFAFAKPVTPPD  93

Query  380   TKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYL  550
                CG A +        P +CCP   + ++D      +K+P+  KL VRPAAHA+D  Y+
Sbjct  94    LSKCGAADLPTGA---TPTNCCPPPATKIID------FKLPAPGKLRVRPAAHAVDQAYI  144

Query  551   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRW  721
             EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY  AG P    QIH +WLFFPFHR+
Sbjct  145   EKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRY  204

Query  722   YLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVT  901
             YLYFYE+IL  LI+DPTF LP+WNWD+P GM LP +F +  +SPLYDK R  +H+   + 
Sbjct  205   YLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALFAN-PKSPLYDKFRAASHQPPTLI  263

Query  902   DLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIEN  1078
             DL Y G +   S+  ++  NL IMYRQM++NA  P LFFG   R   GD   PG G+IE 
Sbjct  264   DLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYR--AGDEPDPGGGSIEG  321

Query  1079  VPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDP  1258
              PH  +H W GD   P+ E+MGNFYSAA DP+F+ HHSNVDRMW+IWKTLGG R DI+  
Sbjct  322   TPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGGKRTDISQS  381

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasv  1438
             DWL + FLFY+E   LV+VKV DSL++  LGY +Q++  PW   KPT +R     SK   
Sbjct  382   DWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVEIPWLQSKPTPRRAKLALSKIKK  441

Query  1439  sasTS-------------VLPATLN-KITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFI  1576
                 +               P  L  KI+T         +   ++E  +  L  +  +F 
Sbjct  442   KLGVAHAAESSTQIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIEGIEFD  501

Query  1577  RfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
             R      +    +  +L    D+ E+AGSF ++ H HK      N+ ++     L +++L
Sbjct  502   RDVAVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKI-NTILR-----LGLTDL  555

Query  1745  ledlrlenddKILVTLVPRAGG  1810
             LEDL  E+D+ ++VTLVP+ G 
Sbjct  556   LEDLDAEDDESVVVTLVPKYGA  577



>gb|AII22007.1| polyphenol oxidase-5 [Gossypium hirsutum]
Length=598

 Score =   410 bits (1053),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 262/562 (47%), Positives = 348/562 (62%), Gaps = 33/562 (6%)
 Frame = +2

Query  218   ASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSC-G  394
             AS+  + N   SSL+    DRR++LLGLG LYGA N+   S+PFALA+PI  P+   C  
Sbjct  50    ASNGNQNNEGSSSLNS--FDRRDILLGLGTLYGATNLV--SDPFALAAPIAAPDLSLCEN  105

Query  395   PATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQ  574
                 S+S+G  +   CCP     T +   +K P FS + +RPAAH +D +YLEK+  A++
Sbjct  106   STVTSSSSGTSISVPCCPPK---TTNILDFKPPRFSTIRLRPAAHLVDANYLEKFTKAME  162

Query  575   KMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERI  745
              MK LP DDPR+F QQANVHCAYCNGAY   G P    Q+HF+WLFFPFHR YLYFYERI
Sbjct  163   LMKALPDDDPRSFKQQANVHCAYCNGAYDQVGFPDQQLQVHFSWLFFPFHRLYLYFYERI  222

Query  746   LQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQE  925
             L  LI DP F +P+WNWD+P GM +P+I+ D   SPLYD+KRN  H+   + DL YAG E
Sbjct  223   LGKLIGDPNFAMPFWNWDSPPGMAIPKIYVD-PNSPLYDEKRNVNHQPPNMLDLDYAGTE  281

Query  926   TSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRW  1105
                S   ++K+NL++MYRQM+T     L F G A R    D  PGMG+IEN PH ++HRW
Sbjct  282   EELSKRDQIKSNLSVMYRQMVTYKTASL-FLGAAYRA-GDDPSPGMGSIENNPHTAVHRW  339

Query  1106  VGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL-GGNRKDITDPDWLQTEFL  1282
             VGD R P +E+MGNFYSA  DP+FY HHS+VDR+W+IW+TL G  R D T  DWL + FL
Sbjct  340   VGDKRQPFSEDMGNFYSAGRDPLFYAHHSDVDRLWSIWRTLPGKKRTDFTGTDWLDSSFL  399

Query  1283  FYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTS---  1453
             FYDE   LV+VKV DSL+    GY +QK+  PW   KP  ++  + +S     A+ +   
Sbjct  400   FYDENANLVRVKVRDSLNMKTFGYDYQKVNIPWLKNKPIPRKSGRGKSGGQAVAAETKNT  459

Query  1454  -----VLPATLNKITTFCVTRSPTSKT----PGKEELLDLH-LAFDDTQFIRfdvfvned  1603
                    P  L+K+    V R   S+T      +EE+L L  +  D    ++FDV++N++
Sbjct  460   TPISIAFPIALDKLVRVEVPRPKKSRTKLEKEDEEEVLVLQNIQLDRDAAVKFDVYINDE  519

Query  1604  ddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKIL  1783
             DD    E +  E+AGSF+NL H H  T    N+ +  P     +++LLEDL +E D+ IL
Sbjct  520   DDETPTEPEDSEFAGSFTNLPHNHHKTGMKLNTNLTLP-----LTDLLEDLNVEGDESIL  574

Query  1784  VTLVPRAGGSFVTVNKAYTEII  1849
             VTLVP+ G   V++     + I
Sbjct  575   VTLVPKEGKGLVSIGNIKIDYI  596



>ref|XP_003593515.1| Polyphenol oxidase [Medicago truncatula]
 gb|ABN08603.1| Tyrosinase [Medicago truncatula]
 gb|AES63766.1| polyphenoloxidase [Medicago truncatula]
Length=607

 Score =   410 bits (1054),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 240/533 (45%), Positives = 320/533 (60%), Gaps = 43/533 (8%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             +NPFALASPI PP+  +CGP  +      P   +CCP    ++     YKIPS ++ L V
Sbjct  90    TNPFALASPISPPDLSTCGPPDLP-LGATPNNINCCPP---NSTKIINYKIPSSNQPLRV  145

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             R AAH ++D+YL+KYK AI+ MK LPS+DPR+F QQAN+HCAYC+GAY   G P    Q+
Sbjct  146   RQAAHLVNDEYLQKYKKAIELMKALPSNDPRSFIQQANIHCAYCDGAYSQVGFPNLDLQV  205

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHRWYLYFYERIL SLI+DPTF LP+WN+D P GM  P I+ D   SPLYD+
Sbjct  206   HNSWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMQFPSIYTD-RTSPLYDE  264

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              RN  H+   + DL Y G + +  + +++  NL IMYRQ+++N     LF G + R   G
Sbjct  265   LRNANHQPPTLIDLNYDGDDENDEN-ERISTNLTIMYRQLVSNGKTSTLFLGSSYR--AG  321

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IENVPH  +HRW GD   P+ ENMG FY+AA DP+F+ HHSN+DR W++WK
Sbjct  322   DQPDPGAGSIENVPHGPVHRWSGDNTQPNFENMGTFYAAARDPIFFSHHSNIDRFWSVWK  381

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP--  1396
             TLGG RKD  D DWL++EFLFYDE K LVKVKV+DSLD  KLGY +Q + TPW + KP  
Sbjct  382   TLGGKRKDFKDKDWLESEFLFYDENKNLVKVKVKDSLDTKKLGYVYQDVDTPWLNAKPKP  441

Query  1397  --------------TrkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE  1534
                                 +  +    S S    P  L+ + +  V R   S++  ++E
Sbjct  442   CRKKIQKNVEVAQGIFFGIGEAHASEINSRSYVTCPLVLDNVVSTIVKRPKKSRSKKEKE  501

Query  1535  LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRV------EYAGSFSNLAH-VHKDTSTT  1693
               +  L  +  +F +      + D     E D+V      E+AGSF N+ H  H      
Sbjct  502   EKEEVLVIEGIEFDK--SLGVKFDVFINDEDDKVIKPVNTEFAGSFVNVPHSSHDHKKKK  559

Query  1694  ANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
              NS ++     + +++LLEDL  E+DD ++VTLVPR G   V +     E+ D
Sbjct  560   TNSCLR-----VGLTDLLEDLGAEDDDSVVVTLVPRYGKGIVKIRNIKIELED  607



>ref|XP_011047843.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Populus euphratica]
Length=590

 Score =   409 bits (1052),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 243/527 (46%), Positives = 322/527 (61%), Gaps = 38/527 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             S+PFA A+P+  P+   C  A +     +    +CCP  +  T   D+ +  S + L VR
Sbjct  75    SDPFAFAAPVSAPDISKCSRADLPTGVNE---TNCCPP-VPSTKILDFKRPSSNAPLRVR  130

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH  + DY+ KY  AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    Q+H
Sbjct  131   PAAHLANKDYIAKYSKAIELMKALPDDDPRSFMQQADVHCAYCNGAYDQVGFPNLDIQVH  190

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFPFHR+YLYFYE+IL  LIDDPTF LP+WNWD+P GM LP ++ D   SPLYD  
Sbjct  191   NSWLFFPFHRYYLYFYEKILGKLIDDPTFALPFWNWDSPGGMQLPAMYAD-PNSPLYDSL  249

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             RN+ H+   + DL ++G +T  S+ +++ +NL IMYRQM++N   P LFFG + R   GD
Sbjct  250   RNKNHQPPTLLDLDWSGTDTPTSNREQISSNLTIMYRQMVSNGKTPRLFFGGSYR--AGD  307

Query  1049  T-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
               GP  G IEN+PH  +H W GD   P+ E+MGNFYSAA DP+F+CHHSNVDRMW++WKT
Sbjct  308   EPGPEAGPIENIPHGPVHIWTGDNTQPNFEDMGNFYSAARDPIFFCHHSNVDRMWSVWKT  367

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrk  1405
             LGG R D+TDPDWL   F FYDE    V+VKV D LD  KLGY +Q +  PW   +PT +
Sbjct  368   LGGRRTDLTDPDWLNASFFFYDENANPVRVKVRDCLDTRKLGYVYQDVEIPWLRSRPTPR  427

Query  1406  rraklrskasvsasTSVL---------------PATLNKITTFCVTRSPTSKTPGKEE--  1534
             R AK  +    S     L               P  LN++ +  V R   S++  ++E  
Sbjct  428   RSAKKVASNIFSHEKEALAAEKKTNALTPITAFPLVLNRVISVKVARPKKSRSKKEKEDE  487

Query  1535  ---LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANST  1705
                L+   L FD T+ ++FDV++N++DD  +   D+ E+AGSF N+ H HK         
Sbjct  488   EELLVIQGLEFDKTKALKFDVYINDEDDSLSAP-DKTEFAGSFVNVPHKHKH-----GKK  541

Query  1706  IKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
             I T  F LA+++LLEDL +E DD ++VTLVPR G     +     E 
Sbjct  542   INT-CFRLALTDLLEDLDVEGDDSVIVTLVPRYGEGLAKIGGIKIEF  587



>gb|EYU34163.1| hypothetical protein MIMGU_mgv1a003224mg [Erythranthe guttata]
Length=598

 Score =   410 bits (1053),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 248/549 (45%), Positives = 341/549 (62%), Gaps = 26/549 (5%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             +I C++ +S+  +N    S S   +DRRNVLLG+GGL GA N+   + P A A+PI PPE
Sbjct  38    QISCSSTTSQN-QNDDTKSQSGKVVDRRNVLLGMGGLCGAANLVSNT-PAASANPILPPE  95

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
                CG AT  N+       +CCP    D      YK+P   ++ +RP+AH    +Y+ KY
Sbjct  96    LNKCGTATNWNNGESLDGINCCPPLTTDIID---YKLPPVFRMKIRPSAHRASAEYMYKY  152

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               A  +MK LP+DDPRNF QQAN+HCAYCNGAY   G+     QIH  WLFFPFHRWYLY
Sbjct  153   NLATDRMKRLPADDPRNFMQQANIHCAYCNGAYDQPGQGTLDIQIHKCWLFFPFHRWYLY  212

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYERIL  LI DPTF LP+WNWDNP+GM +P +F +D  S LYD+KRNQ + R  V DL 
Sbjct  213   FYERILGKLIGDPTFALPFWNWDNPKGMTIPPMFVEDPRSALYDRKRNQKNLRA-VVDLG  271

Query  911   YAGQETSASD-FQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPH  1087
                  T A+D  Q V NNL IM+ +M+     PL F G A   E  D  PG G++E   H
Sbjct  272   L----TDATDTLQVVSNNLTIMHNEMIRGISDPLDFMG-ARYSEGSDPNPGEGSVERGSH  326

Query  1088  NSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNR---KDITDP  1258
              SIH WVGDP  P  E++GNFYSA  DP+FYCHH+NVDRMW +W+ L  N+   K ITDP
Sbjct  327   TSIHAWVGDPEQPSGEDLGNFYSAGRDPLFYCHHANVDRMWYLWQRLPNNKLPDKRITDP  386

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasv  1438
             D+L   FLFYDE   LVKV V D+ DN ++G+ ++++  PW D++P  +      +K   
Sbjct  387   DYLNASFLFYDENAQLVKVYVRDTFDNRRMGFDYERIDLPWMDYRPPLQAARTKINKVDA  446

Query  1439  sasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnT  1618
               + ++ P  L+++  F V +  T K    E L+  ++  D ++ ++FDVFVN++DD  +
Sbjct  447   PNAKTLFPLKLDRVVRFQVDK--TKKGKADEILVLENITVDASKLLKFDVFVNDEDDNPS  504

Query  1619  KELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVP  1798
              ELD+  Y G+++ L H  +  +T+ +S+I+     L +++L +D+ + +DD I+VTLVP
Sbjct  505   -ELDKASYLGTYAQLPHKPRSGTTSNSSSIR-----LKLTDLYDDIDIGDDDAIVVTLVP  558

Query  1799  RAGGSFVTV  1825
             R  G  VT+
Sbjct  559   RHQGPGVTI  567



>gb|AAW78869.1| polyphenol oxidase [Ipomoea batatas]
Length=588

 Score =   409 bits (1052),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 263/578 (46%), Positives = 357/578 (62%), Gaps = 52/578 (9%)
 Frame = +2

Query  161   PNPSR----AARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayni  328
             P PS+     A+R    K+ C A + +          S+ KLDRR+VLLGLGGL GA ++
Sbjct  31    PKPSQIHIATAKRTHHFKVSCNAPNGD----------SQPKLDRRDVLLGLGGLAGAASL  80

Query  329   aggSNPFALASPIPPPETKSCGPATISNSNGKP--VPYSCCPSTLMDTASADYYKIP--S  496
                +NP A A PI  PE   C    +   +  P  +  SCCP    +   +   K+P  S
Sbjct  81    I--NNPLAFAEPIHAPEISKC---VVPPKDLPPDAIVDSCCPPLATNVIPS---KVPKTS  132

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              S + +RPA H +D +Y+ K++ AI+ MK+LP+DDPRNFYQQA VHCAYCNG Y     P
Sbjct  133   PSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRNFYQQALVHCAYCNGGYVQTDYP  192

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHRWYLYFYERIL  LI+DPTF LP+WNWD P GM++P+ F  ++ 
Sbjct  193   DKEIQVHNSWLFFPFHRWYLYFYERILGKLINDPTFGLPFWNWDTPAGMLIPQYF-RNQN  251

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             SPLYD+ R Q+H    V DL YAG +T  +D +++ NNLA+MY+ M+TNA    LF GK 
Sbjct  252   SPLYDENRLQSH-LPLVMDLGYAGTDTDVTDDERISNNLALMYKSMVTNAGTAELFLGKP  310

Query  1028  IRKETGDTGPGMGTIENVPHNSIHRWVGD--PRSPHNENMGNFYSAAIDPVFYCHHSNVD  1201
              +        G G+IEN+PH  +HRWVGD  PR+ + E+MGNFYSA  D +FYCHHSNVD
Sbjct  311   YKAGDDPVNKGGGSIENIPHTPVHRWVGDVQPRTQNGEDMGNFYSAGRDILFYCHHSNVD  370

Query  1202  RMWTIWKTLGGN--RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPT  1375
             RMWTIW+ LGG   R+D TD DWL   F+FYDE K   +V+V D+LDN KLGY ++    
Sbjct  371   RMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAYRVRVGDALDNQKLGYKYEFTNL  430

Query  1376  PWKDFKPT-rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTP-------GKE  1531
             PW + KP   K++  L +++     T V P TL+K+    V R   S++           
Sbjct  431   PWLNSKPLPTKKKTGLAARSKAPFVTDVFPLTLDKVVQVKVPRPKKSRSKEEKEAEEEIL  490

Query  1532  ELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIK  1711
             E+  + +A D  Q+ +FDV++N++D+    + ++ EYAGSF++L H H     T +  I+
Sbjct  491   EIEGIEVAID--QYAKFDVYLNDEDEPEAGK-EKAEYAGSFAHLPHKH-----TGSKKIR  542

Query  1712  TPTFSLAISelledlrlenddKILVTLVPRAGGSFVTV  1825
             T + SL ++E LEDL  E+DD +LVTL P+ GG  VTV
Sbjct  543   T-SLSLGLNEPLEDLGAEDDDAVLVTLAPKVGGGDVTV  579



>ref|XP_010052352.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW76288.1| hypothetical protein EUGRSUZ_D00657 [Eucalyptus grandis]
Length=601

 Score =   410 bits (1053),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 262/580 (45%), Positives = 344/580 (59%), Gaps = 48/580 (8%)
 Frame = +2

Query  176   AARRGDVIKIRCAAASSEGRE-NPADSSLSEAKLDRRNVllglgglygayniaggSNPFA  352
             +ARR     I C A S++  E NP       AK DRRNVL+GLGG YGA  +   S+PFA
Sbjct  49    SARRS---TISCKAPSNDDSEQNPL-----SAKFDRRNVLIGLGGFYGAVGLR--SDPFA  98

Query  353   LASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSF-SKLNVRP  520
             LA PI  P+   CG A +  +  K    +CCP   + ++D      +K+PS  S L VRP
Sbjct  99    LADPISAPDLTKCGKADLP-AGAKAT--NCCPPPTTKILD------FKLPSSNSPLRVRP  149

Query  521   AAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHF  691
             AAH  D DY+ KY  AI+ MK LP+DDPR+F QQANVHCAYC+GA+   G P    Q+H 
Sbjct  150   AAHLADKDYIAKYAKAIELMKALPADDPRSFMQQANVHCAYCDGAHHQVGFPNLELQVHN  209

Query  692   TWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKR  871
             +WLFFPFHR+YLYFYE+IL SLI DPTF LPYWNWD P GM +P +F D  +SPLYD  R
Sbjct  210   SWLFFPFHRYYLYFYEKILGSLIGDPTFALPYWNWDAPDGMKMPALFAD-PKSPLYDANR  268

Query  872   NQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT  1051
             N  H    + DL Y G++ + S+  ++ +NL IMYRQM++N     LF G   R    D 
Sbjct  269   NPKHAPPMLVDLDYNGEDPTTSNQDQLSSNLTIMYRQMVSNGKSAKLFLGSDYR-AGDDA  327

Query  1052  GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLG  1231
              PG G++EN+PH  +H W GD R P+ E+MGNFYSAA DP+F+ HHSNVDRMWT+WKTLG
Sbjct  328   DPGAGSLENIPHGPVHVWCGDNRQPNLEDMGNFYSAARDPIFFSHHSNVDRMWTVWKTLG  387

Query  1232  GNRK-DITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkr  1408
             G+R+ D TDPDWL   FLFYDE    V+VKV+D L+   LGY +Q +  PW   KPT ++
Sbjct  388   GSRRIDFTDPDWLNAAFLFYDENAQAVRVKVKDCLETTNLGYVYQDVDIPWLKSKPTPRK  447

Query  1409  raklrskasvsasTSV--------LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDD  1564
              AK  +KA    + +          P  L+K+    V R    ++  ++E  +  L  + 
Sbjct  448   TAKKVAKAFGKVAHAAEIPRPIVQFPVKLDKVVRTLVKRPKQKRSKKEKEEEEEVLVIEG  507

Query  1565  TQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLA  1732
              +F R      +    +  +     D+ E+AGSF N+           +  +KT    L 
Sbjct  508   IEFERDAFVKFDVYINDEHDSLSSPDQTEFAGSFVNVP-----HKHKHHKKMKT-RLRLG  561

Query  1733  ISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             I++LLEDL  E+DD+ILVTL P+  G  VTV     E +D
Sbjct  562   ITDLLEDLVCEDDDEILVTLAPKYAGEQVTVGNIKIEFVD  601



>ref|XP_009334541.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=600

 Score =   410 bits (1053),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 280/612 (46%), Positives = 361/612 (59%), Gaps = 41/612 (7%)
 Frame = +2

Query  50    MATSTHPISSTKNI----SFIstnsssprnfsrrpsQIFLNPNPSRAARRGDVIKIRCAA  217
             MAT+  P  ST  +    S I + +S       +    F   +    +RR     I C A
Sbjct  1     MATAPSPTGSTTTMGTYSSLIISTNSYSAFLPNKSQLSFSGKSKQYVSRRS---SISCKA  57

Query  218   AS---SEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKS  388
              +   +E +  P  SS    KLDRRNVLLGLGGLYGA  +A    P A A+P+ PP+   
Sbjct  58    TNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLA--QKPLAFAAPLAPPDLTK  115

Query  389   CGPATISNSNGKPVPYSCCP--STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYK  562
             C  A I+ + G+ V  +CCP  ST +   + D   IP    L  RPAAH + D+YL K+K
Sbjct  116   CTLAEIT-TGGETV--ACCPPVSTKIKAFTPDR-SIP----LRTRPAAHLVTDEYLAKFK  167

Query  563   TAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYF  733
              A   M+ LP DDPR+  QQA VHCAYCN AY   G P    Q+HF+WLFFPFHR YLYF
Sbjct  168   KAQALMRALPEDDPRSMVQQAKVHCAYCNDAYPQVGFPDIDIQVHFSWLFFPFHRMYLYF  227

Query  734   YERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAY  913
             YERIL  LIDDPTF LPYWNWD+P G  +P+I+ D   SPLYD+ RN  H+   + DL+Y
Sbjct  228   YERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTD-TTSPLYDQYRNAGHQPPVLVDLSY  286

Query  914   AGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNS  1093
              G +    +  ++  NLAIMYRQM++ A  P LFFG   R     TG   GTIEN PHN+
Sbjct  287   GGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGNYAGTIENNPHNN  346

Query  1094  IHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQT  1273
             IH W GDP  P+ E+MGNFYS+  DP+FY HH NVDRMW IWKTLGG RKD TD DWL  
Sbjct  347   IHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLGGKRKDPTDTDWLDA  406

Query  1274  EFLFYDETKTLVKVKVEDSLDNVK-LGYTFQKMPTPWKDFKPTrkr-raklrskasvsas  1447
             EFLFYDE   LV  KV DS+   K L YT++ +  PW   KPT ++ R K ++K S +  
Sbjct  407   EFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPWLFSKPTARKPRNKTKAKVSATQL  466

Query  1448  TSVLPATLNKITTFCVTRSPTSKTPGKEE------LLDLHLAFDDTQFIRfdvfvneddd  1609
             T+  PAT +  TT  V R    K   KE+      L+   + F+  + ++FDVF+N+D +
Sbjct  467   TTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVFINDDAE  526

Query  1610  vnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVT  1789
               +++ D+ E+AGSF ++ H  K  + T  +        L I++LLEDL +E D  +LVT
Sbjct  527   SLSRK-DKSEFAGSFVHVPHKQKTGTKTKTN------LKLGITDLLEDLGVEEDSCVLVT  579

Query  1790  LVPRAGGSFVTV  1825
             LVPR   S +TV
Sbjct  580   LVPRVSNSPITV  591



>gb|ACR61399.1| polyphenol oxidase [Solanum melongena]
Length=546

 Score =   407 bits (1047),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 244/549 (44%), Positives = 333/549 (61%), Gaps = 39/549 (7%)
 Frame = +2

Query  161   PNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             P PS+     +R    K+ C  +++ G +N   + + +  +DRRNVLLGLGG+YGA N A
Sbjct  11    PKPSQLFLHGKRKQTFKVSCKVSNNNGDQN--QNEVEKNSVDRRNVLLGLGGMYGAANFA  68

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               +   A   P    +  SC  A I+ +  + V YSCC  T  D     YYK PS +KL 
Sbjct  69    PLAASAAPTPPP---DLSSCSIAKITET--EEVSYSCCAPTPDDLNKIPYYKFPSMTKLR  123

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN---FYQQANVHCAYCNGAYQLAGKPYQ  682
             +R  AHA D++Y+ KY  AI +MK L + +P N   F QQAN+HCAYCNGAY++  K  Q
Sbjct  124   IRQPAHAADEEYIAKYNLAISRMKHLDTTEPLNPIGFKQQANIHCAYCNGAYKIGDKVLQ  183

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYFYERIL S+IDDPTF LPYWNWD+P+GM +P +FD  E + LYD
Sbjct  184   VHNSWLFFPFHRWYLYFYERILGSIIDDPTFALPYWNWDHPKGMRMPAMFDG-EGTALYD  242

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCP------LLFFGK  1024
             + RNQ+HR G V DL   G E   ++ Q + NNL +MYRQ    APCP      L F G 
Sbjct  243   QVRNQSHRNGRVMDLGSFGDEVQTTELQLMSNNLTLMYRQWYY-APCPRMFLARLTFLGI  301

Query  1025  AIR-----KETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHH  1189
              ++     K +       G ++      +     + R+ H ENMG+FYSA +DPVF+CHH
Sbjct  302   TLKPQEPLKSSLTVLSTFGLVQCQVQPCL-----NGRTSHGENMGHFYSAGLDPVFFCHH  356

Query  1190  SNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKM  1369
             SNVDRMW+ WK +GG R+DI+  DWL +EF FYDE     +VKV D LD  K+GY +  M
Sbjct  357   SNVDRMWSEWKAIGGKRRDISHKDWLNSEFFFYDENGDPFRVKVRDCLDTKKMGYDYAPM  416

Query  1370  PTPWKDFKPTrkrraklrskasvsasTSVLP-ATLNKITTFCVTRSPTSKTPG----KEE  1534
             P PW++FKP  K        +S+   + V P A L+K  +F + R  +S+T      +EE
Sbjct  417   PRPWRNFKPITKASVGKVDTSSLPPVSQVFPLAKLDKAISFSINRPASSRTQQEKNEQEE  476

Query  1535  LLDL-HLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIK  1711
             +L   ++ +D+  ++RFDVF+N D +VN  ELD+ E+AGS++NL HVH+    T +  + 
Sbjct  477   MLTFNNIKYDNRNYVRFDVFLNVDSNVNADELDKAEFAGSYTNLPHVHRVGENTDH--VA  534

Query  1712  TPTFSLAIS  1738
             T T  LAI+
Sbjct  535   TATLQLAIT  543



>ref|XP_010242012.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nelumbo nucifera]
Length=610

 Score =   409 bits (1052),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 256/576 (44%), Positives = 334/576 (58%), Gaps = 41/576 (7%)
 Frame = +2

Query  182   RRGDVIKIRCAAASSEGRENPADSSLSE------AKLDRRNVllglgglygayniaggSN  343
             R+  V K+ C A   E +    D+S S        ++DRRNVL+ LGGLYGA  +   ++
Sbjct  41    RQRMVGKVSCGARGGEQKPTQGDASSSGNGEGSLGRMDRRNVLISLGGLYGATGLG--AD  98

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPA  523
               A  +PI  P+   CG A +  S     P +CCP T   +   D+   P    + VR A
Sbjct  99    RLAFGAPIMAPDLTKCGAADLPTSAK---PTNCCPPT--SSKVVDFKLPPQNEDMRVRQA  153

Query  524   AHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFT  694
             AH +DD+Y+ KY+ AI +MK LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +
Sbjct  154   AHLVDDEYVAKYQDAIARMKALPTDDPRNFTQQANVHCAYCDGAYDQVGFPDLELQVHNS  213

Query  695   WLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRN  874
             WLFFPFHR+YLYFYERIL  LI DPTF LP+WNWD P GM LP ++ +   S LY+K R+
Sbjct  214   WLFFPFHRYYLYFYERILGKLIGDPTFALPFWNWDAPAGMTLPAMYTNPSSS-LYNKLRD  272

Query  875   QAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-  1051
               H+   + DL Y  ++ S ++ +++K+NLAIMYRQM++N     LF G   R   GD  
Sbjct  273   TKHQPPTLIDLDYNLKDPSITNEEQLKHNLAIMYRQMVSNGSTAQLFLGTPYR--AGDEP  330

Query  1052  GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLG  1231
              PG G++ENVPH  +H W GD   P+ E+MGNFYSAA DP+FY HH+NVDRMWTIWKTLG
Sbjct  331   DPGNGSLENVPHGPVHLWAGDRNQPNVEDMGNFYSAARDPIFYAHHANVDRMWTIWKTLG  390

Query  1232  GNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrr  1411
             G R+D TDPDWL + FLFYDE   LVKVKV D LD  KL YT+Q +  PW   KPT  R+
Sbjct  391   GKRRDFTDPDWLDSAFLFYDENAELVKVKVRDCLDEKKLRYTYQSVDIPWLKTKPTPVRK  450

Query  1412  aklrska---------------svsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDL  1546
              K   K                    + S  P  L+      V R   S++  ++E  + 
Sbjct  451   MKEALKEEEGLKDKIKERVLKLEKKIAVSEFPKQLDTAFKTVVKRPRKSRSKKEKEDEEE  510

Query  1547  HLAFDDTQFIRfdvfvnedddvnTKE--LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
              L  +  +  R  V   +    N  E   D+ E+AGSF N+ H H         T     
Sbjct  511   ILVIEKIELERDSVVKFDVYINNEDEPSPDKSEFAGSFVNVPHKHGKKKKKRVKTF----  566

Query  1721  FSLAISelledlrlenddKILVTLVPRAGGSFVTVN  1828
               L+I+ELLEDL  E+DD+++VT+VPR GG  V + 
Sbjct  567   LRLSITELLEDLETEDDDEVVVTIVPRLGGDLVIIG  602



>gb|AHC98007.1| PPO [Salvia miltiorrhiza]
Length=589

 Score =   409 bits (1050),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 255/579 (44%), Positives = 354/579 (61%), Gaps = 43/579 (7%)
 Frame = +2

Query  164   NPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSN  343
             NPSR+       KI C +++ +    P  S     K DRRN+L+GLGGLYGA  +A  ++
Sbjct  38    NPSRS------YKISCKSSNHDHESPPPPS-----KFDRRNLLIGLGGLYGATTLA--TS  84

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPA  523
             PF+ A+PI  P+   CGPA +        P +CCP    +     +   P+  KL +RPA
Sbjct  85    PFSFAAPISGPDVTQCGPADLP---AGATPTNCCPPLTGEILDFQFPAPPA--KLRIRPA  139

Query  524   AHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFT  694
             AH  DD Y+ K+  A++ M+ LP DDPR+F QQANVHCAYC+GAY  AG P    Q+H +
Sbjct  140   AHLADDAYIAKFNRAVELMRALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQVHNS  199

Query  695   WLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRN  874
             WLFFPFHR+YLYFYERIL  LIDDP+F +PYWNWD P GM +P I+ +   S LYD  R+
Sbjct  200   WLFFPFHRYYLYFYERILAKLIDDPSFAMPYWNWDAPAGMPIPRIYAN-PSSALYDPLRD  258

Query  875   QAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTG  1054
             +AH+   + DL Y+G + + +  Q+ + NL +MYRQM++N+  P LFFG   R+   D  
Sbjct  259   KAHQPPALVDLNYSGTDPATTANQQAQTNLTVMYRQMVSNSKTPRLFFGSPYRRGE-DPN  317

Query  1055  PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG  1234
             PG G+IE +PH  +H W GD   P+ ENMGNFYSAA DP+FY HHSN+DRMW++WKTLGG
Sbjct  318   PGGGSIEGIPHGPVHVWTGDRTQPNTENMGNFYSAARDPIFYAHHSNIDRMWSVWKTLGG  377

Query  1235  NRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrra  1414
              R+DITDPD+L   FLFYDE   +V+VKV D LD  KLGY +Q +  PW + +PT +  +
Sbjct  378   RRQDITDPDFLDAAFLFYDENAKMVRVKVRDCLDPRKLGYAYQDVEIPWANSRPTPRVSS  437

Query  1415  klrskasvsasTS--------VLPATLNKITTFCVTRSPTSKTPGK----EELLDLH-LA  1555
              LR    +  + +        V PA L+++    V R    ++  +    EE+L +  + 
Sbjct  438   VLRKLKKLGRAKAADAQSPREVFPAKLDRVLKVMVKRPKKKRSKKEKDELEEILVIKGIE  497

Query  1556  FDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAI  1735
              D   +++FDV++N++DD  T   +  E+AGSF N+ H HK                L+I
Sbjct  498   VDRDTYVKFDVYINDEDDEITTA-ENTEFAGSFVNVPHKHKHDKKIKTQ------LRLSI  550

Query  1736  SelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             S++LEDL  E+D+ +LVTLVP   G  +T++    E+ D
Sbjct  551   SDILEDLDAEDDEHVLVTLVPTNAGDAITIHDIKIELDD  589



>ref|XP_007211392.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
 gb|EMJ12591.1| hypothetical protein PRUPE_ppa003257mg [Prunus persica]
Length=589

 Score =   408 bits (1049),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 249/562 (44%), Positives = 338/562 (60%), Gaps = 50/562 (9%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++ C A +S+ + + A     + KLDRRNVLLGLGGLYG   +   ++PFA A P+ PP+
Sbjct  41    RVSCKAKNSDNQNDQA-----QTKLDRRNVLLGLGGLYGVAGLG--TDPFAFAKPVNPPD  93

Query  380   TKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYL  550
                CG A +        P +CCP   + ++D      +K+P+  KL +RPAAHA+D  Y+
Sbjct  94    LSKCGAADLPTGA---TPTNCCPPPATKIID------FKLPAPGKLRIRPAAHAVDQAYI  144

Query  551   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRW  721
             EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY  AG P    QIH +WLFFPFHR+
Sbjct  145   EKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRY  204

Query  722   YLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVT  901
             YLYFYE+IL  LI+DPTF LP+WNWD+P GM LP +F +  +SPLYDK R  +H+   + 
Sbjct  205   YLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALFAN-PKSPLYDKFRAASHQPPTLI  263

Query  902   DLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIEN  1078
             DL Y G +   S+  ++  NL IMYRQM++NA  P LFFG   R   GD   PG G+IE 
Sbjct  264   DLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYR--AGDEPDPGGGSIEG  321

Query  1079  VPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDP  1258
              PH  +H W GD   P+ E+MGNFYSAA DP+F+ HHSNVDRMW+IWKTLGG R DI+  
Sbjct  322   TPHGPVHLWTGDNTQPNLEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGGKRTDISHS  381

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasv  1438
             DWL + FLFY+E   LV+VKV DSL++  LGY +Q++  PW   KPT +R     SK + 
Sbjct  382   DWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPTPRRAKLAVSKIAK  441

Query  1439  sasTS-------------VLPATLN-KITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFI  1576
                 +               P  L  KI+T         +   ++E  +  L  +  +F 
Sbjct  442   KLGVAHAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIEGIEFD  501

Query  1577  RfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
             R      +    +  +L    D+ E+AGSF ++ H HK      N+ ++     L +++L
Sbjct  502   RDVAVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKI-NTILR-----LGLTDL  555

Query  1745  ledlrlenddKILVTLVPRAGG  1810
             LED+  E+D+ ++VTLVP+ G 
Sbjct  556   LEDIDAEDDESVVVTLVPKYGA  577



>gb|AGC54425.1| polyphenol oxidase 1 [Gossypium hirsutum]
Length=616

 Score =   409 bits (1051),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 260/568 (46%), Positives = 353/568 (62%), Gaps = 36/568 (6%)
 Frame = +2

Query  203   IRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPET  382
             + C A  S+  +N ADSS S  + DRR++LLGLGGLYGA N+   S+PFA A+PI  P+ 
Sbjct  64    VSCKA--SDRNQNNADSS-SLNRFDRRDILLGLGGLYGATNLV--SDPFASAAPIAAPDL  118

Query  383   KSC-GPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
               C      S+S+G  +   CCP    +      +K P FS + +RPAAH +D +YLEK+
Sbjct  119   SLCENSTVTSSSSGTSISVPCCPPKATNIID---FKPPRFSNIRLRPAAHLVDANYLEKF  175

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               A++ MK LP DDPR+F QQANVHCAYCNG Y   G P    QIHF+WLFFPFHR+YLY
Sbjct  176   TKAMELMKALPDDDPRSFKQQANVHCAYCNGVYDHVGFPDQQLQIHFSWLFFPFHRFYLY  235

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYERIL  LI DP F +P+WNWD+P GM++P+I+ D   SPLYD+KRN  H+   + DL 
Sbjct  236   FYERILGKLIGDPNFVMPFWNWDSPPGMVIPDIYVD-PTSPLYDEKRNVDHQPPKMLDLD  294

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPH  1087
             YAG E   S   ++K+NL++MYRQM+T    P LF G A R   GD   PGMG++EN PH
Sbjct  295   YAGTEELLSKRDQIKSNLSVMYRQMVTYK-TPSLFHGAAYR--AGDNPSPGMGSVENNPH  351

Query  1088  NSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL-GGNRKDITDPDW  1264
              ++HRWVGD R P +E+MGNFYSA  DP+FY HH NVDR+W IWK+L G  R D TD DW
Sbjct  352   TAVHRWVGDKREPFSEDMGNFYSAGRDPLFYAHHCNVDRLWNIWKSLPGKKRTDFTDTDW  411

Query  1265  LQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT--------rkrrakl  1420
             L + FLFYDE   LV+VKV D L++  LGY +QK+  PW   KPT            A  
Sbjct  412   LDSSFLFYDENANLVRVKVRDCLNSRTLGYDYQKVNIPWLKNKPTPRRPGRGSGSGSAMA  471

Query  1421  rskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQF-----IRfd  1585
                ++ +   +  P  L+K+    V R+  S+T  ++E  +  L   + +      ++FD
Sbjct  472   AETSTKTVIRNAFPIVLDKLVRIEVPRTKKSRTKVEKENEEEVLVLQNIRVDRDVAVKFD  531

Query  1586  vfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrle  1765
             V++N++DD    E +  E+AGSF+N+ H H + +   ++ +  P     +S+LLEDL +E
Sbjct  532   VYINDEDDETPTEPEDSEFAGSFTNIPHNHHNPAVKLDTNLTLP-----LSDLLEDLDIE  586

Query  1766  nddKILVTLVPRAGGSFVTVNKAYTEII  1849
              DD I+VTLVP+ G   V++     + +
Sbjct  587   RDDNIVVTLVPKEGKGLVSIGNIKIDFV  614



>ref|XP_006370117.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
 gb|ERP66686.1| hypothetical protein POPTR_0001s39650g [Populus trichocarpa]
Length=543

 Score =   406 bits (1044),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 239/491 (49%), Positives = 301/491 (61%), Gaps = 32/491 (7%)
 Frame = +2

Query  431   PYSCCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPR  607
             P +CCP T   +     ++ PS S  + +RPAAH +D  Y+ KY  AI  MK LP DDPR
Sbjct  65    PSNCCPPT---STKIKNFEFPSASSPMRIRPAAHLVDKAYVAKYAKAIALMKSLPDDDPR  121

Query  608   NFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFT  778
             +F  QA+VHCAYC+GAY  AG P    QIHF+WLFFP+HR YLY++ERIL  LID PTF 
Sbjct  122   SFKSQADVHCAYCDGAYHQAGFPDLDLQIHFSWLFFPWHRLYLYYFERILGKLIDGPTFA  181

Query  779   LPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETS---ASDFQK  949
             LP+WNWD P GM +P IF D  ESPLYD  R+  H+   + DL YA  + +   A   + 
Sbjct  182   LPFWNWDAPAGMQMPAIFTD-PESPLYDPLRDANHQPPTLLDLNYAKGDANPDPAKAEEL  240

Query  950   VKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPH  1129
               +NL +MYRQM++ A  P LFFGK  R    D  PGMGTIE  PH  IH W GDP   +
Sbjct  241   YASNLNVMYRQMVSGATKPTLFFGKPYRA-GDDPSPGMGTIETTPHTQIHYWTGDPNQTN  299

Query  1130  NENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL-GGNRKDITDPDWLQTEFLFYDETKTL  1306
              ENMGNFYSA  DP+FYCHHSNVDRMW +WK + GG RKDI DPDWL +EFLF+DE K L
Sbjct  300   GENMGNFYSAGRDPIFYCHHSNVDRMWDLWKKIPGGKRKDIEDPDWLNSEFLFWDENKEL  359

Query  1307  VKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasT-----SVLPATL  1471
             V+VKV+D+LD  KL Y FQ +P PW   + T K   + +S+ +   S      S  P  L
Sbjct  360   VRVKVKDTLDTKKLRYGFQDVPIPWLKTRATPKLTRQEKSRRAAKKSVVLTPISAFPVVL  419

Query  1472  NKITTFCV-----TRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRV  1636
             +K+ +  V     +RS T K    E L+   + +++ Q I+FDV VN++ D      D+ 
Sbjct  420   DKVISVEVSRPKKSRSATEKEDEDEVLVIEGIEYEENQLIKFDVLVNDEPDSPGGP-DKS  478

Query  1637  EYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSF  1816
             E+AGSF N+ H H   S T        T  L I+ LLEDL  E DD ++VT VPR+GG F
Sbjct  479   EFAGSFVNVPHKHAKKSKT--------TMVLGITGLLEDLEAEGDDTLVVTFVPRSGGDF  530

Query  1817  VTVNKAYTEII  1849
             VTV     E +
Sbjct  531   VTVANVKIEFV  541



>emb|CAC83610.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   404 bits (1039),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 231/486 (48%), Positives = 303/486 (62%), Gaps = 43/486 (9%)
 Frame = +2

Query  437   SCCPSTLMDTASADYYKIP--SFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN  610
             +CCP    +      YK+P  S S + +RPA H +D +Y+ K++ AI+ MK+LP+DDPRN
Sbjct  26    NCCPPLATNVIP---YKVPKTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRN  82

Query  611   FYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTL  781
             FYQQA VHCAYCNG Y     P    Q+H +WLFFPFHRWYLYFYERIL  LI DPTF L
Sbjct  83    FYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFGL  142

Query  782   PYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNN  961
             P+WNWD P GM++P+ F  ++ SPLYD+ RNQ+H    V DL YAG +T  +D +++ NN
Sbjct  143   PFWNWDTPAGMLIPQYF-RNQNSPLYDENRNQSHLP-LVMDLGYAGTDTDVTDQERISNN  200

Query  962   LAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGD--PRSPHNE  1135
             LA+MY+ M+TNA    LF GK  +        G G+IEN+PH  +HRWVGD  PR+ + E
Sbjct  201   LALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGGSIENIPHTPVHRWVGDVKPRTQNGE  260

Query  1136  NMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN--RKDITDPDWLQTEFLFYDETKTLV  1309
             +MGNFYSA  D +FYCHHSNVDRMWTIW+ LGG   R+D TD DWL   F+FYDE K  V
Sbjct  261   DMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAV  320

Query  1310  KVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-rkrraklrskasvsasTSVLPATLNKITT  1486
             +V+V D+LDN KLGY ++    PW + KP   K++  L +++     T V P TL+K+  
Sbjct  321   RVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKKTGLAARSKAPFVTDVFPLTLDKVVQ  380

Query  1487  FCVTRSPTSKTP-------------GKEELLDLHLAFDDTQFIRfdvfvnedddvnTKEL  1627
               V R   S++              G E  +D +  FD           +ED+    KE 
Sbjct  381   VKVPRPKKSRSKEEKEAEEEILEIQGIEVAIDQYAKFD-------VYLNDEDEPEAGKE-  432

Query  1628  DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAG  1807
              + EYAGSF++L H H     T +  I+T + SL ++E LEDL  E+DD +LVTL P+ G
Sbjct  433   -KAEYAGSFAHLPHKH-----TGSKKIRT-SLSLGLNEPLEDLGAEDDDPVLVTLAPKVG  485

Query  1808  GSFVTV  1825
             G  VTV
Sbjct  486   GGVVTV  491



>gb|AAK53414.1|AF368291_1 polyphenol oxidase [Populus tremuloides]
Length=563

 Score =   405 bits (1041),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 239/502 (48%), Positives = 315/502 (63%), Gaps = 35/502 (7%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCC---PSTLMDTASADYYKIPS-FSKLNVR  517
             A A PI  P+  +C    + N      P  CC   P  ++D      ++ PS FS L  R
Sbjct  65    AYAKPITSPDLTNCKLVDLPNPEN---PTDCCSPLPRKIID------FRPPSPFSPLRTR  115

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
              AAH +D+DY+ KY  AI  MK LP DDPRNFYQQANVHCAYC+ AY+  G P     +H
Sbjct  116   RAAHLVDEDYVAKYAEAISLMKSLPEDDPRNFYQQANVHCAYCDDAYEQVGFPKLELDVH  175

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
             F WLFFP+HR+YLYFYERIL  LI+DPTF LP+WNWD+P GM +P IF D  +SPLYD+ 
Sbjct  176   FCWLFFPWHRYYLYFYERILGKLINDPTFALPFWNWDSPSGMQMPYIFTD-PKSPLYDQF  234

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKV-KNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
             R+Q H+   + DL YA  + + ++  +V  +N  +MY+QM++ A  P LFFGK  R    
Sbjct  235   RDQNHQPPVLLDLDYAAGDPNPTNANQVYSSNRRVMYKQMVSGAAKPTLFFGKPYRA-GD  293

Query  1046  DTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
             D  PG GTIE+ PHN+IHRW GDP   + E+MGNFYSAA DP+F+CHHSNVDRMWTIWKT
Sbjct  294   DARPGAGTIESSPHNNIHRWTGDPTQENTEDMGNFYSAARDPIFFCHHSNVDRMWTIWKT  353

Query  1226  L-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-  1399
             + GG R+DITDPDWL +EFLFY+E   LV+ KV D LDN +L YT+Q +  PW   KP  
Sbjct  354   IPGGLRRDITDPDWLNSEFLFYNENAELVRCKVRDCLDNRRLRYTYQNVEIPWLKSKPIP  413

Query  1400  rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE-----LLDLHLAFDD  1564
             R+   K     +     +  P  L+K     V+R   S++  ++E     L+   + +D+
Sbjct  414   RRLGKKAAETKTALTPITAFPLVLDKTIVTVVSRPKKSRSRKEKEEEDEVLVIEGIEYDN  473

Query  1565  TQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
              +F+RFDVF+N+D ++ +K  +  E+AGSF N++H     S T           L I+EL
Sbjct  474   DKFVRFDVFINDDLEIPSKP-ENTEFAGSFVNVSHKRAKKSKT--------RLILGITEL  524

Query  1745  ledlrlenddKILVTLVPRAGG  1810
             LEDL  + DD I+V LVPR+ G
Sbjct  525   LEDLETDGDDSIVVALVPRSNG  546



>ref|XP_010686568.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Beta vulgaris 
subsp. vulgaris]
Length=603

 Score =   406 bits (1044),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 256/579 (44%), Positives = 347/579 (60%), Gaps = 35/579 (6%)
 Frame = +2

Query  170   SRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPF  349
             SR   R    KI C  A ++ +    +   S   LDRRN+L+GLGGLYGA    G   P 
Sbjct  36    SRRLARRPTRKISCNVAKNDDQNPKTNHERSNNMLDRRNMLIGLGGLYGAATTLG-GGPA  94

Query  350   ALASPIPPPETKSCGPATI-SNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
             +LA+P+  P   +CG A + SN+ G     +CCP     T   D+   P+ + L VRP A
Sbjct  95    SLAAPVQTPNPTACGAADLPSNAQG----LNCCPPRA--TNIVDFVLPPTPNTLRVRPPA  148

Query  527   HAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTW  697
             H +DD Y +K+  AI  MK LPS DPR+F QQANVHCAYCNG+Y   G P    Q+H +W
Sbjct  149   HLVDDQYRQKFNRAISLMKALPSTDPRSFTQQANVHCAYCNGSYSPVGFPNLDLQVHNSW  208

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LF+PFHRWYLYF+ERIL +LI+DPTF +P+WNWD P GM++P ++ D   SPLYD  R++
Sbjct  209   LFYPFHRWYLYFFERILGTLINDPTFAIPFWNWDTPAGMVMPALYTD-PNSPLYDSVRDR  267

Query  878   AHRRGYVTDLAYAGQETSASDF---QKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             AH+   V DL Y    T A+D    Q +  NL +MYRQM+TN+    LF G+  R  T  
Sbjct  268   AHQPPKVLDLNY--DLTDANDLSNQQMISANLTLMYRQMVTNSSTARLFLGQPYRAGT-R  324

Query  1049  TGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL  1228
               PG G++ENVPH ++H W GD   P+ E+MGNFYSAA DP+FY HH+N+DRMW+IWKTL
Sbjct  325   PNPGGGSVENVPHGTVHVWTGDRNQPNFEDMGNFYSAARDPLFYAHHANIDRMWSIWKTL  384

Query  1229  GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkr  1408
             GGNR+D T+ DWL   F+FYDE    V+V+V D L+  +LGY +Q +  PW++ +P R  
Sbjct  385   GGNRQDFTETDWLDASFIFYDENAQAVRVRVRDCLNTARLGYNYQNVDLPWRNAQPLRTS  444

Query  1409  raklrska--------svsasTSVLPATLNKITTFCV-----TRSPTSKTPGKEELLDLH  1549
             R    S          S + +T   P  LNK     V     +RS + K   +EEL+   
Sbjct  445   RVSSISSTPQAANAMESKTTTTVKFPRPLNKSIRTNVARPKKSRSKSEKDREEEELVIEV  504

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELD-RVEYAGSFSNLAHVHKDTSTTANSTIKTPTFS  1726
                   ++ +FDV++N++DDV +K++  + EYAGSF N+ H HK        T    TF 
Sbjct  505   DVLRHDKYAKFDVYINDEDDVPSKKMQVKAEYAGSFVNVPHRHKQGEDKHKLTT---TFR  561

Query  1727  LAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTE  1843
             + ++EL+++L  ++DD I V LVPRAG   V +     E
Sbjct  562   VGLTELIQELGADDDDGITVNLVPRAGKDNVVIKNVKIE  600



>emb|CAC29040.1| catechol oxidase [Ipomoea batatas]
Length=500

 Score =   403 bits (1035),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 230/486 (47%), Positives = 302/486 (62%), Gaps = 43/486 (9%)
 Frame = +2

Query  437   SCCPSTLMDTASADYYKIP--SFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN  610
             +CCP    +      YK+P  S S + +RPA H +D +Y+ K++ AI+ MK+LP+DDPRN
Sbjct  26    NCCPPLATNVIP---YKVPRTSPSAMKIRPAIHRMDKEYIAKFEKAIRLMKELPADDPRN  82

Query  611   FYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTL  781
             FYQQA VHCAYCNG Y     P    Q+H +WLFFPFHRWYLYFYERIL  LI DPTF L
Sbjct  83    FYQQALVHCAYCNGGYVQTDYPDKEIQVHNSWLFFPFHRWYLYFYERILGKLIGDPTFGL  142

Query  782   PYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNN  961
             P+WNWD P GM++P+ F  ++ SPLYD+ RNQ+H    V DL YAG +   +D +++ NN
Sbjct  143   PFWNWDTPAGMLIPQYF-RNQNSPLYDENRNQSHLP-LVMDLGYAGTDNDVTDQERISNN  200

Query  962   LAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGD--PRSPHNE  1135
             LA+MY+ M+TNA    LF GK  +        G G+IEN+PH  +HRWVGD  PR+ + E
Sbjct  201   LALMYKSMVTNAGTAELFLGKPYKAGDDPVNKGGGSIENIPHTPVHRWVGDVKPRTQNGE  260

Query  1136  NMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN--RKDITDPDWLQTEFLFYDETKTLV  1309
             +MGNFYSA  D +FYCHHSNVDRMWTIW+ LGG   R+D TD DWL   F+FYDE K  V
Sbjct  261   DMGNFYSAGRDILFYCHHSNVDRMWTIWQQLGGKGRRRDFTDSDWLDATFIFYDENKQAV  320

Query  1310  KVKVEDSLDNVKLGYTFQKMPTPWKDFKPT-rkrraklrskasvsasTSVLPATLNKITT  1486
             +V+V D+LDN KLGY ++    PW + KP   K++  L +++     T V P TL+K+  
Sbjct  321   RVRVGDALDNQKLGYKYEFTNLPWLNSKPLPTKKKTGLAARSKAPFVTDVFPLTLDKVVQ  380

Query  1487  FCVTRSPTSKT-------------PGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKEL  1627
               V R   S++              G E  +D +  FD           +ED+    KE 
Sbjct  381   VKVPRPKKSRSKEEKEAEEEILEIQGIEVAIDQYAKFD-------VYLNDEDEPEAGKE-  432

Query  1628  DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAG  1807
              + EYAGSF++L H H     T +  I+T + SL ++E LEDL  E+DD +LVTL P+ G
Sbjct  433   -KAEYAGSFAHLPHKH-----TGSKKIRT-SLSLGLNEPLEDLGAEDDDAVLVTLAPKVG  485

Query  1808  GSFVTV  1825
             G  VTV
Sbjct  486   GGVVTV  491



>ref|XP_011096441.1| PREDICTED: aureusidin synthase-like [Sesamum indicum]
Length=585

 Score =   405 bits (1042),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 246/565 (44%), Positives = 341/565 (60%), Gaps = 33/565 (6%)
 Frame = +2

Query  206   RCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETK  385
             RC   S +  +N  +S+ +  K DRRNVL+GLGGLYGA  +A  ++PF+ A+PI  P+  
Sbjct  38    RCPKVSCKSPDNDQESA-APGKFDRRNVLIGLGGLYGATTLA--ASPFSFAAPISAPDIT  94

Query  386   SCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDDDYLEKYK  562
              CGPA +        P +CCP     TA    +K P  S  + VRPAAH  D+ Y+ K+ 
Sbjct  95    KCGPADLPPGAA---PTNCCPPP---TAKIIDFKFPPPSTTMRVRPAAHLADEAYIAKFN  148

Query  563   TAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYF  733
              A++ M+ LP DDPR+F QQA+VHCAYC+GAY   G P    Q+H +WLFFPFHR+YLYF
Sbjct  149   KAVELMRALPEDDPRSFKQQASVHCAYCDGAYDQVGFPNLELQVHNSWLFFPFHRYYLYF  208

Query  734   YERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAY  913
             +ERIL  LIDDPTF +P+WNWD+P GM +P ++ +   SPLYD  R+Q H+   V DL Y
Sbjct  209   FERILGKLIDDPTFAMPFWNWDSPGGMRIPAMYAN-PNSPLYDSLRDQRHQPPTVLDLNY  267

Query  914   AGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNS  1093
             +G + + S  Q+ + NL +MYRQM++N+    LFFG   R+   D  PG G+IEN+PH  
Sbjct  268   SGTDPTISADQQTRRNLTVMYRQMVSNSRTARLFFGSPYRR-GDDPNPGSGSIENIPHGP  326

Query  1094  IHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQT  1273
             +H W GD   P+ ENMGNFYSA  DP+FY HHSN+DR+W+IWKTLGG R+DITD D+L  
Sbjct  327   VHVWTGDRNQPNFENMGNFYSAGRDPIFYAHHSNIDRLWSIWKTLGGRRQDITDRDFLDA  386

Query  1274  EFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTS  1453
              F+FYDE   +V+VKV D LD+ KLGY +Q +  PW D +PT +  + LR    +  + +
Sbjct  387   SFVFYDENAQMVRVKVRDCLDHTKLGYVYQDVEIPWLDSRPTPRVSSVLRKLKKLGKANA  446

Query  1454  --------VLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvneddd  1609
                     V PATL+K+    V R    ++  +++ L+  L  +  +  R      +   
Sbjct  447   ADTHSPKDVFPATLDKVLKVMVKRPKKKRSKKEKDELEEILVIEGIELDRDVYAKFDVYI  506

Query  1610  vnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddK  1777
              +  +     +  E+AGSF N+ H HK                L+I+E++EDL  ++DD 
Sbjct  507   NDEDDEITTPENTEFAGSFVNVPHKHKHGKKIKTQ------LRLSITEIMEDLDADDDDH  560

Query  1778  ILVTLVPRAGGSFVTVNKAYTEIID  1852
             +LVTLVP   G  VTV+    E+ D
Sbjct  561   VLVTLVPTNAGDAVTVHGIKIELDD  585



>gb|ADF59058.2| polyphenol oxidase IV [Pyrus x bretschneideri]
Length=587

 Score =   404 bits (1039),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 247/564 (44%), Positives = 330/564 (59%), Gaps = 39/564 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC A  ++G  +  D  L  A+LDRRN+L+GLG            NPFA A+PI  P+
Sbjct  48    RVRCKA--TKGDNDSLDQGL--ARLDRRNMLIGLGAGGLYGAA---GNPFAFAAPISAPD  100

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD--YLE  553
               +CGPA     +G  +   CCP T   T +   +K+P    L  RPAA  +  D  YL 
Sbjct  101   LTTCGPA--DKPDGSTI--DCCPPT---TTTIIDFKLPDKGPLRTRPAAQDVAKDPAYLA  153

Query  554   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWY  724
             KYK A++ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+H+ WLFFPFHRWY
Sbjct  154   KYKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHRWY  213

Query  725   LYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTD  904
             LYFYE+IL  LI DPTF LP+WNWD P GM +PEIF D   S LYD+ RN AH+   + D
Sbjct  214   LYFYEKILGELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSS-LYDQYRNAAHQPPKLLD  272

Query  905   LAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVP  1084
             L Y+G +    D  ++K NL  MY+QM++ A    LF+G+       D  PG G IE++P
Sbjct  273   LNYSGTDDDVDDPTRIKENLTTMYQQMVSKATSHRLFYGEPY-SAGDDPSPGAGNIESIP  331

Query  1085  HNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK-TLGGNRKDITDPD  1261
             HN+IH W GDP   + E+MG FYS+  DP+FY HHSNVDRMW+I+K  LGG   DI   D
Sbjct  332   HNNIHFWTGDPTQTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGGT--DIEKTD  389

Query  1262  WLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrskasv  1438
             WL TEFLFYDE K LV+VKV DSLD  KLGY + QK+P PW  +KPT ++    R  +  
Sbjct  390   WLDTEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDQKVPIPWLKYKPTARKSTNKRKASVS  449

Query  1439  sa-sTSVLPATLNKITTFCVTR-SPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddv  1612
             S+  T+  PA L+   +  VTR S T +T  +++  D  L     +F   +    +    
Sbjct  450   SSDLTTTFPAVLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVFVN  509

Query  1613  nTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKI  1780
             +  +     D+ E+AGSF ++ H HK         IKT    L+I+ LLE+L  E D  +
Sbjct  510   DDADSLAGKDKSEFAGSFVHVPHKHK-------KNIKT-NLRLSIASLLEELAAETDSSL  561

Query  1781  LVTLVPRAGGSFVTVNKAYTEIID  1852
             +VTLVP+ G   +T+     E+I+
Sbjct  562   VVTLVPKVGKGPITIGGFSIELIN  585



>ref|XP_004293526.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=594

 Score =   404 bits (1038),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 252/575 (44%), Positives = 337/575 (59%), Gaps = 47/575 (8%)
 Frame = +2

Query  197   IKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPP  376
             I+ R +  ++   +N  D+     K DRRNVLLGLGGLYG   +   S+PFA A P+ PP
Sbjct  40    IRTRVSCKATNSDQN--DAQPPVPKFDRRNVLLGLGGLYGVVGLG--SDPFAFAKPVAPP  95

Query  377   ETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDDY  547
             +   CG A + N      P  CCP   S ++D      +K+PS + L VRPAAHA+DD Y
Sbjct  96    DVSKCGAADLPNGVA---PTDCCPPTPSKIID------FKLPSPTPLRVRPAAHAVDDAY  146

Query  548   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHR  718
             + KY  A++ MK LP DDPR+F  QANVHCAYC+GAY  AG P    QIH +WLFFPFHR
Sbjct  147   IAKYTKAMELMKALPDDDPRSFKNQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHR  206

Query  719   WYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYV  898
             +YLYFYERIL  LI+DPTF LP+WNWDNP GM LP +F +  +SPLYD+ R  AH+   +
Sbjct  207   YYLYFYERILGKLINDPTFALPFWNWDNPAGMQLPALFAN-PKSPLYDQFRAAAHQPPTL  265

Query  899   TDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIE  1075
              DL + G E + S+  ++ +NL+IMYRQM++NA    LFFG   R   GD   PG G+IE
Sbjct  266   IDLDFNGTEDNTSNTTQINSNLSIMYRQMVSNAKNAQLFFGNPYR--AGDEPDPGGGSIE  323

Query  1076  NVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITD  1255
               PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDRMW+IWKTL    KDITD
Sbjct  324   GTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNVDRMWSIWKTLAPKNKDITD  383

Query  1256  PDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT------------  1399
              DWL + FLFYDE   +V+VKV D L++  LGY +Q +  PW + KPT            
Sbjct  384   SDWLDSGFLFYDENANMVRVKVRDCLESKNLGYVYQDVDIPWLNSKPTPRRSKVAFSNIA  443

Query  1400  -rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLH-LAFDDTQF  1573
              +   A      +     +  P TL++  +  V R    K   KE+  +   L  +  +F
Sbjct  444   KKLGVANAAGSKAKVVKITDFPLTLSRKISVAVPRPKQKKRSKKEKEDEEEILVIEGIEF  503

Query  1574  IRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISe  1741
              R      +    +  +L    D+ E+AGSF ++ H HK T    N+ ++     L +++
Sbjct  504   DRDVAVKFDVYINDEDDLPSGPDKSEFAGSFVSVPHRHKHTKKI-NTVLR-----LGLTD  557

Query  1742  lledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
             LLEDL  E+D+ ++VTL+PR     V +     E 
Sbjct  558   LLEDLDAEDDETVVVTLIPRYAADKVKIGGIKIEF  592



>gb|KHN46329.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=624

 Score =   405 bits (1040),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 256/594 (43%), Positives = 345/594 (58%), Gaps = 57/594 (10%)
 Frame = +2

Query  182   RRGDVIKIRCAAASSEGRENPADSSLSE---AKLDRRNVllg--lgglygayniaggSNP  346
             +R  V K+ C +  +    NP +   S    A  +RR+VL+G               +NP
Sbjct  46    KRHHVSKVSCHSNQNNSAPNPEEGKPSHNIVAGKNRRDVLIGFGGLYGASTLTNNNNNNP  105

Query  347   FALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSF-SKLNV  514
              A+A+PI PP+ K+CGP  ++ +  KPV  +CCP   ST++D      +K+PS  + L V
Sbjct  106   LAIAAPILPPDLKTCGPPDLA-TGAKPV--NCCPPISSTIID------FKLPSSGAPLRV  156

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAH ++D Y+ KY+ A+++MK L  +DPRNF QQANVHCAYC+GAY   G P    Q+
Sbjct  157   RPAAHLVNDVYIAKYREALKRMKALSPNDPRNFTQQANVHCAYCDGAYHQVGFPNLDLQV  216

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H  WLFFP+HRWYLYFYERIL +LI DPTF LP+WNWDNP+G +    F  D+ SPLYD 
Sbjct  217   HNCWLFFPYHRWYLYFYERILGNLIGDPTFALPFWNWDNPKGGMTIPSFYVDKNSPLYDP  276

Query  866   KRNQAHRRGYVTDLAYAGQET---SASDF----QKVKNNLAIMYRQMLTNAPCPLLFFGK  1024
              RN  H+   + DL Y  ++    SAS+     +++ +NL+IMYR +++N   P LF G 
Sbjct  277   LRNLNHQPPVLIDLDYNRRDDDDPSASESVDPNEQIASNLSIMYRNVISNGKLPRLFLGS  336

Query  1025  AIRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVD  1201
               R   GD   PG G++ENVPH  +H W GD R P+ ENMG FYSAA DP+F+ HH+NVD
Sbjct  337   PYR--AGDEPEPGAGSLENVPHGPVHSWTGDKREPNRENMGIFYSAARDPIFFSHHANVD  394

Query  1202  RMWTIWKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTP  1378
             RMW+IWKT+ GG R+D TDPDWL++ F FYDE K LV+VKV+DSLD  KLGY +Q +  P
Sbjct  395   RMWSIWKTIPGGKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYVYQDVDIP  454

Query  1379  WKDFKPTrkrraklrskasvsasTSV------------LPATLNKITTFCVTRSPTSKTP  1522
             W   KP  KR    +   +                    P TL+   +  V R    ++ 
Sbjct  455   WLKNKPKPKRSKAKKLALAQDFIVGAAQAVETTPKSVKFPLTLDSKVSTLVKRPKLLRSK  514

Query  1523  GKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRV------EYAGSFSNLAHVHKDT  1684
              ++E  +  L  D  +F R      + D     E D+V      E+AGSF ++ H H   
Sbjct  515   EEKEEEEEVLVIDGIEFDR--NKAVKFDVFINDEDDKVITPSNTEFAGSFVSVPHSH---  569

Query  1685  STTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
                 N  IKT  F + +++LLEDL  ENDD ILVTLVP+ G   VT+     E+
Sbjct  570   -VHKNKKIKT-CFRVGLTDLLEDLEAENDDSILVTLVPKYGKGLVTIRDIKIEL  621



>gb|AAP33165.1| polyphenol oxidase [Medicago sativa]
Length=607

 Score =   404 bits (1038),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 245/532 (46%), Positives = 325/532 (61%), Gaps = 40/532 (8%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             +NPFALASPI PP+  +CGP  +      P   +CCP    ++     YKIPS ++ L V
Sbjct  89    TNPFALASPISPPDLSTCGPPDLP-LGATPNNINCCPP---NSTKIINYKIPSSNQPLRV  144

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             R AAH ++D+YL+KYK A++ MK LPS DPR+F QQAN+HCAYC+GAY   G P    Q+
Sbjct  145   RQAAHLVNDEYLQKYKKALELMKALPSSDPRSFVQQANIHCAYCDGAYSQVGFPNLDLQV  204

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHRWYLYFYERIL SLI+DPTF LP+WN+D+P GM LP I+ D   SPLYDK
Sbjct  205   HNSWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDSPNGMQLPSIYAD-STSPLYDK  263

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R  +H+   + DL Y   +       ++ +NL  MYRQM++N     LF G + R   G
Sbjct  264   LRTASHQPPTLIDLNYDDVDVDDDANGRISSNLTTMYRQMVSNGKTSSLFLGSSYR--AG  321

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IENVPH  +HRW GD   P+ ENMG FY+AA DP+F+ HHSN+DR W+IWK
Sbjct  322   DEPDPGAGSIENVPHGPVHRWSGDNTQPNFENMGVFYAAARDPIFFSHHSNIDRFWSIWK  381

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP--  1396
             TLGG RKD  D DWL++EFLFYDE K LVKVKV+D LD  KLGY +Q +  PW + KP  
Sbjct  382   TLGGKRKDFKDKDWLESEFLFYDENKNLVKVKVKDCLDTKKLGYVYQDVDIPWLNAKPKP  441

Query  1397  --------------TrkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE  1534
                                 + R+    S S    P  L+ + +  V R   S++  ++E
Sbjct  442   CRKNIQKNVEVAQGNFFGIGEARASEINSRSYVTCPLVLDNVVSTIVKRPKKSRSKKEKE  501

Query  1535  -----LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAH-VHKDTSTTA  1696
                  L+   + FD +  ++FDVF+N++DD   K ++  E+AGSF N+ H  H       
Sbjct  502   EEEEVLVIEGIEFDKSLGVKFDVFINDEDDKVIKPIN-TEFAGSFVNVPHSSHDHKKKKT  560

Query  1697  NSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             NS ++     + +++LLEDL  E+DD I+VTLVPR G   V +     E+ D
Sbjct  561   NSCLR-----VGLTDLLEDLGAEDDDSIVVTLVPRYGKGIVKIRNIKIELED  607



>gb|AAW65103.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=589

 Score =   403 bits (1036),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 249/559 (45%), Positives = 334/559 (60%), Gaps = 44/559 (8%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++ C A +S+ + + A     + KLDRRNVLLGLGGLYG   +   ++PFA A P+ PP+
Sbjct  41    RVSCKAKNSDNQNDQA-----QTKLDRRNVLLGLGGLYGVAGLG--TDPFAFAKPVNPPD  93

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
                CG A +        P +CCP   + T   D+ K+P+  KL VRPAAHA+D  Y+EKY
Sbjct  94    LSKCGAADLPTGA---TPTNCCPP--LATKIIDF-KLPAPGKLRVRPAAHAVDQAYIEKY  147

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               AI+ MK LP DDPR+F QQANVHCAYC+GAY  AG P    QIH +WLFFPFHR+ LY
Sbjct  148   SKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNSWLFFPFHRYCLY  207

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYE+IL  LI+DPTF LP+WNWD+P GM LP +F +  +SPLYDK R  +H+   + DL 
Sbjct  208   FYEKILGKLINDPTFALPFWNWDSPAGMQLPALFAN-PKSPLYDKFRAASHQPPTLIDLD  266

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPH  1087
             Y G +   S+  ++  NL IMYRQM++NA  P LFFG   R   GD   PG G+IE  PH
Sbjct  267   YNGTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYR--AGDEPDPGGGSIEGTPH  324

Query  1088  NSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWL  1267
               +H W GD    + E+MGNFYSAA DP+F+ HHSNVDRMW+IWKTLGG R DI+  DWL
Sbjct  325   GPVHLWTGDNTQSNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLGGKRTDISQSDWL  384

Query  1268  QTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsas  1447
              + FLFY+E   LV+VKV DSL++  LGY +Q++  PW   KPT +R     SK      
Sbjct  385   DSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPTPRRAKLELSKIKKKLG  444

Query  1448  TS-------------VLPATLN-KITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfd  1585
              +               P  L  KI+T         +   ++E  +  L  +  +F R  
Sbjct  445   VAQAAESSTKIVAGRAFPINLETKISTVVPRPKQKKRNKKEKEEEEEILVIEGIEFDRDV  504

Query  1586  vfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelled  1753
                 +    +  +L    D+ E+AGSF ++ H HK      N+ ++     L +++LLED
Sbjct  505   AVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKI-NTILR-----LGLTDLLED  558

Query  1754  lrlenddKILVTLVPRAGG  1810
             +  E+D+ ++VTLVP+ G 
Sbjct  559   IEAEDDESVVVTLVPKYGA  577



>emb|CDP06093.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   402 bits (1033),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 220/453 (49%), Positives = 285/453 (63%), Gaps = 16/453 (4%)
 Frame = +2

Query  341   NPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN-VR  517
             NPFA+A+PI  PE   CGP       G  V  +CCP           YK+P   K+N  R
Sbjct  80    NPFAMAAPIAAPEISKCGPPA-DLPPGAVVTDNCCPPVPGKVID---YKLPPPPKVNRFR  135

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKPYQI--HF  691
             PAAH +  DY+EK   A++ MK LP+DDPRNF QQANVHCAYCNGAY   G   +I  H+
Sbjct  136   PAAHLVKKDYIEKLNKAVELMKALPADDPRNFTQQANVHCAYCNGAYVQPGSDQEISVHY  195

Query  692   TWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKR  871
             +WLFFPFHRWYLYFYERIL  LI DP+F LP+WNWDN  GM +P IF D + S LY++ R
Sbjct  196   SWLFFPFHRWYLYFYERILGKLIGDPSFGLPFWNWDNIGGMTIPSIFMD-QSSALYNENR  254

Query  872   NQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK-ETGD  1048
             NQ+H    V DL Y G +  A+  ++++NNLAIMYRQM++NA     FFGK  R  +  +
Sbjct  255   NQSHLPPTVVDLGYNGTDRDATCTERIENNLAIMYRQMVSNATTGRDFFGKEYRAGDQPN  314

Query  1049  TGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL  1228
                G G+IE  PH  +HRWVGDPR P+ E++GNFYSA  D +FY HH+NVDRMWTIW+ L
Sbjct  315   AFAGAGSIEASPHIPLHRWVGDPRQPNGEDLGNFYSAGRDVLFYSHHANVDRMWTIWQQL  374

Query  1229  GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkr  1408
             GG RK++ DPDWL + F+FYDE    V+VKV DS  N ++GY ++K+  PW   KP  + 
Sbjct  375   GGKRKEVPDPDWLNSSFIFYDENAQPVRVKVRDSFSNDRMGYIYEKVDIPWLKNKPVPRV  434

Query  1409  raklrskasvsasT-SVLPATLNKITTFCV-----TRSPTSKTPGKEELLDLHLAFDDTQ  1570
             R    +  S +     V P  LNKI    V     +RS   K   +E L+   + F   +
Sbjct  435   RKSRVAFTSGAPPADKVFPGPLNKIVKVLVKRPKLSRSKRQKEEEEERLVVYGIEFSMDK  494

Query  1571  FIRfdvfvnedddvnTKELDRVEYAGSFSNLAH  1669
             +++FDVF+N++DD    +  + EY GSF+NL H
Sbjct  495   YVKFDVFINDEDDNPN-DFAKSEYVGSFANLPH  526



>emb|CDO99592.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   402 bits (1033),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 222/516 (43%), Positives = 312/516 (60%), Gaps = 37/516 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSK-  505
             ++PFALA+PI  P+   CGPA + +      P +CCP   +T++D      +K+P+ S  
Sbjct  74    ADPFALAAPIQAPDVSKCGPADLPSG---ATPTNCCPPPATTIVD------FKLPAPSNT  124

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---  676
             L VRPAAH +D+ Y+ K++ A+Q MK LP DDPR+F QQANVHCAYC+GAY   G P   
Sbjct  125   LRVRPAAHLVDEAYIAKFQRAVQLMKALPDDDPRSFKQQANVHCAYCDGAYDQVGFPNLE  184

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+H +WLF PFHR+YLYFYERIL  LI+DPTF +P+WNWD   GM LP+I+ D   SPL
Sbjct  185   LQVHNSWLFLPFHRYYLYFYERILGKLINDPTFAMPFWNWDAQGGMRLPDIYTD-PTSPL  243

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD  R+ +H+   + DL + G +++ SD Q++  N  IMYRQM++N+  P LFFG   R 
Sbjct  244   YDTLRDGSHQPPTMIDLDFNGTDSNISDSQQLSQNYTIMYRQMVSNSRTPRLFFGSPYRA  303

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
                D  PG G +EN+PH  +H W GD   P+ E+MGNFYSA  DP+FY HHSN+DRMWT+
Sbjct  304   -GDDPDPGAGQLENIPHGPVHVWTGDRTQPNLEDMGNFYSAGRDPIFYAHHSNIDRMWTL  362

Query  1217  WKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             WKTLGG R+DITD DWL   F+FYDE   +V+V+V D LD  KLGY++Q + TPW + +P
Sbjct  363   WKTLGGRRQDITDTDWLNASFVFYDENAQMVRVRVRDCLDTTKLGYSYQTVDTPWLNSRP  422

Query  1397  Trkrraklrskasvsas---------TSVLPATLNKITTFCVTRSPTSKTPGKEELLDLH  1549
             T +     R    +  +         T + PA L+KI    V R    ++  +++  +  
Sbjct  423   TPRLTKVARKIKKLVVANAADHSHSPTDIFPAKLDKIIKVMVKRPKKKRSKKEKDEKEEI  482

Query  1550  LAFDDTQFIRfdvfvnedddvnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTP  1717
             L  +  +  R      +    +  +     +  E+AGSF N+           +      
Sbjct  483   LVIEKIEVERDAFAKFDIYINDEDDPKSTPENTEFAGSFVNVP------HKHKHGKKIKT  536

Query  1718  TFSLAISelledlrlenddKILVTLVPRAGGSFVTV  1825
               +L+++E+LEDL  E+D+ ++VTLVPR G   VT+
Sbjct  537   HLNLSLTEILEDLDAEDDEHVMVTLVPRVGCDAVTI  572



>ref|XP_009334438.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Pyrus x bretschneideri]
Length=586

 Score =   402 bits (1033),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 246/567 (43%), Positives = 332/567 (59%), Gaps = 45/567 (8%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC A  ++G  +  D  L  A+LDRRN+L+GLG            NPFA A+PI  P+
Sbjct  47    RVRCKA--TKGDNDNLDQGL--ARLDRRNMLIGLGAGGLYGAA---GNPFAFAAPISAPD  99

Query  380   TKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDD--  544
               +CGPA     +G  +   CCP   +T++D      +++P    L  RPAA  +  D  
Sbjct  100   LTTCGPA--DKPDGSTI--DCCPPSTTTIID------FELPDSGPLRTRPAAQDVAKDPA  149

Query  545   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFH  715
             YL KYK A++ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+H+ WLFFPFH
Sbjct  150   YLAKYKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFH  209

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             RWYLYFYE+IL  LI DPTF LP+WNWD P GM +PEIF D   S LYD+ RN AH+   
Sbjct  210   RWYLYFYEKILGELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSS-LYDQYRNAAHQPPK  268

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIE  1075
             + DL Y+G +    D  ++K NL  MY+QM++ A    LF+G+       D  PG G IE
Sbjct  269   LLDLNYSGTDDDVDDPTRIKENLTTMYQQMVSKATSHRLFYGEPY-SAGDDPSPGAGNIE  327

Query  1076  NVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK-TLGGNRKDIT  1252
             ++PHN+IH W GDP   + E+MG FYS+  DP+FY HHSNVDRMW+I+K  LGG   DI 
Sbjct  328   SIPHNNIHFWTGDPTQTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGGT--DIE  385

Query  1253  DPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrsk  1429
               DWL TEFLFYDE K LV+VKV DSLD  KLGY + QK+P PW  +KPT ++    R  
Sbjct  386   KTDWLDTEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDQKVPIPWLKYKPTARKSTNKRKA  445

Query  1430  asvsa-sTSVLPATLNKITTFCVTR-SPTSKTPGKEELLDLHLAFDDTQFIRfdvfvned  1603
             +  S+  T+  PA L+   +  VTR S T +T  +++  D  L     +F   +    + 
Sbjct  446   SVSSSDLTTTFPAVLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVKFDV  505

Query  1604  ddvnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlend  1771
                +  +     D+ E+AGSF ++ H HK         IKT    L+I+ LLE+L  E D
Sbjct  506   FVNDDADSLAGKDKSEFAGSFVHVPHKHK-------KNIKT-NLRLSIASLLEELAAETD  557

Query  1772  dKILVTLVPRAGGSFVTVNKAYTEIID  1852
               ++VTLVP+ G   +T+     E+I+
Sbjct  558   SSLVVTLVPKVGKGPITIGGFSIELIN  584



>gb|KDP20931.1| hypothetical protein JCGZ_21402 [Jatropha curcas]
Length=592

 Score =   402 bits (1034),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 235/524 (45%), Positives = 321/524 (61%), Gaps = 45/524 (9%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSK-  505
             ++P ALA P+  P+   CG A +       +P +CCP   + ++D      +K+PS +  
Sbjct  78    NDPSALAKPVAAPDLTKCGKADLP---ANALPTNCCPPPSTKILD------FKLPSSNNP  128

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---  676
             L +RPAAH  DD Y+ KY  AI+ MK LP DDPR+F QQA+VHCAYC+GAY   G P   
Sbjct  129   LRIRPAAHLADDAYVAKYSKAIELMKALPDDDPRSFKQQASVHCAYCDGAYHQVGFPDLD  188

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              QIH +WLFFPFHR+YLYFYE+IL  LIDDP F LP+WNWD+P GM +P++F    +S L
Sbjct  189   LQIHNSWLFFPFHRYYLYFYEKILGKLIDDPNFALPFWNWDSPAGMQIPKMFVS-PKSAL  247

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD+ R+++H+   + DL Y+G E+S S+ +++ +NL IMYRQM++N     LFFG A R 
Sbjct  248   YDQYRHKSHQPPTLIDLDYSGTESSYSNQEQLSSNLTIMYRQMVSNGKTAKLFFGNAYR-  306

Query  1037  ETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWT  1213
              +GD   PG G+IEN+PH  +H W GD   P+ E+MGNFYSA  DP+F+ HH+NVDRMWT
Sbjct  307   -SGDEPDPGAGSIENIPHGPVHLWTGDSTQPNKEDMGNFYSAGRDPIFFAHHANVDRMWT  365

Query  1214  IWKTLGGN-RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDF  1390
             +WKTLGG+ R +ITD DWL  EFLFYDE   LV+VKV+DS+D  KLGY +Q +  PW   
Sbjct  366   LWKTLGGSKRTEITDTDWLNAEFLFYDENANLVRVKVKDSIDYKKLGYGYQDVEVPWLKS  425

Query  1391  KPT-------------rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKE  1531
             KPT               + AK           S  P  L K+T   V R   S++  ++
Sbjct  426   KPTPRKVIKKIVKALHHGQEAKAAENNQNLTPISSFPLVLEKVTRVLVKRPKKSRSKKEK  485

Query  1532  ELLDLHLAFDDTQFIRfdvfv-----nedddvnTKELDRVEYAGSFSNLAHVHKDTSTTA  1696
             E  +  L  D  +F R          N++DD  + + D+ E+AGSF ++ H H      +
Sbjct  486   EEEEEVLLVDGIEFARESAVKFDVYINDEDDSTSTKPDKSEFAGSFVSVPHTH------S  539

Query  1697  NSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVN  1828
             + T       L +++LLEDL  E+DD++LVTLVPR G   V ++
Sbjct  540   HGTKMKTCLRLGLTDLLEDLGAEDDDEVLVTLVPRYGIGLVKID  583



>gb|AGU01537.1| polyphenol oxidase [Malus domestica]
Length=616

 Score =   403 bits (1035),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 213/418 (51%), Positives = 271/418 (65%), Gaps = 21/418 (5%)
 Frame = +2

Query  182   RRGDVIKIRCAAA--SSEGRENPADSS-------LSEAKLDRRNVllglgglygayniag  334
             R  ++  + C A   SS+  +NP+ SS        S   LDRRNVL+GLG LYG     G
Sbjct  38    RHSNLQAVSCKATNNSSDQNKNPSTSSNDHDHENPSPVNLDRRNVLIGLGSLYGGVAGLG  97

Query  335   gSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNV  514
              S+PFA+A P+ PP+   CG A   +     VP +CCP T         +K PS +KL V
Sbjct  98    -SDPFAVAKPVSPPDLAKCGAADFPSG---AVPTNCCPPTSQKIVD---FKFPSPTKLRV  150

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAH +D  Y+EKY  AI+ MK LP DDPR+F QQA++HCAYC+GAY   G P    QI
Sbjct  151   RPAAHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQI  210

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+ERIL  LIDDPTF LP+WNWD P GM LP +F +  +SPLYD+
Sbjct  211   HQSWLFFPFHRYYLYFHERILAKLIDDPTFALPFWNWDAPAGMQLPALFAN-PDSPLYDE  269

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R  +H+   + DL + G + + S   ++  NL IMYRQM++N+  PLLFFG   R  T 
Sbjct  270   LRADSHQPPTLIDLDFNGTDETMSKDAQIDANLKIMYRQMVSNSKKPLLFFGSPYRAGT-  328

Query  1046  DTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
             +  PG G+IE  PH  +H W GD   P+ E+MGNFYSAA DP+F+ HHSN+DRMW IWK+
Sbjct  329   EPDPGAGSIETTPHGPVHTWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNIDRMWNIWKS  388

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             +G   KDI D DWL T FLFYD+   LV+V V D+LDN KLGYT++ +  PW   +PT
Sbjct  389   IGTKNKDINDTDWLDTGFLFYDKNAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPT  446



>ref|XP_008383785.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
 sp|P43309.1|PPO_MALDO RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Malus domestica]
 gb|AAA69902.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   402 bits (1033),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 247/581 (43%), Positives = 340/581 (59%), Gaps = 56/581 (10%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+ L   P R+  R    K+ C A +++  +       +++KLDRRNVLLGLGGLYG   
Sbjct  31    QVSLLTKPKRSFAR----KVSCKATNNDQNDQ------AQSKLDRRNVLLGLGGLYGVAG  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPS  496
             +   ++PFA A PI PP+   CGPA +       VP +CCP   + ++D      +K+P+
Sbjct  81    MG--TDPFAFAKPIAPPDVSKCGPADLPQGA---VPTNCCPPPSTKIID------FKLPA  129

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              +KL +RP AHA+D  Y +KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P
Sbjct  130   PAKLRIRPPAHAVDQAYRDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFP  189

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 QIH +WLFFPFHR+YLYF+E+IL  LI+DPTF LP+WNWD+P GM LP I+ D  +
Sbjct  190   ELELQIHNSWLFFPFHRYYLYFFEKILGKLINDPTFALPFWNWDSPAGMPLPAIYAD-PK  248

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             SPLYDK R+  H+   + DL Y G E + S    +  NL IMYRQM++N+    LFFG  
Sbjct  249   SPLYDKLRSANHQPPTLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGNP  308

Query  1028  IRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDR  1204
              R   GD   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDR
Sbjct  309   YR--AGDEPDPGGGSIEGTPHAPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDR  366

Query  1205  MWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWK  1384
             MW+IWKTLGG R D+TD DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW 
Sbjct  367   MWSIWKTLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWL  426

Query  1385  DFKPT--------------rkrraklrskasvsasTSVLPATL-NKITTFCVTRSPTSKT  1519
               KPT                      + +S   + +  P +L +KI+T         ++
Sbjct  427   SSKPTPRRAKVALSKVAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRS  486

Query  1520  PGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTS  1687
                +E  +  L  +  +F R      +    +  +L    D+ E+AGSF ++ H HK   
Sbjct  487   KKAKEDEEEILVIEGIEFDRDVAVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHSHKHKK  546

Query  1688  TTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGG  1810
                N+ ++     L +++LLE++  E+DD ++VTLVP+ G 
Sbjct  547   KM-NTILR-----LGLTDLLEEIEAEDDDSVVVTLVPKFGA  581



>ref|XP_006594327.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
Length=670

 Score =   404 bits (1039),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 257/601 (43%), Positives = 346/601 (58%), Gaps = 57/601 (9%)
 Frame = +2

Query  161   PNPSRAARRGDVIKIRCAAASSEGRENPADSSLSE---AKLDRRNVllg--lgglygayn  325
             P      +R  V K+ C +  +    NP +   S    A  +RR+VL+G           
Sbjct  85    PTKHSKPKRHHVSKVSCHSNQNNSAPNPEEGKPSHNIVAGKNRRDVLIGFGGLYGASTLT  144

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPS  496
                 +NP A+A+PI PP+ K+CGP  ++ +  KPV  +CCP   ST++D      +K+PS
Sbjct  145   NNNNNNPLAIAAPILPPDLKTCGPPDLA-TGAKPV--NCCPPISSTIID------FKLPS  195

Query  497   F-SKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK  673
               + L VRPAAH ++D Y+ KY+ A+++MK L  +DPRNF QQANVHCAYC+GAY   G 
Sbjct  196   SGAPLRVRPAAHLVNDVYIAKYREALKRMKALSPNDPRNFTQQANVHCAYCDGAYHQVGF  255

Query  674   P---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDE  844
             P    Q+H  WLFFP+HRWYLYFYERIL +LI DPTF LP+WNWDNP+G +    F  D+
Sbjct  256   PNLDLQVHNCWLFFPYHRWYLYFYERILGNLIGDPTFALPFWNWDNPKGGMTIPSFYVDK  315

Query  845   ESPLYDKKRNQAHRRGYVTDLAYAGQET---SASDF----QKVKNNLAIMYRQMLTNAPC  1003
              SPLYD  RN  H+   + DL Y  ++    SAS+     +++ +NL+IMYR +++N   
Sbjct  316   NSPLYDPLRNLNHQPPVLIDLDYNRRDDDDPSASESVDPNEQIASNLSIMYRNVISNGKL  375

Query  1004  PLLFFGKAIRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFY  1180
             P LF G   R   GD   PG G++ENVPH  +H W GD R P+ ENMG FYSAA DP+F+
Sbjct  376   PRLFLGSPYR--AGDEPEPGAGSLENVPHGPVHSWTGDKREPNRENMGIFYSAARDPIFF  433

Query  1181  CHHSNVDRMWTIWKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYT  1357
              HH+NVDRMW+IWKT+ GG R+D TDPDWL++ F FYDE K LV+VKV+DSLD  KLGY 
Sbjct  434   SHHANVDRMWSIWKTIPGGKRRDFTDPDWLESAFFFYDENKNLVRVKVKDSLDTRKLGYV  493

Query  1358  FQKMPTPWKDFKPTrkrraklrskasvsasTSV------------LPATLNKITTFCVTR  1501
             +Q +  PW   KP  KR    +   +                    P TL+   +  V R
Sbjct  494   YQDVDIPWLKNKPKPKRSKAKKLALAQDFIVGAAQAVETTPKSVKFPLTLDSKVSTLVKR  553

Query  1502  SPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRV------EYAGSFSNL  1663
                 ++  ++E  +  L  D  +F R      + D     E D+V      E+AGSF ++
Sbjct  554   PKLLRSKEEKEEEEEVLVIDGIEFDR--NKAVKFDVFINDEDDKVITPSNTEFAGSFVSV  611

Query  1664  AHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTE  1843
              H H       N  IKT  F + +++LLEDL  ENDD ILVTLVP+ G   VT+     E
Sbjct  612   PHSH----VHKNKKIKT-CFRVGLTDLLEDLEAENDDSILVTLVPKYGKGLVTIRDIKIE  666

Query  1844  I  1846
             +
Sbjct  667   L  667



>ref|XP_010039984.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW45576.1| hypothetical protein EUGRSUZ_L00689 [Eucalyptus grandis]
Length=595

 Score =   402 bits (1033),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 261/569 (46%), Positives = 337/569 (59%), Gaps = 47/569 (8%)
 Frame = +2

Query  203   IRCAAASSEGRE-NPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             I C A S++  E NP        KLDRRN L+GLGG YGA  +   S+PFALA PI   +
Sbjct  55    ISCKALSNDDSEQNPM-----SVKLDRRNALIGLGGFYGAVGLR--SDPFALADPISVLD  107

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
                CG         KP    CCP     T   D+   PS S   VRPAAH  D DY+ KY
Sbjct  108   FTQCGKV-------KPCVKDCCPPPT--TKVLDFKLPPSNSPTRVRPAAHLADKDYIAKY  158

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               A + MK LP+DDPR+F QQANVHCAYC+G Y   G P    Q+H +WLFFPFHR+YLY
Sbjct  159   AEATKLMKALPADDPRSFMQQANVHCAYCDGYYHQVGFPNLELQVHDSWLFFPFHRYYLY  218

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYE+IL +LI DPTF LPYWNWD P GM +P +F D  +SPLYD  RN  H +  + DL 
Sbjct  219   FYEKILGNLIGDPTFALPYWNWDAPDGMKMPAMFTD-PQSPLYDANRNPEHAQPTLVDLN  277

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTG-PGMGTIENVPH  1087
             Y  +    SD +   NNLAIMYRQ+++      LF G A R   GD   PG G+IEN+PH
Sbjct  278   YNCKHPPPSDLES--NNLAIMYRQIVSCGKTAKLFLGHAYR--AGDQASPGRGSIENMPH  333

Query  1088  NSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG-NRKDITDPDW  1264
             N++H W GD R P  E+MG FYSA  DP+F+ HHSNVDRMWT+WKTLGG  R D TDPDW
Sbjct  334   NTVHDWCGDYRQPKREDMGIFYSAGRDPLFFAHHSNVDRMWTLWKTLGGRKRTDFTDPDW  393

Query  1265  LQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsa  1444
             L   FLFYDE    ++VKV+D L+   LGY +Q +  PW+++KP  +++AK   K+S   
Sbjct  394   LNATFLFYDENAQAMRVKVKDCLETSNLGYKYQDVDIPWRNYKPVPRKKAKKLPKSSGKI  453

Query  1445  sTSV--------LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQ-----FIRfd  1585
             +            P  L+K+ +  V R    ++  ++E  +  LA +  +     F++FD
Sbjct  454   ADVAGIPRHIVHFPVKLDKVVSTWVKRPKQKRSKKEKEEEEEVLAIEGIELESDAFVKFD  513

Query  1586  vfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrle  1765
             V +N+  D  +   D+ E+AGSF N+ H HK         +KT   +L I++LLEDL  E
Sbjct  514   VHINDKQDSLSSP-DKTEFAGSFVNVPHKHK-----PGKKMKT-KLTLGITDLLEDLMRE  566

Query  1766  nddKILVTLVPRAGGSFVTVNKAYTEIID  1852
              D+K+LVTL PR GG  V ++    E +D
Sbjct  567   EDEKVLVTLAPRCGGEDVIISNIKIEFVD  595



>ref|XP_007025706.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
 gb|EOY28328.1| Larreatricin hydroxylase isoform 1 [Theobroma cacao]
Length=602

 Score =   402 bits (1033),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 258/586 (44%), Positives = 349/586 (60%), Gaps = 39/586 (7%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+FLN    +    G    + C A ++  +    DSSL+  + DRR++L+GLGGLYGA N
Sbjct  36    QLFLNKKIKKPDYSGPSKVVSCKATNNGSK---GDSSLN--RFDRRDLLIGLGGLYGATN  90

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             ++  ++PFALA+PI  P+   CG ATIS++  + V   CCP    +T     +K P++SK
Sbjct  91    LS--NDPFALAAPIAAPDLTLCGDATISDTTKETV--YCCPP---ETTKVIDFKPPTYSK  143

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAG--KPY  679
             +  R AAH +D DYL K+  A++ M+ LP DDPR+F QQAN+HCAYCNGAY   G  +  
Sbjct  144   IRYRSAAHLVDPDYLAKFTKAMELMRALPDDDPRSFKQQANIHCAYCNGAYDQVGFDQDI  203

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+HF+WLFFPFHR YLYFYERIL  LI DP F +P+WNWD P GM +P I+ +   SPLY
Sbjct  204   QVHFSWLFFPFHRLYLYFYERILGKLIGDPDFAMPFWNWDAPAGMPIPAIYVN-PNSPLY  262

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D KRN  H+   V DL Y G +   +D   V++NL +MY+QM++ +    LF GK  R  
Sbjct  263   DDKRNVNHQPPKVVDLDYNGTDKDITDKAMVQSNLKVMYKQMVSGSKTASLFHGKVYR--  320

Query  1040  TGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
              GD   PG G +E   H +IHRW GDPR  ++E+MGNFYSA  DP+FY HHSNVDRMW+I
Sbjct  321   AGDKPSPGGGVVELGSHTAIHRWCGDPRQTYSEDMGNFYSAGRDPLFYAHHSNVDRMWSI  380

Query  1217  WKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             WK L G  R D TD DWL   F+FYDE   LV+ +V D LD   LGY +Q +  PW   K
Sbjct  381   WKGLPGKKRNDFTDTDWLDASFVFYDENANLVRARVRDCLDTRTLGYDYQGVDVPWLKTK  440

Query  1394  PT----------rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKT----PGKE  1531
             P              +A      + +   +  P  L+KI +  + R   S+T      +E
Sbjct  441   PVPRKFSKKGGKGHGQAVAAETKNKNVIRNAFPIVLDKIVSIEIPRPKKSRTKLEKEEEE  500

Query  1532  ELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIK  1711
              L+   +  D +  ++FD+++N++DD      +  E+AGSF+N+ H H  +     S   
Sbjct  501   VLVLESIQLDTSTPVKFDIYINDEDDEAPSGPEDSEFAGSFTNVPHNHSHSKKLETS---  557

Query  1712  TPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
                FSLAISE+LEDL +E DD I+VTLVPR G   V+V     + I
Sbjct  558   ---FSLAISEVLEDLDVEGDDNIVVTLVPREGKGLVSVGNIKIDYI  600



>gb|ADP89908.1| polyphenol oxidase [Nelumbo nucifera]
Length=500

 Score =   399 bits (1024),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 231/487 (47%), Positives = 294/487 (60%), Gaps = 26/487 (5%)
 Frame = +2

Query  260   SEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYS  439
             S  +LDRRNVL+GLGGLYGA  +   ++  A  +PI PP+   CG A +  +  KP   +
Sbjct  15    SLGRLDRRNVLIGLGGLYGATGLG--ADRLAFGAPIMPPDLSKCGAANLP-AGAKPT--N  69

Query  440   CCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFY  616
             CCP    +      +K+PS S+ + VRPAAH +D++Y+ KY  AI  MK LP+DDPRNF 
Sbjct  70    CCPPASSEIVD---FKLPSSSEPMRVRPAAHMVDEEYIAKYSKAIALMKALPADDPRNFT  126

Query  617   QQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPY  787
             QQANVHCAYC+GAY   G P    Q+H +WLFFPFHR+YLYFYER+L  LIDDPTF LPY
Sbjct  127   QQANVHCAYCDGAYDQIGFPDLELQVHNSWLFFPFHRYYLYFYERMLGKLIDDPTFALPY  186

Query  788   WNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLA  967
             WNWD P GM +P ++ +   SPLYDK R+  H+   + DL Y  Q+T+ +  Q +KNNLA
Sbjct  187   WNWDAPAGMKMPTMYAN-PNSPLYDKLRDAKHQPPTMIDLNYNVQDTTMTPEQLLKNNLA  245

Query  968   IMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMG  1144
              MYRQ+++N     LF G   R   GD   PG G++ENVPH  +H W GD   P+ ENMG
Sbjct  246   TMYRQVVSNGSTAQLFLGSPYR--AGDQPDPGFGSLENVPHGPVHLWAGDRTQPNIENMG  303

Query  1145  NFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVE  1324
             NFYSAA DP+FY HHSNVDRMWTIWK LGG RKD  DPDWL   FL YDE K LV+VKV 
Sbjct  304   NFYSAARDPIFYAHHSNVDRMWTIWKKLGGRRKDFKDPDWLNAGFLLYDENKQLVRVKVR  363

Query  1325  DSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrsk--------asvsasTSVLPATLNKI  1480
             D LD  KL Y++Q +  PW   +PT  +      K             + S  P  L+  
Sbjct  364   DCLDEKKLRYSYQDVEIPWMKTRPTPGKLMAAAQKLKITDRGLKKKKPTVSEFPKELDAP  423

Query  1481  TTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfv--nedddvnTKELDRVEYAGSF  1654
                 V R   S++  ++E  +  L  D  +  R  V       +D +    D+ E+AGSF
Sbjct  424   FKVVVKRPRKSRSKKEKEDEEEILVIDQVELERDTVVKFDVHINDEDGPSPDKSEFAGSF  483

Query  1655  SNLAHVH  1675
              N+ H H
Sbjct  484   VNVPHKH  490



>gb|ABI96939.1| putative polyphenol oxidase [Neillia thyrsiflora]
Length=451

 Score =   397 bits (1019),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 196/356 (55%), Positives = 242/356 (68%), Gaps = 13/356 (4%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPA  523
             PFA A P+ PP+   CG   +       +P +CCP   + T   D+ K+P+ ++L +RP 
Sbjct  1     PFAFAKPVAPPDISKCGAPDLPTGA---LPTNCCPP--LATKIIDF-KVPAPNRLRIRPP  54

Query  524   AHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFT  694
             AHA+D  Y++KY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P    QIH  
Sbjct  55    AHAVDQAYIDKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQVGFPDLEIQIHNC  114

Query  695   WLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRN  874
             WLFFPFHR++LYFYERIL  LI+DPTF LP+WNWD+P GM LP IF +  +SPLYDK RN
Sbjct  115   WLFFPFHRYFLYFYERILGKLINDPTFALPFWNWDSPAGMQLPAIFAN-PQSPLYDKLRN  173

Query  875   QAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-  1051
             + H+   + DL Y G E + S    +  NL IMYRQM++NA  PLLFFG   R   GD  
Sbjct  174   RQHQPPTLVDLDYNGTEDNTSRETTINANLKIMYRQMVSNAKNPLLFFGNPYR--AGDEP  231

Query  1052  GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLG  1231
              PG G+IE  PHN +H W GD   P+ E+MGNFYSAA DP+F+ HHSNVDR+W IWKTLG
Sbjct  232   DPGAGSIELTPHNPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRLWIIWKTLG  291

Query  1232  GNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             G R DITD DWL + FLFY+E   LV+VKV D L++ KLGY +Q +  PW D KPT
Sbjct  292   GKRTDITDSDWLDSGFLFYNENAELVRVKVRDCLESKKLGYVYQDVDIPWLDSKPT  347



>gb|AFO55219.1| chloroplast polyphenol oxidase III [Eriobotrya japonica]
Length=614

 Score =   401 bits (1031),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 254/533 (48%), Positives = 326/533 (61%), Gaps = 31/533 (6%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
              KLDRRNVL+GLGGLYGA  +     P A A+P+ PP+   C  A I+ + G+ V   CC
Sbjct  91    GKLDRRNVLIGLGGLYGATTLV--PKPLAFANPLAPPDLTKCTLAEIT-TGGETV--ECC  145

Query  446   P--STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQ  619
             P  ST + T + D   IP    L  RPAAH + D+YL K+K A   M+ LP DDPR+  Q
Sbjct  146   PPVSTKIKTFTPDL-SIP----LRTRPAAHLVTDEYLAKFKKAQALMRALPEDDPRSMVQ  200

Query  620   QANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYW  790
             QA VHCAYCNGAY   G P    Q+HF+WLFFPF   YLYFYERIL  LIDDPTF LPYW
Sbjct  201   QAKVHCAYCNGAYPQIGFPDIDIQVHFSWLFFPFPPMYLYFYERILGKLIDDPTFALPYW  260

Query  791   NWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAI  970
             NWD+  G  +P+I+ D   SPLYD+ RN  H+   + DL+Y G +    +  ++  NLAI
Sbjct  261   NWDSLDGFPIPDIYTD-TTSPLYDQYRNADHQPPVLVDLSYGGTDDDVDEQTRIDENLAI  319

Query  971   MYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNF  1150
             MYRQM++ A  P LFFG   R     TG   GTIEN PHN+IH W GDP   + E+MGNF
Sbjct  320   MYRQMVSGAKTPDLFFGHEYRAGDTTTGTYAGTIENTPHNNIHLWCGDPNQTNKEDMGNF  379

Query  1151  YSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDS  1330
             YSA  DP+FY HH NVDRMW IWKTLGG RKD TD DWL  EFLFYDE   LV  KV DS
Sbjct  380   YSAGRDPLFYAHHCNVDRMWNIWKTLGGKRKDPTDTDWLDAEFLFYDENAELVSCKVRDS  439

Query  1331  LDNVK-LGYTFQKMPTPWKDFKPTrkr-raklrskasvsasTSVLPATLNKITTFCVTRS  1504
             L   K L YT++ +  PW   KPT ++ ++K ++K + +  T+  PAT +  TT  V R 
Sbjct  440   LKPAKDLRYTYEPVSVPWLFTKPTARKPKSKTKAKVAATQLTTKFPATFDSKTTVEVARP  499

Query  1505  PTSKTPGKEE------LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLA  1666
                K   KE+      L+   + F+  + ++  VF+N+D +  +++ D+ E+AGSF ++ 
Sbjct  500   KPRKRTKKEKIDEEEVLIIKDIEFESNEAVKLIVFINDDAESLSRK-DKSEFAGSFVHVP  558

Query  1667  HVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTV  1825
             H  K        T K     L I++LLEDL  E++  +LVTLVPR   S +T+
Sbjct  559   HNQK------TGTKKKTNLKLGITDLLEDLGAEDESSVLVTLVPRVSNSPITI  605



>gb|AED02598.1| polyphenol oxidase [Prunus salicina var. cordata]
Length=584

 Score =   400 bits (1028),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 249/565 (44%), Positives = 326/565 (58%), Gaps = 40/565 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC A  + G  +  +  LS  +LDRRN+L+GLG           +NPFA A+P+  P+
Sbjct  44    RVRCKA--TNGGNDHLEQGLS--RLDRRNMLIGLGAGGLYGATGLENNPFASAAPVSAPD  99

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD--YLE  553
                CGPA     +G  +   CCP T   T +   +K+P    L  R AA  +  D  YL 
Sbjct  100   LTQCGPA--DKPDGTTI--DCCPPT---TTTIIDFKLPDKGPLRTRLAAQDVAKDPVYLA  152

Query  554   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWY  724
             KYK AI  M+ LP DDPR+F QQA VHC+YC+G Y   G P    Q+HF WLFFPFHRWY
Sbjct  153   KYKKAIALMRALPDDDPRSFTQQAMVHCSYCDGGYPQVGYPNLEIQVHFCWLFFPFHRWY  212

Query  725   LYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTD  904
             LYF+E+I+  LI DPTF LP+WNWD P GM LPEIF  D  SPLYD+ RN AH+   + D
Sbjct  213   LYFFEKIMGELIGDPTFALPFWNWDAPVGMYLPEIF-TDTTSPLYDQYRNAAHQPPKLLD  271

Query  905   LAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD-TGPGMGTIENV  1081
             L Y G +    D  ++K NL  MY+QM++ A    LF+G+      GD + PG G IEN 
Sbjct  272   LNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPY--SAGDASSPGAGNIENT  329

Query  1082  PHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT-LGGNRKDITDP  1258
             PHN+IH W GDP   + E+MG FYSA  DPVF+ HHSNVDRMW+I+K+ LGG   DI   
Sbjct  330   PHNNIHLWTGDPTQTNGEDMGAFYSAGRDPVFFAHHSNVDRMWSIYKSKLGGT--DIKKT  387

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrskas  1435
             DWL  EFLFYDE K L++VKV DSLD  KLGY +  K+  PW  +KPT ++ +  R    
Sbjct  388   DWLDAEFLFYDEKKNLMRVKVRDSLDTTKLGYVYGDKVEIPWLTYKPTARKSSNKRKATV  447

Query  1436  vsa-sTSVLPATLNKITTFCVTRSPTSK-TPGKEELLDLHLAFDDTQFIRfdvfvneddd  1609
              SA  T+  PATL    T  V R+ T K T  +++  D  L     ++        +   
Sbjct  448   SSADLTTNFPATLTDTITVEVARTSTKKRTSAQKKAQDEVLVISGIKYAMNKAVKFDVYV  507

Query  1610  vnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddK  1777
              +  +     D+ E+AGSF ++ H      TT        T  L+I++LLE+L  E D  
Sbjct  508   NDDADSLAGKDKSEFAGSFVHVPHKGSKDITT--------TLRLSITKLLEELDAETDSS  559

Query  1778  ILVTLVPRAGGSFVTVNKAYTEIID  1852
             ++VTLVP+ G   VT+    TE+ID
Sbjct  560   VVVTLVPKIGT--VTIGGFSTELID  582



>gb|ABI96932.1| putative polyphenol oxidase [Fallugia paradoxa]
Length=452

 Score =   395 bits (1015),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 195/356 (55%), Positives = 240/356 (67%), Gaps = 13/356 (4%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPA  523
             PFA A P+ PP+   CG A + N      P +CCP           +K+P+ S L VRPA
Sbjct  1     PFAFAKPVAPPDVSKCGAADLPNGV---TPTNCCPPAATKIID---FKLPAPSTLRVRPA  54

Query  524   AHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFT  694
             AHA+DD Y+ KY  AI+ MK LP DDPR+F QQANVHCAYC+GAY  AG P    QIH +
Sbjct  55    AHAVDDVYIAKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNS  114

Query  695   WLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRN  874
             WLFFPFHR+YLYFYE+IL  LI+DPTF LP+WNWD+P GM LP +F +  +SPLYDK R 
Sbjct  115   WLFFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALFAN-PKSPLYDKFRA  173

Query  875   QAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-  1051
               H+  ++ DL Y G E + S+  +V +NL+IMYRQM++NA    LFFG   R   GD  
Sbjct  174   ATHQPPHLIDLDYNGTEDNTSNTTQVNSNLSIMYRQMVSNAKNAQLFFGNPYR--AGDEP  231

Query  1052  GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLG  1231
              PG G+IE  PH  +H W GD   P+ E+MGNFYSAA DP+F+ HHSNVDRMW+IWKTL 
Sbjct  232   DPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLA  291

Query  1232  GNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
                KDITD DWL + FLFYDE   +V+VKV D LD+  LGY +Q +  PW + KPT
Sbjct  292   TKNKDITDSDWLDSGFLFYDENANMVRVKVRDCLDSKNLGYVYQDVEIPWLNSKPT  347



>gb|ABI96925.1| putative polyphenol oxidase [Adenostoma fasciculatum]
Length=454

 Score =   395 bits (1015),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 196/356 (55%), Positives = 243/356 (68%), Gaps = 13/356 (4%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPA  523
             P A A P+ PP+   CG A +        P +CCP  L  T   D+ K+P+ ++L VRPA
Sbjct  1     PLAFAKPVAPPDVSKCGAADLPTGAE---PMNCCP--LPATKIIDF-KLPAPTQLRVRPA  54

Query  524   AHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFT  694
             AH +D  Y++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    QIH +
Sbjct  55    AHTVDQAYIDKYTKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQIHNS  114

Query  695   WLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRN  874
             WLFFPFHR+YLYFYE+IL  LI+DPTF LP+WNWD+P GM LP IF +  +SPLYDK RN
Sbjct  115   WLFFPFHRYYLYFYEKILGKLINDPTFVLPFWNWDSPAGMQLPAIFAN-PKSPLYDKFRN  173

Query  875   QAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-  1051
               H+   + DL + G + + S+  ++  NL IMYRQM++NA  PLLFFG   R   GD  
Sbjct  174   ANHQPPNLVDLDFNGTDENDSNATQINANLKIMYRQMVSNAKNPLLFFGNPYR--AGDEP  231

Query  1052  GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLG  1231
              PG G+IE  PH  IH W GD   P+ E+MGNFYSA  DP+FY HHSNVDRMW+IWKTLG
Sbjct  232   DPGAGSIEGTPHGPIHLWTGDNTQPNFEDMGNFYSAGKDPIFYSHHSNVDRMWSIWKTLG  291

Query  1232  GNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             G R DITD DWL + FLFY+E   LV+VKV DSL++  LGY +Q++  PW D KPT
Sbjct  292   GKRTDITDKDWLDSGFLFYNENAELVRVKVRDSLESKNLGYVYQEVDIPWLDSKPT  347



>gb|ABI96941.1| putative polyphenol oxidase [Physocarpus capitatus]
Length=451

 Score =   395 bits (1015),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 244/359 (68%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A + N      P +CCP   + ++D      +K+P+ ++L V
Sbjct  1     PFAFAKPVAPPDISKCGAADLPNGVQ---PTNCCPPPGTKIID------FKLPAPNRLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RP AHA+D  Y++KY  AIQ MK LP DDPR+F QQA VHCAYC+GAY   G P    QI
Sbjct  52    RPPAHAVDQAYIDKYSKAIQLMKALPDDDPRSFKQQALVHCAYCDGAYDQVGFPDLELQI  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYFYERIL  LI+DPTF LP+WNWD+P GM LP I+ +  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFYERILGKLINDPTFALPFWNWDSPAGMQLPAIYAN-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R+  H+   + DL Y G E + S    +  NL IMYRQM++NA  PLLFFG   R   G
Sbjct  171   FRHHQHQPPTLVDLDYNGTEDNTSRETTINANLKIMYRQMVSNAKNPLLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE+ PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDR+W+IWK
Sbjct  229   DEPDPGGGSIESTPHGPVHLWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R DITD DWL + FLFY+E   LV+VKV DSL++ KLGY +Q +  PW D KPT
Sbjct  289   TLGGKRTDITDSDWLDSGFLFYNENAELVRVKVRDSLESKKLGYVYQDVDIPWLDSKPT  347



>ref|XP_007025701.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
 gb|EOY28323.1| Uncharacterized protein TCM_029921 [Theobroma cacao]
Length=618

 Score =   400 bits (1029),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 249/575 (43%), Positives = 335/575 (58%), Gaps = 44/575 (8%)
 Frame = +2

Query  203   IRCAAASSEGRENPADSSLSEAK------LDRRNVllglgglygayniaggSNPFALASP  364
             + C A  + G +NP  SS +  K       DRR+VL+GLGGLYGA +++   + F+LA+P
Sbjct  60    VSCKA--TNGDQNPTPSSKNTEKSFLLNKFDRRDVLIGLGGLYGAASLS--QDQFSLAAP  115

Query  365   IPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD  544
             I  PE + CG A +        P +CCP   +     D+    S S L VRPAAH +DD 
Sbjct  116   ISAPELEKCGNAELPEGAD---PTNCCPP--VSRKILDFKPPSSNSPLRVRPAAHLVDDA  170

Query  545   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFH  715
             Y+ KY  AI+ MK LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +WLFFPFH
Sbjct  171   YIAKYSRAIELMKALPADDPRNFMQQANVHCAYCDGAYDQVGFPDLELQVHNSWLFFPFH  230

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             R+YLYF+E+IL  LIDDPTF LP+WNWD+P GM +P ++ +  +SPLY++ RN++H    
Sbjct  231   RYYLYFFEKILGKLIDDPTFALPFWNWDSPAGMKMPAMYGN-TKSPLYNELRNRSHYPPT  289

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTG-PGMGTI  1072
             + DL Y G + + +   ++ +NL IMYRQM++N     LF G   R   GD    G G++
Sbjct  290   LVDLDYNGTDETTTTRDQLTSNLRIMYRQMVSNGKTARLFLGGPFR--AGDEPYQGFGSV  347

Query  1073  ENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDIT  1252
             ENVPH  +H W GD   P+ E+MG FYSAA DP+FY HHSNVDRMW +WKTLG  RKD T
Sbjct  348   ENVPHGPVHVWCGDNTQPNGEDMGTFYSAARDPIFYAHHSNVDRMWAVWKTLGKKRKDFT  407

Query  1253  DPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrsk-  1429
             DPDWL   FLFYDE   LV+VKV D LDN  LGY +Q +  PW   KPT ++  K  +  
Sbjct  408   DPDWLNASFLFYDENANLVRVKVRDCLDNRSLGYVYQDVDIPWLKTKPTPRKLRKKVASG  467

Query  1430  -----------asvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFI  1576
                             +++  P  L+KI +  V R   S++  ++E  +  L  D  +  
Sbjct  468   GPGIALAAEINKKKVIASNQFPIVLDKIVSVDVPRPKKSRSKKEKEDEEEILVIDQIELD  527

Query  1577  RfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
                    +    +  +L    D  E+AGSF N+ H HK         ++T    L +++L
Sbjct  528   GDSFAKFDVYVNDEDDLTIGPDNTEFAGSFVNVPHKHK-----GGKKMRT-CLRLGLTDL  581

Query  1745  ledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
             LEDL  E+DD ++VTLVP+ G   V +     E I
Sbjct  582   LEDLGAEDDDSVVVTLVPKYGKGNVKIGSIKIEFI  616



>gb|AFO55218.1| chloroplast polyphenol oxidase II [Eriobotrya japonica]
Length=576

 Score =   399 bits (1024),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 245/564 (43%), Positives = 328/564 (58%), Gaps = 39/564 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC A  ++G  +  D     A+LDRRN+L+GLG            NPFA A+P+  P+
Sbjct  37    RVRCKA--TKGDNDNLDQG--PARLDRRNMLIGLGAGGLYGAA---GNPFAFAAPVSAPD  89

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD--YLE  553
               +CGPA     +G  +   CCP T   T +   +K+P    L  RPAA  +  D  YL 
Sbjct  90    LTTCGPA--DKPDGSTI--DCCPPT---TTTIIDFKLPDSGPLRTRPAAQNVAKDPAYLA  142

Query  554   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK---PYQIHFTWLFFPFHRWY  724
             KYK AIQ M++LP DDPR+  QQA VHC+YC+G Y   G      Q+H+ WLFFPFHRWY
Sbjct  143   KYKKAIQLMRELPDDDPRSHAQQAMVHCSYCDGGYPQVGYTDLEIQVHYCWLFFPFHRWY  202

Query  725   LYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTD  904
             LYFYE+I+  LI DPTF LP+WNWD P GM +PEIF D   S LYD+ RN AH+   + D
Sbjct  203   LYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSS-LYDQYRNAAHQPPKLLD  261

Query  905   LAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVP  1084
             L Y+G +    D  ++  NL  MY+QM++ A    LF+G+       D  PG G IE++P
Sbjct  262   LNYSGTDDDVDDATRITENLTTMYQQMVSKAASHRLFYGEPY-SAGDDPSPGAGNIESIP  320

Query  1085  HNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK-TLGGNRKDITDPD  1261
             HN+IH W GDP   + E+MG FYSA  DP+FY HHSNVDRMW+I+K  LGG   DI   D
Sbjct  321   HNNIHFWTGDPTQTNGEDMGAFYSAGRDPLFYSHHSNVDRMWSIYKDKLGGT--DIEKTD  378

Query  1262  WLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrskasv  1438
             WL TEFLFYDE K LV+VKV DSLD  KLGY + + +  PW + KPT ++    R  A  
Sbjct  379   WLDTEFLFYDEKKNLVRVKVRDSLDTTKLGYVYDENVSIPWLESKPTARKSTNKRKAAVS  438

Query  1439  sa-sTSVLPATLNKITTFCVTR-SPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddv  1612
             S+  T+  PATL+   +  VTR S T +T  +++  D  L     +F   +    +    
Sbjct  439   SSDLTTTFPATLSDTISVEVTRPSATKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVYVN  498

Query  1613  nTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKI  1780
             +  +     D+ E+AGSF ++ H HK         IKT    L+I+ LLE+L  E D  +
Sbjct  499   DDADSLAGKDKSEFAGSFVHVPHKHK-------KNIKT-NLRLSITSLLEELGAETDSSL  550

Query  1781  LVTLVPRAGGSFVTVNKAYTEIID  1852
             +VTLVP+ G   +T+     E+I+
Sbjct  551   VVTLVPKVGKGPITIGGFSIELIN  574



>ref|XP_011098120.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
 gb|AFJ42577.1| polyphenol oxidase [Sesamum indicum]
Length=584

 Score =   399 bits (1025),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 249/563 (44%), Positives = 351/563 (62%), Gaps = 35/563 (6%)
 Frame = +2

Query  170   SRAARRGDVIKIRCAAASSEGRENPADS-SLSEAKLDRRNVllglgglygayniaggSNP  346
             + A RR +  ++R +A + + + N + +   ++ ++DRRNVLLGLGG          S+P
Sbjct  31    THAKRRSN--RLRVSATAGQNQSNSSQNVETAQGRVDRRNVLLGLGGGLYGAANLI-SSP  87

Query  347   FALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
              A A+P+ PPE   CG AT  N+ G+ +  +CCP     T     Y++P   +L VRP+A
Sbjct  88    GASANPVQPPELDKCGTATNLNT-GEQLDINCCPPV---TDRILDYRLPPVYQLKVRPSA  143

Query  527   HAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTW  697
             H +  +Y+ KY  AI  MK LP+DDPRNF QQA +HCAYCNGAY   G+     QIH +W
Sbjct  144   HRVSPEYIAKYNKAIDLMKRLPADDPRNFMQQAMIHCAYCNGAYDQPGQGSLDLQIHNSW  203

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LFFPFHRWYLYFYERIL  LI DPTF LP+WNWDNP+GM +P +F+D + + +YD KRNQ
Sbjct  204   LFFPFHRWYLYFYERILAKLIGDPTFALPFWNWDNPKGMTIPPMFNDTKAA-IYDPKRNQ  262

Query  878   AHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGP  1057
               R   V DL   G   +    Q V NNL IMY +M+        F G+  R+ T    P
Sbjct  263   -DRLTAVVDLGMTG---NTDPLQLVANNLTIMYSEMIRGNADVYDFMGQPYREGTA-VNP  317

Query  1058  GMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT-LGG  1234
             G G+ E   H +IH +VGDPR P  E++GNFYSA  DP+FYCHH+NVDRMWT+W+  L  
Sbjct  318   GPGSSERGSHTAIHVFVGDPREPSGEDLGNFYSAGRDPLFYCHHANVDRMWTLWQYFLPS  377

Query  1235  NR---KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK--PT  1399
             N+   K ITDPD+L   F+FYDE   LV+V V+DSLDN+++GY F+++  PW D++  P 
Sbjct  378   NKVPDKRITDPDFLNASFVFYDENAQLVRVTVKDSLDNLRMGYDFERVDLPWIDYRPPPQ  437

Query  1400  rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDL-HLAFDDTQFI  1576
               +   +R+  +   + ++ P  L K+  F V   P +K    +ELL L ++  D T+F+
Sbjct  438   TVKAKIVRTGTTAPKADTLFPLKLEKVVRFQV---PKAKKGKADELLVLENITVDTTKFL  494

Query  1577  RfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledl  1756
             +FDVFVN++DD    ELD+  YAG+++ +   HK  + TA ++I+     L +++L +D+
Sbjct  495   KFDVFVNDEDDNAF-ELDKAAYAGTYAQVP--HKSKNKTATTSIR-----LKLTDLYDDM  546

Query  1757  rlenddKILVTLVPRAGGSFVTV  1825
              + +DD I+VTLVPR  G  VT+
Sbjct  547   DIGDDDTIVVTLVPRHQGPGVTI  569



>ref|XP_010054349.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Eucalyptus 
grandis]
Length=595

 Score =   399 bits (1025),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 261/570 (46%), Positives = 339/570 (59%), Gaps = 49/570 (9%)
 Frame = +2

Query  203   IRCAAASSEGRE-NPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             I C A S++  E NP        KLDRRNVL+GLGG YGA  +   S+PFALA PI  P+
Sbjct  55    ISCKALSNDDSEQNPM-----SVKLDRRNVLIGLGGFYGAVGLR--SDPFALAEPISVPD  107

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSF-SKLNVRPAAHAIDDDYLEK  556
                CG          P   +CCP    +      +K+PS  S   VRPAAH  D+DY+ K
Sbjct  108   FTQCGKVN-------PCAKACCPPPTTEVLD---FKLPSSNSPTRVRPAAHLADEDYIAK  157

Query  557   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKPY---QIHFTWLFFPFHRWYL  727
             Y  AI+ MK LP+DDPR+F QQANVHCAYC+G Y   G P+   Q+H +WLFFPFHR+YL
Sbjct  158   YAEAIRLMKALPADDPRSFMQQANVHCAYCDGYYNQVGFPHLEVQVHCSWLFFPFHRYYL  217

Query  728   YFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDL  907
             YFYE+IL SLI DPTF LPYWNWD P GM +P +F D   SPLYD  RN  H    + DL
Sbjct  218   YFYEKILGSLIKDPTFALPYWNWDAPGGMKMPAMFTD-PHSPLYDFNRNPDHAPPMLVDL  276

Query  908   AYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD-TGPGMGTIENVP  1084
              Y  +    S+   + NNL+IMYRQM+++     LF G A R   GD   PG G+IE +P
Sbjct  277   NYNCEHLPPSNL--IHNNLSIMYRQMVSSGKTAKLFLGHAYR--AGDHANPGAGSIELMP  332

Query  1085  HNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG-NRKDITDPD  1261
             HN++H W GD R P+ E+MG  YSAA DP+F+ HHSNVDRMWT+WKTLGG  R D T PD
Sbjct  333   HNTVHNWCGDYRQPNLEDMGILYSAARDPLFFAHHSNVDRMWTLWKTLGGPKRTDFTHPD  392

Query  1262  WLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvs  1441
             WL   FLFYDE K  V+VKV+D L+   LGY +Q +  PW++ KP  ++ A   ++ S  
Sbjct  393   WLNASFLFYDENKQAVRVKVKDCLETTNLGYKYQDVDIPWRNSKPVPRKIAIKVTETSGG  452

Query  1442  --------asTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQ-----FIRf  1582
                      S +  P  L+K+ +  V R    ++  ++E  +  L  +  +     F++F
Sbjct  453   IADVAEIPRSIAHFPVKLDKVVSTLVKRPKQKRSKKEKEEKEEVLVIEGIELESDAFVKF  512

Query  1583  dvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrl  1762
             DV +N++    +   D  E+AGSF N+ H HK         +KT   +L I+ELLEDL  
Sbjct  513   DVHINDEQASLSSP-DMTEFAGSFVNVPHKHK-----PGKKMKT-KLTLGITELLEDLMC  565

Query  1763  enddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             E+D+KILVTL PR GG  V ++    E +D
Sbjct  566   EDDEKILVTLNPRYGGEDVIISNIKIEFVD  595



>gb|AHF20575.1| polyphenol oxidase [Hevea brasiliensis]
Length=600

 Score =   399 bits (1025),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 233/524 (44%), Positives = 305/524 (58%), Gaps = 34/524 (6%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
              +PFA A PI  PE   CG A + N   KP P +CCP T   T   D+    S S L +R
Sbjct  87    GDPFAFAKPISTPEPTKCGKADLPNY-AKP-PTNCCPPT--STKILDFKLPSSQSPLRIR  142

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH  DD Y+ KY  A++ MK LP DDPR+F QQA VHCAYCNGAY   G P    Q+H
Sbjct  143   PAAHLADDAYIAKYSKAVKLMKALPEDDPRSFMQQAKVHCAYCNGAYDQVGFPDLQIQVH  202

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFPFHR+YLYF+E+IL  LIDDPTF LPYWNWD+P+GM LP ++ +  +SPLYD+ 
Sbjct  203   NSWLFFPFHRYYLYFHEKILGKLIDDPTFALPYWNWDSPKGMQLPALYAN-PKSPLYDQY  261

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             RN+ H+   + DL Y   E    + + + +NL IMYRQM++N     LF G   R   GD
Sbjct  262   RNKNHQPPTIVDLDYNATEGPTPEQETISSNLTIMYRQMISNGKTAKLFLGSPYR--AGD  319

Query  1049  T-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
                PG G+IEN+PHN +H W GD    + ENMGNFYSA  DP+FY HHSNVDRMWTIWKT
Sbjct  320   EPDPGAGSIENIPHNPLHVWTGDNFQRNLENMGNFYSAGRDPIFYAHHSNVDRMWTIWKT  379

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT--  1399
             LGG R + TDPDWL   FL YDE   LV+VKV D +D+ KL Y +Q++  PW   +PT  
Sbjct  380   LGGKRTEFTDPDWLDAAFLLYDENANLVRVKVRDCIDHKKLRYAYQEVEIPWLKSRPTPR  439

Query  1400  -----------rkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDL  1546
                           +    ++      T+  P  L+K+    V+R   S++  ++E  + 
Sbjct  440   RLIKKMAKVFHHHDQVAQAAETQNLTPTNSFPLKLDKVIRTMVSRPKKSRSKKEKEEEEE  499

Query  1547  HLAFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKT  1714
              L  +  +F R  V   +    +  +     ++ E+AGSF N+ H HK         +KT
Sbjct  500   ILVINGIEFERDAVVKFDVYVNDEHDSPSGPNKSEFAGSFVNVPHAHKH-----GKKMKT  554

Query  1715  PTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
                 L I++LLEDL  E+DD ++V LVPR G   V +     E+
Sbjct  555   -CLRLGITDLLEDLGAEDDDNVVVALVPRIGKGQVRIGGIKIEL  597



>pdb|1BT1|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BT1|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BT2|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Reduced Cu(I)-Cu(I) State
 pdb|1BT2|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Reduced Cu(I)-Cu(I) State
 pdb|1BT3|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes) 
In The Native Cu(Ii)-Cu(Ii) State
 pdb|1BUG|A Chain A, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes)- 
Inhibitor Complex With Phenylthiourea (Ptu)
 pdb|1BUG|B Chain B, Catechol Oxidase From Ipomoea Batatas (Sweet Potatoes)- 
Inhibitor Complex With Phenylthiourea (Ptu)
Length=345

 Score =   390 bits (1001),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 233/352 (66%), Gaps = 13/352 (4%)
 Frame = +2

Query  359   SPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAID  538
             +PI  PE   C         G  V  +CCP    +      YK+P+ + + VRPAAH +D
Sbjct  1     APIQAPEISKCVVPPADLPPGAVVD-NCCPPVASNIVD---YKLPAVTTMKVRPAAHTMD  56

Query  539   DDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFP  709
              D + K+  A++ MK LP+DDPRNFYQQA VHCAYCNG Y     P    Q+H +WLFFP
Sbjct  57    KDAIAKFAKAVELMKALPADDPRNFYQQALVHCAYCNGGYDQVNFPDQEIQVHNSWLFFP  116

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWYLYFYERIL  LI DP+F LP+WNWDNP GM+LP+ F +D  S LYD  RNQ+H  
Sbjct  117   FHRWYLYFYERILGKLIGDPSFGLPFWNWDNPGGMVLPD-FLNDSTSSLYDSNRNQSHLP  175

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMG  1066
               V DL Y G +T  +D Q++ +NLA+MY+QM+TNA    LF GKA R   GD   PG G
Sbjct  176   PVVVDLGYNGADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYR--AGDAPSPGAG  233

Query  1067  TIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN--R  1240
             +IE  PH  IHRWVGDPR+ +NE+MGNFYSA  D  FYCHHSNVDRMWTIW+ L G   +
Sbjct  234   SIETSPHIPIHRWVGDPRNTNNEDMGNFYSAGRDIAFYCHHSNVDRMWTIWQQLAGKPRK  293

Query  1241  KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             +D TD DWL   FLFYDE    VKV++ DSLDN K+GY + K P PW D KP
Sbjct  294   RDYTDSDWLNATFLFYDENGQAVKVRIGDSLDNQKMGYKYAKTPLPWLDSKP  345



>gb|ABI96928.1| putative polyphenol oxidase [Chamaebatia foliolosa]
Length=455

 Score =   394 bits (1011),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 242/359 (67%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +        P +CCP   S ++D      +K+PS S+L V
Sbjct  1     PFAFAKPVAPPDVSKCGAADLPTGAQ---PTNCCPPVASKIID------FKLPSPSRLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D  Y+EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY  AG P    QI
Sbjct  52    RPAAHAVDQAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQI  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL SLI DPTFTLP+WNWD P GM LP ++ + + S LYDK
Sbjct  112   HNSWLFFPFHRYYLYFHEKILGSLIGDPTFTLPFWNWDAPAGMPLPALYANPKSS-LYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R   H+   + DL + G E S S+  ++  NL IMYRQM++NA  P LFFG   R   G
Sbjct  171   FRAAKHQPPTLVDLDFNGTEDSVSNETQINANLKIMYRQMVSNAKTPQLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDR+W+IWK
Sbjct  229   DEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRLWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R DITD DWL + FLFYDE   +V+VKV D L++  LGY +Q +  PW + KPT
Sbjct  289   TLGGKRTDITDTDWLDSGFLFYDENAQMVRVKVRDCLESKNLGYVYQDVNIPWLESKPT  347



>gb|KHN46528.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=596

 Score =   399 bits (1024),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 235/528 (45%), Positives = 320/528 (61%), Gaps = 44/528 (8%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSK-  505
             +NPFA A+PI PP+  +CGP  +        P +CCP   ST++D      +K P  +K 
Sbjct  87    NNPFAFAAPISPPDLTTCGPPDLPEGAE---PTNCCPPFSSTIID------FKFPPSNKP  137

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---  676
             L VRPAAH +D +YL KYK AI  MK LP++DPRNF QQANVHCAYC G+Y   G P   
Sbjct  138   LRVRPAAHLVDKNYLAKYKKAIDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLE  197

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+H +WLFFP+HRW+LYFYERIL SLI+DPTF LP+WNWD P+GM LP I+ D  +SPL
Sbjct  198   LQVHSSWLFFPYHRWFLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYAD-PKSPL  256

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD  RN  H+   + D  +      ++   ++  NL IMYRQ+++N   P LF G   R 
Sbjct  257   YDPLRNANHQPPTLVDFDFNLDNPISNG--RISTNLTIMYRQLVSNGKTPTLFLGNPYR-  313

Query  1037  ETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWT  1213
               GD   PG G++E VPH  +H W GD   P+ ENMG+FYSAA DP+FY HHSNVDRMW+
Sbjct  314   -AGDAPDPGGGSVEGVPHGPVHLWTGDINQPNIENMGDFYSAARDPIFYSHHSNVDRMWS  372

Query  1214  IWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             IWKTLGG R+D TD DWL++  LFYDE K LV+VKV+D LD  KLGY +Q +  PW   K
Sbjct  373   IWKTLGGKRRDFTDSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDVEIPWLKSK  432

Query  1394  PTrkrraklrskasvsasTSV-----------LPATLNKITTFCVTRSPTSKTPGKEELL  1540
             P+ +R    +       +T V            P  L+ + +  V R   S++  ++E  
Sbjct  433   PSPRRSRVQKVALGPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSRSKKEKEEE  492

Query  1541  DLHLAFDDTQF-----IRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANST  1705
             +  L  +  ++     ++FDV +N++DD   +  D  EYAGSF  + H HK  +    + 
Sbjct  493   EEVLVIEGVEYDSNIPVKFDVLINDEDDKQIQPEDS-EYAGSFVTVPHSHKHKNKKIITC  551

Query  1706  IKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
             ++     L +++LLE+L  E+DD ++VTLVPR G   V +     +++
Sbjct  552   LR-----LGLTDLLEELEAEDDDSVVVTLVPRYGKGRVQIGGIKIDLV  594



>ref|XP_003526194.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Glycine max]
Length=596

 Score =   399 bits (1024),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 235/528 (45%), Positives = 320/528 (61%), Gaps = 44/528 (8%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSK-  505
             +NPFA A+PI PP+  +CGP  +        P +CCP   ST++D      +K P  +K 
Sbjct  87    NNPFAFAAPISPPDLTTCGPPDLPEGAE---PTNCCPPFSSTIID------FKFPPSNKP  137

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---  676
             L VRPAAH +D +YL KYK AI  MK LP++DPRNF QQANVHCAYC G+Y   G P   
Sbjct  138   LRVRPAAHLVDKNYLAKYKKAIDLMKKLPANDPRNFMQQANVHCAYCTGSYDQVGFPGLE  197

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+H +WLFFP+HRW+LYFYERIL SLI+DPTF LP+WNWD P+GM LP I+ D  +SPL
Sbjct  198   LQVHSSWLFFPYHRWFLYFYERILGSLINDPTFALPFWNWDAPKGMQLPSIYAD-PKSPL  256

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD  RN  H+   + D  +      ++   ++  NL IMYRQ+++N   P LF G   R 
Sbjct  257   YDPLRNANHQPPTLVDFDFNLDNPISNG--RISTNLTIMYRQLVSNGKTPTLFLGNPYR-  313

Query  1037  ETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWT  1213
               GD   PG G++E VPH  +H W GD   P+ ENMG+FYSAA DP+FY HHSNVDRMW+
Sbjct  314   -AGDAPDPGGGSVEGVPHGPVHLWTGDINQPNIENMGDFYSAARDPIFYSHHSNVDRMWS  372

Query  1214  IWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             IWKTLGG R+D TD DWL++  LFYDE K LV+VKV+D LD  KLGY +Q +  PW   K
Sbjct  373   IWKTLGGKRRDFTDSDWLESGLLFYDENKNLVRVKVKDCLDTRKLGYVYQDVEIPWLKSK  432

Query  1394  PTrkrraklrskasvsasTSV-----------LPATLNKITTFCVTRSPTSKTPGKEELL  1540
             P+ +R    +       +T V            P  L+ + +  V R   S++  ++E  
Sbjct  433   PSPRRSRVQKVALGPHFNTGVARAAETSRNVQFPLVLDSVVSIVVKRPKKSRSKKEKEEE  492

Query  1541  DLHLAFDDTQF-----IRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANST  1705
             +  L  +  ++     ++FDV +N++DD   +  D  EYAGSF  + H HK  +    + 
Sbjct  493   EEVLVIEGVEYDSNIPVKFDVLINDEDDKQIQPEDS-EYAGSFVTVPHSHKHKNKKIITC  551

Query  1706  IKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
             ++     L +++LLE+L  E+DD ++VTLVPR G   V +     +++
Sbjct  552   LR-----LGLTDLLEELEAEDDDSVVVTLVPRYGKGRVQIGGIKIDLV  594



>ref|XP_011098121.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=585

 Score =   398 bits (1023),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 242/550 (44%), Positives = 334/550 (61%), Gaps = 31/550 (6%)
 Frame = +2

Query  179   ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALA  358
             A+R + +++ CA A  + +E   D      K+DRRN+LLGLGG   +      + P A A
Sbjct  31    AKRSNRLRVSCADAQKK-KEASRDVETPIGKVDRRNMLLGLGGGLYSAANLIPT-PGASA  88

Query  359   SPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAID  538
             +PI  PE   CG AT  N+ G+ +  +CCP T  + A    Y++P   ++ VRP+AH + 
Sbjct  89    NPIKAPELDKCGVATNLNT-GEKLDMNCCPPTSENIAD---YQLPPVVQMKVRPSAHRVS  144

Query  539   DDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK---PYQIHFTWLFFP  709
              +Y+ KY  AI +MK LP DDPRNF QQAN+HCAYCNGAY   G+     Q+H +WLFFP
Sbjct  145   PEYIFKYNMAIDRMKRLPKDDPRNFMQQANIHCAYCNGAYDQPGQGTLDLQVHNSWLFFP  204

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWYLYFYERI+  LI DPTF LP+WNWDNP+GM +P +F  D +S LYD KRNQ + +
Sbjct  205   FHRWYLYFYERIMGKLIGDPTFALPFWNWDNPKGMTIPPMF-LDPKSALYDSKRNQDNLK  263

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGT  1069
               V DL   G +      Q V NNL IM+ +M+        F GK  R E     PG G+
Sbjct  264   A-VLDLGMTGNKDP---LQVVSNNLTIMHTEMVRGNASVYDFMGKPYR-EGDKVNPGPGS  318

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT-LGGNR--  1240
              E   H ++H +VGDPR P  E++GNFYSA  DP+FYCHH+NVDRMWT+WK  L  N+  
Sbjct  319   AERGSHTAVHVFVGDPREPSGEDLGNFYSAGRDPLFYCHHANVDRMWTLWKYFLPSNKVP  378

Query  1241  -KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK--PTrkrr  1411
              + ITDPD+L T FLFYDE   LV+V V+D +DN+++GY F+++  PW D++  P     
Sbjct  379   ERTITDPDFLNTSFLFYDENAQLVRVTVKDCVDNLRMGYDFERIDLPWLDYRPPPQTAGA  438

Query  1412  aklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvf  1591
                R++ S   + +V P  L+KI    V +  T K    E L+   +  D T+F++    
Sbjct  439   KVKRTRKSAENAETVFPLKLDKIVRVLVPK--TRKGVADEVLVIEDITVDTTKFLK-FDV  495

Query  1592  vnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlend  1771
                D+D N +ELD+  YAG+++ +   HK  + TA ++I+     L + EL ED+ + +D
Sbjct  496   FVNDEDDNVEELDKAAYAGTYAQVP--HKTNNKTATTSIR-----LKLKELYEDMDVADD  548

Query  1772  dKILVTLVPR  1801
             D +LVTLVPR
Sbjct  549   DTVLVTLVPR  558



>ref|XP_004303397.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=603

 Score =   398 bits (1023),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 211/405 (52%), Positives = 266/405 (66%), Gaps = 17/405 (4%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLS--EAKLDRRNVllglgglygayniaggSNPFALASPIPP  373
             +I C   SS   +NP+D      +  LDRRNVL+GLGGLYG    +  ++PFA A P+ P
Sbjct  45    RIICKCTSSN--QNPSDEHKHSHQTNLDRRNVLIGLGGLYGVGLGS--ADPFAFAKPVAP  100

Query  374   PETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLE  553
             P+   CG A +        P +CCP           +  PS S L VRPAAHA+D  Y++
Sbjct  101   PDLSKCGAADLPPGA---TPINCCPPISDKIVD---FTFPSSSPLRVRPAAHAVDQAYID  154

Query  554   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWY  724
             KY  AI+ MK LP  DPR+F QQA++HCAYC+GAY   G P    QIH +WLF+PFHR+Y
Sbjct  155   KYSKAIELMKALPDSDPRSFSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFYPFHRYY  214

Query  725   LYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTD  904
             LYFYE+IL  LIDDPTF LP+WNWD+P GM LP +F D  +SPLY++ RN  H+   + D
Sbjct  215   LYFYEKILGKLIDDPTFALPFWNWDSPPGMKLPALFAD-PKSPLYNELRNANHQPPTLLD  273

Query  905   LAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVP  1084
             L +   +T  ++  ++ +NL IMYRQM++NA    LFFG A R  T D  PG G+IE+ P
Sbjct  274   LDWNLTDTPTTEADQISSNLKIMYRQMVSNAKKQQLFFGTAYRAGT-DPSPGSGSIESTP  332

Query  1085  HNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDW  1264
             H  +H W GD   P+ E+MGNFYSAA DP+F+ HHSNVDRMW++WKTLG   KDITDPDW
Sbjct  333   HGPVHVWTGDNTQPNYEDMGNFYSAARDPIFFSHHSNVDRMWSVWKTLGATNKDITDPDW  392

Query  1265  LQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             L T FLFYDE   LV+VKV D LD+ KLGY +Q +  PW   KPT
Sbjct  393   LDTGFLFYDENAQLVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPT  437



>ref|XP_008364151.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=582

 Score =   397 bits (1021),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 248/580 (43%), Positives = 334/580 (58%), Gaps = 39/580 (7%)
 Frame = +2

Query  155   LNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniag  334
             L PN S+   +    +    A  ++G  +  D  L  A+LDRRN+L+GLG       +  
Sbjct  26    LFPNKSQTPLQRKPKQCLRVAQKTKGDNDNLDQGL--ARLDRRNMLIGLGAGGLYGAV--  81

Query  335   gSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNV  514
               NPFA A+P+  P+  +CGPA  +  +G  +   CCP T   T +   +++P    L  
Sbjct  82    -GNPFAFAAPVSAPDLTTCGPA--NKPDGSTI--DCCPPT---TTTIIDFELPDSGPLRT  133

Query  515   RPAAHAI--DDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---Y  679
             RPAA  +  D +YL KYK A++ M+ LP DDPR+  QQA VHC+YC+G Y   G      
Sbjct  134   RPAAQDVANDPEYLAKYKKAVELMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEI  193

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+H+ WLFFPFHRWYLYFYE+I+  LI DPTF LP+WNWD P GM +PEIF D   S LY
Sbjct  194   QVHYCWLFFPFHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFIDTSSS-LY  252

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
             D+ RN AH+   + DL Y G +    D  ++K NL  MY+QM++NA    LF+G+     
Sbjct  253   DQYRNAAHQPPKLLDLNYGGTDDDVDDATRIKENLTTMYKQMVSNATSHRLFYGEPY--S  310

Query  1040  TGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
              GD   PG G IE  PHN+IH W GDP   + E+MG FYSAA DP+FY HHSNVDRMW I
Sbjct  311   AGDEPSPGAGNIETTPHNNIHLWAGDPTQTNGEDMGTFYSAARDPLFYSHHSNVDRMWXI  370

Query  1217  WK-TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDF  1390
             +K  LGG   DI + DWL  EFLFYDE K LV+VKV DSLD  KLGY + + +  PW + 
Sbjct  371   YKDKLGGT--DIENTDWLDAEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDENVSIPWLES  428

Query  1391  KPTrkrraklrskasvsasTS-VLPATLNKITTFCVTR-SPTSKTPGKEELLDLHLAFDD  1564
             KPT ++    R     S+  S   PATL+ I +  VTR S T +T  +++  D  L    
Sbjct  429   KPTTRKSTNKRKAXVSSSDLSTTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKG  488

Query  1565  TQFIRfdvfvnedddvnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLA  1732
              +F   +    +    +  +     D+ E+AGSF ++ H HK         IKT    L+
Sbjct  489   IEFAGNETVKFDVYVNDDADSLAGKDKSEFAGSFVHVPHKHK-------KNIKT-NLRLS  540

Query  1733  ISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             I+ LLE+L  E D+ ++VTLVP+ G   +T+     E+I+
Sbjct  541   ITSLLEELDAETDNSLVVTLVPKVGKGPITIGGFSIELIN  580



>gb|ADI44162.1| polyphenol oxidase 1 [Fragaria pentaphylla]
Length=607

 Score =   398 bits (1023),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 213/409 (52%), Positives = 271/409 (66%), Gaps = 23/409 (6%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAK-----LDRRNVllglgglygayniaggSNPFALASP  364
             ++ C A +S+  +NP+++S ++A+     LDRRNVLLGLGGLYG   +   ++PFA A P
Sbjct  47    RVSCKATNSD--QNPSNNS-NDAQPLGRTLDRRNVLLGLGGLYGVAGLG--TDPFAFAKP  101

Query  365   IPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD  544
             + PP+   CG A +     K     CCP           +++P  SKL VRPAAHA+D  
Sbjct  102   VAPPDVSKCGAADLPTGAQK---TDCCPPVAQKIFD---FQLPPQSKLRVRPAAHAVDKA  155

Query  545   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFH  715
             Y+EKY  AI+ MK LP DDPR+F QQAN+HCAYC+GAY  AG P    QIH +WLFFPFH
Sbjct  156   YIEKYSKAIELMKALPDDDPRSFKQQANIHCAYCDGAYDQAGFPDLELQIHDSWLFFPFH  215

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             R+YLYFYERIL  LI+DP+F  P+WNWD P GM LP +F +  +SPLYDK RN  H+   
Sbjct  216   RYYLYFYERILGKLINDPSFASPFWNWDAPAGMQLPGMFAN-PKSPLYDKFRNANHQPPK  274

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTI  1072
             + DL Y  ++ + SD  ++  NL IMYRQM++NA  P LFFG   R   GD   PG G I
Sbjct  275   LIDLNYNLKDANVSDETQINTNLKIMYRQMVSNAKNPKLFFGNPYR--AGDEPSPGGGAI  332

Query  1073  ENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDIT  1252
             E  PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDR+W++WKTLGG R+D T
Sbjct  333   ETTPHGPVHIWTGDNTQPNLEDMGNFYSAGRDPIFFSHHSNVDRLWSVWKTLGGKREDFT  392

Query  1253  DPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             D DWL + FLFYDE   +V+VKV D LD+ KLGY +Q +  PW   KPT
Sbjct  393   DSDWLDSGFLFYDENANMVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPT  441



>gb|ABI96926.1| putative polyphenol oxidase [Cercocarpus betuloides]
Length=455

 Score =   393 bits (1009),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/359 (54%), Positives = 241/359 (67%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +        P +CCP   S ++D      +K+PS + L V
Sbjct  1     PFAFAKPVAPPDVSKCGAADLPTGAQ---PTNCCPPVASKIID------FKLPSPTPLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D  Y+EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY  AG P    QI
Sbjct  52    RPAAHAVDKAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQI  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL SLI DPTF LP+WNWD P GM LP I+ +  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFHEKILGSLIGDPTFALPFWNWDAPAGMPLPAIYAN-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R   H+   + DL + G E +AS+  ++  NL IMYRQM++NA  P LFFG   R   G
Sbjct  171   FRAANHQPPTLVDLDFNGTEDAASNETQINANLKIMYRQMVSNAKTPQLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDR+W+IWK
Sbjct  229   DEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRLWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R DITD DWL + FLFYDE   +V+VKV D L++  LGY +Q    PW + KPT
Sbjct  289   TLGGKRTDITDTDWLDSGFLFYDENAQMVRVKVRDCLESKNLGYVYQDANIPWLESKPT  347



>sp|Q06215.1|PPO_VICFA RecName: Full=Polyphenol oxidase A1, chloroplastic; Short=PPO; 
AltName: Full=Catechol oxidase; Flags: Precursor [Vicia faba]
 emb|CAA77764.1| polyphenol oxidase [Vicia faba]
Length=606

 Score =   398 bits (1022),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 256/577 (44%), Positives = 332/577 (58%), Gaps = 51/577 (9%)
 Frame = +2

Query  200   KIRCAAASSEGRENP-ADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPP  376
             K +   +S+  + NP  +  LS     RRNVL+GLGG+YG       +NP ALASPI PP
Sbjct  43    KRQVTCSSNNNQNNPKEEQELSNIVGHRRNVLIGLGGIYGTLA----TNPSALASPISPP  98

Query  377   ETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEK  556
             +   C P +   S   P   +CCP     T   D+ K PS   L VR AAH +D+++LEK
Sbjct  99    DLSKCVPPSDLPSGTTPPNINCCPP--YSTKITDF-KFPSNQPLRVRQAAHLVDNEFLEK  155

Query  557   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYL  727
             YK A + MK LPS+DPRNF QQAN+HCAYC+GAY   G P    Q+H +WLFFPFHRWYL
Sbjct  156   YKKATELMKALPSNDPRNFTQQANIHCAYCDGAYSQIGFPDLKLQVHGSWLFFPFHRWYL  215

Query  728   YFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDL  907
             YFYERIL SLI+DPTF LP+WN+D P GM LP I+ D + SPLYD+ RN +H+   + DL
Sbjct  216   YFYERILGSLINDPTFALPFWNYDAPDGMQLPTIYAD-KASPLYDELRNASHQPPTLIDL  274

Query  908   AYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGP-GMGTIENVP  1084
              +    +     + +K NL+IMYRQ+ +N     LF G   R   GD  P G G+IENVP
Sbjct  275   NFCDIGSDIDRNELIKTNLSIMYRQVYSNGKTSRLFLGNPYR--AGDAEPQGAGSIENVP  332

Query  1085  HNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDW  1264
             H  +H W GD    + E+MG FYSAA DP+FY HHSNVDR+W IWKTLGG + D TD DW
Sbjct  333   HAPVHTWTGDNTQTNIEDMGIFYSAARDPIFYSHHSNVDRLWYIWKTLGGKKHDFTDKDW  392

Query  1265  LQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsa  1444
             L++ FLFYDE K LV+V V+DSLD  KLGY +Q +P PW+  KP  +R    +       
Sbjct  393   LESGFLFYDENKNLVRVNVKDSLDIDKLGYAYQDVPIPWEKAKPVPRRTKVQKLVEVEVN  452

Query  1445  sTSV-------------------LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDT  1567
               ++                    P  LN   +  V R    ++  ++E  +  L  +  
Sbjct  453   DGNLRKSPTIFLVRQQSPRKYVTFPLVLNNKVSAIVKRPKKLRSKKEKEEEEEVLVIEGI  512

Query  1568  QFIRfdvfvnedddvnTKELDRV-----EYAGSFSNL---AHVHKDTSTTANSTIKTPTF  1723
             +F  +     + D     E D+V     E+AGSF N+   AH HK      N  I T + 
Sbjct  513   EF--YMNIAIKFDVYINDEDDKVGAGNTEFAGSFVNIPHSAHGHK------NKKIIT-SL  563

Query  1724  SLAISelledlrlenddKILVTLVPRAGGSFVTVNKA  1834
              L I++LLEDL +E DD I+VTLVP+ G   V +N  
Sbjct  564   RLGITDLLEDLHVEGDDNIVVTLVPKCGSGQVKINNV  600



>ref|XP_009408264.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   397 bits (1020),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 248/566 (44%), Positives = 333/566 (59%), Gaps = 29/566 (5%)
 Frame = +2

Query  161   PNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggS  340
             P P+R A     + +R   A   G E+        AK+DRR+VL+GLGGL GA    GG 
Sbjct  33    PYPTRRA-----LHVRPNIACKAGEEHEI-----AAKVDRRDVLVGLGGLCGAAAGLGGF  82

Query  341   NPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRP  520
             +  ALA+PI  P+   CGPA +    G PV  +CCP         D+ +    S L VRP
Sbjct  83    DKAALANPIQAPDLSKCGPADLPT--GVPV-VNCCPPYRPGAKIVDFKRPSPSSPLRVRP  139

Query  521   AAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHF  691
             AAH +D +YL KYK AI+ MK LP+DDPRNF QQA+VHCAYC+GAY   G P    Q+H 
Sbjct  140   AAHLVDPEYLAKYKKAIELMKALPADDPRNFMQQADVHCAYCDGAYDQIGFPNLEIQVHN  199

Query  692   TWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKR  871
             +WLFFP+HR YLYF ERIL  LI D TF+LP+WNWD P GM+LP I+ D   SPLYDK R
Sbjct  200   SWLFFPWHRLYLYFNERILGKLIGDDTFSLPFWNWDAPGGMMLPSIYAD-PSSPLYDKLR  258

Query  872   NQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT  1051
             +  H+   + DL Y G + +  D Q++ +NL IMYRQ+ +N   PLLF G A R      
Sbjct  259   DAKHQPPVLVDLDYNGTDPTFPDAQQIDHNLKIMYRQVFSNGKTPLLFLGSAYRAGE-QP  317

Query  1052  GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLG  1231
              PG G++EN+PHN++H W GD   P+ ENMG FY+AA DP+F+ HH+N+DRMW +WK L 
Sbjct  318   NPGAGSVENMPHNNVHLWTGDRTQPNFENMGTFYAAARDPIFFAHHANIDRMWYLWKKLS  377

Query  1232  GNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrr  1411
                +D  D DWL+  FLFYDE   LV+V V+D L+   L YT+Q +  PW + +PT K  
Sbjct  378   RKHQDFNDSDWLKASFLFYDENADLVRVTVKDCLETDWLRYTYQDVKIPWVNARPTPKLA  437

Query  1412  aklrskasvsasTSVL--PATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfd  1585
                ++ +S   +T+ +  P TL       V R    ++  ++E  +  L  +  +F R  
Sbjct  438   KARKAASSSLKATAEVQFPVTLESPVKATVKRPKVGRSGKEKEDEEEILIVEGIEFDRDY  497

Query  1586  vfvnedddvnTKELDRV-----EYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelle  1750
                 +     T E D +     E+AGSF N+ H HK       + +KT    L I++LLE
Sbjct  498   FIKFDVFVNAT-EGDGITAGASEFAGSFVNVPHKHKHRKD--ENKLKT-RLCLGITDLLE  553

Query  1751  dlrlenddKILVTLVPRAGGSFVTVN  1828
             D+  E+DD +LVT+VP+AG   V+V 
Sbjct  554   DIGAEDDDSVLVTIVPKAGKGKVSVG  579



>gb|AEY78528.1| polyphenol oxidase [Canarium album]
Length=606

 Score =   398 bits (1022),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 239/556 (43%), Positives = 323/556 (58%), Gaps = 37/556 (7%)
 Frame = +2

Query  248   DSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKP  427
             D   S  K DRR+VL+GLGG  G  +++  S+PFA+A+P+  P+   CG A +     + 
Sbjct  66    DGQTSLNKFDRRDVLVGLGGFCGFASLS--SDPFAVAAPVSAPDLAKCGKANLPAGAKQT  123

Query  428   VPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPR  607
                +CCP T         +  PS + L +RPAAH +DD Y+ KY  AI+ MK LP+DDPR
Sbjct  124   ---NCCPPTSKKILGFKLH--PSNAPLRIRPAAHLVDDAYIAKYSRAIELMKALPADDPR  178

Query  608   NFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFT  778
              F QQANVHCAYC+GAY   G P    Q+H +WLFFPFHR+YLYFYE+IL  LI+DPTF 
Sbjct  179   GFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPFHRYYLYFYEKILGKLIEDPTFA  238

Query  779   LPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKN  958
             LP+WNWD+P GM +P ++ +  +SPLYD  RN +H+   + DL Y   + + ++  ++ +
Sbjct  239   LPFWNWDSPPGMQMPAMYAN-PKSPLYDNFRNASHQPPTLVDLDYNRTDETTTNKDQLSS  297

Query  959   NLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNE  1135
             NL IMYRQM++N     LFFG A R   GD   PG+G+IEN+PH  +H W GD   P+ E
Sbjct  298   NLKIMYRQMVSNGKTAKLFFGNAYR--AGDEPDPGLGSIENIPHGPVHLWCGDKTQPNLE  355

Query  1136  NMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN-RKDITDPDWLQTEFLFYDETKTLVK  1312
             +MGNFYSAA DP+FY HHSN+DRMWTIWKTLGG  RK+ TDPDWL   FLFYDE   LV+
Sbjct  356   DMGNFYSAARDPIFYSHHSNIDRMWTIWKTLGGKKRKEFTDPDWLDAGFLFYDENANLVR  415

Query  1313  VKVEDSLDNVKLGYTFQKMPTPWKDFKPT------------rkrraklrskasvsasTSV  1456
             VKV D LDN KLGY +QK+  PW + KPT                    ++     + S 
Sbjct  416   VKVRDCLDNKKLGYDYQKVDIPWLNTKPTPRKRIVNKVRSTFGVAHAAETRRIQLTARSQ  475

Query  1457  LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKEL---  1627
              P  L+K  +  V R   S++  ++E  +  L  +   F R      +    +  ++   
Sbjct  476   FPLVLDKTMSTLVPRPKKSRSKKEKEEEEEVLVIEGIDFERDAQVKFDVYINDEHDVPSG  535

Query  1628  -DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRA  1804
              D  E+AGSF N+           +         L +++L+EDL  E+DD ++VTLVPR 
Sbjct  536   PDDTEFAGSFVNVP------HKHKHGKKIKTCLRLGLTDLIEDLEAEDDDSVVVTLVPRY  589

Query  1805  GGSFVTVNKAYTEIID  1852
             G     +     E  D
Sbjct  590   GKGLARIGGIKIEFYD  605



>gb|AFH00996.1| polyphenol oxidase II [Pyrus x bretschneideri]
 gb|AFH00997.1| polyphenol oxidase II [Pyrus x bretschneideri]
Length=600

 Score =   397 bits (1021),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 264/557 (47%), Positives = 339/557 (61%), Gaps = 34/557 (6%)
 Frame = +2

Query  203   IRCAAAS---SEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPP  373
             I C A +   +E +  P  SS    KLDRRNVLLGLGGLYGA  +A    P A A+P+ P
Sbjct  53    ISCKATNPNNNEKQNQPEQSSNLLGKLDRRNVLLGLGGLYGATTLA--QKPLAFAAPLAP  110

Query  374   PETKSCGPATISNSNGKPVPYSCCP--STLMDTASADYYKIPSFSKLNVRPAAHAIDDDY  547
             P+   C  A I+ + G+ V  +CCP  ST +   + D   IP    L  RPAAH + D+Y
Sbjct  111   PDLTKCTLAEIT-TGGETV--ACCPPVSTKIKAFTPDR-SIP----LRTRPAAHLVTDEY  162

Query  548   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHR  718
             L K+K A   M+ LP DDPR+  QQANVHCAYCNGAY   G P    Q+HF+WLFFPFHR
Sbjct  163   LAKFKNAQALMRALPEDDPRSMVQQANVHCAYCNGAYPQVGFPDIDIQVHFSWLFFPFHR  222

Query  719   WYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYV  898
              YLYFYERIL  LIDDPTF LPYWNWD+P G  +P+I+ D   SPLYD+ RN  H+   +
Sbjct  223   MYLYFYERILGKLIDDPTFALPYWNWDSPDGFPIPDIYTD-TTSPLYDQYRNAGHQPPVL  281

Query  899   TDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIEN  1078
              DL+Y G +    +  ++  NLAIMYRQM++ A  P LFFG   R     TG   GTIEN
Sbjct  282   VDLSYGGTDDDVDEQTRIDENLAIMYRQMVSGAKTPDLFFGHEYRAGDTTTGTYAGTIEN  341

Query  1079  VPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDP  1258
              PHN+IH W GDP  P+ E+MGNFYS+  DP+FY HH NVDRMW IWKTLGG RK     
Sbjct  342   NPHNNIHLWCGDPDQPNKEDMGNFYSSGRDPLFYAHHCNVDRMWNIWKTLGGKRKVPYRH  401

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVK-LGYTFQKMPTPWKDFKPTrkr-raklrska  1432
              WL  EFLFYDE   LV  KV DS+   K L YT++ +  P    KPT ++ R K +++ 
Sbjct  402   RWLDAEFLFYDENAELVSCKVRDSIHPAKDLRYTYEPVSVPCLFSKPTARKPRNKTKARV  461

Query  1433  svsasTSVLPATLNKITTFCVTRSPTSKTPGKEE------LLDLHLAFDDTQFIRfdvfv  1594
             S +  T+  PAT +  TT  V R    K   KE+      L+   + F+  + ++FDVF+
Sbjct  462   SDTQLTTKFPATFDSKTTVEVARPKPRKRTKKEKSNEEEVLIIKDIEFESNEAVKFDVFI  521

Query  1595  nedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlendd  1774
             N+D +  +++ D+ E+AGSF ++ H  K  + T  +        L I++LLEDL +E D 
Sbjct  522   NDDAESLSRK-DKSEFAGSFVHVPHKQKTGTKTKTN------LKLGITDLLEDLGVEEDS  574

Query  1775  KILVTLVPRAGGSFVTV  1825
              +LVTLVPR   S +TV
Sbjct  575   CVLVTLVPRVSNSPITV  591



>gb|KCW76289.1| hypothetical protein EUGRSUZ_D00659 [Eucalyptus grandis]
Length=659

 Score =   399 bits (1026),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 261/570 (46%), Positives = 339/570 (59%), Gaps = 49/570 (9%)
 Frame = +2

Query  203   IRCAAASSEGRE-NPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             I C A S++  E NP        KLDRRNVL+GLGG YGA  +   S+PFALA PI  P+
Sbjct  119   ISCKALSNDDSEQNPM-----SVKLDRRNVLIGLGGFYGAVGLR--SDPFALAEPISVPD  171

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSF-SKLNVRPAAHAIDDDYLEK  556
                CG          P   +CCP    +      +K+PS  S   VRPAAH  D+DY+ K
Sbjct  172   FTQCGKVN-------PCAKACCPPPTTEVLD---FKLPSSNSPTRVRPAAHLADEDYIAK  221

Query  557   YKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKPY---QIHFTWLFFPFHRWYL  727
             Y  AI+ MK LP+DDPR+F QQANVHCAYC+G Y   G P+   Q+H +WLFFPFHR+YL
Sbjct  222   YAEAIRLMKALPADDPRSFMQQANVHCAYCDGYYNQVGFPHLEVQVHCSWLFFPFHRYYL  281

Query  728   YFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDL  907
             YFYE+IL SLI DPTF LPYWNWD P GM +P +F D   SPLYD  RN  H    + DL
Sbjct  282   YFYEKILGSLIKDPTFALPYWNWDAPGGMKMPAMFTD-PHSPLYDFNRNPDHAPPMLVDL  340

Query  908   AYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD-TGPGMGTIENVP  1084
              Y  +    S+   + NNL+IMYRQM+++     LF G A R   GD   PG G+IE +P
Sbjct  341   NYNCEHLPPSNL--IHNNLSIMYRQMVSSGKTAKLFLGHAYR--AGDHANPGAGSIELMP  396

Query  1085  HNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG-NRKDITDPD  1261
             HN++H W GD R P+ E+MG  YSAA DP+F+ HHSNVDRMWT+WKTLGG  R D T PD
Sbjct  397   HNTVHNWCGDYRQPNLEDMGILYSAARDPLFFAHHSNVDRMWTLWKTLGGPKRTDFTHPD  456

Query  1262  WLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvs  1441
             WL   FLFYDE K  V+VKV+D L+   LGY +Q +  PW++ KP  ++ A   ++ S  
Sbjct  457   WLNASFLFYDENKQAVRVKVKDCLETTNLGYKYQDVDIPWRNSKPVPRKIAIKVTETSGG  516

Query  1442  --------asTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQ-----FIRf  1582
                      S +  P  L+K+ +  V R    ++  ++E  +  L  +  +     F++F
Sbjct  517   IADVAEIPRSIAHFPVKLDKVVSTLVKRPKQKRSKKEKEEKEEVLVIEGIELESDAFVKF  576

Query  1583  dvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrl  1762
             DV +N++    +   D  E+AGSF N+ H HK         +KT   +L I+ELLEDL  
Sbjct  577   DVHINDEQASLSSP-DMTEFAGSFVNVPHKHK-----PGKKMKT-KLTLGITELLEDLMC  629

Query  1763  enddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             E+D+KILVTL PR GG  V ++    E +D
Sbjct  630   EDDEKILVTLNPRYGGEDVIISNIKIEFVD  659



>gb|KDO75857.1| hypothetical protein CISIN_1g042556mg [Citrus sinensis]
Length=591

 Score =   397 bits (1020),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 244/571 (43%), Positives = 325/571 (57%), Gaps = 42/571 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             K+ C A +    +NP+ S  S  KLDRR+VLL   G     +    S+PFA A+P+  P+
Sbjct  40    KVTCKATN---EQNPS-SKDSLNKLDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSAPD  95

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
                CG A  +  N       CCP     T   ++   PS S L VRPAAH  DD Y+ KY
Sbjct  96    ISKCGKADTTTDN-------CCPPK--STNIINFKLPPSNSSLRVRPAAHLSDDAYIAKY  146

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               AI+ MK LP+DDPR+F  QANVHCAYC+GAY   G P    QIH +WLFFPFHR+YLY
Sbjct  147   SKAIELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRYYLY  206

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYE+IL  LIDDPTF LP+WNWD+P GM +P +F +   SPLYDK RN  H+   + DL 
Sbjct  207   FYEKILGKLIDDPTFALPFWNWDSPPGMQMPPMFAN-PNSPLYDKLRNANHQPPTLLDLD  265

Query  911   YAGQETSASDFQK--VKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVP  1084
             Y   +   +  +K  + +NL IMYRQM++N     LF G   R    D  PG G+IEN P
Sbjct  266   YNETDDDQTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYRA-GDDPEPGSGSIENAP  324

Query  1085  HNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDW  1264
             HN +H W GD   P+ ENMGNFYSA  DP+F+ HHSN+DRMWTIW+TLGG R + T+PDW
Sbjct  325   HNPVHLWCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLGGKRTNFTEPDW  384

Query  1265  LQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsa  1444
             L + FLFYDE   LV+VKV D LD   LGY +Q +  PW++ KP+ +  AK R   +   
Sbjct  385   LDSAFLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKAFGV  444

Query  1445  sTS-----------VLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvf  1591
             + +           V P  L+++ +  V R   S++  ++E  +  L  D+ +F R    
Sbjct  445   AQAAELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERDARV  504

Query  1592  vnedddvnTKEL-----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledl  1756
               +      ++      D  E+AGSF N+ H HK       S        L +++LLEDL
Sbjct  505   KFDVYINEDEDEMPIGPDNSEFAGSFVNVPHKHKHGKKMKTS------LRLGLTDLLEDL  558

Query  1757  rlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
               E+DD ++VTLVP+ G     +     + +
Sbjct  559   GAEDDDSVIVTLVPKFGKGLARIGGIKIDFV  589



>ref|XP_011082857.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=579

 Score =   396 bits (1018),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 256/558 (46%), Positives = 350/558 (63%), Gaps = 34/558 (6%)
 Frame = +2

Query  179   ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALA  358
             A+R   +++ CA A ++   N +     + K+DRRN+LLGLGGLYGA N+   S P A A
Sbjct  35    AKRSPRLQVSCATAPNK---NDSVDDTPQGKVDRRNMLLGLGGLYGATNLV--STPGASA  89

Query  359   SPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAID  538
             +PI PPE   CG AT + +N KPV +SCCP     T     YK+P   ++ +RP+AH + 
Sbjct  90    NPIQPPELDKCGVAT-NAANQKPVEFSCCPPV---TQRIIDYKLPPVFQMKIRPSAHRVS  145

Query  539   DDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK---PYQIHFTWLFFP  709
              +Y+ KY  AI +MK LP DDPRNF QQAN+HCAYCNGAY   G+     Q+H +WLFFP
Sbjct  146   PEYIFKYNMAIDRMKRLPQDDPRNFLQQANIHCAYCNGAYDQPGQGTLDLQVHESWLFFP  205

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWYLYFYERIL  LI DPTF LP+WNWDNP+GM +P +F  D  S LYD+KR+ A   
Sbjct  206   FHRWYLYFYERILGKLIGDPTFALPFWNWDNPKGMTMPPMF-VDPRSALYDEKRDPASLP  264

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGT  1069
               V DL   G        Q V NNL IMY +M+        F G+ +R+       G G+
Sbjct  265   PAVVDL---GNTQVTDPLQLVANNLTIMYSEMIRVNANVYDFMGQPLREGGKPK--GGGS  319

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT-LGGNR--  1240
              E   H S+H WVGDP  P  E++GNFYSA  DP+FYCHH+NVDRMWT+W+  L  N+  
Sbjct  320   SERGSHTSVHIWVGDPNQPTREDLGNFYSAGRDPLFYCHHANVDRMWTLWQYFLPSNKVP  379

Query  1241  -KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP--Trkrr  1411
              K ITDPD+L   FLFYDE   LV+V V+D LDN+++GY F+++  PW D++P     + 
Sbjct  380   DKRITDPDFLNAAFLFYDENAQLVRVTVKDCLDNLRMGYDFERIDLPWLDYRPPRQTAKA  439

Query  1412  aklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvf  1591
               LR+ ++   ++++ P  L+K+  F V +  T K    E L+  ++  D T+F++FDVF
Sbjct  440   KVLRTSSTAPKASTLFPLNLDKVVRFQVDK--TKKGKADELLVLENITVDTTKFLKFDVF  497

Query  1592  vnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlend  1771
             VN++DD  T ELD+  Y G+++ +   HK  + TA STI+     + ++EL +D+ + +D
Sbjct  498   VNDEDDNAT-ELDKAAYLGTYAQVP--HKTPNKTATSTIR-----MKLTELYDDMDISDD  549

Query  1772  dKILVTLVPRAGGSFVTV  1825
             D I+VTLVPR  G  VT+
Sbjct  550   DSIVVTLVPRHQGPGVTI  567



>ref|XP_006468218.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Citrus sinensis]
Length=591

 Score =   397 bits (1019),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 246/573 (43%), Positives = 326/573 (57%), Gaps = 46/573 (8%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             K+ C A +    +NP+ S  S  KLDRR+VLL   G     +    S+PFA A+P+  P+
Sbjct  40    KVTCKATN---EQNPS-SKDSLNKLDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSTPD  95

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
                CG A  +  N       CCP     T   ++   PS S L VRPAAH  DD Y+ KY
Sbjct  96    ISKCGKADTTTDN-------CCPPK--STNIINFKLPPSNSSLRVRPAAHLSDDAYIAKY  146

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               AI+ MK LP+DDPR+F  QANVHCAYC+GAY   G P    QIH +WLFFPFHR+YLY
Sbjct  147   SKAIELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRYYLY  206

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYE+IL  LIDDPTF LP+WNWD+P GM +P +F +   SPLYDK RN  H+   + DL 
Sbjct  207   FYEKILGKLIDDPTFALPFWNWDSPPGMQMPPMFAN-PNSPLYDKLRNANHQPPTLLDLD  265

Query  911   YA----GQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIEN  1078
             Y      Q T+  D  ++ +NL IMYRQM++N     LF G   R    D  PG G+IEN
Sbjct  266   YNETDDDQTTTKKD--QISSNLTIMYRQMVSNGKTSKLFLGSPYRA-GDDPEPGSGSIEN  322

Query  1079  VPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDP  1258
              PHN +H W GD   P+ ENMGNFYSA  DP+F+ HHSN+DRMWTIW+TLGG R + T+P
Sbjct  323   APHNPVHLWCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLGGKRTNFTEP  382

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasv  1438
             DWL + FLFYDE   LV+VKV D LD   LGY +Q +  PW++ KP+ +  AK R   + 
Sbjct  383   DWLDSAFLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKAF  442

Query  1439  sasTS-----------VLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfd  1585
               + +           V P  L+++ +  V R   S++  ++E  +  L  D+ +F R  
Sbjct  443   GVAQAAELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERDA  502

Query  1586  vfvnedddvnTKEL-----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelle  1750
                 +      ++      D  E+AGSF N+ H HK       S        L +++LLE
Sbjct  503   RVKFDVYINEDEDEMPIGPDNSEFAGSFVNVPHKHKHGKKMKTS------LRLGLTDLLE  556

Query  1751  dlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
             DL  E+DD ++VTLVP+ G     +     + +
Sbjct  557   DLGAEDDDSVIVTLVPKFGKGLARIGGIKIDFV  589



>ref|XP_008349220.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=610

 Score =   397 bits (1021),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 212/418 (51%), Positives = 267/418 (64%), Gaps = 21/418 (5%)
 Frame = +2

Query  182   RRGDVIKIRCAAA--SSEGRENPADSS-------LSEAKLDRRNVllglgglygayniag  334
             R  ++  + C A   SS+  +NP+ SS        S   LDRR VL+GLG LYG     G
Sbjct  38    RHSNLQAVSCKATNNSSDQNKNPSTSSNDHDHENPSPVNLDRRXVLIGLGSLYGGVAGLG  97

Query  335   gSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNV  514
              S+PFA+A P+ PP+   CG A   +     VP +CCP T         +K PS +KL V
Sbjct  98    -SDPFAVAKPVSPPDLAKCGAADFPSG---AVPTNCCPPTSQKIVD---FKFPSPTKLRV  150

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D  Y+EKY  AI+ MK LP DDPR+F QQA+VHCAYCNGAY   G P    QI
Sbjct  151   RPAAHAVDKAYIEKYSKAIELMKALPDDDPRSFTQQADVHCAYCNGAYDQVGFPNLELQI  210

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+ERIL  LIDDPTF LP+WNWD P GM LP ++ +  +SPLYD+
Sbjct  211   HQSWLFFPFHRYYLYFHERILAKLIDDPTFALPFWNWDAPAGMQLPALYAN-PDSPLYDE  269

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R  +H+   + DL + G + + S   +++ NL IMYRQM++N+  PLLFFG   R  T 
Sbjct  270   LRAASHQPPTLIDLDFNGTDETMSKDAQIEANLKIMYRQMVSNSKKPLLFFGSPYRAGT-  328

Query  1046  DTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
             +  PG G IE  PH  +H W GD   P+ E+MGNFYS A DP+F+ HH N DRMW IWK+
Sbjct  329   EPDPGXGXIEXTPHGPVHXWTGDNTQPNXEDMGNFYSXARDPIFFXHHXNXDRMWNIWKS  388

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             +G    DI D DWL T FLFYDE   LV+V V D+LDN KLGYT++ +  PW   +PT
Sbjct  389   IGTKNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLXSRPT  446



>gb|ADI44161.1| polyphenol oxidase 2 [Fragaria pentaphylla]
Length=603

 Score =   397 bits (1019),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/403 (52%), Positives = 261/403 (65%), Gaps = 13/403 (3%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             +I C + SS    +       +  +DRRNVL+GLGGLYG       ++PFA A P+ PP+
Sbjct  45    RIICKSTSSNQSPSDEHKHPHQTNVDRRNVLIGLGGLYGVGLGG--ADPFAFAKPVAPPD  102

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
                CG A +        P +CCP           +  PS S L VRPAAHA+D  Y++KY
Sbjct  103   LSKCGAADLPPGA---TPINCCPPISDKIVD---FTFPSSSPLRVRPAAHAVDQAYIDKY  156

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               AI+ MK LP  DPR+F QQA++HCAYC+GAY   G P    QIH +WLFFPFHR+YLY
Sbjct  157   SKAIELMKALPDSDPRSFSQQADIHCAYCDGAYDQVGFPDLELQIHQSWLFFPFHRYYLY  216

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYE+IL  LIDDPTF LP+WNWD+P GM LP +F D  +SPLY++ RN  H+   + DL 
Sbjct  217   FYEKILGKLIDDPTFALPFWNWDSPPGMKLPALFAD-PKSPLYNELRNANHQPPTLLDLD  275

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHN  1090
             +   +T  ++  ++ +NL IMYRQM++NA    LFFG A R  T D  PG G+IE+ PH 
Sbjct  276   WNLTDTPTTEADQISSNLKIMYRQMVSNAKKQQLFFGTAYRAGT-DPSPGSGSIESTPHG  334

Query  1091  SIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQ  1270
              IH W GD   P+ E+MGNFYSAA DP+F+ HHSNVDRMW++WKT G   KDITDPDWL 
Sbjct  335   PIHVWTGDNTQPNYEDMGNFYSAARDPIFFSHHSNVDRMWSVWKTFGATNKDITDPDWLD  394

Query  1271  TEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             T FLFYDE   LV+VKV D LD+ KLGY +Q +  PW   KPT
Sbjct  395   TGFLFYDENAQLVRVKVRDCLDSKKLGYVYQDVDIPWLTSKPT  437



>emb|CAQ76694.1| polyphenol oxidase (chloroplast) (chloroplast) [Taraxacum officinale]
Length=594

 Score =   396 bits (1018),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 245/550 (45%), Positives = 330/550 (60%), Gaps = 34/550 (6%)
 Frame = +2

Query  260   SEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYS  439
             +  K+DRRN+LLGLGGLYGA    G SNP A A PI  P+   CGPA +       V  +
Sbjct  60    NSGKVDRRNMLLGLGGLYGAAATFG-SNPLAFADPIMAPDLTKCGPADLPQG---AVATN  115

Query  440   CCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQ  619
             CCP    +    D+   P  + L VRPAAH  + DY+ K+  AI+ MK LP DDPR+F Q
Sbjct  116   CCPPFTKNII--DFKLPPPSTNLRVRPAAHLANKDYIAKFNKAIELMKALPDDDPRSFKQ  173

Query  620   QANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYW  790
             QA VHCAYC+GAY   G P    Q+H +WLF PFHR YLYF+E+I   LI+DP F +P+W
Sbjct  174   QAAVHCAYCDGAYDQVGFPDLDLQVHNSWLFLPFHRHYLYFFEKICGKLINDPNFAIPFW  233

Query  791   NWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAI  970
             NWD P GM +P I+ + + S LYD  R+  H+   + DL + G++ + S  ++   NL I
Sbjct  234   NWDTPDGMTIPAIYAN-KNSQLYDALRDGKHQPPSLVDLDFNGEDENLSKSKQTSTNLTI  292

Query  971   MYRQMLTNAPCPLLFFGKAIRKETGDTG-PGMGTIENVPHNSIHRWVGDPRSPHNENMGN  1147
             MYRQM++++    LF G   R   GD   PG G++E++PH  +H W GD   P+ E+MGN
Sbjct  293   MYRQMVSSSKTASLFMGSPYR--AGDEANPGGGSLESIPHGPVHIWTGDRNQPNGEDMGN  350

Query  1148  FYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVED  1327
             FYSAA DP+FY HH+N+DRMW++WKTLGG R D TD DWL + FLFYDE   LV+VKV D
Sbjct  351   FYSAARDPIFYAHHANIDRMWSVWKTLGGRRNDFTDKDWLDSAFLFYDENAELVRVKVRD  410

Query  1328  SLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasT----------SVLPATLNK  1477
             +LD+ KLGY +Q +  PW + KP  + +  L       A             V PATL+K
Sbjct  411   ALDSKKLGYVYQDVGIPWLETKPEPRLKRALSKIKKKLAVARADEHIPFAKDVFPATLDK  470

Query  1478  ITTFCVTRSPTSKTP----GKEELLDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEY  1642
             +    V R   S++      +EE+L +  +     +F++FDVFVN++DD      D+ E+
Sbjct  471   VIKVLVPRPKKSRSKKQKDAEEEILVIEGIEVKRDEFVKFDVFVNDEDDGMRATADKTEF  530

Query  1643  AGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVT  1822
             AGSF N+ H HK        ++KT    L ISELL+DL  ++DD +LVTLVP+  G  V+
Sbjct  531   AGSFVNVPHKHKH-----GKSVKT-RLRLGISELLDDLGADDDDNVLVTLVPKNKGDEVS  584

Query  1823  VNKAYTEIID  1852
             +     E  D
Sbjct  585   IKGMKIEYED  594



>ref|XP_008366047.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08584.1| polyphenol oxidase V [Malus domestica]
Length=610

 Score =   397 bits (1019),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 214/429 (50%), Positives = 270/429 (63%), Gaps = 27/429 (6%)
 Frame = +2

Query  149   IFLNPNPSRAARRGDVIKIRCAAA--SSEGRENPADSS-------LSEAKLDRRNVllgl  301
             +F NP      R  ++  + C A   SS+  +NP+ SS       LS   LDRR+VL+GL
Sbjct  33    LFENP------RHSNLQAVSCKATNNSSDQNKNPSTSSNDHDHENLSPVNLDRRHVLIGL  86

Query  302   gglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADY  481
             G LYG     G S+PFA+A P+ PP+   CG A   +     VP +CCP T         
Sbjct  87    GSLYGGVAGLG-SDPFAVAKPVSPPDLAKCGGADFPSG---AVPXNCCPPTSQKIVD---  139

Query  482   YKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQ  661
             +K PS +KL VRPAAH +D  Y+EKY  AI+ MK LP DDPR+F QQA+ HCAYC+GAY 
Sbjct  140   FKFPSPTKLRVRPAAHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADJHCAYCDGAYD  199

Query  662   LAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIF  832
               G P    QIH  WLFFPFHR+Y YF ERIL  LIDDPTF LP+WNWD P GM LP +F
Sbjct  200   QVGFPNLELQIHQXWLFFPFHRYYXYFXERILAKLIDDPTFALPFWNWDAPAGMQLPALF  259

Query  833   DDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLL  1012
              +  +SPLYD+ R  +H+   + DL + G + + S   ++  NL IMYRQM++N+  PLL
Sbjct  260   AN-PDSPLYDELRAASHQPPTLIDLDFNGTDETMSKDAQIDANLKIMYRQMVSNSKKPLL  318

Query  1013  FFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHS  1192
             FFG   R  T +  PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHS
Sbjct  319   FFGSPYRAGT-EPDPGAGSIETTPHGPVHTWTGDNTQPNFEDMGNFYSAXRDPIFFSHHS  377

Query  1193  NVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMP  1372
             N+DRMW IWK++G    DI D DWL T FLFYDE   LV+V V D+LDN KLGYT++ + 
Sbjct  378   NIDRMWNIWKSIGTKNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVE  437

Query  1373  TPWKDFKPT  1399
              PW   +PT
Sbjct  438   IPWLKSRPT  446



>gb|AEG78292.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   396 bits (1018),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 246/583 (42%), Positives = 339/583 (58%), Gaps = 60/583 (10%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+ L   P R+  R    K+ C A +++  +       +++KLDRRNVLLGLGGLYG   
Sbjct  31    QVSLLTKPKRSFAR----KVSCKATNNDQNDQ------AQSKLDRRNVLLGLGGLYGVAG  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPS  496
             +   ++PFA A PI PP+   CG A +          +CCP   + ++D      +K+P+
Sbjct  81    MG--TDPFAFAKPIAPPDVSKCGSADLPQGAEA---TNCCPPPATKIID------FKLPA  129

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              +KL +RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P
Sbjct  130   PAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFP  189

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHR+YLYF+E++L  LI+DPTF +P+WNWD+P GM LP I+ D  +
Sbjct  190   ELELQVHNSWLFFPFHRYYLYFFEKMLGKLINDPTFAMPFWNWDSPAGMPLPAIYAD-PK  248

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             SPLYDK R+  H+   + DL Y G E + S    +  NL IMYRQM++N+    LFFG  
Sbjct  249   SPLYDKFRSAKHQPPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNP  308

Query  1028  IRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDR  1204
              R   GD   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DPVFY HHSNVDR
Sbjct  309   YR--AGDEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDR  366

Query  1205  MWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWK  1384
             MW+IWKTLGG R D+ D DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW 
Sbjct  367   MWSIWKTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWL  426

Query  1385  DFKPT--------------rkrraklrskasvsasTSVLPATL-NKITTFCVTRSPTSKT  1519
               KPT                      + +S   + +  P +L +KI+T  V + P  K 
Sbjct  427   SSKPTPRRAKVALGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKIST--VVKRPKQKK  484

Query  1520  PGKEELLDLH--LAFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKD  1681
               K+   D    L  +  +F R      +    +  +L    D+ E+AGSF ++ H HK 
Sbjct  485   RSKKGQRDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKH  544

Query  1682  TSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGG  1810
                  N+ ++     L +++LLE++  E+DD ++VTLVP+ G 
Sbjct  545   KKKI-NTILR-----LGLTDLLEEIEAEDDDSVVVTLVPKYGA  581



>gb|ADF59059.2| polyphenol oxidase V [Pyrus x bretschneideri]
Length=605

 Score =   397 bits (1019),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 244/585 (42%), Positives = 332/585 (57%), Gaps = 41/585 (7%)
 Frame = +2

Query  173   RAARRGDVIKIRCAAASSEGRENPADSSLSE---------AKLDRRNVllglgglygayn  325
             R  R  ++  + C A ++   +N   S+ S            LDRRNVL+GLGGLYG   
Sbjct  35    RNPRHSNLQAVSCKATNNSSDQNKNHSTSSNDHDNENPSPVNLDRRNVLIGLGGLYGGVA  94

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
               G S+ FALA P+ PP+   CGPA + +     +P +CCP T         +K PS  K
Sbjct  95    GLG-SDHFALAKPVSPPDIDKCGPADLPSG---ALPTNCCPPTSQKIVD---FKFPSPGK  147

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---  676
             L VRPAA ++D  Y++KY  AI+ MK LP DDPR+F QQA+VHCAYC+GAY   G P   
Sbjct  148   LRVRPAAQSVDKAYIDKYSKAIELMKALPDDDPRSFSQQADVHCAYCDGAYDEVGFPNLE  207

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              QIH  WLFFPFHR+YLYFYERIL  LI DPTF LP+WN+D P GM +P ++ +  +SPL
Sbjct  208   LQIHNCWLFFPFHRYYLYFYERILGKLIGDPTFALPFWNYDAPAGMQIPALYTN-PDSPL  266

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YDK R  +H+   + DL + G + + S+  ++  NL +MYRQM++NA   LLFFG  +R 
Sbjct  267   YDKFRAASHQPPTLIDLDFNGTDETISNDARIDANLKLMYRQMISNAKKQLLFFGAPLRA  326

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
              T +  PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDRMW I
Sbjct  327   GT-EPDPGQGSIETAPHGPVHLWTGDNTQPNIEDMGNFYSAGRDPIFFAHHSNVDRMWNI  385

Query  1217  WKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             WK+LG   KDI DPDWL   FLFYDE   LV+V+V D LDN KLGYT++ +  PW   +P
Sbjct  386   WKSLGTKNKDINDPDWLDAGFLFYDENAELVRVRVRDCLDNKKLGYTYEDVEIPWLKTRP  445

Query  1397  Trkrraklrskasvsas-------TSVLPATLN-KITTFCVTRSPTSKTPGKEELLDLHL  1552
             T +R        +   +       +   P +L  KI T         ++  ++E  +  L
Sbjct  446   TPRRTKAAGVAKAAETTSLGKLVGSKDFPVSLETKIRTVVPRPKQKKRSKKEKEDEEEIL  505

Query  1553  AFDDTQFIRfdvfvnedddvnTKELDR------VEYAGSFSNLAHVHKDTSTTANSTIKT  1714
               D  +F +      +    +  + +        E+AGSF ++ H HK+   +       
Sbjct  506   VIDGIEFDKDVAVKFDVCVNDVDDDEAPSGPIYSEFAGSFVSVPHKHKENKRSKG-----  560

Query  1715  PTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
                 L ++ELLEDL  E+D+ ++VTLVPR     V +     E +
Sbjct  561   -CLRLGLTELLEDLGAEDDESVVVTLVPRFSSQAVKIGSIKIEFL  604



>gb|ABI96945.1| putative polyphenol oxidase [Prunus mexicana]
Length=452

 Score =   391 bits (1004),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 193/356 (54%), Positives = 242/356 (68%), Gaps = 13/356 (4%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPA  523
             PFA A P+ PP+   CG A +        P +CCP   + T   D+ K+P+  KL VRPA
Sbjct  1     PFAFAKPVNPPDLSKCGAADLPTGA---TPTNCCPP--LATKIIDF-KLPAPGKLRVRPA  54

Query  524   AHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFT  694
             AH++D  Y++KY  AI+ MK LP DDPR+F QQANVHCAYC+GAY  AG P    QIH +
Sbjct  55    AHSVDQAYIDKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQIHNS  114

Query  695   WLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRN  874
             WLFFPFHR+YLYFYE+IL  LI+DPTF LP+WNWD+P GM LP +F +  +SPLYDK R 
Sbjct  115   WLFFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALFAN-PKSPLYDKFRA  173

Query  875   QAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-  1051
              +H+   + DL Y G +   S+  ++  NL IMYRQM++NA  P LFFG   R   GD  
Sbjct  174   ASHQPPTLIDLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPQLFFGNPYR--AGDEP  231

Query  1052  GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLG  1231
              PG G+IE  PH  +H W GD   P+ E+MGNFYSAA DP+F+ HHSNVDRMW+IWKTLG
Sbjct  232   DPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSNVDRMWSIWKTLG  291

Query  1232  GNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             G R DI+  DWL + FLFY+E   LV+VKV DSL++  LGY +Q++  PW   KPT
Sbjct  292   GKRTDISQSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPT  347



>gb|EPS59410.1| polyphenoloxidase [Genlisea aurea]
Length=575

 Score =   395 bits (1015),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 251/552 (45%), Positives = 332/552 (60%), Gaps = 37/552 (7%)
 Frame = +2

Query  203   IRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPF-ALASPIPPPE  379
             I C+AA S    NP D +    K+DRRN+L GLGG+          NP  A A+PI PPE
Sbjct  30    ISCSAAKSPNSSNP-DPATPLPKVDRRNILFGLGGVGLM-------NPMDAGANPIEPPE  81

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
                CG AT  N+ GKP+  +CCP     T     +K+P   K+ VR +AH +  +Y  KY
Sbjct  82    FNKCGTATNLNT-GKPLDINCCPPV---TTKIIDFKLPPVGKIRVRNSAHRVSAEYTAKY  137

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               AI+ MK LP DDPR+F QQANVHCAYCNGAY   G      Q+H +WLFFPFHRWYLY
Sbjct  138   NAAIKAMKSLPDDDPRSFKQQANVHCAYCNGAYDQPGGGKIDLQVHNSWLFFPFHRWYLY  197

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             F+E+IL SLI DP F LP+WNWDNP+GM +P IF  D  S +YD  RNQAH    V DL 
Sbjct  198   FFEKILGSLIKDPDFALPFWNWDNPKGMTIPPIF-LDSNSAIYDVNRNQAHLPPAVIDLG  256

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHN  1090
               G   +    Q V NNL IMY +ML        F GKA R+  G   PG G  E   H 
Sbjct  257   LTG---NTDPLQVVSNNLTIMYNEMLRGNSSVYDFMGKAYREGDG-PNPGPGASERGSHT  312

Query  1091  SIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT-LGGNR---KDITDP  1258
             S+H WVGD R+P  E+MGNFYSA  DP+FY HH+NVDRMW +W+  L  N+   K ITDP
Sbjct  313   SVHVWVGDTRTPSGEDMGNFYSAGRDPLFYVHHTNVDRMWVLWQYFLPSNKVPDKRITDP  372

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasv  1438
             D+L   FLFYDE   L +V V+D LDN+ LGY ++++  PW D++P  +      S+   
Sbjct  373   DFLNAAFLFYDENAQLTRVTVKDCLDNLSLGYEYERIDLPWIDYRPPPQTAKAKISRIDT  432

Query  1439  sasTSVLPATLNKITTFCVTR--SPTSKTPGKEELLDL-HLAFDDTQFIRfdvfvneddd  1609
              A T+   ATL  +    V R   P +K    +ELL L ++  D T+F++FDVF+N++D+
Sbjct  433   GAKTAT-SATLFPLKLESVVRVLVPKTKKGKADELLVLENITVDTTKFLKFDVFINDEDE  491

Query  1610  vnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVT  1789
               T ELD+  Y G+++ +   HK  + TA ++I+     L ++++ +D+ +E D+ ++VT
Sbjct  492   KPT-ELDKAAYVGTYAQVP--HKTNAGTATTSIQ-----LKLTDVYDDMNVEEDEDLIVT  543

Query  1790  LVPRAGGSFVTV  1825
             LVPR  G  VT+
Sbjct  544   LVPRHQGPGVTI  555



>gb|AAO16865.1| polyphenol oxidase [Ananas comosus]
Length=577

 Score =   395 bits (1015),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 228/501 (46%), Positives = 300/501 (60%), Gaps = 24/501 (5%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSK-LNVR  517
             A+ +PI  P+  +CGP     +   P    CCP   ST++D      +K+P  S  L VR
Sbjct  85    AVGAPIQAPDISTCGPPADLPATAPPT--DCCPPYQSTIVD------FKLPPRSDPLRVR  136

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAA ++D DYL KYK A++ MK LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H
Sbjct  137   PAAQSVDADYLAKYKKAVELMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQVH  196

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFP+HR+YLYF ERIL  LI D TF LP+WNWD P GM +P I+ D   SPLYDK 
Sbjct  197   SSWLFFPWHRFYLYFNERILGKLIGDDTFALPFWNWDAPGGMQIPAIYAD-ASSPLYDKL  255

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             RN  H+   + DL Y G + + +  Q++ +NL IMYRQ+++    P LF G A R   GD
Sbjct  256   RNAKHQPPTLVDLDYNGTDPTFTPEQQIAHNLTIMYRQVISGGKTPELFMGAAYR--AGD  313

Query  1049  T-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
                PG GT+E VPHN++H W GDP  P++E+MG FY+AA DP+F+ HH NVDRMW +W+ 
Sbjct  314   APDPGAGTLELVPHNTMHLWTGDPNQPNDEDMGTFYAAARDPIFFAHHGNVDRMWYVWRK  373

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrk  1405
             LGG  +D TDPDWL   FLFYDE   LV+VKV+D L+   L YT+Q +  PW   KPT K
Sbjct  374   LGGTHRDFTDPDWLNASFLFYDENAQLVRVKVKDCLEADALRYTYQDVDIPWISAKPTPK  433

Query  1406  rraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfd  1585
             +     + ++     +  P  L+K  +  V R  T ++ G+EE+L +     D       
Sbjct  434   KTPGGAAPSTTE---ATFPVVLDKPVSATVARPKTGRSTGEEEVLVVEGIELDKDVAVKF  490

Query  1586  vfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrle  1765
                    D      +  E+AGSF  + H HK       + IKT T  L I++LLED+  E
Sbjct  491   DVYINAPDNEGVGPEASEFAGSFVQVPHKHK-KGKKEKARIKT-TLRLGITDLLEDIGAE  548

Query  1766  nddKILVTLVPRAGGSFVTVN  1828
             +D+ +LVTLVPR G   V V 
Sbjct  549   DDESVLVTLVPRIGEGLVKVG  569



>ref|XP_006449291.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
 gb|ESR62531.1| hypothetical protein CICLE_v10014693mg [Citrus clementina]
Length=591

 Score =   395 bits (1016),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 245/572 (43%), Positives = 325/572 (57%), Gaps = 44/572 (8%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             K+ C A +    +NP+ S  S  KLDRR+VLL   G     +    S+PFA A+P+  P+
Sbjct  40    KVTCKATN---EQNPS-SKDSLNKLDRRDVLLVGLGGLYGVSNLSSSDPFAFAAPVSAPD  95

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
                CG A  +  N       CCP     T   ++   PS S L VRPAAH  DD Y+ KY
Sbjct  96    ISKCGKADTTTDN-------CCPPK--STNIINFKLPPSNSSLRVRPAAHLADDAYIAKY  146

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               AI+ MK LP+DDPR+F  QANVHCAYC+GAY   G P    QIH +WLFFPFHR+YLY
Sbjct  147   SKAIELMKALPADDPRSFMNQANVHCAYCDGAYDQVGFPNLDLQIHNSWLFFPFHRYYLY  206

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYE+IL  LIDDPTF LP+WNWD+P GM +P +F     SPLYDK RN  H+   + DL 
Sbjct  207   FYEKILGKLIDDPTFALPFWNWDSPPGMQMPPMFAK-PNSPLYDKLRNANHQPPTLLDLD  265

Query  911   YAGQETSASDFQK--VKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENV  1081
             Y   +   +  +K  + +NL IMYRQM++N     LF G   R   GD   PG G+IEN 
Sbjct  266   YNETDDDQTTTKKDQISSNLTIMYRQMVSNGKTSKLFLGSPYR--AGDEPEPGSGSIENT  323

Query  1082  PHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPD  1261
             PHN +H W GD   P+ ENMGNFYSA  DP+F+ HHSN+DRMWTIW+TLGG R + T+PD
Sbjct  324   PHNPVHLWCGDNTQPNLENMGNFYSAGRDPIFFAHHSNIDRMWTIWRTLGGKRTNFTEPD  383

Query  1262  WLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvs  1441
             WL + FLFYDE   LV+VKV D LD   LGY +Q +  PW++ KP+ +  AK R   +  
Sbjct  384   WLDSAFLFYDENANLVRVKVRDCLDTKNLGYVYQDVEIPWQNSKPSPRNLAKKRVAKAFG  443

Query  1442  asTS-----------VLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdv  1588
              + +           V P  L+++ +  V R   S++  ++E  +  L  D+ +F R   
Sbjct  444   VAQAAELKRKLIPRNVFPIVLDRVISTVVPRPKKSRSKKEKEEEEEVLVVDNIEFERDAR  503

Query  1589  fvnedddvnTKEL-----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelled  1753
                +      ++      D  E+AGSF N+ H HK       S        L +++LLED
Sbjct  504   VKFDVYINEDEDGMPIGPDNSEFAGSFVNVPHKHKHGKKMKTS------LRLGLTDLLED  557

Query  1754  lrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
             L  E+DD ++VTLVP+ G     +     + +
Sbjct  558   LGAEDDDSVVVTLVPKFGKGLARIGGIKIDFV  589



>gb|ABI96929.1| putative polyphenol oxidase [Chamaebatiaria millefolium]
Length=453

 Score =   390 bits (1002),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 192/358 (54%), Positives = 239/358 (67%), Gaps = 18/358 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +        P +CCP   + ++D      +K+P+ ++L V
Sbjct  1     PFAFAKPVAPPDVSKCGAADLPTGAE---PMNCCPPPATKIID------FKLPAPTRLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAH +D  Y++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    QI
Sbjct  52    RPAAHTVDQAYIDKYTKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQI  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYFYE+IL  LI+DPTF LP+WNWD+P GM LP IF +   SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPAIFAN-PNSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              RN  H+   + DL Y G +   S+  ++  NL IMYRQM++NA  PLLF       +  
Sbjct  171   LRNANHQPPNLVDLDYNGTDEKVSNETQINANLKIMYRQMVSNAKNPLLFLNPYRAGDEP  230

Query  1046  DTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
             D  PG G+IE  PH  IH W GD   P+ E+MGNFYSA  DP+FY HHSNVDRMW IWKT
Sbjct  231   D--PGGGSIEGTPHGPIHLWTGDNTQPNFEDMGNFYSAGRDPIFYSHHSNVDRMWAIWKT  288

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             LGG R DITD DWL + FLFY+E   LV+VKV DSL++  LGY +Q++  PW D KPT
Sbjct  289   LGGKRTDITDKDWLDSGFLFYNENAELVRVKVRDSLESKNLGYVYQEVDIPWLDSKPT  346



>gb|ABI96931.1| putative polyphenol oxidase [Exochorda racemosa]
Length=459

 Score =   390 bits (1002),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 195/362 (54%), Positives = 241/362 (67%), Gaps = 22/362 (6%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +        P +CCP   + ++D      +++P+ + L V
Sbjct  1     PFAFAKPVLPPDVSKCGAADLPTGAE---PMNCCPPPATKIID------FRLPAPNSLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA++  Y++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QI
Sbjct  52    RPAAHAVNKAYIDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQIGFPDLELQI  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL  LI+DPTF LPYWNWD P GM +P IF D   SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFFEKILGKLINDPTFALPYWNWDAPAGMQIPAIFAD-PRSPLYDK  170

Query  866   KRNQAHR---RGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
              RN  H+      + DL + G + + S    V  NL IMYRQM++NA  PLLFFG   R 
Sbjct  171   LRNANHQPTSAANLIDLDFNGTDENISKQATVNANLKIMYRQMVSNAKNPLLFFGNPYR-  229

Query  1037  ETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWT  1213
               GD   PG G+IEN+PH  IH W GD   P+ ENMGNFYSA  DP+FY HHSNVDRMW 
Sbjct  230   -AGDEPDPGGGSIENIPHGPIHIWTGDNTQPNLENMGNFYSAGKDPIFYSHHSNVDRMWN  288

Query  1214  IWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             IWKTLGG R D+TD DWL + FLFY+E   LV+VKV+DSLD+ KLGY +Q +  PW + K
Sbjct  289   IWKTLGGKRTDLTDSDWLNSGFLFYNENAELVRVKVKDSLDSKKLGYVYQDVDIPWLESK  348

Query  1394  PT  1399
             P 
Sbjct  349   PV  350



>gb|AAK56323.1|AF380300_1 polyphenol oxidase 2 precursor [Malus domestica]
Length=586

 Score =   394 bits (1013),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 245/567 (43%), Positives = 323/567 (57%), Gaps = 46/567 (8%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC A  ++G  +  D  L  A+LDRRN+L+GLG            N FA A+P+  P+
Sbjct  48    RVRCKA--TKGDNDNLDQGL--ARLDRRNMLIGLGTGGLYSAA---GNSFAFAAPVSAPD  100

Query  380   TKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDD--  544
               +CGPA     +G  +   CCP   +T++D      +K+P    L  R AA  +  +  
Sbjct  101   LTTCGPA--DKPDGSTI--DCCPPITTTIID------FKLPDRGPLRTRIAAQDVAKNPA  150

Query  545   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFH  715
             YL KYK AI+ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+HF WLFFPFH
Sbjct  151   YLAKYKKAIELMRALPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFH  210

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             RWYLYFYE+I+  LI DPTF LP+WN D P GM +PEIF D   S LYD+ RN AH+   
Sbjct  211   RWYLYFYEKIMGELIGDPTFALPFWNRDAPAGMYIPEIFTDTSSS-LYDQNRNTAHQPPK  269

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTI  1072
             + DL Y G +    D  ++K NL  MY+QM++ A    LF+G+      GD   PG G I
Sbjct  270   LLDLNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPY--SAGDEPDPGAGNI  327

Query  1073  ENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK-TLGGNRKDI  1249
             E  PHN+IH WVGDP   + E+MG FYSA  DP+FY HHSNVDRMW+I+K  LGG   DI
Sbjct  328   ETTPHNNIHLWVGDPTQTNGEDMGTFYSAGRDPLFYSHHSNVDRMWSIYKDKLGGT--DI  385

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrs  1426
              + DWL  EFLFYDE K LV+VKV DSLD  KLGY + +K+P PW   KPT   R     
Sbjct  386   ENTDWLDAEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTLVSRRIRER  445

Query  1427  kasvsasTSVLPATLNKITTFCVTR-SPTSKTPGKEELLDLHLAFDDTQFIRfdvfvned  1603
                +   T+  PATL+   +  VTR S T +T  +++  D  L     +F   +    + 
Sbjct  446   PQFIFDLTTTFPATLSDTISVEVTRPSATKRTAAQKKAHDEVLVIKGIEFAGNEPVKFDV  505

Query  1604  ddvnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlend  1771
                +  E     D+ E+AGSF ++ H HK         IKT    L+I  LLE+L  E D
Sbjct  506   YVNDDAESLAGKDKSEFAGSFVHVPHKHK-------KNIKT-NLRLSIMSLLEELDAETD  557

Query  1772  dKILVTLVPRAGGSFVTVNKAYTEIID  1852
               ++VTLVP+ G   +T+     E+I+
Sbjct  558   SSLVVTLVPKVGKGPITIGGFSIELIN  584



>gb|AFO55217.1| chloroplast polyphenol oxidase I [Eriobotrya japonica]
Length=593

 Score =   394 bits (1013),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 245/583 (42%), Positives = 338/583 (58%), Gaps = 60/583 (10%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+ L   P R+  R    K+ C A +++  +       +++KLDRRNVLLGLGG+YG   
Sbjct  31    QVSLLTKPKRSFAR----KVSCKATNNDQNDQ------AQSKLDRRNVLLGLGGIYGVAG  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPS  496
             +   ++PFA A PI PP+   CG A +          +CCP   + ++D      +K+P+
Sbjct  81    MG--TDPFAFAKPIAPPDVSKCGSADLPPGAEA---TNCCPPPATKIID------FKLPA  129

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              +KL +RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P
Sbjct  130   PAKLRIRPPAHAVDQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFP  189

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ +  +
Sbjct  190   ELELQVHNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYAN-PK  248

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             SPLYDK R+  H+   + DL Y G E + S    +  NL IMYRQM++N+    LFFG  
Sbjct  249   SPLYDKFRSAKHQPPTLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNARLFFGNP  308

Query  1028  IRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDR  1204
              R   GD   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DPVFY HHSNVDR
Sbjct  309   YR--AGDEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDR  366

Query  1205  MWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWK  1384
             MW IWKTLGG R D+TD DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW 
Sbjct  367   MWNIWKTLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYGYQDVDIPWL  426

Query  1385  DFKPT--------------rkrraklrskasvsasTSVLPATL-NKITTFCVTRSPTSKT  1519
               KPT                      + +S   + +  P +L +KI+T  V + P  K 
Sbjct  427   SSKPTPRRAKVALSKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKIST--VVKRPQQKK  484

Query  1520  PGKEELLDLH--LAFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKD  1681
               K+   D    L  +  +F R      +    +  +L    D+ E+AGSF ++ H HK 
Sbjct  485   RSKKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKH  544

Query  1682  TSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGG  1810
                  N+ ++     L +++LL ++  E+DD ++VTLVP+ G 
Sbjct  545   KKKI-NTILR-----LGLTDLLGEIEAEDDDSVVVTLVPKYGA  581



>gb|AAK13244.1| polyphenol oxidase [Trifolium pratense]
Length=599

 Score =   394 bits (1013),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 223/519 (43%), Positives = 303/519 (58%), Gaps = 28/519 (5%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             +N  A  +P+P P+   C    +   +G PVP +CCP    D      +K PSF KL VR
Sbjct  89    NNSLAFGAPVPIPDLTKC----VIPPSGAPVPINCCPPFSKDIID---FKYPSFEKLRVR  141

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAA  +DDDY  KY  A++ M+ LP DDPR+F QQA +HCAYC G Y+  G P     +H
Sbjct  142   PAAQLVDDDYFAKYNKALELMRALPDDDPRSFSQQAKIHCAYCVGGYKQLGYPEIELSVH  201

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLF  FHRWY+YFYERIL SLI+DPTF +P+WN+D P GM +P IF +   S LYD K
Sbjct  202   NSWLFLAFHRWYIYFYERILGSLINDPTFAIPFWNFDAPDGMQIPSIFTNPNSS-LYDLK  260

Query  869   RNQAHRRGYVTDLAY------AGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAI  1030
             R+  H+   + DL Y       G     S  Q++K+NL +M++QM+TN+   +LF G   
Sbjct  261   RDSRHQPPRIIDLNYNKDTEDPGPNYPPSAEQQIKDNLTLMHKQMITNSKTCILFHGSPY  320

Query  1031  RKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMW  1210
             R      G G G +E  PHN++H W GD + P+ E+MGNFYS+  DP+FY  H+NVDR+W
Sbjct  321   RAGQA-PGKGHGALEMSPHNNVHIWSGDAKQPYREDMGNFYSSGRDPLFYALHANVDRLW  379

Query  1211  TIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDF  1390
             +IWKTLGG RKD TD DWL++EFLFYDE K LVKVKV+D LD  KLGY +QK+  PW + 
Sbjct  380   SIWKTLGGKRKDPTDDDWLESEFLFYDENKNLVKVKVKDGLDGKKLGYDYQKVDIPWINS  439

Query  1391  KPTrkrraklrskasvsasTSV--LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDD  1564
             KP    R        ++    V   P  L+ + +  V R   S++  ++E  +  L  D 
Sbjct  440   KPKPASRRVQSKGKLLTPRKFVDKFPIVLDSVVSTIVKRPKKSRSSKEKEDEEEILVIDG  499

Query  1565  TQFIRfdvfvnedddvnTKELDRV------EYAGSFSNLAHVHKDTSTTANSTIKTPTFS  1726
              +F        + D +   E D+V      E+AG+F NL H H   ++T           
Sbjct  500   IEF--DSNIEVKFDVIVNDEDDKVIGVGNTEFAGTFVNLLHGHNHENSTNKKKNIVTCMR  557

Query  1727  LAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTE  1843
             L +++LLEDL+ ++DD ILVT +PR GG  V ++    E
Sbjct  558   LGLTDLLEDLKADDDDSILVTFIPRYGGDSVKISGIKIE  596



>ref|XP_008364152.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
 gb|AFI08583.1| polyphenol oxidase IVa [Malus domestica]
Length=587

 Score =   394 bits (1012),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 245/568 (43%), Positives = 325/568 (57%), Gaps = 47/568 (8%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC A  ++G  +  D  L  A+LDRRN+L+GLG            N FA A+P+  P+
Sbjct  48    RVRCKA--TKGDNDNLDQGL--ARLDRRNMLIGLGTGGLYSAA---GNSFAFAAPVSAPD  100

Query  380   TKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDD--  544
               +CGPA     +G  +   CCP   +T++D      +K+P    L  R AA  +  +  
Sbjct  101   LTTCGPA--DKPDGSTI--DCCPPITTTIID------FKLPDRGPLRTRIAAQDVAKNPA  150

Query  545   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFH  715
             YL KYK AI+ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+HF WLFFPFH
Sbjct  151   YLAKYKKAIELMRALPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFH  210

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             RWYLYFYE+I+  LI DPTF LP+WNWD P GM +PEIF +   S LYD+ RN AH+   
Sbjct  211   RWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTBTSSS-LYDQNRNTAHQPPK  269

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTI  1072
             + DL Y G +    D  ++K NL  MY+QM++ A    LF+G+      GD   PG G I
Sbjct  270   LLDLNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPY--SAGDEPDPGAGNI  327

Query  1073  ENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK-TLGGNRKDI  1249
             E  PHN+IH WVGDP   + E+MG FYSA  DP+FY HHSNVDRMW+I+K  LGG   DI
Sbjct  328   ETTPHNNIHLWVGDPTQTNGEDMGTFYSAGRDPLFYSHHSNVDRMWSIYKDKLGGT--DI  385

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrs  1426
                DWL   FLFYDE K LV+VKV DSLD  KLGY + +K+P PW   KPT ++    R 
Sbjct  386   EXTDWLDAXFLFYDEKKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTARKSTNKRK  445

Query  1427  kasvsa-sTSVLPATLNKITTFCVTR-SPTSKTPGKEELLDLHLAFDDTQFIRfdvfvne  1600
                 S+  T+  PATL+   +  VTR S T +T  +++  D  L     +F   +    +
Sbjct  446   ATVSSSDLTTTFPATLSDTISVEVTRPSATKRTAAQKKAXDEVLVIKGIEFAGNEPVKFD  505

Query  1601  dddvnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlen  1768
                 +  E     D+ E+AGSF ++ H HK         IKT    L+I  LLE+L  E 
Sbjct  506   VYVNDDAESLAGKDKSEFAGSFVHVPHKHK-------KNIKT-NLRLSIMSLLEELDAET  557

Query  1769  ddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             D  ++VTLVP+ G   +T+     E+I+
Sbjct  558   DXSLVVTLVPKVGKGPITIGGFSIELIN  585



>gb|AES87890.2| polyphenoloxidase [Medicago truncatula]
Length=606

 Score =   395 bits (1014),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 239/534 (45%), Positives = 315/534 (59%), Gaps = 45/534 (8%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             +NPFALASPI PP+   C  + IS+     +   CCP     T   DY   P    L VR
Sbjct  85    TNPFALASPISPPDLSKCRSSHISSG---AIDIDCCPPK--STKIIDYKFPPLTQPLRVR  139

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
              AAH ++D+YL+KYK AI+ MK LPS+DPR+F QQANVHCAYC+GAY   G P    Q+H
Sbjct  140   QAAHLVNDEYLQKYKKAIELMKALPSNDPRSFMQQANVHCAYCDGAYSQVGFPNLDLQVH  199

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFPFHRWYLYFYERIL SLI+DPTF LP+WN+D P GM  P I+ D   SPLYDK 
Sbjct  200   GSWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMRFPSIYTD-PTSPLYDKL  258

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQK--VKNNLAIMYRQMLTNAPCPLLFFGKAIRKET  1042
             RN  H+   + D  Y   +    D +   +  NL IMYRQ+++      LF G   R   
Sbjct  259   RNAKHQPPTLIDFNYGHCDDIDEDGENNIIHTNLTIMYRQVVSRGKNSRLFLGYPYR--A  316

Query  1043  GDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             G      G++E VPHN++H W GD R P++ENMG FYSAA DPVF+ HHSN+DR+W+IWK
Sbjct  317   GGVPKCAGSVEIVPHNTVHNWSGDTRQPNHENMGTFYSAARDPVFFSHHSNIDRLWSIWK  376

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTr  1402
             TLGG RKD  D DWL++EFLFYDE K LVKV V+D LD  KLGY +Q +  PW + KPT 
Sbjct  377   TLGGKRKDFYDKDWLESEFLFYDENKNLVKVNVKDCLDTQKLGYVYQDVFIPWLNAKPTP  436

Query  1403  krraklrskasvsasTSV--------------------LPATLNKITTFCV-----TRSP  1507
              ++ + + + +   S                        P  L+ I +  V     +RS 
Sbjct  437   CKKIQKKVEVAQGNSFGTGKARLSEINENLTNSRNDVKFPLVLDNIVSTIVRRPKKSRSK  496

Query  1508  TSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAH-VHKDT  1684
             T K   +E L+   + FD +  ++FDVF+N++D    K ++  E+AGSF N+ H  H   
Sbjct  497   TEKEEEEEVLVIEGIEFDKSLGVKFDVFINDEDAKEIKPVN-TEFAGSFVNVPHSSHDHK  555

Query  1685  STTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
                 NS ++     + +++LL+DL  E+DD I+VTLVPR     V +     E+
Sbjct  556   KKKTNSCLR-----VGLTDLLKDLGAEDDDSIVVTLVPRYRKGLVKITNIKIEL  604



>gb|ACM09905.1| polyphenol oxidase 1/4 [Trifolium pratense]
Length=605

 Score =   395 bits (1014),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 228/528 (43%), Positives = 318/528 (60%), Gaps = 33/528 (6%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPV---PYSCCPSTLMDTASADYYKIPSFSKL  508
             +N  A  +P+P P+  SC    I   +   +   P SCCP    D      +K P+F KL
Sbjct  88    NNSLAFGAPVPIPDLTSCVVPPIELPDDMKIINPPLSCCPPFSSDIID---FKFPTFKKL  144

Query  509   NVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAG--KPYQ  682
              VRPAA  ++DDY  KY  A++ M+ LP+DDPR+FYQQAN+HCAYC G Y   G     Q
Sbjct  145   RVRPAAQLVNDDYFAKYNKALELMRALPNDDPRSFYQQANIHCAYCVGGYTQKGYDAELQ  204

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLF PFHRWYLYFYERIL SLI+DPTF +P+WNWD P GM +P IF +   S LYD
Sbjct  205   VHNSWLFLPFHRWYLYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPNSS-LYD  263

Query  863   KKRNQAHRRGYVTDLAYAGQE----TSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAI  1030
              +RN +H+   + DL Y        T+ S  +++K NL  M++QM++N+     F G   
Sbjct  264   PRRNPSHQPPTIVDLNYNKANDNPATNPSAEEQIKINLTWMHKQMISNSKTNRQFLGSPY  323

Query  1031  RKETGDTG-PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRM  1207
             R   GDT   G G++EN+PH  IH W GDPR PH E+MG+FY+A  DP+FY HH+NVDRM
Sbjct  324   R--GGDTPFKGAGSLENIPHTPIHIWTGDPRQPHGEDMGHFYAAGRDPLFYAHHANVDRM  381

Query  1208  WTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKD  1387
             W++WKTLG  RKD TDPDWL++EFLFYDE K LVKVKV+DS ++ KLGY +Q +  PW  
Sbjct  382   WSVWKTLGKKRKDFTDPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDVDIPWIK  441

Query  1388  F--KPTrkrraklrskasvsasTSVL----PATLNKITTFCVTRSPTSKTPGKEELLDLH  1549
             +  KP+R+ ++K ++K+S    +  L    P  L+ I +  V R   S+   ++E  +  
Sbjct  442   YKSKPSRRVKSKDKNKSSAQRPSKKLVDKFPIVLDSIVSIIVKRPKKSRNSKEKEDEEEI  501

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRV------EYAGSFSNLAHVHKDTSTTANSTIK  1711
             L  D  ++   +    + D +   E D+V      E+AG++ ++ HVH            
Sbjct  502   LVIDGIEY--DNKTEVKFDVIVNDEDDKVIGGENTEFAGTYVSVLHVHDHGKNKKKKNNN  559

Query  1712  TPT-FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
               T   L +++LLEDL+ ++DD I+VTL+PR G   V ++    E+ D
Sbjct  560   IVTCLRLGLTDLLEDLKADDDDSIVVTLIPRYG--LVKISGIKIELED  605



>ref|XP_008371330.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Malus domestica]
Length=587

 Score =   394 bits (1012),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 245/568 (43%), Positives = 325/568 (57%), Gaps = 47/568 (8%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC A  ++G  +  D  L  A+LDRRN+L+GLG            N FA A+P+  P+
Sbjct  48    RVRCKA--TKGDNDNLDQGL--ARLDRRNMLIGLGTGGLYSAA---GNSFAFAAPVSAPD  100

Query  380   TKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDD--  544
               +CGPA     +G  +   CCP   +T++D      +K+P    L  R AA  +  +  
Sbjct  101   LTTCGPA--DKPDGSTI--DCCPPITTTIID------FKLPDRGPLRTRIAAQDVAKNPA  150

Query  545   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFH  715
             YL KYK AI+ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+HF WLFFPFH
Sbjct  151   YLAKYKKAIELMRALPDDDPRSLVQQAKVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFH  210

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             RWYLYFYE+I+  LI DPTF LP+WNWD P GM +PEIF +   S LYD+ RN AH+   
Sbjct  211   RWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTBTSSS-LYDQNRNTAHQPPK  269

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTI  1072
             + DL Y G +    D  ++K NL  MY+QM++ A    LF+G+      GD   PG G I
Sbjct  270   LLDLNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPY--SAGDEPDPGAGNI  327

Query  1073  ENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK-TLGGNRKDI  1249
             E  PHN+IH WVGDP   + E+MG FYSA  DP+ Y HHSNVDRMW+I+K  LGG   DI
Sbjct  328   ETTPHNNIHLWVGDPTQTNGEDMGTFYSAGRDPLXYSHHSNVDRMWSIYKDKLGGT--DI  385

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrs  1426
                DWL  EFLFYDE K LV+VKV DSLD  KLGY + +K+P PW   KPT ++    R 
Sbjct  386   EXTDWLDAEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDEKVPIPWLKSKPTARKSTNKRK  445

Query  1427  kasvsa-sTSVLPATLNKITTFCVTR-SPTSKTPGKEELLDLHLAFDDTQFIRfdvfvne  1600
                 S+  T+  PATL+   +  VTR S T +T  +++  D  L     +F   +    +
Sbjct  446   ATVSSSDLTTTFPATLSDTISVEVTRPSATKRTAAQKKAXDEVLVIKGIEFAGNEPVKFD  505

Query  1601  dddvnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlen  1768
                 +  E     D+ E+AGSF ++ H HK         IKT    L+I  LLE+L  E 
Sbjct  506   VYVNDDAESLAGKDKSEFAGSFVHVPHKHK-------KNIKT-NLRLSIMSLLEELDAET  557

Query  1769  ddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             D  ++VTLVP+ G   +T+     E+I+
Sbjct  558   DSSLVVTLVPKVGKGPITIGGFSIELIN  585



>ref|XP_008225000.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   394 bits (1011),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 247/565 (44%), Positives = 324/565 (57%), Gaps = 40/565 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC A  + G  +  +  LS  +LDRRN+L+GLG           +NPFA A+PI  P+
Sbjct  48    RVRCKA--TNGGNDHLEQGLS--RLDRRNMLIGLGAGGLYGATGLENNPFASAAPISAPD  103

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD--YLE  553
                CGPA     +G  +   CCP T   T +   +K+P    L  R AA  +  D  YL 
Sbjct  104   LTQCGPA--DKPDGSTI--DCCPPT---TTTIIDFKLPDKGPLRTRLAAQDVAKDPVYLA  156

Query  554   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWY  724
             KYK AI  M+ LP DDPR+F QQA VHC YC+  Y   G P    Q+HF WLFFPFHRWY
Sbjct  157   KYKKAIALMRALPDDDPRSFTQQAMVHCTYCDDGYPQVGYPNLEIQVHFCWLFFPFHRWY  216

Query  725   LYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTD  904
             LYF+E+I+  LI DPTF +P+WNWD P GM LPEIF  D  SPLYD+ RN AH+   + D
Sbjct  217   LYFFEKIMGELIGDPTFAIPFWNWDAPVGMYLPEIF-TDTTSPLYDQYRNAAHQPPKLLD  275

Query  905   LAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD-TGPGMGTIENV  1081
             L Y G +    D  ++K NL  MY+QM++ A    LF+G+      GD + PG G IEN 
Sbjct  276   LNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPY--SAGDASSPGAGNIENT  333

Query  1082  PHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT-LGGNRKDITDP  1258
             PHN+IH W GDP   + E+MG FYSA  DPVF+ HHSNVDRMW+I+K+ LGG   DI   
Sbjct  334   PHNNIHLWTGDPTQKNGEDMGAFYSAGRDPVFFAHHSNVDRMWSIYKSKLGGT--DIKKT  391

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrskas  1435
             DWL  EFLFYDE K L++VKV DSLD  KLGY +  K+  PW  +KPT ++ +  R    
Sbjct  392   DWLDAEFLFYDEKKNLMRVKVRDSLDTTKLGYVYDDKVEIPWLTYKPTARKSSNKRKATV  451

Query  1436  vsa-sTSVLPATLNKITTFCVTRSPTSK-TPGKEELLDLHLAFDDTQFIRfdvfvneddd  1609
              SA  T+  PATL    +  V R+ T K T  +++  D  L     ++        +   
Sbjct  452   SSADLTTNFPATLTDTISVEVARTSTKKRTSAQKKAQDEVLVISGIKYAGNKTVKFDVYV  511

Query  1610  vnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddK  1777
              +  E     D+ E+AGSF ++ H      TT        T  L+I++LLE+L  E D  
Sbjct  512   NDDAESLAGKDKSEFAGSFVHVPHKGSKDITT--------TLRLSITKLLEELDAETDSS  563

Query  1778  ILVTLVPRAGGSFVTVNKAYTEIID  1852
             ++VTLVP+ G   VT+    TE+I+
Sbjct  564   VVVTLVPKFGT--VTIGGFSTELIN  586



>gb|ABI96938.1| putative polyphenol oxidase [Lyonothamnus floribundus]
Length=454

 Score =   389 bits (999),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/359 (54%), Positives = 244/359 (68%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +  +  KP+  +CCP   + ++D      +K+P+ S+L V
Sbjct  1     PFAFAKPVLPPDVSKCGAADLP-TGAKPM--NCCPPPATKIID------FKLPAPSRLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D  Y+EKY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QI
Sbjct  52    RPAAHAVDQAYIEKYTKAMELMKALPEDDPRSFKQQAAVHCAYCDGAYHQVGFPDLELQI  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+Y+YF+E+IL  LI+DPTF LP+WNWD+P GM LP +F +   SPLYDK
Sbjct  112   HNSWLFFPFHRYYVYFHEKILGKLINDPTFALPFWNWDSPSGMQLPGLFAN-PNSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              RN  H+   + DL Y G + + S   ++  NL IMYRQM++NA  P LFFG   R   G
Sbjct  171   FRNANHQPPNLVDLDYNGTDENVSKETQINANLKIMYRQMVSNAKHPRLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH+ IH W GD   P+ E+MGNFYSA  DP+FY HHSNVDRMW IWK
Sbjct  229   DEPDPGSGSIEGTPHSQIHLWTGDNTQPNFEDMGNFYSAGKDPIFYSHHSNVDRMWCIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R DI+D DWL + FLFY+E   LV+VKV+DSL+   LGY +Q++  PW   KPT
Sbjct  289   TLGGKRTDISDSDWLNSGFLFYNENSELVRVKVKDSLETKNLGYVYQEVDIPWLHSKPT  347



>ref|XP_009782447.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=598

 Score =   394 bits (1012),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 218/506 (43%), Positives = 308/506 (61%), Gaps = 24/506 (5%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
              +PFA A+P+P P+   CGPA +        P +CCP T  +    D+   P  + L  R
Sbjct  98    GHPFAFAAPVPGPDVSKCGPADLPPG---AAPVNCCPPTTANII--DFQLPPPSTTLRTR  152

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH+ D  Y+EK+  AIQ MK LP +DPR+F QQANVHCAYC+GAY+  G P    Q+H
Sbjct  153   PAAHSADSAYIEKFNRAIQLMKQLPDNDPRSFKQQANVHCAYCDGAYEQLGFPSSELQVH  212

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLFFPFHR YLYF+E+IL SLI+DPTF +P+WNWD+P GM LP ++ +   S L+D  
Sbjct  213   SSWLFFPFHRCYLYFFEKILGSLINDPTFAIPFWNWDHPDGMRLPAMYAN-RSSSLFDPL  271

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             R+Q H+   + DL + G + + S+ Q+   NL IMYRQM++    P  F G   R   G+
Sbjct  272   RDQKHQPPVIVDLDFNGADPNISNAQQTSQNLTIMYRQMVSLGSTPAAFLGDPYRA-GGE  330

Query  1049  TGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL  1228
              G G G++EN+PH ++H W GD   P+ ENMG FY+A  DP+FY HHSN+DR+W++WKTL
Sbjct  331   PG-GAGSLENIPHGTVHVWTGDRTQPNFENMGVFYAAGRDPIFYAHHSNIDRLWSVWKTL  389

Query  1229  GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkr  1408
             GG R+D TDPD+L + FLFYDE   +V+++V D LD  +LGY +Q +  PW + +P  + 
Sbjct  390   GGRRQDFTDPDFLNSSFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGVVNPWINSRPRARV  449

Query  1409  raklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEE-------LLDLHLAFDDT  1567
              + L S   ++ +    P  L+ +    V R P +K   KEE       L+   +  +  
Sbjct  450   SSALSSVRRLAEAKDYFPTKLDHVIRVMVKR-PNNKKRNKEEKDAKEEFLVVEGIELETD  508

Query  1568  QFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISell  1747
              F++FDV +N++D+      +  E+AGSF N+ H+    S     T       LAI+ELL
Sbjct  509   VFVKFDVLINDEDETVISP-NNAEFAGSFVNVPHLSHGKSDEKRKT----KLKLAITELL  563

Query  1748  edlrlenddKILVTLVPRAGGSFVTV  1825
             EDL  E+DD ++VT VP+ G   V +
Sbjct  564   EDLDAEDDDHVVVTFVPKNGSGAVKI  589



>gb|ABI96943.1| putative polyphenol oxidase [Prinsepia sinensis]
Length=457

 Score =   389 bits (1000),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/359 (54%), Positives = 238/359 (66%), Gaps = 16/359 (4%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPA  523
             PFA A P+ PP+   CG A +        P +CCP     T     +++P+ S L VRPA
Sbjct  1     PFAFAKPVLPPDVSKCGAADLPTGAE---PMNCCPPP---TTKIIDFRLPAPSGLRVRPA  54

Query  524   AHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFT  694
             AHA+D  Y++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QIH +
Sbjct  55    AHAVDKAYIDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLELQIHNS  114

Query  695   WLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRN  874
             WLFFPFHR+YLYF+E+IL  LI+DPTF LP+WNWD P GM +P IF D  +SPLYDK RN
Sbjct  115   WLFFPFHRYYLYFFEKILGKLINDPTFALPFWNWDAPAGMQIPAIFAD-PKSPLYDKLRN  173

Query  875   QAHR---RGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
               H+      + D  Y G + + S    +  NL IMYRQM++N+  PLLFFG   R   G
Sbjct  174   ANHQPTSAANLIDHDYNGTDENISKQATINANLKIMYRQMVSNSKNPLLFFGNPYR--AG  231

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IEN+PH  IH W GD   P+ ENMGNFYSA  DP+FY HHSNVDRMW IWK
Sbjct  232   DEPDPGGGSIENIPHGPIHIWTGDNTQPNLENMGNFYSAGKDPIFYSHHSNVDRMWNIWK  291

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R D+TD DWL + FLFY+E   LV+VKV+DSLD+ KLGY +Q +  PW + KP 
Sbjct  292   TLGGKRTDLTDSDWLNSGFLFYNENAELVRVKVKDSLDSKKLGYVYQDVDIPWLESKPV  350



>gb|AAK13242.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   394 bits (1013),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 228/526 (43%), Positives = 316/526 (60%), Gaps = 33/526 (6%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCG------PATISNSNGKPVPYSCCPSTLMDTASADYYKIPSF  499
             +N  A  +P+P P+  SC       P  I N +    P SCCP    D      +K P+F
Sbjct  88    NNSLAFGAPVPIPDLTSCVVPPIELPDDIKNIDP---PISCCPPFSSDIID---FKFPTF  141

Query  500   SKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAG--K  673
             +KL VRPAA  ++DDY  KY  A++ M+ LP DDPR+FYQQAN+HCAYC G Y   G   
Sbjct  142   NKLRVRPAAQLVNDDYFAKYNKALELMRALPDDDPRSFYQQANIHCAYCVGGYTQKGYDV  201

Query  674   PYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESP  853
               Q+H +WLF PFHRWYLYFYERIL SLI+DPTF +P+WNWD P GM +P IF +   S 
Sbjct  202   ELQVHNSWLFLPFHRWYLYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPNSS-  260

Query  854   LYDKKRNQAHRRGYVTDLAYAGQE----TSASDFQKVKNNLAIMYRQMLTNAPCPLLFFG  1021
             LYD +RN  H+   + DL Y        T+ S  +++K NL  M++QM++N+  P  F G
Sbjct  261   LYDPRRNPTHQPPTIVDLNYNKANDNPATNPSAEEQIKINLTWMHKQMISNSKTPRQFLG  320

Query  1022  KAIRKETGDTG-PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNV  1198
                R   GDT   G G++EN+PH  IH W GDPR PH E+MG+F++A  DP+FY HH+NV
Sbjct  321   SPYR--GGDTPFKGAGSLENIPHTPIHIWTGDPRQPHGEDMGHFWAAGRDPLFYAHHANV  378

Query  1199  DRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTP  1378
             DRMW++WKTLG  RKD TDPDWL++EFLFYDE K LVKVKV+DS ++ KLGY +Q +  P
Sbjct  379   DRMWSVWKTLGKKRKDFTDPDWLESEFLFYDENKNLVKVKVKDSANDRKLGYVYQDVDIP  438

Query  1379  WKDF--KPTrkrraklrskasvsasTSVL----PATLNKITTFCVTRSPTSKTPGKEELL  1540
             W  +  KP+R+ ++K ++K+S    +  L    P  L+ + +  V R   S+   ++E  
Sbjct  439   WIKYKSKPSRRVKSKDKNKSSAQRPSRKLVDKFPIVLDSVVSIIVKRPKKSRNSKEKEDE  498

Query  1541  DLHLAFDDTQFIRfdvfv--nedddvnTKEL--DRVEYAGSFSNLAHVHKDTSTTANSTI  1708
             +  L  D  ++            +D + KE+  +  E+AGS+ ++ HVH           
Sbjct  499   EEILVIDGIEYDNKTEVKFDVIVNDEDDKEIGGENTEFAGSYVSVLHVHDHGKNKKKKNN  558

Query  1709  KTPT-FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTE  1843
                T   L +++LLEDL+ ++DD I+VTL+PR G   ++  K   E
Sbjct  559   NIVTCLRLGLTDLLEDLKADDDDSIVVTLIPRYGNVKISGIKIELE  604



>ref|XP_009414395.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=590

 Score =   394 bits (1011),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 245/558 (44%), Positives = 323/558 (58%), Gaps = 27/558 (5%)
 Frame = +2

Query  182   RRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALAS  361
             RR    KI C A+             + AKLDRR+VL+GLGGL GA    G     AL +
Sbjct  41    RRHAHSKISCKASDEH-------EMTANAKLDRRDVLVGLGGLCGAAAGLGIDGK-ALGN  92

Query  362   PIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDD  541
             PI  P+   CGPA +        P +CCP    D    D+ + P+ S L VRPAAH +D 
Sbjct  93    PIQAPDLTKCGPADLPKG---ATPTNCCPPYFPDKKIIDFKRPPNSSPLRVRPAAHLVDS  149

Query  542   DYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPF  712
             DYL+KYK A++ M+ LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +WLFFP+
Sbjct  150   DYLDKYKKAVELMRALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPW  209

Query  713   HRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRG  892
             HR+YLYF+ERIL  LI D TF LP+WNWD P GM LP I+ D   S LYDK R+  H+  
Sbjct  210   HRFYLYFHERILGKLIGDDTFALPFWNWDAPGGMKLPSIYADPSSS-LYDKFRDAKHQPP  268

Query  893   YVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGT  1069
              + DL Y G + S +D +++  NL IMYRQ+++N   PLLF G A R   GD   PG G+
Sbjct  269   VLVDLDYNGTDPSFTDAEQIDQNLKIMYRQVISNGKTPLLFLGSAYR--AGDNPNPGAGS  326

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDI  1249
             +EN+PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDRMW +WK LGG  +D 
Sbjct  327   LENIPHGPVHGWTGDRNQPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKKLGGKHQDF  386

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrsk  1429
              D DWL T FLFYDE   LV+V ++D L    L Y +Q +  PW   +PT K     ++ 
Sbjct  387   NDKDWLNTTFLFYDENADLVRVTLKDCLQPEWLRYDYQDVEIPWLKTRPTPKALKAQKTA  446

Query  1430  asvsasTSV--LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvned  1603
             A    +T+    P TL    +  V R   S++  ++E  +  L  +  +F R      + 
Sbjct  447   AKTLKATAETPFPVTLQSAVSTTVRRPKVSRSGKEKEEEEEVLIVEGIEFDRDYFIKFDV  506

Query  1604  ddvnTKELDRV----EYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlend  1771
                 T+         E+AGSF N+ H HK +        +     L I++LLED+  E+D
Sbjct  507   FVNATEGEGITPGASEFAGSFVNVPHKHKHSKKEKKLKTR---LCLGITDLLEDIGAEDD  563

Query  1772  dKILVTLVPRAGGSFVTV  1825
             D +LVT+VP+AG   V+V
Sbjct  564   DSVLVTIVPKAGKGKVSV  581



>gb|ABI96944.1| putative polyphenol oxidase [Prunus dulcis]
Length=451

 Score =   389 bits (998),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 242/359 (67%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +        P +CCP   + ++D      +K+P+  KL V
Sbjct  1     PFAFAKPLNPPDLSKCGAADLPTGA---TPTNCCPPPATKIID------FKLPAPGKLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D  Y+EKY  AI+ MK LP DDPR+F QQANVHCAYC+GAY  AG P    QI
Sbjct  52    RPAAHAVDQAYIEKYSKAIELMKALPDDDPRSFKQQANVHCAYCDGAYDQAGFPDLELQI  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYFYE+IL  LI+DPTF LP+WNWD+P GM LP +F +  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFYEKILGKLINDPTFALPFWNWDSPAGMQLPALFAN-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R  +H+   + DL Y G +   S+  ++  NL IMYRQM++NA  P LFF    R   G
Sbjct  171   FRAASHQPPTLIDLDYNGTDEKVSNESQINANLKIMYRQMVSNAKNPQLFFANPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH  +H W GD   P+ E+MGNFYSAA DP+F+ HHS+VDRMW+IWK
Sbjct  229   DEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFSHHSSVDRMWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R DI+  DWL + FLFY+E   LV+VKV DSL++  LGY +Q++  PW   KPT
Sbjct  289   TLGGKRTDISHSDWLDSGFLFYNENAELVRVKVRDSLESKSLGYVYQEVDIPWLQSKPT  347



>dbj|BAB64530.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   393 bits (1010),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 243/581 (42%), Positives = 337/581 (58%), Gaps = 56/581 (10%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+ L   P R+  R    K+ C A +++  +       +++KLDRRNVLLGLGGLYG   
Sbjct  31    QVSLLTKPKRSFAR----KVSCKATNNDQNDQ------AQSKLDRRNVLLGLGGLYGVAG  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPS  496
             +   ++PFA A PI PP+   CG A +          +CCP   + ++D      +K+P+
Sbjct  81    MG--TDPFAFAKPIAPPDVSKCGSADLPQGAEA---TNCCPPPATKIID------FKLPA  129

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              +KL +RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P
Sbjct  130   PAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFP  189

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +
Sbjct  190   ELELQVHNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYAD-PK  248

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             SPLYDK R+  H+   + DL Y G E + S    +  NL IMYRQM++N+    LFFG  
Sbjct  249   SPLYDKFRSAKHQPPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNP  308

Query  1028  IRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDR  1204
              R   GD   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DPVFY HHSNVDR
Sbjct  309   YR--AGDEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDR  366

Query  1205  MWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWK  1384
             MW+IWKTLGG R D+ D DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW 
Sbjct  367   MWSIWKTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWL  426

Query  1385  DFKPT--------------rkrraklrskasvsasTSVLPATL-NKITTFCVTRSPTSKT  1519
               KPT                      + +S   + +  P +L +KI+T         ++
Sbjct  427   SSKPTPRRAKVALGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRS  486

Query  1520  PGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTS  1687
                +E  +  L  +  +F R      +    +  +L    D+ E+AGSF ++ H HK   
Sbjct  487   KKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKK  546

Query  1688  TTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGG  1810
                N+ ++     L +++LLE++  E+DD ++VTLVP+ G 
Sbjct  547   KI-NTILR-----LGLTDLLEEIEAEDDDSVVVTLVPKYGA  581



>gb|ABI96950.1| putative polyphenol oxidase [Spiraea densiflora]
Length=454

 Score =   388 bits (997),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 242/358 (68%), Gaps = 17/358 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +        P +CCP   + ++D      +++P+ ++L V
Sbjct  1     PFAFAKPVLPPDVSKCGAADLPTGAE---PMNCCPPPATKIID------FRLPAPNRLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D +Y+ KY  A++ MK LP  DPR+F  QA +HCAYC+GAY   G P    Q+
Sbjct  52    RPAAHAVDKNYIAKYNKAMELMKALPDSDPRSFKSQAAIHCAYCDGAYDQTGFPDLELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYFYE+IL  LI+DP+F +PYWNWDNP GM +P +F +  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFYEKILGKLINDPSFAIPYWNWDNPAGMQMPALFTN-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              RN +H+   + DL Y+G + + ++  +V  NL IMYR M++NA  PLLFFG+  R  T 
Sbjct  171   LRNASHQPPNMIDLDYSGTDENNTNQVQVNQNLKIMYRAMVSNAKNPLLFFGQPYRAGTS  230

Query  1046  DTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT  1225
                PG G++EN PH  IH W GD   P+ ENMGNFYSA  DP+FY HHSNVDRMW +WK 
Sbjct  231   -PNPGGGSVENTPHGPIHLWAGDKTQPNFENMGNFYSAGKDPIFYSHHSNVDRMWDLWKG  289

Query  1226  LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             LGG R DITD DWL + FLFY+E   +V+V V+D LD+ KLGYT+Q +  PW   KPT
Sbjct  290   LGGKRTDITDSDWLNSGFLFYNENAEMVRVTVKDCLDSKKLGYTYQDVEIPWLKSKPT  347



>gb|AHH92831.1| polyphenol oxidase [Musa acuminata AAA Group]
Length=588

 Score =   393 bits (1009),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 245/558 (44%), Positives = 324/558 (58%), Gaps = 27/558 (5%)
 Frame = +2

Query  182   RRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALAS  361
             RR    KI C A+             + AKLDRR+VL+GLGGL GA    G  +  AL +
Sbjct  39    RRHAHPKISCKASDEH-------EMTANAKLDRRDVLVGLGGLCGAAAGLGIDSK-ALGN  90

Query  362   PIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDD  541
             PI  P+   CGPA +        P +CCP    D    D+ + P+ S L VRPAAH +D 
Sbjct  91    PIQAPDLTKCGPADLPTGA---TPTNCCPPYFPDKKIIDFKRPPNSSPLRVRPAAHLVDS  147

Query  542   DYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPF  712
             DYL+KYK A++ M+ LP+DDPRNF QQANVHCAYC+GAY   G P    Q+H +WLFFP+
Sbjct  148   DYLDKYKKAVELMRALPADDPRNFMQQANVHCAYCDGAYDQIGFPNLELQVHNSWLFFPW  207

Query  713   HRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRG  892
             HR+YLYF+ERIL  LI D TF LP+WNWD P GM LP I+ D   S LYDK R+  H+  
Sbjct  208   HRFYLYFHERILGKLIGDDTFALPFWNWDAPGGMKLPSIYADPSSS-LYDKFRDAKHQPP  266

Query  893   YVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGT  1069
              + DL Y G + S +D +++  NL IMYRQ+++N   PLLF G A R   GD   PG G+
Sbjct  267   VLVDLDYNGTDPSFTDAEQIDQNLKIMYRQVISNGKTPLLFLGSAYR--AGDNPNPGAGS  324

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDI  1249
             +EN+PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDRMW +WK LGG  +D 
Sbjct  325   LENIPHGPVHGWTGDRSQPNLEDMGNFYSAGRDPIFFAHHSNVDRMWYLWKKLGGKHQDF  384

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrsk  1429
              D DWL T FLFYDE   LV+V ++D L    L Y +Q +  PW   +PT K     ++ 
Sbjct  385   NDKDWLNTTFLFYDENADLVRVTLKDCLQPEWLRYDYQDVEIPWLKTRPTPKALKAQKTA  444

Query  1430  asvsasTSV--LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvned  1603
             A    +T+    P TL    +  V R   S++  ++E  +  L  +  +F R      + 
Sbjct  445   AKTLKATAETPFPVTLQSAVSTTVRRPKVSRSGKEKEEEEEVLIVEGIEFDRDYFIKFDV  504

Query  1604  ddvnTKELDRV----EYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlend  1771
                 T+         E+AGSF N+ H HK +        +     L I++LLED+  E+D
Sbjct  505   FVNATEGEGITPGASEFAGSFVNVPHKHKHSKKEKKLMTR---LCLGITDLLEDIGAEDD  561

Query  1772  dKILVTLVPRAGGSFVTV  1825
             D +LVT+VP+AG   V+V
Sbjct  562   DSVLVTIVPKAGKGKVSV  579



>gb|ABI96942.1| putative polyphenol oxidase [Dasiphora fruticosa]
Length=452

 Score =   388 bits (996),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/355 (54%), Positives = 237/355 (67%), Gaps = 13/355 (4%)
 Frame = +2

Query  347   FALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
             FA A P+ PP+   CG A + N      P  CCP T         +K+PS + L VRPAA
Sbjct  2     FAFAKPVAPPDVSKCGAADLPNGVA---PTDCCPPTPSKIID---FKLPSPTPLRVRPAA  55

Query  527   HAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTW  697
             HA+DD Y+ KY  A++ MK LP  DPR+F  QANVHCAYC+GAY  AG P    QIH +W
Sbjct  56    HAVDDAYIAKYTKAMELMKALPDSDPRSFKNQANVHCAYCDGAYDQAGFPELELQIHNSW  115

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LFFPFHR+YLYFYERIL  LI+DPTF LP+WNWD+P GM LP +F D  +SPLYDK R+ 
Sbjct  116   LFFPFHRYYLYFYERILGKLINDPTFALPFWNWDSPAGMKLPALFAD-PKSPLYDKFRSA  174

Query  878   AHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-G  1054
             AH+   + DL + G E + S+  ++ +NL+IMYRQM++NA    LFFG   R   GD   
Sbjct  175   AHQPPKLIDLDFNGTEDNTSNTTQINSNLSIMYRQMVSNAKNAQLFFGNPYR--AGDEPD  232

Query  1055  PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG  1234
             PG G+IE+ PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDRMW+IWKTL  
Sbjct  233   PGGGSIESTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNVDRMWSIWKTLAP  292

Query  1235  NRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
               KDITD DWL + FLFYDE   +V+VKV D LD   LGY +Q +  PW + KPT
Sbjct  293   KNKDITDSDWLDSGFLFYDENANMVRVKVRDCLDYKNLGYVYQDVEIPWLNSKPT  347



>gb|ABX09994.1| chloroplast polyphenol oxidase [Taraxacum officinale]
Length=599

 Score =   393 bits (1009),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 250/553 (45%), Positives = 322/553 (58%), Gaps = 36/553 (7%)
 Frame = +2

Query  257   LSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPY  436
             +    LDRRNVLL LGGLYGA    G SN  A A PI  P+   CGPA I       +  
Sbjct  62    IDSGTLDRRNVLLRLGGLYGAAATFG-SNSLAFADPIMAPDLTQCGPADIPAGG---IVT  117

Query  437   SCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFY  616
              CCP     T   D+   P  + L +RPAAH +D DY++K+  AI  MK LP DDPR+F 
Sbjct  118   DCCPP--FTTKIQDFKLPPPSNTLRIRPAAHLVDKDYIDKFNKAIGLMKALPDDDPRSFK  175

Query  617   QQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPY  787
             QQA VHCAYC+GAY+  G P    Q+H +WLFFPFHR YLYF+E+I   LI+DPTF +P+
Sbjct  176   QQAVVHCAYCDGAYEQVGYPGLDLQVHNSWLFFPFHRCYLYFFEKICGKLINDPTFAIPF  235

Query  788   WNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLA  967
             WNWD   GM +P+I+ +  +SPLYD  R+  H+   V DL Y G + + S  ++   NL 
Sbjct  236   WNWDAADGMTIPDIYTN-SKSPLYDTLRDAKHQPPSVVDLDYNGVDENLSPSEQTSTNLT  294

Query  968   IMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMG  1144
             IMYRQM+++A    LF G   R   GD   PG GT+EN+PH  +H W GD   P+ ENMG
Sbjct  295   IMYRQMVSSAKTASLFMGSPYR--AGDEPNPGGGTLENIPHGPVHIWTGDRNQPNGENMG  352

Query  1145  NFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVE  1324
             NFYSA  DP+FY HH+NVDRMW+IWKTLGG RKD TD DWL + F FYDE    V+VKV 
Sbjct  353   NFYSAGKDPIFYAHHANVDRMWSIWKTLGGRRKDFTDSDWLDSSFSFYDENAEFVRVKVR  412

Query  1325  DSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTS-----------VLPATL  1471
             D LD+ KLGY ++ +  PW   KP  K     R       + +           V PA+L
Sbjct  413   DCLDSKKLGYAYEDVKIPWLKTKPRSKYGKSRRKAVGHKHAVARADELIPFAKDVFPASL  472

Query  1472  NKITTFCV------TRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDR  1633
             +K+    +      +RS   K   +E L+   +     +F++FDVFV++DDD      D+
Sbjct  473   DKVMIKVLVPRPKKSRSKKQKDEEEEVLVVEGIEVKRNEFVKFDVFVDDDDDEVRATADK  532

Query  1634  VEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGS  1813
              E+AGSF N+ HVHK           T    L ISELL+DL  ++DD +LVTLVP+  G 
Sbjct  533   TEFAGSFVNVPHVHKHEKNV------TTRLRLGISELLDDLGADDDDNVLVTLVPKTEGG  586

Query  1814  FVTVNKAYTEIID  1852
              V++     E  D
Sbjct  587   EVSIGMIKIEYED  599



>gb|EYU26237.1| hypothetical protein MIMGU_mgv1a026995mg [Erythranthe guttata]
Length=590

 Score =   392 bits (1008),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 247/546 (45%), Positives = 342/546 (63%), Gaps = 32/546 (6%)
 Frame = +2

Query  221   SSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPA  400
             S++ + +  +S+  + KLDRRNVLLG+GGLYGA      + P A A+P+  P+   CG A
Sbjct  52    SAQKQNDNPESTHPQGKLDRRNVLLGMGGLYGAAASLVSTPPEASANPVQAPQLDKCGTA  111

Query  401   TISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKM  580
             T  N+ GK +  +CCP     T +   YKIP   ++ +RP+AH +   Y+ KY  A+ +M
Sbjct  112   TDLNT-GKKLDLNCCPPV---TDNIIDYKIPPALRMKLRPSAHRVSAQYMFKYNLAVDRM  167

Query  581   KDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQ  751
             K LP DDPR+F QQA +HCAYCNGAY   G+     QIH +WLFFPFHRWYLYFYERIL 
Sbjct  168   KRLPDDDPRSFSQQAMIHCAYCNGAYDQPGQGSLDLQIHNSWLFFPFHRWYLYFYERILG  227

Query  752   SLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETS  931
              LI DPTF LP+WNWDNP+GM +P +F  DE+S +Y+ KRNQ + +  + DL   G +  
Sbjct  228   KLIGDPTFALPFWNWDNPKGMTIPPMF-LDEKSAIYNSKRNQDNLKA-IVDLGMTGNKDP  285

Query  932   ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVG  1111
                 Q V NNL +MY +M+        F G+  R+ T    PG G+ E   H +IH +VG
Sbjct  286   ---LQVVSNNLTVMYSEMIRGNADVYDFMGQPYREGTA-VNPGPGSSERGSHTAIHVFVG  341

Query  1112  DPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT-LGGNR---KDITDPDWLQTEF  1279
             DPR P  E++GNFYSA  D +FY HH NVDRMWT+W+  L  N+   K ITDPD+L   F
Sbjct  342   DPREPSGEDLGNFYSAGRDSLFYSHHCNVDRMWTLWQYFLPSNKVPDKKITDPDFLNASF  401

Query  1280  LFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP---TrkrraklrskasvsasT  1450
             LFYDE K LV+V V+DSLDN+K+GY ++++  PW D++P       R    S ++   + 
Sbjct  402   LFYDENKQLVRVSVKDSLDNLKMGYEYERVDLPWLDYRPPPQAAAARITRTSASAAPKAE  461

Query  1451  SVLPATLNKITTFCVTRSPTSKTPGKEELLDL-HLAFDDTQFIRfdvfvnedddvnTKEL  1627
             ++ P  L+++  F V +S   K    +ELL L ++  D T+F++FDVFVN++DD  T EL
Sbjct  462   TLFPLKLDRVVRFEVQKSKKGKA---DELLVLENITVDTTKFLKFDVFVNDEDDGAT-EL  517

Query  1628  DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAG  1807
             D+  YAG+++ + H       TAN T  T +  L ++EL +D+ + +DD I+VTLVPR  
Sbjct  518   DKAAYAGTYAQVPH------KTANKTATT-SIRLKLTELYDDMDVGDDDTIVVTLVPRHQ  570

Query  1808  GSFVTV  1825
             G  VT+
Sbjct  571   GPGVTI  576



>gb|AEE61322.1| polyphenol oxidase I [Pyrus x bretschneideri]
 gb|AEE61323.1| polyphenol oxidase I precursor [Pyrus x bretschneideri]
Length=593

 Score =   392 bits (1008),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 243/581 (42%), Positives = 336/581 (58%), Gaps = 56/581 (10%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+ L   P R+  R    K+ C A +++  +       +++KLDRRNVLLGLGGLYG   
Sbjct  31    QVSLLTKPKRSFAR----KVSCKATNNDQNDQ------AQSKLDRRNVLLGLGGLYGVAG  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPS  496
             +   ++PFA A PI PP+   CG A +          +CCP   + ++D      +K+P+
Sbjct  81    MG--TDPFAFAKPIAPPDVSKCGSADLPQGAEA---TNCCPPPATKIID------FKLPA  129

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              +KL +RP AHA+D  Y +K+  A+  MK LP DDPR+F QQA VHCAYC+GAY  AG P
Sbjct  130   PAKLRIRPPAHAVDKAYRDKFYKAMGLMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFP  189

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +
Sbjct  190   ELELQVHNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYAD-PK  248

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             SPLYDK R+  H+   + DL Y G E + S    +  NL IMYRQM++N+    LFFG  
Sbjct  249   SPLYDKFRSAKHQPPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNP  308

Query  1028  IRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDR  1204
              R   GD   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DPVFY HHSNVDR
Sbjct  309   YR--AGDEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDR  366

Query  1205  MWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWK  1384
             MW+IWKTLGG R D+ D DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW 
Sbjct  367   MWSIWKTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWL  426

Query  1385  DFKPT--------------rkrraklrskasvsasTSVLPATL-NKITTFCVTRSPTSKT  1519
               KPT                      + +S   + +  P +L +KI+T         ++
Sbjct  427   SSKPTPRRAKVALGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRS  486

Query  1520  PGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTS  1687
                +E  +  L  +  +F R      +    +  +L    D+ E+AGSF ++ H HK   
Sbjct  487   KKAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKK  546

Query  1688  TTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGG  1810
                N+ ++     L +++LLE++  E+DD ++VTLVP+ G 
Sbjct  547   KI-NTILR-----LGLTDLLEEIEAEDDDSVVVTLVPKYGA  581



>ref|XP_011082856.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=558

 Score =   391 bits (1004),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 250/560 (45%), Positives = 337/560 (60%), Gaps = 63/560 (11%)
 Frame = +2

Query  179   ARRGDVIKIRCAAASSEGRENPADSS----LSEAKLDRRNVllglgglygayniaggSNP  346
             A+RG  +++ CA       EN  DSS     S+ K+DRRN+LLGLGGLYGA N+   S P
Sbjct  34    AKRGHRLQVSCAT------ENQNDSSRNVETSQGKVDRRNMLLGLGGLYGASNLV--SAP  85

Query  347   FALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAA  526
              A A+PI PPE   CG AT  N+N + +  +CCP    +      Y++P   ++ +RP+A
Sbjct  86    GASANPIKPPEIDKCGTATNLNNNTQ-LDINCCPPLSQNIVD---YRLPPVFQMKIRPSA  141

Query  527   HAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTW  697
             H +  +Y+ KY  AI +MK LP +DPR+F QQAN+HCAYCNGAY   G+     Q+H +W
Sbjct  142   HRVSPEYIFKYNMAIDRMKRLPKEDPRSFMQQANIHCAYCNGAYDQPGQGTLDLQVHNSW  201

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LFFPFHRWYLYFYERIL  LI DPTF LP+WNWDNP+GM +P IF  D +S LYD+KRNQ
Sbjct  202   LFFPFHRWYLYFYERILGKLIGDPTFALPFWNWDNPKGMTIPPIF-VDPKSALYDEKRNQ  260

Query  878   AHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGP  1057
             A+    V DL   G   +    Q V NNL IMY +M+        F G+  R+ T    P
Sbjct  261   ANMPPAVVDL---GMTRNPDPLQVVANNLTIMYNEMIRGNSDVYDFMGQPYREGT-PVNP  316

Query  1058  GMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN  1237
             G G  E   H ++H WVGDP  P  E++GNFYSA  DP+FYCHH+NVDRMW++W+    +
Sbjct  317   GPGASERGSHTAVHVWVGDPSQPSGEDLGNFYSAGRDPLFYCHHANVDRMWSLWQYFLPS  376

Query  1238  R----KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrk  1405
             +    K ITDPD+L   FLFYDE   LV+V V+D LDN+++GY F+++  P         
Sbjct  377   KTVPDKRITDPDFLNAAFLFYDENAQLVRVTVKDCLDNLRMGYDFERIDLP---------  427

Query  1406  rraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfd  1585
                             + P TL+KI    V +  T K    E LL  ++  D T+F++FD
Sbjct  428   ----------------IFPLTLDKIVRVLVPK--TKKGKADELLLLENIQVDTTKFLKFD  469

Query  1586  vfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrle  1765
             VF+N++DD  T ELD+  Y G+++ + H       TAN +  T +  L +++L +D+ + 
Sbjct  470   VFINDEDDNIT-ELDKAAYVGTYAQVPH------KTANKSATT-SIRLKLTDLYDDMDVA  521

Query  1766  nddKILVTLVPRAGGSFVTV  1825
             +DD ILVTLVPR  G  VT+
Sbjct  522   DDDTILVTLVPRHQGPGVTI  541



>ref|XP_004293563.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=587

 Score =   392 bits (1006),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 244/530 (46%), Positives = 323/530 (61%), Gaps = 40/530 (8%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
              KLDRRN+L+GLG           +NPFA A+P+PPP+  +CGPA     +G  +   CC
Sbjct  66    GKLDRRNMLIGLGAGGLYGTAGLETNPFAFAAPVPPPDLATCGPA--DKPDGTTI--DCC  121

Query  446   P---STLMDTASADYYKIPSFSKLNVRPAAHAIDDD--YLEKYKTAIQKMKDLPSDDPRN  610
             P   +T++D      +K+P    +  R AA  +  D  YL KYK AI+ M+ LP DDPR+
Sbjct  122   PPKTTTIID------FKLPDPGPMRTRLAAQNVAKDPVYLAKYKKAIELMRALPDDDPRS  175

Query  611   FYQQANVHCAYCNGAYQLAG---KPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTL  781
               QQA VHC+YC+G Y +AG      Q+HF WLF+P+HR YLYFYE+I+  LIDDPTF L
Sbjct  176   LAQQAMVHCSYCDGGYPMAGFSDLEIQVHFCWLFYPWHRLYLYFYEKIMCKLIDDPTFAL  235

Query  782   PYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNN  961
             P+WNWD P GM +P IF D   S LYD+ RN AH+   + DL Y G +    D  +++ N
Sbjct  236   PFWNWDAPAGMYIPSIFTDTTSS-LYDQYRNAAHQPPKLLDLNYGGTDDDTDDKTRIREN  294

Query  962   LAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNEN  1138
             L  MY+QM++ A    LFFG+      GD   PG G IE++PHN+IH W GDP   + E+
Sbjct  295   LTTMYQQMISKATSHRLFFGEPY--SAGDEPNPGAGNIESIPHNNIHLWTGDPTQTNGED  352

Query  1139  MGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVK  1318
             MG FYSA  DP+FY HH+NVDRMW+I+K  GG   DIT  DWL TEFLFYDE K LV+VK
Sbjct  353   MGAFYSAGRDPIFYSHHANVDRMWSIYKARGGT--DITKKDWLDTEFLFYDENKNLVRVK  410

Query  1319  VEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsa-sTSVLPATLNKITTFCV  1495
             V DSLD  KLGY +Q +  PW + KPT ++    R  A  SA  TS  PATL++  +  V
Sbjct  411   VRDSLDESKLGYKYQDVEIPWLNSKPTARKSKNKRKAAVSSADLTSKFPATLSETISVEV  470

Query  1496  T------RSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFS  1657
                    R+   KT  +E L+   + F  ++ ++FDV+VN+D D  + + D+ E+AGSF 
Sbjct  471   ARPSAAKRTTAEKTKEEEVLVISGIEFAGSEMLKFDVYVNDDADEVSGK-DKAEFAGSFV  529

Query  1658  NLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAG  1807
             ++ H        AN  IKT    L I+ LL DL  E D+ ++VTLVP+ G
Sbjct  530   HVPH-------RANKKIKT-NLRLGITNLLTDLGAEEDNSVVVTLVPKFG  571



>gb|ACM43505.1| polyphenoloxidase [Camellia nitidissima]
Length=595

 Score =   392 bits (1007),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 246/572 (43%), Positives = 337/572 (59%), Gaps = 42/572 (7%)
 Frame = +2

Query  197   IKIRCAAASSEGRENPADSSLSE----AKLDRRNVllglgglygayniaggSNPFALASP  364
              KI C +  ++  +NP  +S +E     KLDRRNVLLGLGG   A  +   +NP A A+P
Sbjct  42    FKISCKSTDND-NQNPNTTSKNEETFLGKLDRRNVLLGLGGYSAATIL---ANPLAFAAP  97

Query  365   IPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD  544
             +  P+   CG A +  +  KP   +CCP           +K P  + + VRPAAH  D +
Sbjct  98    VTAPDLAKCGAADLP-AGAKPT--NCCPPKATKIID---FKFPQSNSMRVRPAAHLADAE  151

Query  545   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFH  715
             Y+ K+  A+  MK LP DDPR+F QQANVHCAYC+GAY   G P    Q+H +WLFFPFH
Sbjct  152   YIAKFSKALALMKALPEDDPRSFKQQANVHCAYCDGAYHQVGFPELDLQVHNSWLFFPFH  211

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             R+YL+F+ERIL SLI DP+F +P+WNWD+P GM +P ++ D   SPLYD  R+  H+   
Sbjct  212   RYYLHFFERILGSLIGDPSFAIPFWNWDSPNGMQMPAMYAD-PNSPLYDVLRDAKHQPPT  270

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTI  1072
             + DL Y G + + +D Q+  +NL +MYRQM++++    LF G   R   GD   PG G++
Sbjct  271   LVDLDYNGSDPTTTDAQQKSSNLNVMYRQMVSSSKSARLFLGSPYR--AGDEPDPGAGSL  328

Query  1073  ENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDIT  1252
             EN+PH  +H W GD   P+ E+MGNFYSA  D +FY HH+NVDRMW+IWKTLGG R+D T
Sbjct  329   ENIPHGPVHIWCGDRTQPNLEDMGNFYSAGRDSIFYGHHANVDRMWSIWKTLGGKRQDFT  388

Query  1253  DPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT---------rk  1405
             DPDWL   F+FYDE   LV+VKV+D LD+ KLGY +Q +  PW + +P            
Sbjct  389   DPDWLNAGFVFYDENAQLVRVKVKDCLDSRKLGYVYQDVDIPWLNTRPAPRVSKLSRKIN  448

Query  1406  rraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTP----GKEELLDLH-LAFDDTQ  1570
             +     +  + S +  V P  L+K     V R   S++      +EE+L +  +  D   
Sbjct  449   KAGVAMAADTPSTAAEVFPKKLDKAVRVMVPRPKKSRSKKEKDDEEEILVIEGIEVDRDV  508

Query  1571  FIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelle  1750
             F++FDVF+N++ +V     D  E+AGSF N+ H HK                L I+ELLE
Sbjct  509   FVKFDVFINDEHEVVIGPND-TEFAGSFVNVPHKHKHGKKIKT------ILRLGITELLE  561

Query  1751  dlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
             +L  E+DD +LVTLVP+ G   VT+     E 
Sbjct  562   ELGAEDDDGVLVTLVPKNGAGAVTIGGVKIEF  593



>emb|CDP06099.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   392 bits (1006),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 250/563 (44%), Positives = 336/563 (60%), Gaps = 49/563 (9%)
 Frame = +2

Query  200   KIRCAAASSEGRENPAD--------SSLSEAKLDRRNVllglgglygayniaggSNPFAL  355
             K+ C   S++G +N +D           S  KLDRRNVLLG+GG     +     NP A 
Sbjct  38    KLTCN--STKGDQNSSDHDTAGSKNGETSLLKLDRRNVLLGIGGGLYGASTFV-GNPSAF  94

Query  356   ASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSF-SKLNVRPAAHA  532
             A+P+ P  T +C  AT  +S        CCP +       D+  +P+  S +  RPAA  
Sbjct  95    AAPLSPTFT-ACHDATDPDSK----EIDCCPPSATAADITDF--VPTAPSVIATRPAAQQ  147

Query  533   IDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP-----YQIHFTW  697
             +D  YL+KYKTAI+KM++L SDDPR+F  QANVHCAYCNG Y   G         +H +W
Sbjct  148   VDSTYLKKYKTAIEKMRNLSSDDPRSFTAQANVHCAYCNGGYYQDGYADSSLLLDVHNSW  207

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LFFPFHRWYLYF+E+I Q+++DD TF LP+WNWDNP GM LP IF D   SPLYD  RN 
Sbjct  208   LFFPFHRWYLYFFEKICQNMVDDDTFALPFWNWDNPPGMYLPAIFKD-SSSPLYDSLRNP  266

Query  878   AHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK-ETGDTG  1054
             +H    V DL+Y G +++ S    +KNNL +MY+QM+T +  PL FFGK  R  ET D  
Sbjct  267   SHLNT-VLDLSYEGTDSTDSTITVIKNNLILMYKQMVTQSTTPLSFFGKTFRAGETSD--  323

Query  1055  PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG  1234
             PG G+IE  PH ++HRW GDP   H ENMG+FYSA  DPVFY HH+NVDRMW++W +LGG
Sbjct  324   PGAGSIETSPHTNVHRWTGDPNESHGENMGSFYSAGRDPVFYAHHANVDRMWSLWNSLGG  383

Query  1235  NRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrra  1414
               ++ TD DWL + F FY+E    VKV V+D LD   LGYT+Q +  PW + KP+   R 
Sbjct  384   --QNFTDSDWLNSSFYFYNEQAKPVKVYVKDCLDTSVLGYTYQTVDIPWLNSKPS--PRR  439

Query  1415  klrskasvsasTSVLPATLNKITTFCVTRSPTSKTP----GKEELLDLH-LAFDDTQFIR  1579
                +  +    + V P TL K  T  V R    +T       EE+L++  + ++  +F++
Sbjct  440   TAVALPTAPTPSQVFPTTLEKAITVLVKRPKKKRTKKEKQSAEEVLEISGIQYNIGEFVK  499

Query  1580  fdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlr  1759
             FDV++NED    +   ++ E  GSF N+ H H        S I T T S  ISE+L++L 
Sbjct  500   FDVYINEDTPDESGP-EKTELVGSFINVPHGH--------SMISTTTKSFDISEVLQELG  550

Query  1760  lenddKILVTLVPRAGGSFVTVN  1828
              +  + +LVTLVP++  S VT++
Sbjct  551   ADEFESVLVTLVPKS--STVTIS  571



>ref|XP_003593517.1| Polyphenol oxidase A1 [Medicago truncatula]
 gb|ABN08604.1| Tyrosinase [Medicago truncatula]
 gb|AES63768.1| polyphenoloxidase [Medicago truncatula]
Length=608

 Score =   392 bits (1008),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 195/361 (54%), Positives = 243/361 (67%), Gaps = 14/361 (4%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             +NPFALASPI  P+  +CGP  +  S   P   +CCP     T   DY K PS ++ L V
Sbjct  85    ANPFALASPISAPDLSTCGPPDLP-SGATPSGLNCCPPN--STKIIDY-KFPSSTQPLRV  140

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             R AAH ++D+YL+KYK AI+ MK LPS+DPRNF QQAN+HCAYC+GAY   G P    Q+
Sbjct  141   RQAAHLVNDEYLQKYKKAIELMKALPSNDPRNFIQQANIHCAYCDGAYSQVGFPNLDLQV  200

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHRWYLYFYERIL SLI+DPTF LP+WN+D P GM  P I+ D   SPLYD+
Sbjct  201   HSSWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMQFPSIYTD-RTSPLYDE  259

Query  866   KRNQAHRRGYVTDLAYAGQETS--ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKE  1039
              RN  H+   + D  Y   + S    + +++  NL IMYRQ+++      LF G   R  
Sbjct  260   LRNANHQPPTLIDFNYVPGDDSDEVDENERISTNLTIMYRQVVSGGKTSTLFLGNPYR--  317

Query  1040  TGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
              GD   PG G++E VPHN +H W GD   P+ E+MG+FYSAA DP+F+ HHSN+DR W+I
Sbjct  318   AGDAPDPGAGSVEIVPHNIVHLWSGDDTQPNFEDMGDFYSAARDPIFFSHHSNIDRFWSI  377

Query  1217  WKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             WKTLGG RKD  D DWL++EFLFYDE K LVKV V+D LD  KLGY +Q +  PW + KP
Sbjct  378   WKTLGGKRKDFNDKDWLESEFLFYDENKNLVKVNVKDCLDTKKLGYVYQDVDIPWLNAKP  437

Query  1397  T  1399
             T
Sbjct  438   T  438



>ref|XP_008371328.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=587

 Score =   390 bits (1003),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 244/562 (43%), Positives = 324/562 (58%), Gaps = 37/562 (7%)
 Frame = +2

Query  206   RCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETK  385
             R    +++G     D  L  A+LDRRN+L+GLG            NPFA A+P+  P+  
Sbjct  48    RVXCKATKGDNENLDQGL--ARLDRRNMLIGLGAGGLYGAA---GNPFAFAAPVSAPDLT  102

Query  386   SCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDD--YLEKY  559
             +CGPA     +G  +   CCP T   T +   +K+P    L  R AA  +  +  YL KY
Sbjct  103   TCGPA--DKPDGSTI--DCCPPT---TTTIIDFKLPDRGPLRTRLAAQDVAKNPAYLAKY  155

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
             K AI+ M+ LP DDPR+F QQA VHC+YC+G Y   G      Q+H+ WLFFPFHRWYLY
Sbjct  156   KKAIELMRALPDDDPRSFAQQAKVHCSYCDGGYPQVGYSDLEIQVHYCWLFFPFHRWYLY  215

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             FYE+I+  LI DPTF LP+WNWD P GM +PEIF D   S LYD+ RN AH+   + D  
Sbjct  216   FYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDTSSS-LYDQYRNAAHQPPKLLDFN  274

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHN  1090
             Y+G +    D   +K NL  MY+QM++ A    LFFG+       D  PG G IE++PHN
Sbjct  275   YSGTDDBVDDATXIKENLTTMYQQMVSKATSHRLFFGEPY-SAGDDPSPGAGNIESIPHN  333

Query  1091  SIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK-TLGGNRKDITDPDWL  1267
             +IH W GDP   + E+MG FYS+  DP+FY HHSNVDRMW+I+K  LGG   DI   DWL
Sbjct  334   NIHFWTGDPTQTNGEDMGAFYSSGRDPLFYSHHSNVDRMWSIYKDKLGGT--DIEKTDWL  391

Query  1268  QTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrskasvsa  1444
              TEFLFYDE K LV+VKV DSLD  KLGY + +K+P PW   KPT ++    R  A  S+
Sbjct  392   DTEFLFYDEKKNLVRVKVCDSLDTKKLGYVYDEKVPIPWLKSKPTXRKSTNKRKAAVSSS  451

Query  1445  -sTSVLPATLNKITTFCVTR-SPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnT  1618
               T+  PATL+   +  VTR S T +T  +++  D  L     +F   +    +    + 
Sbjct  452   DLTTTFPATLSBTISVEVTRPSATKRTTAQKKAQDEVLVIKGIEFAGNETVKFDVYVNDD  511

Query  1619  KE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILV  1786
              +     D+ E+AGSF ++ H HK         IKT    L+I+ LLE+L  E D  ++V
Sbjct  512   ADSLAGKDKSEFAGSFVHVPHKHK-------KNIKT-NLRLSITSLLEELDAETDSSLVV  563

Query  1787  TLVPRAGGSFVTVNKAYTEIID  1852
             TLVP+ G   +T+     E+I+
Sbjct  564   TLVPKVGKGPITIGGFSIELIN  585



>gb|ABS88291.1| polyphenol oxidase [Pyrus x bretschneideri]
 gb|ACI15854.1| polyphenol oxidase [Pyrus x bretschneideri]
Length=593

 Score =   390 bits (1003),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 241/580 (42%), Positives = 336/580 (58%), Gaps = 54/580 (9%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+ L   P R+  R    K+ C A +++  +       +++KLDRRNVLLGLGGLYG   
Sbjct  31    QVSLLTKPKRSFAR----KVSCKATNNDQNDQ------AQSKLDRRNVLLGLGGLYGVAG  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPS  496
             +   ++PFA A PI PP+   CG A +          +CCP   + ++D      +K+P+
Sbjct  81    MG--TDPFAFAKPIAPPDVSKCGSADLPPGAEA---TNCCPPPATKIID------FKLPA  129

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              +KL +RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P
Sbjct  130   PAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFP  189

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +
Sbjct  190   ELELQVHDSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYAD-PK  248

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             +PLYDK R+  H+   + DL Y   E + S    +  NL IMYRQM++N+    LFFG  
Sbjct  249   TPLYDKFRSAKHQPPTLIDLDYNRTEDNVSTETTINANLKIMYRQMVSNSKNAQLFFGNP  308

Query  1028  IRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRM  1207
              R   G   PG G+IE  PH S+H W GD   P+ E+MGNFYSA  DPVFY HHSNVDRM
Sbjct  309   YRAGDG-PNPGGGSIEGTPHGSVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRM  367

Query  1208  WTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKD  1387
             W+IWKTLGG R D+ D DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW  
Sbjct  368   WSIWKTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLS  427

Query  1388  FKPT--------------rkrraklrskasvsasTSVLPATL-NKITTFCVTRSPTSKTP  1522
              KPT                      + +S   + +  P +L +KI+T         ++ 
Sbjct  428   SKPTPRRAKVALGKIAKKLGVAHATVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSK  487

Query  1523  GKEELLDLHLAFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTST  1690
               +E  +  L  +  +F R      +    +  +L    D+ E+AGSF ++ H HK    
Sbjct  488   KAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKK  547

Query  1691  TANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGG  1810
               N+ ++     L +++LLE++  E+DD ++VTLVP+ G 
Sbjct  548   I-NTILR-----LGLTDLLEEIEAEDDDSVVVTLVPKYGA  581



>ref|XP_011082867.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=586

 Score =   390 bits (1002),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 246/563 (44%), Positives = 342/563 (61%), Gaps = 29/563 (5%)
 Frame = +2

Query  179   ARRGDVIKIRCAA--ASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFA  352
             A+R     + C A   + E RE+P      + K DRRN+L+G+GGLYGA N+       A
Sbjct  32    AKRTRQFNLSCKARNGNDEQRESPGKEETFQGKFDRRNLLVGMGGLYGAANLVSADYSPA  91

Query  353   LASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHA  532
              ASPI  P+   C   T  N+  +P+  +CCP   +   S DY K+P  +K+  RPAAH 
Sbjct  92    FASPISAPDLSKCTRGTNLNTQ-QPLDVNCCPP--LSQKSIDY-KLPPVTKMRFRPAAHL  147

Query  533   IDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLF  703
                +Y+ KY+ A++ MK LP DDPR+F QQANVHCAYCN  Y+  G P    QIH  W F
Sbjct  148   ASQEYIAKYEKAVELMKALPEDDPRSFMQQANVHCAYCNLTYEQTGDPSLRLQIHNCWHF  207

Query  704   FPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAH  883
             FP+HRWYL+FYERIL  LIDDPTF LP+WNWDNP GM++P +F   ++SPLY+ +RNQ H
Sbjct  208   FPWHRWYLFFYERILGKLIDDPTFGLPFWNWDNPPGMVMPNMF-VKKDSPLYNPRRNQDH  266

Query  884   RRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGM  1063
                  TDL YAG+ T+    + + NNL  MY +M+ N      F+G      T    PG 
Sbjct  267   LPPATTDLNYAGKPTTDPS-KIIPNNLTEMYSEMVRNVSTLEDFYGAKYVTGT-KPDPGP  324

Query  1064  GTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNR-  1240
             GT+E   H ++H WVG   +P  E+MGNFYSA  +P+F+ HH+NVDR+W+IW+ L G++ 
Sbjct  325   GTVERGSHTALHVWVGQA-TPSGEDMGNFYSAGREPLFFSHHANVDRLWSIWRGLRGSKP  383

Query  1241  KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrakl  1420
             KD  + DWL   FLFYDE   LV+VKV D+L+N K+GY +Q++  PW   +PT + +   
Sbjct  384   KDFPESDWLNANFLFYDENAQLVRVKVGDTLENQKMGYVWQEVDLPWLKNRPTARVKKSK  443

Query  1421  rskasvs--asTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQ-----FIR  1579
              +  S +  A+ +V P  L+K+    V R   S++   +E  +  L  D  +     F+R
Sbjct  444   VATTSTAPKATETVFPVKLDKVVKVLVDRPKKSRSKKDKEKEEELLVIDGIEVDTAKFVR  503

Query  1580  fdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlr  1759
             F+V++N++DD   + +D+ EYAG +S + H         NST  T    L ++ELLEDL 
Sbjct  504   FEVYINDEDDKADEIIDKAEYAGCYSQVPH--------KNSTKVTSKIRLGLTELLEDLD  555

Query  1760  lenddKILVTLVPRAGGSFVTVN  1828
             +E+DDKILV+LVPRAGG  +T+ 
Sbjct  556   VEDDDKILVSLVPRAGGEDITIG  578



>dbj|BAO79386.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=607

 Score =   390 bits (1003),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 261/581 (45%), Positives = 338/581 (58%), Gaps = 41/581 (7%)
 Frame = +2

Query  179   ARRGDVIKIRCAAASSEGRENPADS--SLSEAKLDRRNVllglgglygayniaggSNPFA  352
             +RR    K+ C +A+ +   +        S  KLDRRNVLLG+GGLYGA    G + P A
Sbjct  42    SRRFAPSKVSCNSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLA  101

Query  353   LASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHA  532
               +PI  P+   CG AT+ +      P +CCP   + T   D+    S S +  RPAAH 
Sbjct  102   FGAPIQAPDISKCGTATVPDGV---TPTNCCPP--VTTKIIDFQLPSSGSPMRTRPAAHL  156

Query  533   IDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK---PYQIHFTWLF  703
             +  +YL KYK AI+  K LP DDPR+F QQANVHC YC GAY   G      Q+H +WLF
Sbjct  157   VSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASWLF  216

Query  704   FPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAH  883
              PFHR+YLYF ERIL  LIDDPTF LPYW WDNP GM +P I+     S LYD+KRN  H
Sbjct  217   LPFHRYYLYFNERILAKLIDDPTFALPYWAWDNPDGMYMPTIYASSPSS-LYDEKRNAKH  275

Query  884   RRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPG  1060
                 V DL Y G E +  D +   +NLAIMY+Q+++ A  P LF G   R   GD   PG
Sbjct  276   LPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSGATTPKLFLGYPYR--AGDAIDPG  333

Query  1061  MGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG-N  1237
              GT+E+VPHN +H+W G    P +E+MGNFY+A  DP+F+ HH+NVDRMW IWKT+GG N
Sbjct  334   AGTLEHVPHNIVHKWTGLADKP-SEDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGGKN  392

Query  1238  RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrak  1417
             RKD TD DWL   F+FYDE K LVKVKV D +D  KL Y +Q +P PW   K   K +  
Sbjct  393   RKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPIPWLPKKTKAKAKTT  452

Query  1418  lrskasvsasTSVLPAT-----------LNKITTFCVTRSPTSKTPGKEE-----LLDLH  1549
              +S  S  A  + LP T           LN +    V R   S++  ++E     LL   
Sbjct  453   TKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVLLIKG  512

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVH-KDTSTTANSTIKTPTFS  1726
             +  D   F++FDV++N++D   ++  +  E+AGSF N+ H H K+  T  N         
Sbjct  513   IELDRENFVKFDVYINDEDYSVSRPKNS-EFAGSFVNVPHKHMKEMKTKTN-------LR  564

Query  1727  LAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              AI+ELLEDL  E+D+ ++VT+VPRAGG  VT+     E +
Sbjct  565   FAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEFV  605



>gb|ABI96947.1| putative polyphenol oxidase [Rhodotypos scandens]
Length=447

 Score =   385 bits (988),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 194/361 (54%), Positives = 242/361 (67%), Gaps = 21/361 (6%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +       VP +CCP   + ++D      ++ P+ S+L V
Sbjct  1     PFAFAKPVLPPDVSECGAADLPTGA---VPTNCCPPPSTKIID------FRPPTPSRLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK----PYQ  682
             R AAHA+D  Y++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G       Q
Sbjct  52    RQAAHAVDRAYIDKYTKALELMKALPDDDPRSFKQQAAVHCAYCDGAYDQVGTDPKVELQ  111

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHR+YLYFYE+IL SLI+DPTF LP+WNWD+P GM +P+IF  +  SPLYD
Sbjct  112   VHNSWLFFPFHRYYLYFYEKILGSLINDPTFALPFWNWDSPAGMEMPKIF-ANPNSPLYD  170

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKET  1042
             K RN  H+   + DL Y G + + S   ++  NL IMYRQM++NA  PLLFFG   R   
Sbjct  171   KFRNANHQPPNLVDLDYNGTDENVSKETQINANLKIMYRQMVSNAKNPLLFFGNPYR--A  228

Query  1043  GDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIW  1219
             GD   PG G+IE  PH  IH W GD   P+ E+MGNFYSA  DP+FY HHSNVDRMWTIW
Sbjct  229   GDEPDPGGGSIEGTPHGPIHLWCGDNTHPNFEDMGNFYSAGRDPIFYSHHSNVDRMWTIW  288

Query  1220  KT-LGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             KT LGG R DITD DWL + FLFY+E   LV+VKV+DSL    LGY +Q++  PW + KP
Sbjct  289   KTKLGGKRTDITDSDWLNSGFLFYNEKAELVRVKVKDSLQTETLGYVYQEVDIPWLESKP  348

Query  1397  T  1399
             T
Sbjct  349   T  349



>gb|ABI96940.1| putative polyphenol oxidase [Oemleria cerasiformis]
Length=457

 Score =   385 bits (988),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 192/362 (53%), Positives = 238/362 (66%), Gaps = 22/362 (6%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +        P +CCP   + ++D      +++PS S+L V
Sbjct  1     PFAFAKPVLPPDVSKCGAADLPTGAE---PMNCCPPPATKIID------FRLPSPSRLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D  Y++KY  A++ MK LP DDPR+F QQA VHCAYC+GAY   G P    QI
Sbjct  52    RPAAHAVDKAYIDKYYKAMELMKGLPDDDPRSFKQQAAVHCAYCDGAYDQVGFPDLELQI  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL  LI+DPTF LP+WNWD P GM +P IF D   SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFFEKILGKLINDPTFALPFWNWDAPAGMQIPAIFAD-PRSPLYDK  170

Query  866   KRNQAHR---RGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
              RN  H+      V DL Y G + + S    +  NL IMYRQM++N   PLLFFG   R 
Sbjct  171   LRNANHQPTSAANVIDLDYNGTDENISKQATINANLKIMYRQMVSNGKNPLLFFGIPYR-  229

Query  1037  ETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWT  1213
               GD   PG G+IE +PH  +H W GD    + E+MGNFYS   DP+FY HHSNVDRMW 
Sbjct  230   -AGDEPDPGGGSIEGIPHGPVHLWTGDNTQLNFEDMGNFYSXGKDPIFYSHHSNVDRMWN  288

Query  1214  IWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             IWKTLGG R D+TD DWL + FLFY+E   LV+VKV+DSLD+ KLGY +Q +  PW + K
Sbjct  289   IWKTLGGKRTDLTDSDWLNSGFLFYNENAELVRVKVKDSLDSKKLGYVYQDVDIPWLESK  348

Query  1394  PT  1399
             P 
Sbjct  349   PV  350



>gb|AEQ30073.1| polyphenol oxidase [Litchi chinensis]
Length=599

 Score =   390 bits (1001),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 243/567 (43%), Positives = 331/567 (58%), Gaps = 41/567 (7%)
 Frame = +2

Query  200   KIRCAAASSEG---RENP----ADSSLSEAKLDRRNVllglgglygayniaggSNPFALA  358
             K+ C   S+     R++P     D  L+  K+DRR VLLGLGGLYG   ++  S+P + A
Sbjct  39    KVSCKVTSNNSDHLRKSPNTSSKDGELTPKKVDRREVLLGLGGLYGVTTLS--SDPLSFA  96

Query  359   SPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAID  538
             +P+  P+   CG A +  +  KP   +CCP         D+   PS S L +RPAAH  D
Sbjct  97    APVSAPDLSRCGKADLP-AGAKPT--NCCPPK--SNKIIDFKLPPSNSPLRIRPAAHLAD  151

Query  539   DDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFP  709
             ++Y+ KY  A++ MK LP+DDPRNF QQA+VHCAYC+GAY   G P    Q+  +WLFFP
Sbjct  152   NEYIAKYYKAVELMKALPADDPRNFMQQADVHCAYCDGAYDQIGFPNLDLQVRNSWLFFP  211

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHR+YLYFYE+IL  LI DPTF +P+WNWD+P G  +P +F +  +SPLYD  RN  H+ 
Sbjct  212   FHRYYLYFYEKILGKLIGDPTFVMPFWNWDSPPGTPMPAMFAN-PKSPLYDTLRNSNHQP  270

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMG  1066
               + DL Y+G + + ++ +++ +NL +MYRQM++N+  P LF G   R   GD   PG G
Sbjct  271   PTLADLDYSGTDVTTTNEKQISSNLKVMYRQMVSNSKTPRLFLGNTYR--AGDEPDPGAG  328

Query  1067  TIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKD  1246
              +EN+PH  IH W GD + P+ ENMGNFYSAA DP+FY HHSNVDRMWT+WKTLGG R +
Sbjct  329   ALENLPHGPIHLWCGDTKQPNFENMGNFYSAARDPIFYAHHSNVDRMWTVWKTLGGKRTN  388

Query  1247  ITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPW-----------KDFK  1393
              TDPDWL   FLFYDE   LV+VKV D LD+ KLGY +Q +  PW           K   
Sbjct  389   FTDPDWLNAGFLFYDENANLVRVKVRDCLDSKKLGYVYQDVDVPWLRTKPKPKKLRKKVA  448

Query  1394  PTrkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQF  1573
                   A      +    +S  P  L+ I +  V R   S++  ++E  +  L  D+  F
Sbjct  449   KLLGPVALAAEINTKLTPSSQFPLVLDSIKSTVVPRPKKSRSKKEKEEEEEILVIDNIGF  508

Query  1574  IRfdvfvnedddvnTKEL---DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
              R  V   +    +  +    +  E+AGSF N+ H HK                L +++L
Sbjct  509   EREAVVKFDVYVNDEDQAIGPENTEFAGSFVNVPHKHKHGKKMKT------CLRLGLTDL  562

Query  1745  ledlrlenddKILVTLVPRAGGSFVTV  1825
             LEDL  E+DD ++VTLVP+ G   V++
Sbjct  563   LEDLEAEDDDSVVVTLVPKYGKGLVSI  589



>ref|XP_007211389.1| hypothetical protein PRUPE_ppa003190mg [Prunus persica]
 gb|EMJ12588.1| hypothetical protein PRUPE_ppa003190mg [Prunus persica]
Length=594

 Score =   389 bits (1000),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 243/568 (43%), Positives = 324/568 (57%), Gaps = 40/568 (7%)
 Frame = +2

Query  194   VIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPP  373
             V  +RC A +  G  +  D  L   KLDRRN+L+GLG           +NPFA A+P+  
Sbjct  50    VGGVRCQAKN--GDNDHLDQGL--GKLDRRNMLIGLGAGGLYGAAGLENNPFAFAAPVSA  105

Query  374   PETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDD  544
             P+   CGPA     +G  +   CCP    T++D      +K+P    L  R  A  +  D
Sbjct  106   PDFTECGPA--DKPDGSTI--DCCPPITKTIID------FKLPDPGPLRTRRPAQDLAKD  155

Query  545   --YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFP  709
               YL KYK A+  M+ LP DDPR+  QQA VHC+YC+G Y   G P    Q+HF WLF+P
Sbjct  156   PVYLAKYKKAVALMRALPDDDPRSLAQQAMVHCSYCDGGYPQVGFPDLEIQVHFCWLFYP  215

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWYLYFYE+I+  LI DPTF LP+WNWD P GM +PEIF D   S LYD+ RN AH+ 
Sbjct  216   FHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDPTSS-LYDQYRNAAHQP  274

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGT  1069
               + DL Y G +    D  ++K NL  MY+QM++ A    LF+G+       D  PG G 
Sbjct  275   PKLLDLNYGGSDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPY-SAGDDASPGAGN  333

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDI  1249
             IE++PHN+IH W GDP+  + ENMG FYSA  DP+FY HHSNVDRMW+I+K L G   DI
Sbjct  334   IESIPHNNIHLWSGDPKQTNGENMGAFYSAGRDPLFYSHHSNVDRMWSIYKDLLGG-TDI  392

Query  1250  TDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPT-rkrraklr  1423
                DWL TEFLFYDE K LV+VKV DSLD  KLGY +  K+P PW   KP  RK + + +
Sbjct  393   DKTDWLNTEFLFYDEKKNLVRVKVRDSLDTKKLGYVYDNKVPIPWLKAKPNPRKSQNQRK  452

Query  1424  skasvsasTSVLPATL-NKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvne  1600
             +  S    T+  PATL +KI+      S T +T  +++  D  L     +F   +    +
Sbjct  453   AAVSSGDLTTAFPATLSDKISVEVARPSTTKRTSEQKKAQDEVLVIKGIEFAGNEPLKFD  512

Query  1601  dddvnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlen  1768
                 +  +     D+ E+AGSF ++ H  K         IKT    L+I++LLE+L  E 
Sbjct  513   VFVNDDADSEAGKDQSEFAGSFIHVPHKQK-------KNIKT-NLRLSITKLLEELDAET  564

Query  1769  ddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             D  ++VTLVP+ G   +T+     E+++
Sbjct  565   DKSLVVTLVPKLGKGPITIGGFSIELLN  592



>ref|XP_008371327.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Malus domestica]
Length=585

 Score =   389 bits (998),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 246/565 (44%), Positives = 325/565 (58%), Gaps = 41/565 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC    ++G  +  D  L  A+LDRRN+L+GLG       +    NPFA A+PI  P+
Sbjct  46    RVRCK--XTKGDNDNLDQGL--ARLDRRNMLIGLGAGGLYGXV---GNPFAFAAPISAPD  98

Query  380   TKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAI--DDDYLE  553
               +C PA  S  +G  +   CCP T   T +   +++P    L  RPAA  +  D +YL 
Sbjct  99    LTTCVPA--SKPDGSTI--DCCPPT---TTTIIDFELPDSGPLRTRPAAQDVANDPEYLA  151

Query  554   KYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWY  724
             KYK A++ M+ LP DDPR+  QQA VHC+YC+G Y   G      Q+HF WLFFPFHRWY
Sbjct  152   KYKNAVEMMRALPDDDPRSHAQQAMVHCSYCDGGYPQVGYSDLEIQVHFCWLFFPFHRWY  211

Query  725   LYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTD  904
             LYFYE+I+  LI D TF LP+WNWD P GM +PEIF D   S LYD+ RN AH+   + D
Sbjct  212   LYFYEKIMGELIGDQTFALPFWNWDAPAGMYIPEIFTDTTSS-LYDQYRNTAHQPPKLLD  270

Query  905   LAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENV  1081
             L Y   +    D  ++K NL  MY+QM++NA C  LF+G+      GD   PG G IE  
Sbjct  271   LNYGXTDDDVDDATRIKENLTTMYKQMVSNATCHRLFYGEPY--SAGDEPDPGAGNIETT  328

Query  1082  PHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK-TLGGNRKDITDP  1258
             PHN+IH WVGDP  P+ E+MG FYSAA DPVFY HHSNVDRMW I+K  LGG   DI + 
Sbjct  329   PHNNIHLWVGDPTQPNGEDMGTFYSAARDPVFYSHHSNVDRMWXIYKDKLGGT--DIENT  386

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQ-KMPTPWKDFKPTrkrraklrskas  1435
             DWL  EFLFYDE K L +V   DSLD  KLGY +   +  PW   KPT ++    R    
Sbjct  387   DWLDAEFLFYDEKKNLXRVXXRDSLDTKKLGYVYDXNVSIPWLXSKPTXRKSTNKRKAXV  446

Query  1436  vsasTS-VLPATLNKITTFCVTR-SPTSKTPGKEELLDLHLAFDDTQFIRfdvfvneddd  1609
              S+  S   PATL+ I +  VTR S T +T  +++  D  L     +F   +    +   
Sbjct  447   SSSDLSTTFPATLSDIISVEVTRPSXTKRTAAQKKAQDEVLVIKGIEFAGNETVKFDVYV  506

Query  1610  vnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddK  1777
              +  +     D+ E+AGSF ++ H HK         IKT    L+I+ LLE+L  E D+ 
Sbjct  507   NDDADSLAGKDKSEFAGSFVHVPHKHK-------KNIKT-NLRLSITSLLEELDAETDNS  558

Query  1778  ILVTLVPRAGGSFVTVNKAYTEIID  1852
             ++VTLVP+ G   +T+     E+I+
Sbjct  559   LVVTLVPKVGKGPITIGGFSIELIN  583



>gb|AFL03159.1| polyphenol oxidase [Pyrus pyrifolia]
Length=593

 Score =   389 bits (999),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 240/580 (41%), Positives = 336/580 (58%), Gaps = 54/580 (9%)
 Frame = +2

Query  146   QIFLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
             Q+ L   P R+  R    K+ C A +++  +       +++KLDRRNVLLGLGGLYG   
Sbjct  31    QVSLLTKPKRSFAR----KVSCKATNNDQNDQ------AQSKLDRRNVLLGLGGLYGVAG  80

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPS  496
             +   ++PFA A PI PP+   CG A +          +CCP   + ++D      +K+P+
Sbjct  81    MG--TDPFAFAKPIAPPDVSKCGSADLPPGAEA---TNCCPPPATKIID------FKLPA  129

Query  497   FSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP  676
              +KL +RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P
Sbjct  130   PAKLRIRPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFP  189

Query  677   ---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +
Sbjct  190   ELELQVHDSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYAD-PK  248

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             +PLYDK R+  H+   + DL Y   E + S    +  NL IMYRQM++N+    LFFG  
Sbjct  249   TPLYDKFRSAKHQPPTLIDLDYNRTEDNVSTETTINANLKIMYRQMVSNSKNAQLFFGNP  308

Query  1028  IRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRM  1207
              R   G   PG G+IE  PH S+H W GD   P+ E+MGNFYSA  DPVFY HHSNVDRM
Sbjct  309   YRAGDG-PNPGGGSIEGTPHGSVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRM  367

Query  1208  WTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKD  1387
             W+IW+TLGG R D+ D DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW  
Sbjct  368   WSIWRTLGGKRTDLADKDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLS  427

Query  1388  FKPT--------------rkrraklrskasvsasTSVLPATL-NKITTFCVTRSPTSKTP  1522
              KPT                      + +S   + +  P +L +KI+T         ++ 
Sbjct  428   SKPTPRRAKVALGKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKISTVVKRPKQKKRSK  487

Query  1523  GKEELLDLHLAFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTST  1690
               +E  +  L  +  +F R      +    +  +L    D+ E+AGSF ++ H HK    
Sbjct  488   KAKEDEEEILVIEGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKK  547

Query  1691  TANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGG  1810
               N+ ++     L +++LLE++  E+DD ++VTLVP+ G 
Sbjct  548   I-NTILR-----LGLTDLLEEIEAEDDDSVVVTLVPKYGA  581



>ref|XP_008346980.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   387 bits (994),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 237/357 (66%), Gaps = 11/357 (3%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             S+PFA+A P+ PP+   CG A   +     VP +CCP T         +K PS +KL VR
Sbjct  30    SDPFAVAKPVXPPDLAKCGAADFPSGA---VPINCCPPTSQKIVD---FKFPSPTKLRVR  83

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH +D  Y+EKY  AI+ MK LP DDPR+F QQA++HCAYC+GAY   G P    QIH
Sbjct  84    PAAHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIH  143

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
               WLFFPFHR+Y YF ERIL  LIDDPTF LP+WNWD P GM LP +F +  +SPLYD+ 
Sbjct  144   QCWLFFPFHRYYXYFXERILAKLIDDPTFALPFWNWDAPAGMQLPALFAN-PDSPLYDEL  202

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             R  +H+   + DL + G + + S+  +++ NL IMYRQM++N+  PLLFFG   R  T +
Sbjct  203   RAASHQPPTLIDLDFNGTDETMSNDAQIEANLKIMYRQMVSNSKKPLLFFGSPYRAGT-E  261

Query  1049  TGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL  1228
               PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSN+DRMW IWK++
Sbjct  262   PDPGGGSIETTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFFSHHSNIDRMWNIWKSI  321

Query  1229  GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             G    DI D DWL T FLFYDE   LV+V V D+LDN KLGYT++ +  PW   +PT
Sbjct  322   GTKNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLKSRPT  378



>ref|XP_011082866.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Sesamum 
indicum]
Length=580

 Score =   388 bits (997),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 251/570 (44%), Positives = 344/570 (60%), Gaps = 42/570 (7%)
 Frame = +2

Query  155   LNPNPSRA---ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayn  325
              +P PS+    +RR    ++ C    ++   NP+    ++  +DRRN+LLGLGGLYGA N
Sbjct  27    FSPKPSQLLTDSRRSHRFQVSCNGGINQ---NPS----ADGTVDRRNLLLGLGGLYGAAN  79

Query  326   iaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK  505
             +   S   A A+PI PPE K+CG A    +N   +  +CCP     T     YK+P  + 
Sbjct  80    LVSDSQ--AYAAPIEPPEFKNCGVARDVQTNDI-LDVNCCPPV---TDKIIDYKLPPVTN  133

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDP---RNFYQQANVHCAYCNGAYQLAG--  670
               +RPAAH +  +YL K++ AI++MK L  DDP   R F QQAN+HCAYCNGA+   G  
Sbjct  134   WRIRPAAHRVSKEYLAKFEEAIRRMKALDKDDPTDPRGFMQQANIHCAYCNGAHDQVGFK  193

Query  671   -KPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEE  847
                 Q+H +WLFFPFHRWYLYFYERIL  LIDDPTF LP+WNWDNP+GM +P IF D   
Sbjct  194   DLDLQVHNSWLFFPFHRWYLYFYERILGKLIDDPTFCLPFWNWDNPKGMQMPRIF-DKTG  252

Query  848   SPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKA  1027
             SPLY+  R++ HR   + DL+ +     + D Q V NNL +MY +M+ +    L F GK 
Sbjct  253   SPLYNVNRDKTHRPPALIDLSLS---NISDDLQVVVNNLTVMYSEMIRSVNSTLDFMGKP  309

Query  1028  IRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDR  1204
              RK  GD   PGMG+ E   H + H WVGDP + + E+MGNFYSA  D +FY HH+NVDR
Sbjct  310   YRK--GDNPSPGMGSSERGSHVAAHVWVGDPNNRYREDMGNFYSAGRDILFYSHHANVDR  367

Query  1205  MWTIWKTLGGNR-KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPW  1381
             MW+IW+TL  +  KDITDPD+L   FLFYDE K LV+V+V D +D+ K+GY F+K+  PW
Sbjct  368   MWSIWRTLKTDVPKDITDPDYLNAAFLFYDENKQLVRVRVADCIDHKKMGYDFEKVDIPW  427

Query  1382  KDFKP--TrkrraklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLA  1555
              +++P     +       +    +  + P  L KIT   V +S  +K    E L+  ++ 
Sbjct  428   LNYRPPKKAAKTKIQNISSGAQKAEGLFPLNLKKITRVLVPKS--AKGKADEVLVLENIE  485

Query  1556  FDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAI  1735
              D TQ+I+       D+D N KELD+ EYAG+F+ + H  K     +N        +L +
Sbjct  486   TDATQYIK-FDVFVNDEDDNAKELDKAEYAGTFAQVPHKTKSKKDISN-------INLRL  537

Query  1736  SelledlrlenddKILVTLVPRAGGSFVTV  1825
             +EL ED+ +++DD I+VTLVPR+ G  VT+
Sbjct  538   TELYEDIDIDDDDTIVVTLVPRSNGDDVTI  567



>gb|ABM68051.1| polyphenol oxidase [Trifolium pratense]
Length=604

 Score =   389 bits (999),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 231/516 (45%), Positives = 307/516 (59%), Gaps = 40/516 (8%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKL  508
             +N  A  +P+P P+   C  +T  + +    P  CCP   S ++D      +K P+F KL
Sbjct  89    NNSLAFGAPVPIPDLSKCVKSTPKDID----PVDCCPPFSSNIID------FKFPTFGKL  138

Query  509   NVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---Y  679
               RPAA  +DDDY+ KYK A++ MK LP+DDPR+F QQA VHCAYC G Y   G P    
Sbjct  139   RERPAAQLVDDDYIAKYKEALKLMKALPADDPRSFEQQAKVHCAYCVGGYTQLGYPGVQL  198

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
              +H +WLFFPFHRWYLYFYERIL SLI+DPTF +P+WNWD P GM +P IF D + S LY
Sbjct  199   SVHNSWLFFPFHRWYLYFYERILGSLINDPTFAIPFWNWDAPDGMRIPSIFTDPKSS-LY  257

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDF----------QKVKNNLAIMYRQMLTNAPCPL  1009
             D KR+  H+   + DL Y   +   ++           Q+++ NL++M+RQM+TN+    
Sbjct  258   DPKRDCRHQLPKIVDLDYTKSKEDPTNVNYVPNYPSAEQQIQINLSVMHRQMITNSQTSR  317

Query  1010  LFFGKAIRK--ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYC  1183
              FFG   R   E G    G G+IE  PH  IH W GDP+ P  E+MGNFYSA  DP+FY 
Sbjct  318   QFFGSPYRAGDEGGVDDKGPGSIELTPHTPIHIWTGDPKQPVGEDMGNFYSAGRDPLFYA  377

Query  1184  HHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQ  1363
             HH NVDRMW+IWKTL G  KD  D DWL +EFLFYDE K LVKVKV+D +D  KLGY +Q
Sbjct  378   HHGNVDRMWSIWKTLPGISKDCNDNDWLDSEFLFYDENKNLVKVKVKDCVDESKLGYCYQ  437

Query  1364  KMPTPWKDFKPT---rkrraklrskasvsasTSVLPATLNKITTFCVTR----SPTSKTP  1522
             K+  PW D KP    R+ R+K +       S    P  L+ + +  V R      + +  
Sbjct  438   KVDIPWIDSKPKPAGRRVRSKGKLLTKPRKSVDNFPIVLDSVVSTIVKRPKKSRSSKEKK  497

Query  1523  GKEELLDLH-LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTAN  1699
              +EE+L ++ + FDD   ++FDV VN++DD      +  E+AGSF +L HVH        
Sbjct  498   DQEEILVIYGIEFDDKIEVKFDVIVNDEDDKVIGA-ENTEFAGSFVSLMHVHNKKINMKK  556

Query  1700  STIKTPTFSLAISelledlrlenddKILVTLVPRAG  1807
             +T+      + +++LLE L   +DD I VTL+PR G
Sbjct  557   NTVT--CLRIGLTDLLEGLNAADDDSIRVTLIPRYG  590



>ref|XP_009773173.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
sylvestris]
Length=606

 Score =   389 bits (998),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 217/521 (42%), Positives = 299/521 (57%), Gaps = 28/521 (5%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
              +PFA A+P+P P+   CGPA +        P +CCP T  +    D+   P  + L  R
Sbjct  98    GHPFAFAAPVPGPDVSKCGPADLPPG---AAPVNCCPPTTANII--DFQLPPPSTTLRTR  152

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH+ D  Y+EK+  AIQ MK LP DDPR+F QQANVHCAYC+GAY   G P    Q+H
Sbjct  153   PAAHSADSAYIEKFNRAIQLMKQLPDDDPRSFRQQANVHCAYCDGAYDQLGFPNSELQVH  212

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
             F+WLF PFHR YLYF+E+IL SLI+DPTF +P+WNWD+P GM LP ++ +   S L+D  
Sbjct  213   FSWLFLPFHRCYLYFFEKILGSLINDPTFVIPFWNWDHPDGMRLPAMYAN-RSSSLFDPL  271

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             R++ H+   + DL + G + + S+ Q+   NL IMYRQM++    P  F G   R   G+
Sbjct  272   RDRRHQPPVMVDLDFNGTDPNISNAQQTSQNLTIMYRQMVSLGSTPATFLGDPYR-AGGE  330

Query  1049  TGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL  1228
              G G G++EN+PH  +H W GD   P+ ENMG+FYSAA DP+FY HHSN+DR+W++WKTL
Sbjct  331   PG-GAGSLENIPHGPVHVWTGDRTQPNFENMGDFYSAARDPIFYAHHSNIDRLWSVWKTL  389

Query  1229  GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkr  1408
             GG R+D TDPD+L   FLFYDE   +V+++V D LD  +LGY +Q +  PW + +P  + 
Sbjct  390   GGRRQDFTDPDFLNASFLFYDEKAQMVRIRVRDCLDTTRLGYVYQGVANPWINSRPRARV  449

Query  1409  raklrskasvsasTS---------VLPATLNKITTFCVTRSPTSKTP----GKEELLDLH  1549
              + L S   +  + +         V P  L+ +    V R    +       KEE L + 
Sbjct  450   SSALSSVRRLVEARAADNFPSAKDVFPTKLDHVIRVMVKRPIKKRNKKEKDAKEEFLVVE  509

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSL  1729
                 +T        +  D+D      +  E+AGSF N+ H     S     T       L
Sbjct  510   GIELETDVFVKFDVLINDEDETVISPNNAEFAGSFVNVPHHSHGKSDKKRKT----KLKL  565

Query  1730  AISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
             AI+ELLEDL  E+DD ++VT VP+ G   V +      + D
Sbjct  566   AITELLEDLDAEDDDHVVVTFVPKNGSGAVKIGGVKIVLED  606



>ref|XP_008224999.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=588

 Score =   388 bits (997),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 240/567 (42%), Positives = 327/567 (58%), Gaps = 44/567 (8%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             ++RC A  + G ++     LS  +LDRRN+L+GLG      +    +NPFA A+P+  PE
Sbjct  48    RVRCKA--TNGGDDHLQQGLS--RLDRRNMLIGLGAGGLYGSTGLENNPFAFAAPVSAPE  103

Query  380   TKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDD--  544
                CGPA     +G  +   CCP   +T++D      +K+P    L  R AA  +  D  
Sbjct  104   FTKCGPA--DKPDGSTI--DCCPPTATTIID------FKLPDKGPLRTRLAAQNVAKDPV  153

Query  545   YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAY---QLAGKPYQIHFTWLFFPFH  715
             YL KYK AI  M+ LP DDPR+F QQA VHC+YC+G Y   + +    Q+HF WLF+PFH
Sbjct  154   YLAKYKKAIALMRALPDDDPRSFAQQAKVHCSYCDGGYPQVEYSDLEIQVHFCWLFYPFH  213

Query  716   RWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGY  895
             RWYLYF+E+I+  LI DPTF LP+WNWD P GM +PEIF D   S LYD+ RN AH+   
Sbjct  214   RWYLYFFEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDTTSS-LYDQYRNAAHQPPK  272

Query  896   VTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIE  1075
             + DL Y G +    D  ++K NL  MY+QM++ A    LF+G+       D  PG G IE
Sbjct  273   LLDLNYGGTDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGEPY-SAGDDPNPGAGNIE  331

Query  1076  NVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKT-LGGNRKDIT  1252
             ++PHN+IH W GD    + E+MG FYSA  DP+FY HHSNVDRMW+I+K+ LGG   DI 
Sbjct  332   SIPHNNIHLWTGDTTQTNGEDMGAFYSAGRDPLFYAHHSNVDRMWSIYKSKLGGT--DIE  389

Query  1253  DPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPTrkrraklrsk  1429
               D+L  EFLFYDE K LV+VKV DSLD  KLGY +  K+  PW  +KPT ++ +  R  
Sbjct  390   KKDYLDAEFLFYDEKKNLVRVKVRDSLDTTKLGYVYDNKVEIPWLTYKPTARKSSNKRKA  449

Query  1430  asvsa-sTSVLPATLNKITTFCVTRSPTSK-TPGKEELLDLHLAFDDTQFIRfdvfvned  1603
                SA  T+  PA L    +  V R+ T+K T  +++  D  L     ++   +    + 
Sbjct  450   TVSSADLTTNFPAPLTDTISVEVARTSTTKRTSAQKKAQDEVLVISGIKYAGNETVKFDV  509

Query  1604  ddvnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlend  1771
                +  E     D+ E+AGSF  + H  K   TT        T  L+I++LLE+L  E D
Sbjct  510   YVNDDAESLAGKDKSEFAGSFIQVPHKGKKDITT--------TLRLSITKLLEELDAETD  561

Query  1772  dKILVTLVPRAGGSFVTVNKAYTEIID  1852
               ++VTLVP+ G   +T+    TE+I+
Sbjct  562   SSVVVTLVPKVGT--ITIGGVSTELIN  586



>ref|XP_002519016.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF43227.1| Polyphenol oxidase, chloroplast precursor, putative [Ricinus 
communis]
Length=589

 Score =   388 bits (997),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 236/532 (44%), Positives = 308/532 (58%), Gaps = 46/532 (9%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSF-SK  505
              +P A A P+  P+   CG A + +S     P +CCP   + ++D      +K+PS  S 
Sbjct  74    GDPLAFAKPVSAPDLTKCGKADLPSSAK---PTNCCPPPSTKILD------FKLPSSNSP  124

Query  506   LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---  676
             L +RPAAH +DD YL KY  AI+ MK LP DDPR+F QQANVHCAYC+GAY   G P   
Sbjct  125   LRIRPAAHVVDDAYLAKYSKAIELMKALPDDDPRSFMQQANVHCAYCDGAYHQVGLPDLD  184

Query  677   YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPL  856
              Q+H +WLFFPFHR++LYF+E+IL  LIDDPTF LP+WNWD+P GM LP I+ D  +SPL
Sbjct  185   LQVHNSWLFFPFHRYFLYFHEKILGKLIDDPTFALPFWNWDSPAGMQLPAIYVD-PKSPL  243

Query  857   YDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK  1036
             YD+ RN+ H+   + DL Y G E   S  + + +NL IMYRQM++N     LF G A R 
Sbjct  244   YDQFRNKNHQPPTLVDLDYNGSENPTSKQELLSSNLTIMYRQMVSNGKTARLFHGSAYR-  302

Query  1037  ETGDTG-PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWT  1213
               GD   PG G+IEN+PH  +H W GD   P+ E+MGNFYSAA DP+F+ HHSNVDRMWT
Sbjct  303   -AGDEADPGAGSIENIPHGPVHVWCGDNTQPNLEDMGNFYSAARDPIFFAHHSNVDRMWT  361

Query  1214  IWKTLGGN-RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDF  1390
             IWKTLGGN R + TDPDWL  EF+FYDE    V+VKV D +D  KLGY +Q +  PW   
Sbjct  362   IWKTLGGNKRTEFTDPDWLDAEFIFYDENANPVRVKVRDCIDTKKLGYIYQDVDIPWLKS  421

Query  1391  KPTrkrraklrskasvsasTSVLPA--TLN--KITTFCVTRSPTSKTPGKEE--------  1534
             +P  +R  K  +            A  TLN   IT F +       T  K          
Sbjct  422   RPKSRRLIKKVANKVFHHDGQAAHAAETLNLPPITAFPLVLDKVISTVAKRPKKSRSKKE  481

Query  1535  -------LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTT  1693
                    LL   + F+    ++FDV+VN++ D  +   D  E+AGSF N+          
Sbjct  482   KEEEEEVLLIDAIEFERNALVKFDVYVNDEHDSTSARPDNSEFAGSFVNIP------HKH  535

Query  1694  ANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              +         L +++LLED+  E+DD ++VTLVPR G   V +     + I
Sbjct  536   KHGKKMKTCLRLGLTDLLEDMGAEDDDTVVVTLVPRYGKGLVKIGGIMIDYI  587



>ref|XP_004485748.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Cicer arietinum]
Length=601

 Score =   388 bits (997),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 228/523 (44%), Positives = 311/523 (59%), Gaps = 41/523 (8%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             +NPFALASPI PP+  +CGP  +      P   +CCP    +      +KIPS ++ L +
Sbjct  84    NNPFALASPISPPDLSTCGPPDLP-LGATPNNINCCPPNSTNIID---FKIPSTNQPLRI  139

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP----YQ  682
             R AAH +D+ YL KY  A++ MK LPSDDPR+F QQAN+HCAYC+GAY   G P     Q
Sbjct  140   RQAAHLVDNKYLRKYNKAVELMKSLPSDDPRSFIQQANIHCAYCDGAYSQVGFPSDLDLQ  199

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             +H +WLFFPFHRWYLYFYERIL SLI+DPTF LP+WN+D P GM  P I+ D + S LYD
Sbjct  200   VHNSWLFFPFHRWYLYFYERILGSLINDPTFALPFWNYDAPNGMQFPTIYTDTKSS-LYD  258

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKET  1042
             K RN  H+   + +L + G +    + ++V  NL IMYRQ+++N     LF G + R   
Sbjct  259   KLRNTDHQPPTLINLNFDGDDDDDVN-ERVSTNLTIMYRQVVSNGKTSKLFLGNSYR--A  315

Query  1043  GDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIW  1219
             GD   PG G++ENVPH ++H W GD   P+ E+MG FYSAA DP+F+ HHSN+DR+W+IW
Sbjct  316   GDEPDPGAGSVENVPHGTVHGWSGDKTQPNREDMGVFYSAARDPIFFSHHSNIDRLWSIW  375

Query  1220  KTLGG-NRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKP  1396
             KTLGG NRKD TD DWL++ FLFYDE K LV VKV+D LD   LGY +Q +  PW   KP
Sbjct  376   KTLGGKNRKDFTDSDWLESGFLFYDENKNLVNVKVKDCLDTKNLGYVYQDVDIPWLKSKP  435

Query  1397  TrkrraklrskasvsasTSV--------------LPATLNKITTFCVTRSPTSKTPGKEE  1534
             T + + + + + +      +               P  L+ + +  V R   S++  ++E
Sbjct  436   TPRGKTQKKVEVAQGLHFGIGEAHAFESSRKYVKFPLVLDNVVSTIVKRPKKSRSKKEKE  495

Query  1535  LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRV------EYAGSFSNLAHVHKDTSTTA  1696
               +  L  +  +F R      + D     E D+V      E+AGSF N+ H +++     
Sbjct  496   EEEEVLVIEGIEFER--NLAVKFDVFINDEDDKVIRPVDTEFAGSFVNVPHFNENKGKKK  553

Query  1697  NSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTV  1825
                       L +++LLEDL  E+DD ++VTLVPR G   V +
Sbjct  554   ----IISCLRLGLTDLLEDLGAEDDDSVVVTLVPRNGKGLVKI  592



>sp|P43311.1|PPO_VITVI RecName: Full=Polyphenol oxidase, chloroplastic; Short=PPO; AltName: 
Full=Catechol oxidase; Flags: Precursor [Vitis vinifera]
 pir||S52629 catechol oxidase (EC 1.10.3.1) precursor - grape
 emb|CAA81798.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   388 bits (997),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 259/581 (45%), Positives = 336/581 (58%), Gaps = 41/581 (7%)
 Frame = +2

Query  179   ARRGDVIKIRCAAASSEGRENPADS--SLSEAKLDRRNVllglgglygayniaggSNPFA  352
             +RR    K+ C +A+ +   +        S  KLDRRNVLLG+GGLYGA    G + P A
Sbjct  42    SRRFAPSKVSCNSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLA  101

Query  353   LASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHA  532
               +PI  P+   CG AT+ +      P +CCP   + T   D+    S S +  RPAAH 
Sbjct  102   FGAPIQAPDISKCGTATVPDGV---TPTNCCPP--VTTKIIDFQLPSSGSPMRTRPAAHL  156

Query  533   IDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK---PYQIHFTWLF  703
             +  +YL KYK AI+  K LP DDPR+F QQANVHC YC GAY   G      Q+H +WLF
Sbjct  157   VSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASWLF  216

Query  704   FPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAH  883
              PFHR+YLYF ERIL  LIDDPTF LPYW WDNP GM +P I+     S LYD+KRN  H
Sbjct  217   LPFHRYYLYFNERILAKLIDDPTFALPYWAWDNPDGMYMPTIYASSPSS-LYDEKRNAKH  275

Query  884   RRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPG  1060
                 V DL Y G E +  D +   +NLAIMY+Q+++ A  P LF G   R   GD   PG
Sbjct  276   LPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSGATTPKLFLGYPYR--AGDAIDPG  333

Query  1061  MGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG-N  1237
              GT+E+ PHN +H+W G    P +E+MGNFY+A  DP+F+ HH+NVDRMW IWKT+GG N
Sbjct  334   AGTLEHAPHNIVHKWTGLADKP-SEDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGGKN  392

Query  1238  RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrak  1417
             RKD TD DWL   F+FYDE K LVKVKV D +D  KL Y +Q +P PW       K +  
Sbjct  393   RKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPIPWLPKNTKAKAKTT  452

Query  1418  lrskasvsasTSVLPAT-----------LNKITTFCVTRSPTSKTPGKEE-----LLDLH  1549
              +S  S  A  + LP T           LN +    V R   S++  ++E     LL   
Sbjct  453   TKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVLLIKG  512

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVH-KDTSTTANSTIKTPTFS  1726
             +  D   F++FDV++N++D   ++  +  E+AGSF N+ H H K+  T  N         
Sbjct  513   IELDRENFVKFDVYINDEDYSVSRPKNS-EFAGSFVNVPHKHMKEMKTKTN-------LR  564

Query  1727  LAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              AI+ELLEDL  E+D+ ++VT+VPRAGG  VT+     E +
Sbjct  565   FAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEFV  605



>gb|EYU26238.1| hypothetical protein MIMGU_mgv1a025156mg [Erythranthe guttata]
Length=587

 Score =   387 bits (995),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 239/558 (43%), Positives = 333/558 (60%), Gaps = 31/558 (6%)
 Frame = +2

Query  179   ARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALA  358
             A+R + ++I C+  S + +++  ++   +  +DRRNVLLG GGL GA N+   S   A A
Sbjct  37    AKRNNRLQISCSD-SQKQKDSSQNADTPQGNVDRRNVLLGFGGLCGAANLI--STHTASA  93

Query  359   SPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAID  538
             +P+  P+   CG AT  N+ GK +  +CCP    +      +K P   ++  RP+AH + 
Sbjct  94    NPVQAPQIDKCGVATNLNT-GKQLDINCCPPMGKNIID---FKPPPLVQMRTRPSAHRVS  149

Query  539   DDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK---PYQIHFTWLFFP  709
              +Y+ KY TAI +MK LP DDPR+F QQAN+HCAYCNGAY   G+     Q+H +WLFFP
Sbjct  150   AEYMFKYNTAIDRMKRLPKDDPRSFMQQANIHCAYCNGAYDQPGQGTLDLQVHNSWLFFP  209

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWYLYFYERIL  LI DPTF LP+WNWDNP+GM +P +F  D ++ +YD KRN A+  
Sbjct  210   FHRWYLYFYERILGKLIGDPTFALPFWNWDNPKGMTIPPMF-VDPKAAIYDAKRNPANMP  268

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGT  1069
               V DL   G +      Q V NNL +MY +M+        F GK  R+ T    PG G 
Sbjct  269   PAVVDLGLTGNKDP---LQVVSNNLTVMYSEMVRANSDIYDFMGKPYREGTL-VNPGPGA  324

Query  1070  IENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNR---  1240
              E   H +IH +VGDPR P  E++GNFYSA  DP+FYCHH+NVDRMWT+W+    N    
Sbjct  325   SERGSHVAIHVFVGDPREPSGEDLGNFYSAGRDPLFYCHHANVDRMWTLWQYFLPNNKLI  384

Query  1241  -KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK--PTrkrr  1411
              K ITDPD+L   FLFYDE   LV+V V+D LDN KLGY F+++  PW D++  P   + 
Sbjct  385   DKKITDPDYLNASFLFYDENAQLVRVTVKDCLDNTKLGYDFERVDLPWLDYRPPPQTAQA  444

Query  1412  aklrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvf  1591
               +R+ ++   + +V P  L+ I    + +  T K    E L+   +  D ++F++    
Sbjct  445   KVMRTVSTTRKADAVFPLKLDGIARVLIQK--TKKGKADELLVIEDITVDTSKFLK-FDV  501

Query  1592  vnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlend  1771
                D+D N  ELD+  YAG+++ +   HK    TA +TI+     L ++EL +D+ +  D
Sbjct  502   FVNDEDDNVGELDKAAYAGTYAQVP--HKTNEKTATTTIR-----LKLTELYDDMDVTED  554

Query  1772  dKILVTLVPRAGGSFVTV  1825
             D +LVTLVPR  G  VT+
Sbjct  555   DTVLVTLVPRHEGEGVTI  572



>ref|XP_008349252.1| PREDICTED: polyphenol oxidase, chloroplastic-like, partial [Malus 
domestica]
Length=542

 Score =   386 bits (991),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 235/357 (66%), Gaps = 11/357 (3%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             S+PFA+A P+ PP+   CG A   +     VP +CCP T         +K PS +KL VR
Sbjct  30    SDPFAVAKPVXPPDLAKCGAADFPSGA---VPXNCCPPTSQKIVD---FKFPSPTKLRVR  83

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAAH +D  Y+EKY  AI+ MK LP DDPR+F QQA++HCAYC+GAY   G P    QIH
Sbjct  84    PAAHTVDKAYIEKYSKAIELMKALPDDDPRSFTQQADLHCAYCDGAYDQVGFPNLELQIH  143

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
               WLFFPFHR+Y YF ERIL  LIDDPTF LP+WNWD P GM LP +F +  +SPLYD+ 
Sbjct  144   QCWLFFPFHRYYXYFXERILAKLIDDPTFALPFWNWDAPAGMQLPALFAN-PDSPLYDEL  202

Query  869   RNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD  1048
             R  +H+   + DL + G + + S   ++  NL IMYRQM++N+  PLLFFG   R  T +
Sbjct  203   RAASHQPPTLIDLDFNGTDETMSXDAQIXANLKIMYRQMVSNSKKPLLFFGSPYRAXT-E  261

Query  1049  TGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTL  1228
               PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DP+F+ HHSN+DRMW IWK++
Sbjct  262   PDPGXGSIETTPHGPVHXWTGDNTQPNFEDMGNFYSAXRDPIFFSHHSNIDRMWNIWKSI  321

Query  1229  GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             G    DI D DWL T FLFYDE   LV+V V D+LDN KLGYT++ +  PW   +PT
Sbjct  322   GTKNXDINDKDWLDTGFLFYDENAELVRVTVRDTLDNKKLGYTYEDVEIPWLXSRPT  378



>gb|AII22006.1| polyphenol oxidase-4 [Gossypium hirsutum]
Length=584

 Score =   387 bits (994),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 237/549 (43%), Positives = 315/549 (57%), Gaps = 41/549 (7%)
 Frame = +2

Query  263   EAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCG----PATISNSNGKPV  430
             + K DRR++LLGLGGLYG  ++   ++  A A P+  P+   CG    P   +N N    
Sbjct  53    QNKFDRRDILLGLGGLYGVSSL---NDSLAFAKPVTGPDFTHCGRPDLPIGAANIN----  105

Query  431   PYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRN  610
                CCP     T   D+   PS + L  RPAAH ++DDYL K+  AI+ MK LP+ DPR+
Sbjct  106   ---CCPPP--STKIVDFVLPPSNAPLQTRPAAHLVNDDYLAKFSKAIELMKALPASDPRS  160

Query  611   FYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTL  781
             F QQANVHCAYC+GAY   G P    Q+H +WLFFPFHR+YLYF+E+IL  LIDDPTF +
Sbjct  161   FMQQANVHCAYCDGAYHQLGFPDLDLQVHNSWLFFPFHRFYLYFFEKILGKLIDDPTFAM  220

Query  782   PYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNN  961
             P+WNWD+P GM +P I+ +   SPLYDK RN  H+   + DL Y G + + S   ++ +N
Sbjct  221   PFWNWDSPAGMQMPAIYAN-PNSPLYDKLRNARHKPPTLLDLDYNGVDETLSSKDQISSN  279

Query  962   LAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENM  1141
             L +MYRQM++N     LF G A R    +  PG G++EN+PH  +H W GD    + ENM
Sbjct  280   LNVMYRQMVSNGKTAKLFLGNAYRAGE-EPDPGAGSLENIPHGLVHIWCGDNTQQNFENM  338

Query  1142  GNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKV  1321
             GNFYSA  DP+FY HHSNVDRMW++WKTLGG R D TD DWL + FLFYDE   LV+VKV
Sbjct  339   GNFYSAGRDPIFYAHHSNVDRMWSVWKTLGGKRTDFTDSDWLDSAFLFYDENANLVRVKV  398

Query  1322  EDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTS----------VLPATL  1471
              D LD  KL Y +Q +  PW   KPT KR      +A   A+ +            P  L
Sbjct  399   RDCLDTKKLRYEYQNVEIPWLKTKPTPKRVISKVKRALGVANAAETKKMVVRNFKFPLVL  458

Query  1472  NKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKEL----DRVE  1639
             + I +  V R   S++  +EE  +  L  ++ +F R  V   +    +  +     D  E
Sbjct  459   DDIVSLEVARPKKSRSRKEEEEEEEVLVIENIEFDRHQVVKFDVYINDEDDTVIGPDNTE  518

Query  1640  YAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFV  1819
             +AGSF N+ H HK     A          L ++ LLE+L  E+DD ++VTLVP+ G    
Sbjct  519   FAGSFVNVPHKHKHGKKMAT------FLRLGLTYLLEELDAEDDDGVVVTLVPKFGKGLA  572

Query  1820  TVNKAYTEI  1846
              +     E 
Sbjct  573   KIGGIKIEF  581



>gb|ACN86310.1| polyphenol oxidase [Juglans regia]
Length=603

 Score =   386 bits (992),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 250/571 (44%), Positives = 337/571 (59%), Gaps = 38/571 (7%)
 Frame = +2

Query  158   NPNPSRAARRGDVIKIRCAAASSEG-RENPADSSLSEAKLDRRNVllglgglygayniag  334
             N   S+  ++   +  R A  ++ G ++N  +    + K DRR+VLLGLGG+YGA N+  
Sbjct  35    NTQVSKVGKQYHHLTTRVACRATNGDQQNINNGQNPQGKFDRRDVLLGLGGMYGAANLC-  93

Query  335   gSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNV  514
              ++PFALA P+  PE   C  A +       +P +CCP T       D+      + L V
Sbjct  94    -NDPFALADPVSAPELTLCSEADLP---AGALPVNCCPPT--SKKIKDFVLPSQNTPLRV  147

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAH +D+DY+ KY   I+ MK LP+DDPR+F QQANVHCAYC+GAY   G P    Q+
Sbjct  148   RPAAHLVDNDYIAKYNKGIELMKSLPADDPRSFTQQANVHCAYCDGAYTQVGFPDLSLQV  207

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H  WLFFPFHR+Y+YF+E+IL  LI DPTF LP+WNWD+P GM LP ++     S +YD 
Sbjct  208   HECWLFFPFHRYYVYFFEKILGKLIGDPTFALPFWNWDSPPGMQLPSLYAV-SNSAIYDP  266

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              RN  H+   + DL Y     S +   +V +NL IMYRQM++ A  P LFFG   R   G
Sbjct  267   LRNANHQPPTIIDLDYGETSESTTTTDQVPSNLKIMYRQMVSGAKNPTLFFGSPYR--AG  324

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG GTIE+ PHN+IH W GD   P+ ENMGNFYSA  DP+F+ HHSNVDRMWTIWK
Sbjct  325   DEPDPGAGTIESTPHNNIHLWTGDDTQPNIENMGNFYSAGRDPIFFAHHSNVDRMWTIWK  384

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTr  1402
             TLGG RKDITDPDWL + F FYDE    V+VKV+D +DN KL Y +Q +  PW   KPT 
Sbjct  385   TLGGKRKDITDPDWLNSSFFFYDENADPVRVKVKDCVDNTKLRYVYQDVEIPWLKTKPTP  444

Query  1403  krraklrsk----------asvsasTSV-LPATLNKITTFCVTRSPTSKTPGKEELLDLH  1549
             ++    +            A  + ++SV  P  L+K+ +  V R   S++  +++  +  
Sbjct  445   RKSRVKKVAKAFPAGHGGVAQAAETSSVKFPIVLDKVISTVVARPKKSRSKKEKDDEEEV  504

Query  1550  LAFDDTQF-----IRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKT  1714
             L  +  +      ++FDVF+N++DD  T      E+AGSF ++    +            
Sbjct  505   LVIEGIEVERDIPVKFDVFINDEDDAPTGPGINTEFAGSFVSVPQQKQTKKKKT------  558

Query  1715  PTFSLAISelledlrlenddKILVTLVPRAG  1807
                 + IS+LLEDL  E+DD ++VTLVPR G
Sbjct  559   -YLRIGISDLLEDLGAEDDDSVVVTLVPRFG  588



>emb|CBZ41490.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=601

 Score =   386 bits (991),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 242/550 (44%), Positives = 329/550 (60%), Gaps = 37/550 (7%)
 Frame = +2

Query  257   LSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPY  436
             +   K+DRRN+LLGLGGLYGA    G SN  A A PI  P+   CGP  +       +  
Sbjct  65    IDSDKVDRRNILLGLGGLYGAAASFG-SNSLAFADPIMAPDVTKCGPPDLPKG---AIRT  120

Query  437   SCCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNF  613
             +CCP +   T     +K+PS S  L +RPAAH +D DY+ K+  AI+ MK LP+DDPR+F
Sbjct  121   NCCPPS---TTKILDFKLPSPSNTLRIRPAAHLVDKDYITKFNKAIKLMKALPNDDPRSF  177

Query  614   YQQANVHCAYCNGAYQLAG---KPYQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLP  784
               QA+VHCAYC+GAY   G      Q+H +WLF PFHR+Y+YF+E+I   LI+DPTF +P
Sbjct  178   KNQADVHCAYCDGAYDHFGFQDLDLQVHASWLFLPFHRYYIYFFEKICGKLINDPTFAIP  237

Query  785   YWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNL  964
             +WNWD P GM +P+I+ + ++S LYD  R+  H+   + DL Y G + + +  ++   NL
Sbjct  238   FWNWDAPDGMTIPDIYTN-KKSSLYDALRDAKHQPPSLVDLDYNGIDENLNPSKQTSTNL  296

Query  965   AIMYRQMLTNAPCPLLFFGKAIRKETGDTG-PGMGTIENVPHNSIHRWVGDPRSPHNENM  1141
              I+YRQM++++    LF G   R   GD   PG G+IEN+PH+ +H W GD    + E+M
Sbjct  297   KILYRQMVSSSKTASLFMGNPYR--AGDEANPGAGSIENIPHDPVHIWTGDRSQRNGEHM  354

Query  1142  GNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKV  1321
             GNFYSAA DP+FY HH+N+DRMW+IWKTLGG RKD TD DWL + F FYDE   LV+VKV
Sbjct  355   GNFYSAARDPIFYAHHANIDRMWSIWKTLGGRRKDFTDKDWLDSSFSFYDENADLVRVKV  414

Query  1322  EDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTS-----------VLPAT  1468
              D LD+  LGY +Q +  PW   KP+ K     R         +           V PA+
Sbjct  415   RDCLDSKNLGYVYQDVKIPWLKTKPSSKSEKSRRKAEHHKRDVARADEHIPFAKDVFPAS  474

Query  1469  LNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQ-----FIRfdvfvnedddvnTKELDR  1633
             L+K+    V R   S+   ++E  +  L  +  +     F++FDVFVN++DD      D+
Sbjct  475   LDKVIKVLVPRPKKSRNKKQKEEEEEILVVEGIEVKSDLFVKFDVFVNDEDDGVRATADK  534

Query  1634  VEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGS  1813
              E+AGSF N+ H HK         +KT    L ISELLEDL  E+DD +LVTLVP+  G 
Sbjct  535   TEFAGSFVNVPHNHK-----HGKNVKT-RLRLGISELLEDLGAEDDDNVLVTLVPKTKGG  588

Query  1814  FVTVNKAYTE  1843
              V++ +   E
Sbjct  589   EVSIKRIKIE  598



>sp|Q6UIL3.1|LAHY_LARTR RecName: Full=(+)-larreatricin hydroxylase, chloroplastic; AltName: 
Full=Polyphenol oxidase; Flags: Precursor [Larrea tridentata]
 gb|AAQ67412.1| (+)-larreatricin hydroxylase [Larrea tridentata]
Length=584

 Score =   385 bits (989),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 247/575 (43%), Positives = 341/575 (59%), Gaps = 32/575 (6%)
 Frame = +2

Query  167   PSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNP  346
             PSR + R    ++ C A S++ ++ P D   + + +DRRN+L+GLGGLYGA N+   SN 
Sbjct  23    PSRVSLR----RVSCKA-SNDNKDKPNDQEKTFS-IDRRNMLIGLGGLYGASNVFP-SNQ  75

Query  347   FALASPIPPPET-KSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSF-SKLNVRP  520
               LA+PI PP    SC P        + V   CCP  + D      +++PS  S+L +RP
Sbjct  76    STLAAPIQPPVLPDSCHPP---EDLAEGVNVLCCPPDVKDPID---FQMPSNPSRLRIRP  129

Query  521   AAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHF  691
             AAH  D  Y+EKYK A+  MK LP +DPR+FYQQAN+HCAYCNGAY   G P    Q+H 
Sbjct  130   AAHLADPTYIEKYKKALAAMKALPQNDPRSFYQQANIHCAYCNGAYDQVGFPDVNIQVHH  189

Query  692   TWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKR  871
             +WLF PFHRWYLYFYERIL SLIDDPTF +P+WNWD P+GM +P +F  D  SPLYD KR
Sbjct  190   SWLFLPFHRWYLYFYERILGSLIDDPTFAIPFWNWDAPKGMHMPHMF-IDPNSPLYDAKR  248

Query  872   NQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT  1051
             N AH    + DL ++  E  + + +++ NNL+IMY+Q++  A    LF G+ ++  +   
Sbjct  249   NPAHFPDTIVDLDFSSGEAPSHNPRQIGNNLSIMYKQVV-RAKKARLFHGRPLQAGSFPD  307

Query  1052  GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLG  1231
               G G++E  PH +IH W GDPR  + ENMGNFYSA  DP+FY HH+NVDRMW IWK   
Sbjct  308   ESGDGSLEGTPHGNIHLWSGDPRQSNFENMGNFYSAGRDPLFYAHHANVDRMWYIWKNSL  367

Query  1232  GNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrr  1411
             G RKD    DWL   FL +DE    V+V V D+LD  KLGY +Q++  PW + KP  ++ 
Sbjct  368   G-RKDYKKKDWLNAGFLLFDENAQPVRVYVRDALDERKLGYAYQEVDIPWINSKPKPRKA  426

Query  1412  aklrskasvsasTSV-----LPATLNKITTFCVTRSPTSKTPGKEELLDLHLAFD----D  1564
                 ++    A+T+       P TL+   +F V R   S++  ++E  +  L  +    +
Sbjct  427   NPWPNRLRSKATTTTKLINKFPLTLDSTVSFEVKRPKKSRSKSEKEDEEEVLVIEKIKHE  486

Query  1565  TQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
              QF         D+D +    D+ E+AGSF N+ H H+          +T   S+ ISE+
Sbjct  487   PQFPLKFDVYINDEDEDPSAADQTEFAGSFVNVPHFHRHGDKKDKR--QTTNLSIGISEV  544

Query  1745  ledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
             L++L ++ DD I+VTLVPR G   +T+  A  E +
Sbjct  545   LDELDVDGDDSIVVTLVPRVGSGQITIGGAKIEFV  579



>ref|XP_007159290.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
 gb|ESW31284.1| hypothetical protein PHAVU_002G225600g [Phaseolus vulgaris]
Length=594

 Score =   385 bits (989),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 232/534 (43%), Positives = 312/534 (58%), Gaps = 51/534 (10%)
 Frame = +2

Query  341   NPFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLN  511
             N  A+A+P  P + KSCGP  +           CCP   ST++D      +K P  + L 
Sbjct  77    NNIAIAAPTSP-DFKSCGPPDLPRGAES---TDCCPPKSSTIVD------FKFPPRTPLR  126

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQ  682
             VRP AH +DD Y +KYK A+  MK LPS+DPR+F QQAN+HCAYCNGAY   G P    Q
Sbjct  127   VRPGAHLVDDIYRDKYKEALSIMKGLPSEDPRSFIQQANIHCAYCNGAYHQVGFPDLDLQ  186

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQ-GMILPEIFDDDEESPLY  859
             +H +WLFFP+HR+YLYFYERIL SLI DPTF +P+WNWD+P+ GM +P +F  D+ SPLY
Sbjct  187   VHNSWLFFPYHRFYLYFYERILGSLIGDPTFAIPFWNWDHPKGGMTMPSLF-TDKNSPLY  245

Query  860   DKKRNQAHRRGYVTDLAYAGQE-----TSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGK  1024
             D +RN +H+   + DL Y  ++      S S   ++ +NL IMYR +++    P LF G 
Sbjct  246   DPRRNLSHQPPTLIDLDYNRKDDNNPNQSESVADQISSNLTIMYRNVVSGGKLPKLFLGS  305

Query  1025  AIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDR  1204
               R  + D  PG G++E+VPH  +H W GDPR P+ E+MG FYSA  DP+FY HH+NVDR
Sbjct  306   PYRAGS-DPHPGAGSLEHVPHIPVHSWCGDPREPNREDMGVFYSAGKDPIFYAHHANVDR  364

Query  1205  MWTIWKTL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPW  1381
             +W+IWKT+ GG R+D TDPDWL++ FLFYDE K LV+VKV+DSLD   LGY +Q +  PW
Sbjct  365   VWSIWKTIPGGKRRDFTDPDWLESSFLFYDENKNLVRVKVKDSLDTRNLGYVYQDIDLPW  424

Query  1382  KDFKPTrkrraklrskasvs------------asTSV-LPATLNKITTFCVTRSPTSKTP  1522
                KP  +     +   + S             S+SV  P +L+   +  V R    ++ 
Sbjct  425   LKKKPKPRMSKAKKVALAKSFGVTAARAAETTTSSSVRFPLSLDSKVSIVVKRPKLLRSK  484

Query  1523  GKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRV------EYAGSFSNLAHVHKDT  1684
              ++E  +  L  D  +F R      + D     E D V      E+AGSF +L H H   
Sbjct  485   EEKEEEEEVLVIDGIEFGR--DKAVKFDVFINDEDDEVIKASNSEFAGSFVSLPHTHLHK  542

Query  1685  STTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
             S    +      F + +++LLEDL  ENDD I+VTLVP+ G   VT+     E 
Sbjct  543   SMKVKT-----CFRVGLTDLLEDLEAENDDSIVVTLVPKYGKGLVTIQGIKIEF  591



>gb|ABI96949.1| putative polyphenol oxidase [Spiraea cantoniensis]
Length=455

 Score =   380 bits (975),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 187/360 (52%), Positives = 241/360 (67%), Gaps = 20/360 (6%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +        P +CCP   + ++D      +++P+ ++L V
Sbjct  1     PFAFAKPVLPPDVSKCGAADLPTGAE---PMNCCPPPATKIID------FRLPAPNRLRV  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA D  Y+ KY  A++ MK LP  DPR+F  QA VHCAYC+GAY   G P    Q+
Sbjct  52    RPAAHAADKAYIAKYNKAMELMKALPDSDPRSFKSQAAVHCAYCDGAYDQVGFPDLELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYFYE+IL  LI+DP F +PYWNWD+P GM LP +F +  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFYEKILGKLINDPNFAIPYWNWDSPAGMQLPAMFAN-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAP-CPLLFFGKAIRKET  1042
              RN +H+   + DL Y+G + + ++  ++  NL IMYR M++NA   PLLFFG+  R   
Sbjct  171   LRNASHQPPNMIDLDYSGTDENNTNQVQINQNLKIMYRAMVSNAQRNPLLFFGQPYR--A  228

Query  1043  GDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIW  1219
             GD+  PG G++EN PH  IH W GD   P+ ENMGNFYSA  DP+FY HHSNVDRMW +W
Sbjct  229   GDSPNPGGGSVENTPHGPIHLWAGDKTQPNFENMGNFYSAGKDPLFYSHHSNVDRMWDLW  288

Query  1220  KTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             K LGG R DITD DWL + FLFY+E   LV+V V+D LD+ KLGYT+Q +  PW   KPT
Sbjct  289   KGLGGKRADITDSDWLNSGFLFYNENAELVRVTVKDCLDSKKLGYTYQDVEIPWLKSKPT  348



>ref|XP_008442274.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Cucumis melo]
Length=576

 Score =   384 bits (986),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 242/576 (42%), Positives = 345/576 (60%), Gaps = 55/576 (10%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPE  379
             +I C A+      N  D + S  K+DRR++L+GL GLYG+  ++   + FALA+PI  P 
Sbjct  27    RISCKAS------NHNDQNTSNPKIDRRDILIGLTGLYGSSTLSQSPH-FALAAPIQTPN  79

Query  380   TKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYL  550
                CGP  +        P +CCP   +T++D      ++ P  +KL VRPAAH  D +Y+
Sbjct  80    ISKCGPPDLPPGAD---PTNCCPPPATTILD------FQPPPPTKLRVRPAAHLADQNYI  130

Query  551   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKPY--QIHFTWLFFPFHRWY  724
             EKYK AI+ MK LP DDPR+F QQANVHCAYCNGAY   G P   Q+H +WLFFPFHR+Y
Sbjct  131   EKYKKAIELMKALPEDDPRSFTQQANVHCAYCNGAYDQIGFPVEVQVHNSWLFFPFHRFY  190

Query  725   LYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTD  904
             LYF+E+IL  LI D +F LP+WN+D P GM +P ++ + E+S LYD+ RN+ H    + D
Sbjct  191   LYFHEKILGELIGDSSFALPFWNYDAPGGMKMPRMYAE-EKSSLYDELRNENHLPPRLVD  249

Query  905   LAYAG-QETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENV  1081
             L + G  + +  D  ++++NL+IMYRQM++ +  P LFFG A   E  +  PG G++EN+
Sbjct  250   LDFGGVDDPNIGDDAQIRSNLSIMYRQMVSGSRTPSLFFGSAY-VEGDEPSPGGGSVENI  308

Query  1082  PHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPD  1261
             PH  +H W GD   P+ ENMGNFYSAA DP+F+ HHSNVDR+W++WKTLGG RKD+ +P+
Sbjct  309   PHGPVHVWCGDNDQPNFENMGNFYSAARDPIFFAHHSNVDRLWSVWKTLGGRRKDLQNPE  368

Query  1262  WLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvs  1441
             WL   F+FY+E    V+V V D LD+  LGYT+Q +  PW   +PT +R  K      ++
Sbjct  369   WLNASFIFYNEKAQPVRVHVRDCLDSKSLGYTYQPVDLPWLQTRPTPRRAQKTTVAFGIA  428

Query  1442  asTSVLPATLNKITTFCVTRSPTSKTPGKEE-------------------LLDLHLAFDD  1564
             ++ +  P++ +++    +    T K+P   E                   L+   + FD 
Sbjct  429   SALAAGPSS-SRVKPANIKFPITVKSPVSVEVKRPKKSRSKKEKEEEEEVLVIYGIGFDP  487

Query  1565  TQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAH--VHKDTSTTANSTIKTPTFSLAIS  1738
                I+FDVF+N++DD   K  D  E+AGSF N+ H   HK    T           + I+
Sbjct  488   NNGIKFDVFINDEDDKEIKP-DNTEFAGSFVNVPHKQAHKKKVKTG--------LRVGIT  538

Query  1739  elledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
             E+LEDL  +NDD I+VT+VP+ G    ++     E+
Sbjct  539   EVLEDLEADNDDSIIVTIVPKIGAGLFSIGGLKIEL  574



>ref|XP_003522849.1| PREDICTED: polyphenol oxidase A1, chloroplastic-like [Glycine 
max]
 gb|KHN32510.1| Polyphenol oxidase A1, chloroplastic [Glycine soja]
Length=601

 Score =   385 bits (988),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 231/523 (44%), Positives = 315/523 (60%), Gaps = 35/523 (7%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPA  523
             PFA A+PI  P+  +C  A +        P +CCP   + T   D+   PS   L VR A
Sbjct  91    PFANAAPILGPDLTTCVQAELPEGVE---PTNCCPP--ISTNIIDFKFPPSNQPLRVRSA  145

Query  524   AHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFT  694
             AH ++ DYL KY+ A+  MK+LPSDDPR+F QQA VHCAYC+G Y   G P    ++HF+
Sbjct  146   AHLVNKDYLAKYEKAVNLMKNLPSDDPRSFAQQAKVHCAYCDGGYHQLGFPDLDLEVHFS  205

Query  695   WLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRN  874
             WLFFP+HRWYLYF+ERIL SLI+DPTF LP+WNWD P GM LP ++ D  +SPLYD  RN
Sbjct  206   WLFFPYHRWYLYFHERILASLINDPTFALPFWNWDAPGGMQLPSMYAD-PKSPLYDSLRN  264

Query  875   QAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-  1051
               H+   + +L +  ++ +A     +  NL  MYRQ+++NA  P LFFG   R   GD  
Sbjct  265   ANHQPPTLVNLDFTIEDPNAE--ANISTNLTTMYRQLVSNAKTPTLFFGNPYR--AGDQP  320

Query  1052  GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLG  1231
              PG G++E+ PH  +H W GD   P  E+MGN Y+AA DP+FYCHHSNVDRMW+IWKTLG
Sbjct  321   NPGGGSVESTPHGPVHAWTGDINHPTMEDMGNLYAAARDPIFYCHHSNVDRMWSIWKTLG  380

Query  1232  GNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrr  1411
             G R+D+TDPDWL++ FLFYDE K LV+VK +D LD  KLGY +Q +  PW   KPT  R 
Sbjct  381   GKRRDLTDPDWLESAFLFYDENKNLVRVKTKDCLDTRKLGYVYQDVDIPWLKSKPTPLRS  440

Query  1412  ak------------lrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLHLA  1555
                             + A+ ++     P  L+ + +  V R   S++  ++E  +  L 
Sbjct  441   RAQKVELTPLFGGVAAAHAAETSRNVKFPLVLDSVVSTVVKRPKKSRSKKEKEEKEEILV  500

Query  1556  FDDTQF-----IRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
              +  +F     ++FDVF+N++DD   K  D  E+AGSF ++ H H+      N  I T  
Sbjct  501   VEGIEFESSTGVKFDVFINDEDDKLVKP-DNTEFAGSFVSVPHSHEHHKN--NKKIVT-C  556

Query  1721  FSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
               L +++LLE+L  E+DD +LVTLVP+ G   V +     + +
Sbjct  557   LRLGLTDLLEELGAEDDDSVLVTLVPKYGKGRVNIRGIKIDFV  599



>ref|XP_008225030.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Prunus mume]
Length=586

 Score =   384 bits (986),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 236/590 (40%), Positives = 324/590 (55%), Gaps = 49/590 (8%)
 Frame = +2

Query  152   FLNPNPSRAARRGDVIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygaynia  331
             F N     +ARR  V  + C A  ++ ++ P         LDRR  +L   G       +
Sbjct  21    FKNTTKHSSARR--VRLVLCKATGNDDQQPPP------GNLDRRRNVLIGLGGLYGGLSS  72

Query  332   ggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLN  511
               ++PFA A+PI PP+   CGPA + +     +P +CCP T         +K+P  S+L 
Sbjct  73    LPTDPFAFANPISPPDLTQCGPADLPSG---ALPTNCCPPTYPKIID---FKLPPPSRLR  126

Query  512   VRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQ  682
             VRPAA  +D  Y++KY  AI  MK LP DDPRNF QQANVHCAYC+GAY   G P    Q
Sbjct  127   VRPAAQTVDQSYIDKYSKAIALMKALPDDDPRNFTQQANVHCAYCDGAYDQVGFPDLELQ  186

Query  683   IHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYD  862
             IH  WLFFPFHR+YLYFYERIL  LIDDPTF LP+WNWD P GM LP ++ + + S LYD
Sbjct  187   IHNCWLFFPFHRYYLYFYERILAKLIDDPTFALPFWNWDAPAGMQLPALYANSDSS-LYD  245

Query  863   KKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKET  1042
             + R  AH+   + DL + G +   +   +V  N      Q   NA  PLLFFG   R  T
Sbjct  246   ELRAAAHQPPTLVDLDFNGTDEKVNREARVNTNRG----QRGANARNPLLFFGWPYRAGT  301

Query  1043  GDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
              +  PG G++E +PH  +H W GD   P+ E+MGNFYSAA DP+F+ HHSNVDRMW+IWK
Sbjct  302   -EADPGAGSVEAIPHGPVHLWTGDNTQPNFEDMGNFYSAARDPIFFAHHSNVDRMWSIWK  360

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTr  1402
              LG   KD++D DWL + FLFY+E   LV+VKV D LD+ KLGY ++ +  PW   +PT 
Sbjct  361   NLGTKNKDLSDKDWLDSGFLFYNENAELVRVKVRDCLDSRKLGYVYEDVEIPWLKSRPTP  420

Query  1403  krrakl-------------rskasvsasTSVLPATL-NKITTFCVTRSPTSKTPGKEELL  1540
             +R  +               +       +S  P  L +KI+T         +   ++E  
Sbjct  421   RRTKQQRKAKAVGVAKAAGTTSLGKLVKSSEFPIQLESKISTVVSRPRQKKRNKKEKEDE  480

Query  1541  DLHLAFDDTQFIRfdvfvnedddvnTKELDRV-------EYAGSFSNLAHVHKDTSTTAN  1699
             +  L  +  ++ +  V   +    +  + D V       E+AGSF ++ H HK+    + 
Sbjct  481   EEILVIEGIEYEKNAVVKFDVYMNDVGDDDDVLSGPDKSEFAGSFVSVPHTHKEKRNKSK  540

Query  1700  STIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
               ++     L +++LLEDL  E+D+ I+VTLVPR G   VT+     E +
Sbjct  541   GCLR-----LGLTDLLEDLEAEDDESIVVTLVPRFGAQTVTIGSIRIEFV  585



>ref|NP_001268045.1| polyphenol oxidase, chloroplastic [Vitis vinifera]
 gb|AAB41022.1| polyphenol oxidase [Vitis vinifera]
Length=607

 Score =   385 bits (988),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 259/581 (45%), Positives = 336/581 (58%), Gaps = 41/581 (7%)
 Frame = +2

Query  179   ARRGDVIKIRCAAASSEGRENPADS--SLSEAKLDRRNVllglgglygayniaggSNPFA  352
             +RR    K+ C +A+ +   +        S  KLDRRNVLLG+GGLYGA    G + P A
Sbjct  42    SRRFAPSKVSCNSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLA  101

Query  353   LASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHA  532
               +PI  P+   CG AT+ +      P +CCP   + T   D+    S S +  RPAAH 
Sbjct  102   FGAPIQAPDISKCGTATVPDGV---TPTNCCPP--VTTKIIDFQLPSSGSPMRTRPAAHL  156

Query  533   IDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK---PYQIHFTWLF  703
             +  +YL KYK AI+  K LP DDPR+F QQANVHC YC GAY   G      Q+H +WLF
Sbjct  157   VSKEYLAKYKKAIELQKALPDDDPRSFKQQANVHCTYCQGAYDQVGYTDLELQVHASWLF  216

Query  704   FPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAH  883
              PFHR+YLYF ERIL  LIDDPT  L YW WDNP GM +P I+     S LYD+KRN  H
Sbjct  217   LPFHRYYLYFNERILAKLIDDPTIALAYWAWDNPDGMYMPTIYASSPSS-LYDEKRNAKH  275

Query  884   RRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPG  1060
                 V DL Y G E +  D +   +NLAIMY+Q+++ A  P LF G   R   GD   PG
Sbjct  276   LPPTVIDLDYDGTEPTIPDDELKTDNLAIMYKQIVSGATTPKLFLGYPYR--AGDAIDPG  333

Query  1061  MGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG-N  1237
              GT+E+VPHN +H+W G    P +E+MGNFY+A  DP+F+ HH+NVDRMW IWKT+GG N
Sbjct  334   AGTLEHVPHNIVHKWTGLADKP-SEDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGGKN  392

Query  1238  RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrak  1417
             RKD TD DWL   F+FYDE K LVKVKV D +D  KL Y +Q +P PW   K   K +  
Sbjct  393   RKDFTDTDWLDATFVFYDENKQLVKVKVSDCVDTSKLRYQYQDIPIPWLPKKTKAKAKTT  452

Query  1418  lrskasvsasTSVLPAT-----------LNKITTFCVTRSPTSKTPGKEE-----LLDLH  1549
              +S  S  A  + LP T           LN +    V R   S++  ++E     LL   
Sbjct  453   TKSSKSGVAKAAELPKTTISSIGDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVLLIKG  512

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVH-KDTSTTANSTIKTPTFS  1726
             +  D   F++FDV++N++D   ++  +  E+AGSF N+ H H K+  T  N         
Sbjct  513   IELDRENFVKFDVYINDEDYSVSRPKNS-EFAGSFVNVPHKHMKEMKTKTN-------LR  564

Query  1727  LAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
              AI+ELLEDL  E+D+ ++VT+VPRAGG  VT+     E +
Sbjct  565   FAINELLEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEFV  605



>ref|XP_010647098.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like 
[Vitis vinifera]
Length=601

 Score =   384 bits (987),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 242/548 (44%), Positives = 327/548 (60%), Gaps = 37/548 (7%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
              KLDRRNVLLGLGGLYG   +         A  I PP+   CG A +        P +CC
Sbjct  68    GKLDRRNVLLGLGGLYGVSGLGAADPFAFAAP-ISPPDLSECGAADLPAGAQ---PTNCC  123

Query  446   PSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQA  625
             P   + +   D+   P  S   +RPAAH    +Y+ KYK AI+ MK LP DDPR+F QQA
Sbjct  124   PP--VSSKIIDFKLPPKNSPFRIRPAAHLASKEYIAKYKKAIELMKALPDDDPRSFMQQA  181

Query  626   NVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNW  796
             +VHCAYCNGAY   G P    Q+H +WLF P+HR+YLYFYE+IL  LI+DPTF LP+WNW
Sbjct  182   DVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRYYLYFYEKILGKLINDPTFALPFWNW  241

Query  797   DNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMY  976
             D P GM +P +F D   SPLYDK R+  H+   + DL Y   +++ ++ Q++ +NL+IMY
Sbjct  242   DAPAGMQMPAMFAD-PNSPLYDKLRDPKHQPPKLIDLDYTXTDSNDTNEQQISSNLSIMY  300

Query  977   RQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFY  1153
             RQ++++A    LF G A R   GD   PG GT+EN+PH  +H W GD   P+ E+MGNFY
Sbjct  301   RQIVSSAKTTSLFMGAAYR--AGDEPDPGQGTLENIPHGPVHIWCGDRTQPNIEDMGNFY  358

Query  1154  SAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSL  1333
             SAA DP+F+ HHSNVDRMWT+WK LGG RKD TDPDWL   F+FYDE   LV+VKV D L
Sbjct  359   SAARDPIFFSHHSNVDRMWTVWKGLGGKRKDFTDPDWLDAGFVFYDENAQLVRVKVRDCL  418

Query  1334  DNVKLGYTFQKMPTPWKDFKPT------------rkrraklrskasvsasTSVLPATLNK  1477
             D  KL Y +Q++  PW   +P             + +     +    S+S+ V P  L+ 
Sbjct  419   DPTKLRYAYQEVDIPWLKSRPKPRQILKKVVNKLKHKSGVANAAEIPSSSSIVFPIKLDS  478

Query  1478  ITTFCVTRSPTSKTPGKEE-----LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEY  1642
                  V R   S++  ++E     L+   +  +  +F++FD+F+N++DD  ++  D  E+
Sbjct  479   TLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKFVKFDIFINDEDDPVSRP-DNTEF  537

Query  1643  AGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVT  1822
             AGSF N+ H H      ++   K     + ISELLEDL  E+DD ++VTLVPR G   +T
Sbjct  538   AGSFVNVPHQH------SHGKKKNTILRIGISELLEDLEAEDDDSVVVTLVPRYGADVIT  591

Query  1823  VNKAYTEI  1846
             +     E+
Sbjct  592   IGGIEIEL  599



>dbj|BAA21676.1| polyphenol oxidase [Malus domestica]
Length=593

 Score =   383 bits (984),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 252/620 (41%), Positives = 350/620 (56%), Gaps = 66/620 (11%)
 Frame = +2

Query  29    TILS*PAMATSTHPISSTKNISFIstnsssprnfsrrpsQIFLNPNPSRAARRGDVIKIR  208
             T LS P + T T P   TK +S           FS+  SQ+ L   P R+  R    ++ 
Sbjct  2     TSLSPPVVTTPTAPNPDTKPLS----------PFSQNNSQVSLLTKPKRSLGR----EVS  47

Query  209   CAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKS  388
             C A +++  +       +++KLDRRNVLLGLGGLYG   +   ++P      I PP+   
Sbjct  48    CNATNNDQFDQ------AQSKLDRRNVLLGLGGLYGVAGMV--TDPRGFGKSIAPPDVSK  99

Query  389   CGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKY  559
             CGP  +       VP +CCP   + ++D      +K+P+ + L +RP AHA+D  Y +KY
Sbjct  100   CGPGDLPQGA---VPTNCCPPPSTKIID------FKLPAPANLRIRPPAHAVDQAYRDKY  150

Query  560   KTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLY  730
               A++ MK LP DD R+F QQ  VHCAYC+GAY   G P    Q+H +WLFFPFHR+YLY
Sbjct  151   YKAMELMKALPDDDSRSFKQQGAVHCAYCDGAYDQVGFPELELQLHNSWLFFPFHRYYLY  210

Query  731   FYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLA  910
             F E+IL +LI+DPTF LP+WNWD+P GM LP I+ D  +SPLYDK R+  H+   + DL 
Sbjct  211   FCEKILGNLINDPTFALPFWNWDSPAGMPLPAIYAD-PKSPLYDKLRSAKHQPPTLVDLD  269

Query  911   YAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPH  1087
             Y G E + S    +  NL IMYRQM++N+    LFFG   R   GD   PG G+IE  PH
Sbjct  270   YNGTEDNVSKETTINANLKIMYRQMVSNSKNAKLFFGNPYR--AGDEPDPGGGSIEGTPH  327

Query  1088  NSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWL  1267
               +H W GD   P+ E+MGNFYSA  DP+F+ HHSNVDRMW+IWKTLGG R D+TD DWL
Sbjct  328   APVHLWTGDNTQPNFEDMGNFYSAGRDPIFFAHHSNVDRMWSIWKTLGGKRADLTDSDWL  387

Query  1268  QTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrak----------  1417
              + FLFY+E   LV+VKV D L+   LGY +Q +  PW   KPT +R             
Sbjct  388   DSGFLFYNENAELVRVKVRDCLETKHLGYVYQDVDIPWLSSKPTPRRAEVALSPIAKKLG  447

Query  1418  ----lrskasvsasTSVLPATL-NKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRf  1582
                   + +S   + +  P  L +KI+T         ++   +E  +  L  +  +F R 
Sbjct  448   VAHPAVASSSKVVAGTEFPINLGSKISTVVKRPKQKKRSKKAKEDEEEILVIEGIEFDRD  507

Query  1583  dvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelle  1750
                  +    +  +L    D+ E+AGSF ++ H HK      N+T++     L +++LLE
Sbjct  508   VAVKFDVYVNDVDDLPSGPDKTEFAGSFVSVPHSHKHKKKM-NTTLR-----LGLTDLLE  561

Query  1751  dlrlenddKILVTLVPRAGG  1810
             ++  E+DD ++VTLVP+ G 
Sbjct  562   EIEAEDDDSVVVTLVPKFGA  581



>ref|XP_010910924.1| PREDICTED: LOW QUALITY PROTEIN: polyphenol oxidase, chloroplastic-like, 
partial [Elaeis guineensis]
Length=555

 Score =   382 bits (980),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 250/568 (44%), Positives = 327/568 (58%), Gaps = 38/568 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSL---SEAKLDRRNVllglgglygayniaggSNPFALASPIP  370
             +I C A   E  E P  ++    S  KLDRR++L+GLGGLYGA    G  N  AL  PI 
Sbjct  1     RISCKATRDE-HEKPMSTTEAIGSSGKLDRRDMLIGLGGLYGAAAGLGV-NRKALGLPIE  58

Query  371   PPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYL  550
              P+   CGPA +        P  CCPS+   +   D+   PS + L +R AAH +D +YL
Sbjct  59    APDVSKCGPADLPPG---ATPTDCCPSST--SKIIDFKLPPSSNPLRIRSAAHLVDSEYL  113

Query  551   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRW  721
              KY  A++ MK LP+DDPRNF QQANVH AYC+GAY+  G P    Q+H +W+FFP+HR+
Sbjct  114   AKYAKAVELMKALPADDPRNFTQQANVHSAYCDGAYEQIGFPDLELQVHNSWIFFPWHRF  173

Query  722   YLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVT  901
             YLYF+E+IL  LI D TF LP+WNWD P GM +P I+ D   S LY+K  +  H+  Y+ 
Sbjct  174   YLYFHEKILGKLIGDETFALPFWNWDAPAGMQMPSIYTDPSSS-LYNKLCDAKHQPPYLV  232

Query  902   DLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIEN  1078
             DL + GQ+ S +  Q++  NL  MYRQ++TN     LF G   R   GD   PG G++EN
Sbjct  233   DLGFNGQDPSFTHDQQIDYNLKTMYRQVITNGKTAQLFMGSPYR--AGDQPNPGAGSLEN  290

Query  1079  VPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDP  1258
             V HN++H W GD   P+ ENMG  YSAA DP+FY HHSNVDRMW +WK LGG  KD  D 
Sbjct  291   VXHNTVHVWTGDRNQPNGENMGALYSAARDPIFYAHHSNVDRMWYVWKMLGGKHKDFEDK  350

Query  1259  DWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasv  1438
             DWL + FLFYDE   LV+VKV+D LD   L YT+Q +  PW   +PT K  A  +  A  
Sbjct  351   DWLNSSFLFYDENAGLVRVKVKDCLDTQGLRYTYQDVEIPWLKTRPTPKGTAAAKKGARS  410

Query  1439  --sasTSVLPATLNKITTFCVTRSPTSKT-----PGKEELLDLHLAFDDTQFIRfdvfvn  1597
               + + + LP TL+   +  V R   S++       +E L+   + FD   FI+      
Sbjct  411   PRAVTEATLPVTLDSSVSATVRRPKVSRSRKEKEDEEEVLVVEGIEFDRGMFIK------  464

Query  1598  edddvnTKELDRV-----EYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrl  1762
              D  +NT E D V     E+AGSF N+   HK+  +     ++T    L I++LLEDL  
Sbjct  465   FDVYINTPEEDGVDPGSTEFAGSFVNVP--HKNNHSKKEKKVRT-ALRLGITDLLEDLGA  521

Query  1763  enddKILVTLVPRAGGSFVTVNKAYTEI  1846
             E D  +LVTLVPR     V V     E+
Sbjct  522   EADGSVLVTLVPRKEKGNVKVGGLRLEL  549



>dbj|BAO79387.1| polyphenol_oxidase [Vitis labrusca x Vitis vinifera]
Length=602

 Score =   383 bits (984),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 242/548 (44%), Positives = 327/548 (60%), Gaps = 37/548 (7%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
              KLDRRNVLLGLGGLYG   +         A  I PP+   CG A +        P +CC
Sbjct  69    GKLDRRNVLLGLGGLYGVSGLGAADPFAFAAP-ISPPDLSECGAADLP---AGAQPTNCC  124

Query  446   PSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQA  625
             P   + +   D+   P  S   +RPAAH    +Y+ KYK AI+ MK LP DDPR+F QQA
Sbjct  125   PP--VSSKIIDFKLPPKNSPFRIRPAAHLASKEYIAKYKKAIELMKALPDDDPRSFMQQA  182

Query  626   NVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNW  796
             +VHCAYCNGAY   G P    Q+H +WLF P+HR+YLYFYE+IL  LI+DPTF LP+WNW
Sbjct  183   DVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRYYLYFYEKILGKLINDPTFALPFWNW  242

Query  797   DNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMY  976
             D P GM +P +F D   SPLYDK R+  H+   + DL Y   +++ ++ Q++ +NL+IMY
Sbjct  243   DAPAGMQMPAMFAD-PNSPLYDKLRDAKHQPPKLIDLDYNLTDSNDTNEQQISSNLSIMY  301

Query  977   RQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFY  1153
             RQ++++A    LF G A R   GD   PG GT+EN+PH  +H W GD   P+ E+MGNFY
Sbjct  302   RQIVSSAKTTSLFMGAAYR--AGDEPDPGQGTLENIPHGPVHIWCGDRTQPNIEDMGNFY  359

Query  1154  SAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSL  1333
             SAA DP+F+ HHSNVDRMWT+WK LGG RKD TDPDWL   F+FYDE   LV+VKV D L
Sbjct  360   SAARDPIFFSHHSNVDRMWTVWKGLGGKRKDFTDPDWLDAGFVFYDENAQLVRVKVRDCL  419

Query  1334  DNVKLGYTFQKMPTPWKDFKPT------------rkrraklrskasvsasTSVLPATLNK  1477
             D  KL Y +Q++  PW   +P             + +     +    S+S+ V P  L+ 
Sbjct  420   DPTKLRYAYQEVDIPWLKSRPKPRQILKKVVNKLKHKSGVANAAEIPSSSSIVFPIKLDS  479

Query  1478  ITTFCVTRSPTSKTPGKEE-----LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEY  1642
                  V R   S++  ++E     L+   +  +  +F++FD+F+N++DD  ++  D  E+
Sbjct  480   TLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKFVKFDIFINDEDDPVSRP-DNTEF  538

Query  1643  AGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVT  1822
             AGSF N+ H H      ++   K     + ISELLEDL  E+DD ++VTLVPR G   +T
Sbjct  539   AGSFVNVPHQH------SHGKKKNTILRIGISELLEDLEAEDDDSVVVTLVPRYGADVIT  592

Query  1823  VNKAYTEI  1846
             +     E+
Sbjct  593   IGGIEIEL  600



>ref|XP_009610962.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Nicotiana 
tomentosiformis]
Length=609

 Score =   383 bits (984),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 233/535 (44%), Positives = 314/535 (59%), Gaps = 30/535 (6%)
 Frame = +2

Query  272   LDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPS  451
             +DRRN+LLGLGGLYGA  I G  + FA A+P+  P+   CGPA +        P +CCP 
Sbjct  79    IDRRNILLGLGGLYGAATIVG-GHSFAFAAPVNGPDVSKCGPADLPPG---AAPVNCCPP  134

Query  452   TLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANV  631
             T  +    D+   P  + L  RPAAHA D  Y+EK+  AIQ MK LP DDPR+F QQANV
Sbjct  135   TTANII--DFQLPPPSTTLRTRPAAHAADSAYIEKFNRAIQLMKQLPDDDPRSFKQQANV  192

Query  632   HCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDN  802
             HCAYC+GAY   G P    Q+HF+WLF PFHR YLYF+E+IL SLI+DPTF +P+WNWD+
Sbjct  193   HCAYCDGAYDQLGFPNSELQVHFSWLFLPFHRCYLYFFEKILGSLINDPTFAIPFWNWDH  252

Query  803   PQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQ  982
             P GM LP ++ +   S L+D  R++ H+   + DL + G + + S+ Q+   NL IMYRQ
Sbjct  253   PDGMRLPAMYTN-RSSSLFDPLRDRRHQPPVMVDLDFNGTDPNISNAQQTSQNLTIMYRQ  311

Query  983   MLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAA  1162
             M++    P  F G   R   G+ G G G++EN+PH  +H W GD   P+ ENMG+FYSAA
Sbjct  312   MVSLGSTPTTFLGDPYRA-GGEPG-GAGSLENIPHGPVHVWTGDRTQPNFENMGDFYSAA  369

Query  1163  IDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNV  1342
              DP+FY HHSN+DR+W++WKTLGG R+D TDPD+L   FLFYDE   +V+++V D LD  
Sbjct  370   RDPIFYAHHSNIDRLWSVWKTLGGRRQDFTDPDFLNASFLFYDEKAQMVRIRVRDCLDTT  429

Query  1343  KLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTS---------VLPATLNKITTFCV  1495
             +LGY +Q +  PW + +P  +  + L S   +  + +         V P  L+ +    V
Sbjct  430   RLGYAYQNVANPWINSRPRARVSSALSSVRRLVEARAADNFPSAKDVFPTKLDHVIRVMV  489

Query  1496  TRSPTSKTP-----GKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSN  1660
              R    K        KEE+L +     +T        +  D+D      +  E+AGSF N
Sbjct  490   KRPNKKKRNKKEKDAKEEILVVEGIELETDVFVKFDVLINDEDETVISPNNAEFAGSFVN  549

Query  1661  LAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTV  1825
             + H     S     T       LAI+ELLEDL  E+DD +LVT VP+ G   V +
Sbjct  550   VPHHSHGKSGKKRKT----KLKLAITELLEDLDAEDDDHVLVTFVPKNGSGAVKI  600



>emb|CAN61652.1| hypothetical protein VITISV_006012 [Vitis vinifera]
Length=601

 Score =   383 bits (983),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 242/548 (44%), Positives = 327/548 (60%), Gaps = 37/548 (7%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
              KLDRRNVLLGLGGLYG   +         A  I PP+   CG A +        P +CC
Sbjct  68    GKLDRRNVLLGLGGLYGVSGLGAADPFAFAAP-ISPPDLSECGAADLP---AGAQPTNCC  123

Query  446   PSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQA  625
             P   + +   D+   P  S L +RPAAH    +Y+ KYK AI+ MK LP DDPR+F QQA
Sbjct  124   PP--VSSKIIDFKLPPKNSPLRIRPAAHLASKEYIAKYKKAIELMKALPDDDPRSFMQQA  181

Query  626   NVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNW  796
             +VHCAYCNGAY   G P    Q+H +WLF P+HR+YLYFYE+IL  LI+DPTF LP+WNW
Sbjct  182   DVHCAYCNGAYHQVGFPDLDLQVHNSWLFLPYHRYYLYFYEKILGKLINDPTFALPFWNW  241

Query  797   DNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMY  976
             D P GM +P +F D   SPLYDK R+  H+   + DL Y   +++ ++ Q++ +NL+IMY
Sbjct  242   DAPAGMQMPAMFAD-PNSPLYDKLRDAKHQPPKLIDLDYNLTDSNDTNEQQISSNLSIMY  300

Query  977   RQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFY  1153
             RQ++++A    LF G A R   GD   PG GT+EN+PH  +H W GD   P+ E+MGNFY
Sbjct  301   RQIVSSAKTTSLFMGAAYR--AGDEPDPGQGTLENIPHGPVHIWCGDRTQPNIEDMGNFY  358

Query  1154  SAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSL  1333
             SAA DP+F+ HHSNVDRMWT+WK LGG RKD TDPDWL   F+FYDE   LV+VKV D L
Sbjct  359   SAARDPIFFSHHSNVDRMWTVWKGLGGKRKDFTDPDWLDAGFVFYDENAQLVRVKVRDCL  418

Query  1334  DNVKLGYTFQKMPTPWKDFKPT------------rkrraklrskasvsasTSVLPATLNK  1477
             D  KL Y + ++  PW   +P             + +     +    S+S+ V P  L+ 
Sbjct  419   DPTKLRYAYHEVDIPWLKSRPKPRQILKKVVNKLKHKSGVANAAEIPSSSSIVFPIKLDS  478

Query  1478  ITTFCVTRSPTSKTPGKEE-----LLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEY  1642
                  V R   S++  ++E     L+   +  +  +F++FD+F+N++DD  ++  D  E+
Sbjct  479   TLRVDVPRPRKSRSKKEKEDEEEVLVIKGIELERDKFVKFDIFINDEDDPVSRP-DNTEF  537

Query  1643  AGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVT  1822
             AGSF N+ H H      ++   K     + ISELLEDL  E+DD ++VTLVPR G   +T
Sbjct  538   AGSFVNVPHQH------SHGKKKNTILRIGISELLEDLEAEDDDSVVVTLVPRYGADVIT  591

Query  1823  VNKAYTEI  1846
             +     E+
Sbjct  592   IGGIEIEL  599



>ref|XP_008225002.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Prunus mume]
Length=594

 Score =   382 bits (982),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 242/569 (43%), Positives = 324/569 (57%), Gaps = 42/569 (7%)
 Frame = +2

Query  194   VIKIRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPP  373
             V  +RC A  + G  +  +  L   KLDRRN+L+GLG           +N FA A+P+P 
Sbjct  50    VGGVRCQA--TNGDNDHLEQGL--GKLDRRNMLIGLGAGGLYGAAGLENNRFAFAAPLPA  105

Query  374   PETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAIDDD  544
             P+   CGPA     +G  +   CCP    T++D      +K+P    L  R  A  +  D
Sbjct  106   PDFTECGPA--DKPDGSTI--DCCPPITKTIID------FKLPDRGPLRTRRPAQDLAKD  155

Query  545   --YLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFP  709
               YL K+K AI  M+ LP DDPR+  QQA VHC+YC+G Y   G P    Q+H  WLF+P
Sbjct  156   PVYLAKFKKAIALMRALPDDDPRSLAQQAMVHCSYCDGGYPQVGFPDLEIQVHSCWLFYP  215

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             FHRWYLYFYE+I+  LI DPTF LP+WNWD P GM +PEIF D   S LYD+ RN AH+ 
Sbjct  216   FHRWYLYFYEKIMGELIGDPTFALPFWNWDAPAGMYIPEIFTDPTSS-LYDQYRNAAHQP  274

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGD-TGPGMG  1066
               + DL Y G +    D  ++K NL  MY+QM++ A    LF+G+      GD + PG G
Sbjct  275   PKLLDLNYGGSDDDVDDATRIKENLTTMYQQMVSKATSHRLFYGETY--SAGDASSPGAG  332

Query  1067  TIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKD  1246
              IE++PHN+IH W GDP+  + ENMG FYSA  DP+FY HHSNVDRMW+I+K L G   D
Sbjct  333   NIESLPHNNIHLWTGDPKQTNGENMGAFYSAGRDPLFYSHHSNVDRMWSIYKDLLGG-TD  391

Query  1247  ITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTF-QKMPTPWKDFKPT-rkrrakl  1420
             I   DWL TEFLFYDE K LV+VKV DSLD  KLGY +  K+P PW   KP  RK + K 
Sbjct  392   IDKADWLNTEFLFYDEKKNLVRVKVRDSLDTRKLGYVYDNKVPIPWLKAKPNPRKSQNKR  451

Query  1421  rskasvsasTSVLPATL-NKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvn  1597
             ++  S    T+  PATL +KI+      S T +T  +++  D  L     +F   +    
Sbjct  452   KAAVSSGDLTTTFPATLSDKISVEVARPSTTKRTSEQKKAQDEVLVIKGIEFAGNEPLKF  511

Query  1598  edddvnTKE----LDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrle  1765
             +    +  +     D+ E+AGSF ++ H            IKT    L+I++LLE+L  E
Sbjct  512   DVFVNDDADSEAGKDQSEFAGSFIHVPHKQ-------GKNIKT-NLRLSITKLLEELDAE  563

Query  1766  nddKILVTLVPRAGGSFVTVNKAYTEIID  1852
              D  ++VTLVP+ G   +T+     E+++
Sbjct  564   TDTSLVVTLVPKLGKGPITIGGFSIELLN  592



>ref|XP_010910928.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=594

 Score =   382 bits (981),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 246/552 (45%), Positives = 328/552 (59%), Gaps = 36/552 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADSSL---SEAKLDRRNVllglgglygayniaggSNPFALASPIP  370
             +I C A   E  E P  ++    S  KLDRR++L+GLGGLYGA    G  N  AL  PI 
Sbjct  44    RISCKATRDE-HEKPTHTTEAIGSSGKLDRRDMLIGLGGLYGAAAGLGV-NRKALGLPIE  101

Query  371   PPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSK-LNVRPAAHAID  538
              P+   CGPA + +      P  CCP   S ++D      +K+P  S  L +RPAAH +D
Sbjct  102   APDISKCGPADLPSGA---TPTDCCPPFTSKIID------FKLPPRSDPLRIRPAAHLVD  152

Query  539   DDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFP  709
              +YL KY  A++ MK LP+DDPRNF QQANVHCAYC+G+Y   G P    Q+H +W+FFP
Sbjct  153   SEYLAKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIEIQVHNSWIFFP  212

Query  710   FHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRR  889
             +HR+YLYF+E+IL  LI D TF LP+WNWD P GM +P I+ D   S LYDK R+  H+ 
Sbjct  213   WHRFYLYFHEKILGKLIGDETFALPFWNWDAPAGMRMPSIYTDPSSS-LYDKLRDAKHQP  271

Query  890   GYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMG  1066
              Y+ DL + G++ S +  Q++ +NL IMYRQ++ N     LF G       GD   PG G
Sbjct  272   PYLIDLDFNGRDPSFTQAQQIDHNLNIMYRQVIANGKTAQLFMGSPY--HAGDQPNPGGG  329

Query  1067  TIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKD  1246
             ++ENVPH ++H W GD   P+ E+MG  YSAA DP+F+ HHSNVDRMW +WK LGG  KD
Sbjct  330   SLENVPHGTVHVWTGDRNQPNGEDMGTLYSAARDPIFFAHHSNVDRMWYVWKMLGGKHKD  389

Query  1247  ITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT--rkrrakl  1420
               D DWL T FLFYDE   LV+VK++D LD   L YT+Q +  PW   +PT      AK 
Sbjct  390   FEDKDWLNTSFLFYDENADLVRVKIKDCLDTQWLRYTYQDVEIPWLKARPTPKGTVAAKK  449

Query  1421  rskasvsasTSVLPATLNKITTFC-----VTRSPTSKTPGKEELLDLHLAFDDTQFIRfd  1585
              +++  + + +  P TL    +       V+RS   K   +E L+   + FD   FI+FD
Sbjct  450   GARSLRAVTEAAFPVTLESSVSATVRRPKVSRSSKEKKDEEEVLVVEGIEFDRDMFIKFD  509

Query  1586  vfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrle  1765
             V++N  ++    +    E+AGSF N+ H H    +     ++T    L I+ELLEDL  E
Sbjct  510   VYINTPEEEGV-DPGSSEFAGSFVNVPHKH--NHSKKEKKLRT-ALRLGITELLEDLGAE  565

Query  1766  nddKILVTLVPR  1801
              DD +LVTLVPR
Sbjct  566   ADDSVLVTLVPR  577



>gb|ABI96937.1| putative polyphenol oxidase [Kageneckia oblonga]
Length=453

 Score =   377 bits (969),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 237/359 (66%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A PI PP+   CG A +          +CCP   + ++D      +K+P+  KL +
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEF---TNCCPPPATKIID------FKLPAPGKLRI  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    Q+
Sbjct  52    RPPAHAVDQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYAD-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R+ +H+   + DL Y G E + S    +  NL IMYR+M++N+  PLLFFG   R   G
Sbjct  171   LRSASHQPPTLIDLDYNGTEDNVSTETTINANLKIMYRRMVSNSKNPLLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DP+FY HHSNVDRMW+IWK
Sbjct  229   DEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R D+TD DWL + FLFY+E   LV+VKV D LD  K GY +Q +  PW   KP+
Sbjct  289   TLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLDTKKFGYVYQDVDIPWLSSKPS  347



>gb|ABI96951.1| putative polyphenol oxidase [Vauquelinia californica]
Length=453

 Score =   377 bits (968),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 191/359 (53%), Positives = 239/359 (67%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A PI PP+   CG A +    G  V  +CCP   + ++D      +K+P+ SKL +
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPP--GAEV-TNCCPPPATKIID------FKLPAPSKLRI  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    Q+
Sbjct  52    RPPAHAVDQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGYPELELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPPGMPLPAIYAD-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R+  H+   + DL Y G E + S+   +  NL IMYRQM++N+  P LFFG   R   G
Sbjct  171   FRSANHQPPTLIDLDYNGTEDNVSNETTINANLKIMYRQMVSNSKNPQLFFGNPDR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH   H W GD   P+ E+MGNFYSA  DPVFY HHSNVDRMW+IWK
Sbjct  229   DEPDPGGGSIEGTPHGPGHLWTGDHTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R D+TD DWL + FLFY+E   LV+VKV D L+  KLGY +Q +  PW   KPT
Sbjct  289   TLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKKLGYGYQDVDIPWLSSKPT  347



>emb|CBZ41492.1| polyphenol oxidase precursor (chloroplast) (chloroplast) [Taraxacum 
officinale]
Length=593

 Score =   382 bits (980),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 244/557 (44%), Positives = 325/557 (58%), Gaps = 31/557 (6%)
 Frame = +2

Query  215   AASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCG  394
             A S + +++      +  K+DRRNVLLGLG L GA    G  N  A A PI  P+   CG
Sbjct  51    AISCKTQDDHDHRHANSGKIDRRNVLLGLGTLSGATATFG-PNSLAFADPIMAPDITLCG  109

Query  395   PATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDDDYLEKYKTAI  571
             PAT           +CCP +   T     +K+PS +  L VRPAAH ++ DY+ KY   +
Sbjct  110   PATFPEGVATT---NCCPPS---TTKILDFKVPSQANTLRVRPAAHLVNKDYIAKYNKVV  163

Query  572   QKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAG---KPYQIHFTWLFFPFHRWYLYFYER  742
             Q MK LP DDPRNF QQA+VHCAYC+G Y   G     +Q+H +WLF+PFHR+YLYF+E+
Sbjct  164   QLMKALPEDDPRNFMQQASVHCAYCDGTYDQLGFQDLEFQVHASWLFYPFHRYYLYFFEK  223

Query  743   ILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQ  922
             I   LIDDP FT+P+WNWD P GM +P I+ + + S LYD  R+  H+   + DL Y G 
Sbjct  224   ICGKLIDDPNFTIPFWNWDAPDGMTIPYIYTN-KNSSLYDSLRDAKHQPPSLVDLDYNGV  282

Query  923   ETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHR  1102
             + + S  ++   NL IMYRQM+  +    LF G   R    D  PG G +ENVPH  +H 
Sbjct  283   DRNLSPSKQTSTNLNIMYRQMVMASKTTSLFLGSPYR-AGDDPSPGGGIMENVPHTPVHN  341

Query  1103  WVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFL  1282
             W GD   P+ E+MGNFYSA  DP+FY HH+NVDRMW+IWK+L G RKD TD DWL + FL
Sbjct  342   WTGDRSQPNVEDMGNFYSAGRDPIFYAHHANVDRMWSIWKSLVGERKDYTDTDWLDSLFL  401

Query  1283  FYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvsasTSVLP  1462
             FYDE   LV+VKV D LD+  LGY +Q +  PW + KP  + + +LR+  +V  +  V P
Sbjct  402   FYDENADLVRVKVRDCLDSKNLGYVYQDVDIPWLNSKPYPRLKKRLRAYKNVLFAKDVFP  461

Query  1463  ATLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDT----------QFIRfdvfvnedddv  1612
              +L+K+    V R P      +E   D     +            +F++FDV VNEDD+ 
Sbjct  462   GSLDKLIKVMVPR-PKKLRSQEENGHDEVEEEEILVIEGIEVKMDKFVKFDVLVNEDDEK  520

Query  1613  nTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTL  1792
                  D+ E+AGSF N+ H HK         +KT    L ISELL+DL  E+D  +LVTL
Sbjct  521   KATA-DKTEFAGSFVNIPHKHK-----PGKNMKT-RLRLGISELLKDLGAEDDKNVLVTL  573

Query  1793  VPRAGGSFVTVNKAYTE  1843
             VP+  G  + +++   E
Sbjct  574   VPKTKGGEIRIDEIKIE  590



>gb|AHX26182.1| polyphenol oxidase [Sorghum bicolor]
Length=553

 Score =   380 bits (976),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 220/511 (43%), Positives = 303/511 (59%), Gaps = 29/511 (6%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAH  529
             A+A+PI  P+ + C P  + ++ G     +CCP     TA  D+  +P    L VRPAAH
Sbjct  60    AIAAPIQAPDLRDCHPPDLPDTVGD---VNCCPPG-AGTAIVDF-TLPPAVGLRVRPAAH  114

Query  530   AIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWL  700
              +D++YL KY+ A+  MK+LP DDPR+F QQ  VHCA C+GA+   G P    QIH  WL
Sbjct  115   LVDEEYLAKYEKAVALMKELPDDDPRSFTQQWRVHCANCDGAFDQVGFPDLEIQIHNCWL  174

Query  701   FFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQA  880
             FFP+HR+YLYF+ERIL  LI D  F LP+WNWD P GM +P I+ + + SPLYD++R+ A
Sbjct  175   FFPWHRFYLYFHERILGKLIGDDKFALPFWNWDAPGGMSMPAIYAN-KTSPLYDERRDPA  233

Query  881   HRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GP  1057
             H+  +  DL Y G E +    Q++  NL IMYRQM++ A    LFFG  +    GD   P
Sbjct  234   HQPPFTLDLDYDGTEPTIPRHQQIDQNLMIMYRQMISGAKKKELFFG--LPYHQGDQPDP  291

Query  1058  GMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGN  1237
             G G++E +PHN++H W GDPR P+ E+MGNFYSAA DP+F+ HH N+DR+W++W  L   
Sbjct  292   GAGSVELIPHNTVHFWSGDPRQPNGEDMGNFYSAARDPLFFAHHGNIDRLWSVWNGLRAG  351

Query  1238  RKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrrak  1417
               + TDPDWL   FLFYDE   LV+V+V D LD   LGYT+Q +  PW + +PT      
Sbjct  352   NTNFTDPDWLNASFLFYDEEARLVRVRVRDCLDTAALGYTYQDVALPWLNARPT------  405

Query  1418  lrskasvsasTSVLPATLNKITTFCVTRSPTSKT----PGKEELL---DLHLAFDDTQFI  1576
                  S + ++  LPATLN+     VTR  TS+T      +EE+L    + +A   ++F+
Sbjct  406   -TETGSPAPASGALPATLNQTVRVAVTRPRTSRTRQEKDDEEEVLVVEGIEVADHFSRFV  464

Query  1577  RfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledl  1756
             +FDVFVNE            + AGS +   H+ +        ++KT      I +LL+D+
Sbjct  465   KFDVFVNESQSGGGMGSAAAQCAGSVAMTPHLVRPDKR--RGSVKTAA-RFGICDLLDDI  521

Query  1757  rlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
               + D  I+V+LVPR  G  VTV     E I
Sbjct  522   GADGDKTIVVSLVPRCAGDMVTVGCVRIEYI  552



>gb|ABI96934.1| putative polyphenol oxidase [Gillenia trifoliata]
Length=453

 Score =   376 bits (966),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 237/359 (66%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A PI PP+   CG A +          +CCP   + ++D      +K P+ ++L +
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEA---TNCCPPPATKIID------FKRPAPAQLRI  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D  Y +KY  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    Q+
Sbjct  52    RPAAHAVDQAYTDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFFEKILGKLINDPTFAIPFWNWDSPAGMPLPAIYAD-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R   H+   + DL Y   E + S+   +  NL +MYRQM++N+  P LFFG   R   G
Sbjct  171   LRAANHQPPTLIDLDYNRTEDNVSNETTINANLKLMYRQMVSNSKTPQLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH S+H W GD   P+ E+MGNFYSA  DP+FY HHSNVDRMW+IWK
Sbjct  229   DEPDPGTGSIEGSPHGSVHLWTGDNTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R D+TD DWL + FLFY+E   LV+VKV D L++  LGY +Q +  PW   KPT
Sbjct  289   TLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLESKNLGYVYQDVDIPWLSSKPT  347



>gb|ABI96930.1| putative polyphenol oxidase [Crataegus monogyna]
Length=453

 Score =   376 bits (966),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 238/359 (66%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A PI PP+   CG A +    G  V  +CCP   + ++D      +K+P+ +KL +
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPP--GAEV-TNCCPPPATKIID------FKLPAPAKLRI  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    Q+
Sbjct  52    RPAAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGYPELELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPPGMPLPAIYAD-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R+  H+   + DL Y G E + S    +  NL IMYRQM++N+    LFFG   R   G
Sbjct  171   FRSAKHQPPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DPVFY HHSNVDRMW+IWK
Sbjct  229   DEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R D+TD DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW   KPT
Sbjct  289   TLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPT  347



>emb|CAN62983.1| hypothetical protein VITISV_035472 [Vitis vinifera]
Length=607

 Score =   382 bits (980),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 255/575 (44%), Positives = 331/575 (58%), Gaps = 43/575 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENPADS--SLSEAKLDRRNVllglgglygayniaggSNPFALASPIPP  373
             K+ C +A+ +   +        S  KLDRRNVLLG+GGLYGA    G + P A  +PI  
Sbjct  49    KVSCNSANGDPNSDSTSDVRETSSGKLDRRNVLLGIGGLYGAAGGLGATKPLAFGAPIQA  108

Query  374   PETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSF-SKLNVRPAAHAIDDDYL  550
             P+   CG AT+ +        +CCP     T     +++PS  S +  RPAAH +  +YL
Sbjct  109   PDISKCGTATVPDGV---TXTNCCPPV---TTKJIXFQLPSSDSPMRTRPAAHLVSKEYL  162

Query  551   EKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGK---PYQIHFTWLFFPFHRW  721
              KYK AI+  K LP DDPR+F QQANVHC YC GAY   G      Q+H +WLF PFHR+
Sbjct  163   AKYKKAIELQKALPDDDPRSFKQQANVHCXYCQGAYDQVGYTDLELQVHASWLFLPFHRY  222

Query  722   YLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVT  901
             YLYF ERIL  LIDDPTF LPYW WDNP GM +P I+     S  YD+KRN  H    V 
Sbjct  223   YLYFNERILAKLIDDPTFALPYWAWDNPDGMYMPXIYASSPSS-JYDEKRNAKHLPPTVI  281

Query  902   DLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIEN  1078
             DL Y G E +  D +   +NLAIMY+Q+++ A  P LF G   R   GD   PG GT+E 
Sbjct  282   DLDYDGTEPTIPDDELKXDNLAIMYKQIVSGATTPKLFXGYPYR--AGDAIDPGAGTLEX  339

Query  1079  VPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG-NRKDITD  1255
             VPHN +H+W G    P +E+MGNFY+A  DP+F+ HH+NVDRMW IWKT+GG NRKD TD
Sbjct  340   VPHNIVHKWTGLADKP-SEDMGNFYTAGRDPIFFGHHANVDRMWNIWKTIGGKNRKDFTD  398

Query  1256  PDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskas  1435
              DWL   F+FYDE K LV VKV D +D  KL Y +Q +P PW       K +   +S  S
Sbjct  399   TDWLDATFVFYDENKQLVXVKVSDCVDTSKLRYQYQDIPIPWLPKXTKAKAKTTTKSSKS  458

Query  1436  vsasTSVLPAT-----------LNKITTFCVTRSPTSKTPGKEE-----LLDLHLAFDDT  1567
               A  + LP T           LN +    V R   S++  ++E     LL   +  D  
Sbjct  459   GVAKAAELPKTTISSIXDFPKALNSVIRVEVPRPKKSRSKKEKEDEEEVLLIKGIELDRE  518

Query  1568  QFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVH-KDTSTTANSTIKTPTFSLAISel  1744
              F++FDV++N++D   ++  +  E+AGSF N+ H H K+  T  N          AI+EL
Sbjct  519   NFVKFDVYINDEDYSVSRPKNS-EFAGSFVNVPHKHMKEMKTKTN-------LRFAINEL  570

Query  1745  ledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
             LEDL  E+D+ ++VT+VPRAGG  VT+     E +
Sbjct  571   LEDLGAEDDESVIVTIVPRAGGDDVTIGGIEIEFV  605



>gb|ABM68052.1| polyphenol oxidase [Trifolium pratense]
Length=605

 Score =   381 bits (979),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 223/527 (42%), Positives = 300/527 (57%), Gaps = 36/527 (7%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVR  517
             +N  A  +P+P P+   C    +      PV  SCCP    D      +K PSF KL VR
Sbjct  89    NNSLAFGAPVPIPDLTKC----VIPPEKSPVSSSCCPPFSADIID---FKFPSFEKLRVR  141

Query  518   PAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIH  688
             PAA  ++DDY  KY  A++ M+ LP DDPR+F+QQAN+HCAYC G Y   G P     +H
Sbjct  142   PAAQLVNDDYFRKYDEALKLMRALPDDDPRSFFQQANIHCAYCVGGYTQKGYPGLELSVH  201

Query  689   FTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKK  868
              +WLF  FHRWY+YFYERIL SLI+DPTF +P+WNWD P GM +P IF +   S LYD K
Sbjct  202   KSWLFLAFHRWYIYFYERILGSLINDPTFAIPFWNWDAPDGMQIPSIFTNPNSS-LYDPK  260

Query  869   RNQAHRRGYVTDLAYAGQETSASD-----------FQKVKNNLAIMYRQMLTNAPCPLLF  1015
             R+  H+   + DL Y+  +   +D            Q++K+NL +MY+QM+TN+   + F
Sbjct  261   RDPKHQPPTIIDLNYSKSKEDPTDPNYDPNFPPSAEQQIKDNLTLMYKQMITNSKTCIQF  320

Query  1016  FGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSN  1195
              G   R       PG G +E  PHN IH W GDP   + E+MG+FYS+  DP+FY  H+N
Sbjct  321   HGSPYRAGQA-PDPGAGQLEINPHNHIHVWCGDPNQKNREDMGHFYSSGRDPLFYALHAN  379

Query  1196  VDRMWTIWKTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPT  1375
             VDR+W+IWKTLGG RKD TD DWL+TEFLFYDE K LVKVKV+D LD  KLGY +Q    
Sbjct  380   VDRLWSIWKTLGGKRKDPTDDDWLETEFLFYDENKNLVKVKVKDGLDGEKLGYVYQDRDL  439

Query  1376  PWKDFKPTrkrraklrskasvsasT----SVLPATLNKITTFCVTRSPTSKTPGKEELLD  1543
             PWK+ KP    R K + K      +       P  L+ + +  V R   S++  ++E  +
Sbjct  440   PWKNCKPEPSSRVKSKGKLLTQRPSRKFVDKFPIVLDSVVSTIVKRPKKSRSSKEKEDEE  499

Query  1544  LHLAFDDTQFIRfdvfvnedddvnTKELDRV------EYAGSFSNLAHVHKDTSTTANST  1705
               L  D  +F        + D +   E D+V      E+AG+F +L H H   +      
Sbjct  500   EILVIDGIEF--DSNIEVKFDVIVNDEDDKVIGVGNTEFAGTFVSLLHGHNHENNKKKKN  557

Query  1706  IKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEI  1846
               T    L +++LLEDL+ ++DD I+VTL+PR GG  V ++    E 
Sbjct  558   TVT-CLRLGLTDLLEDLKADDDDSIVVTLIPRYGGDGVKISGIKIEF  603



>ref|XP_009407067.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=578

 Score =   380 bits (977),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 217/521 (42%), Positives = 288/521 (55%), Gaps = 43/521 (8%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPS-FSKLNVRPAA  526
             A A+PI  P+  +CG A +        P +CCP +  D   A  + IP   S L VRPAA
Sbjct  81    ASAAPIAAPDLSACGLADLPPDA---TPTNCCPPSAGD---ATEFVIPDPSSPLRVRPAA  134

Query  527   HAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTW  697
             H++D DY+ K+   +  MK LP+DDPRNF Q ANVHCAYC+GAY   G P    Q+H +W
Sbjct  135   HSVDKDYIAKFAKGVALMKALPADDPRNFTQHANVHCAYCDGAYSQVGFPDLELQVHNSW  194

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LF P+HR YLYF+ERIL  LI D +F +P+WNWD P GM LP ++ D   SPLYD  R+ 
Sbjct  195   LFLPWHRCYLYFFERILGKLIGDDSFAIPFWNWDAPDGMRLPAMYVD-PTSPLYDPLRDA  253

Query  878   AHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-G  1054
              H+   + DL + G + S+SD Q++ +NL +MYRQ+++NAP P LFFG   R   GD   
Sbjct  254   QHQPPTLVDLDFGGIDPSSSDKQQIDHNLKVMYRQIVSNAPTPRLFFGNPYR--AGDNPN  311

Query  1055  PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG  1234
             PG G++ENVPH  +H W GD      E+MGN YSAA DPVF+ HHSN+DR+W +WK LG 
Sbjct  312   PGGGSLENVPHGPVHVWTGDRSQSELEDMGNLYSAARDPVFFAHHSNIDRIWNVWKGLGS  371

Query  1235  NRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrra  1414
              RKD+ DPDWL   F+FYDE   LVK++V D +D+ KL Y +Q +  PW + +PT     
Sbjct  372   RRKDLADPDWLDASFVFYDENANLVKIRVRDCIDSDKLRYEYQDVGNPWLNTRPTVTSGV  431

Query  1415  klrskasvsasT--SVLPATLNKITTFCVTRSPTSKT-------------PGKEELLDLH  1549
             + R      A+      P  L+ + T  V R   ++T              G E   D+H
Sbjct  432   RPRVAGVAHANVVEPKFPIKLDSVVTAKVKRPKAARTKEEKEEKEEVLVVEGIELDRDVH  491

Query  1550  LAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSL  1729
             + FD   F+                    E AGSF N+ H HK    +    +KT    L
Sbjct  492   VKFD--VFVNVTDHGKVGPGGR-------ELAGSFVNVPHRHKHDKMSKQ--LKT---RL  537

Query  1730  AISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
              +        L+ D  I+VTLVPR G   V V     E++D
Sbjct  538   QLGLTELLEDLKADGSIMVTLVPRQGKGKVKVGSLKIELVD  578



>gb|ABI96948.1| putative polyphenol oxidase [Sorbus californica]
Length=453

 Score =   376 bits (966),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 237/359 (66%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A PI PP+   CG A +    G  V  +CCP   + ++D      +K+P+ +KL +
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPP--GAEV-TNCCPPPATKIID------FKLPAPAKLRI  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    Q+
Sbjct  52    RPPAHAVDQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL  LI+DPTF +PYWNWD+P GM LP I+ D  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFFEKILGKLINDPTFAIPYWNWDSPAGMPLPAIYAD-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R+  H+   + DL Y G E + S    +  NL IMYRQM++N+    LFFG   R   G
Sbjct  171   FRSAKHQPPTLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DPVFY HHSNVDRMW+IWK
Sbjct  229   DEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R D+TD DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW   KPT
Sbjct  289   TLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYAYQDVDIPWLSSKPT  347



>gb|ABI96933.1| putative polyphenol oxidase [Gillenia stipulata]
Length=453

 Score =   376 bits (965),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 237/359 (66%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A PI PP+   CG A +          +CCP   + ++D      +K P+ ++L +
Sbjct  1     PFAFAKPIAPPDLSKCGSADLPPGAEA---TNCCPPPATKIID------FKRPAPAQLRI  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             R AAHA+D  Y +KY  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    Q+
Sbjct  52    RAAAHAVDQAYKDKYYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPDLELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+Y+YF+E+IL  LI+DPTF +P+WNWD+P GM +P I+ D  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYMYFFEKILGKLINDPTFAMPFWNWDSPAGMTMPAIYTD-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R+ +H+   + DL Y G E + S+   +  NL  MYRQM++N+    LFFG A R   G
Sbjct  171   LRSASHQPPTLVDLDYNGTEDNVSNETTINANLKTMYRQMVSNSKNSQLFFGNAYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH S+H W GD   P+ E+MGNFYSA  DP+FY HHSNVDRMW+IWK
Sbjct  229   DEPDPGGGSIEGSPHGSVHLWTGDTTQPNFEDMGNFYSAGRDPIFYAHHSNVDRMWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R DITD DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW   KPT
Sbjct  289   TLGGKRTDITDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQNVDIPWLSSKPT  347



>emb|CDP22269.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   374 bits (960),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 207/431 (48%), Positives = 269/431 (62%), Gaps = 18/431 (4%)
 Frame = +2

Query  578   MKDLPSDDPRNFYQQANVHCAYCNGAYQLAG--KPYQIHFTWLFFPFHRWYLYFYERILQ  751
             MK LP+DDPRNF QQANVHCAYCNGAY  +G  +  Q+H +WLFFPFHRWYLYFYERIL 
Sbjct  1     MKALPADDPRNFTQQANVHCAYCNGAYIQSGSDQEIQVHNSWLFFPFHRWYLYFYERILG  60

Query  752   SLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETS  931
              LI DP+F LP+WNWDN  GM LP IF D + S LY++ RNQ+H    V DL Y G +T 
Sbjct  61    KLIGDPSFGLPFWNWDNIGGMTLPSIFQD-QSSALYNQNRNQSHLPPTVVDLGYNGTDTD  119

Query  932   ASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIENVPHNSIHRWV  1108
             A+D +++KNNLAIMYRQM+TN+     FFGK  R   GD   PG G+IE +PH  IHRWV
Sbjct  120   ATDIERIKNNLAIMYRQMVTNSTTAKDFFGKEYR--AGDAPSPGAGSIEAIPHIPIHRWV  177

Query  1109  GDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITDPDWLQTEFLFY  1288
             GDPR P+ E+MGNFYSA  D VFY HH+NVDRMWTIW+ LGG RK++ DPDWL + F+FY
Sbjct  178   GDPRQPNGEDMGNFYSAGRDIVFYSHHANVDRMWTIWQQLGGKRKEVPDPDWLNSSFIFY  237

Query  1289  DETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvs-asTSVLPA  1465
             DE    V VKV D   N K+GY +QK+  PW   KP  +      +  S +  +  V P 
Sbjct  238   DENAQPVCVKVGDCFSNDKMGYIYQKVDIPWVKNKPVARVTKSRVAFTSGAPQADKVFPG  297

Query  1466  TLNKITTFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnT----KELDR  1633
              LNK     V R   S++  ++E  +  L     +F        +    +      +  +
Sbjct  298   PLNKTVKVLVKRPKLSRSKKQKEEEEERLVVSGIEFSMDKYVKFDVFINDEDDNPNDFAK  357

Query  1634  VEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGS  1813
              EY GSF++L H         +  +KT T +  ++E+LEDL +E DD +LVTLVP++  +
Sbjct  358   SEYVGSFAHLPH-----KVKGDMKVKT-TQTFELTEILEDLDVEEDDALLVTLVPKSKTA  411

Query  1814  FVTVNKAYTEI  1846
              +T++    E+
Sbjct  412   -LTIDSIKIEV  421



>gb|AII22011.1| polyphenol oxidase-9 [Gossypium hirsutum]
Length=567

 Score =   379 bits (972),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 253/560 (45%), Positives = 333/560 (59%), Gaps = 39/560 (7%)
 Frame = +2

Query  203   IRCAAASSEGRENPADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIPPPET  382
             I C A + E +E+P      + K DRR+VL+GLGGLY            A+A+PI  PE 
Sbjct  33    IPCKAINGE-QEHP------KHKFDRRDVLIGLGGLYYGAASLND----AMAAPISAPEM  81

Query  383   KSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYK  562
             + CG A +           CCP   +     D+    S S + VRPAAH +DD+Y+ KY 
Sbjct  82    EKCGRADVPEGVQTT---DCCPP--VSKRILDFKPPFSNSPVRVRPAAHLVDDEYIRKYS  136

Query  563   TAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYF  733
              AI+ MK LP DDPR+F QQANVHCAYC GAY   G P    Q+H +WLFFPFHR+YLYF
Sbjct  137   KAIELMKALPHDDPRSFMQQANVHCAYCEGAYDQVGFPNLELQVHNSWLFFPFHRYYLYF  196

Query  734   YERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAY  913
             +ERIL  LIDDPTF LP+WNWD+P GM +P++F D   S LYDK RN  H    + DL Y
Sbjct  197   FERILGHLIDDPTFGLPFWNWDSPAGMWMPDMFMDTNSS-LYDKFRNSRHYPPTMVDLDY  255

Query  914   AGQETSASDFQK--VKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDTG-PGMGTIENVP  1084
              G++   +   K  VK+NL+IMYRQM++NA  P LF G   R   GD    G G+IENVP
Sbjct  256   NGEDEHETKMNKDQVKSNLSIMYRQMVSNAKTPRLFLGGPFR--AGDEPYQGSGSIENVP  313

Query  1085  HNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG-NRKDITDPD  1261
             H  +H W GD + P+ E+MG FYSAA DP+FY HHSNVDRMW++WKT+   NRKD  DPD
Sbjct  314   HGPVHVWCGDDKQPNGEDMGTFYSAARDPIFYAHHSNVDRMWSVWKTIENINRKDFDDPD  373

Query  1262  WLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrraklrskasvs  1441
             WL   FLFYDE   LV+VKV D LD+  LGY +Q +  PW   KPT ++  K        
Sbjct  374   WLNASFLFYDENANLVRVKVRDCLDHRNLGYVYQFVDLPWLKEKPTPRKLTKKNKAPPPP  433

Query  1442  asTSVLPATLNKITTFCVTRSPTSKTP----GKEELLDLHLAFDDTQFIRfdvfvneddd  1609
              S++     L+K     V R   S++      KEE+L + +      F++FDV+VN++DD
Sbjct  434   VSSTEF--VLDKPVRVNVERPRKSRSKTEKEEKEEILVIDIELKGDLFVKFDVYVNDEDD  491

Query  1610  vnTK-ELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILV  1786
               +    +  E+AGS+ N+ + HK        T+KT    L +++LLEDL  ++DD I+V
Sbjct  492   AGSNIGSENTEFAGSYVNVPNKHK-----QGKTLKT-RLRLGLTDLLEDLGADDDDGIVV  545

Query  1787  TLVPRAGGSFVTVNKAYTEI  1846
             TLVP+ G   + ++    E 
Sbjct  546   TLVPKYGKGNIKISGIKIEF  565



>gb|ABN13632.1| polyphenol oxidase [Doritis pulcherrima x Phalaenopsis hybrid 
cultivar]
Length=549

 Score =   378 bits (970),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 214/494 (43%), Positives = 298/494 (60%), Gaps = 28/494 (6%)
 Frame = +2

Query  350   ALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFS-KLNVRPAA  526
             AL +PI PP+ K CGPA + +      P +CCP      +SA  +K+PS    + VR AA
Sbjct  63    ALGAPIQPPDLKQCGPADLPSGA---TPVNCCPPV----SSAIDFKLPSHDLPIRVRHAA  115

Query  527   HAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTW  697
             H +D +Y+ KY  A+++MKDLP+DDPR+F QQANVHCAYC+ AY   G P    QIH  W
Sbjct  116   HLVDAEYVAKYAEAVKRMKDLPADDPRSFVQQANVHCAYCDAAYDQVGFPNLELQIHNCW  175

Query  698   LFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQ  877
             LFFP+HR+YLYF+ERIL  LI D TF LP+WNWD+P+GM LP I+     S LYD +R+ 
Sbjct  176   LFFPWHRFYLYFHERILGKLIGDDTFALPFWNWDSPKGMQLPSIYTPTSSS-LYDPRRDP  234

Query  878   AHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-G  1054
             AH+   + DL +       +  + +++NL I+YRQ+++N P   LF G  +R   GD   
Sbjct  235   AHQPPTIIDLDFGISPPPNTKKELIEDNLKIVYRQVISNGPTAELFLGAPLR--AGDQPD  292

Query  1055  PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGG  1234
             PG G++ENVPH ++H W GD R P+ E+MG FY+AA DP+F+ HHSN+DR+W +WK+LGG
Sbjct  293   PGAGSLENVPHGTVHIWTGDSRQPNREDMGVFYTAARDPIFFAHHSNIDRLWDVWKSLGG  352

Query  1235  NRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPTrkrra  1414
              RKD TD DWL T F FYDE   LVKVKV+D L    L Y +Q + +PWK  K  R    
Sbjct  353   QRKDFTDADWLNTGFYFYDENAKLVKVKVKDCLSTELLRYKYQDVDSPWKKAKSARGGTG  412

Query  1415  klrskasvsasTSVLPATLNKITTFCVTRSPTSKTPGKEELLDLH---LAFDDTQFIRfd  1585
             +     +        P +L K       + P       +E+  L    + F+ + F++FD
Sbjct  413   RPVKPKAEPG----FPLSLEKANASATVKRPARAGRKGDEVEVLEANGIGFNSSVFVQFD  468

Query  1586  vfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlrle  1765
             V+VN   +   K     E AGSF ++ H+ ++  +   + +K     L I+EL+ D+  +
Sbjct  469   VYVNASSEAVLKPA-VAECAGSFYHVPHLSREGRSAMKTNLK-----LCITELIVDIGAK  522

Query  1766  nddKILVTLVPRAG  1807
              DD ++VTLVPRAG
Sbjct  523   EDDDLVVTLVPRAG  536



>ref|XP_003567197.1| PREDICTED: polyphenol oxidase I, chloroplastic-like [Brachypodium 
distachyon]
Length=592

 Score =   379 bits (974),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 235/589 (40%), Positives = 329/589 (56%), Gaps = 54/589 (9%)
 Frame = +2

Query  167   PSRAARRGDVIKIRCAAA--SSEGRENPADSSLSEAKLDRRNVllglgglygayniaggS  340
             P RAA R     +RC  +  ++ GR     +     +LDRR+VLL LG L  +      S
Sbjct  31    PRRAAGR-----VRCTLSTDATGGR-----AEHDGPRLDRRDVLLRLGTLGASATAGLLS  80

Query  341   NP-FALASPIPPPETKSCGPATIS---NSNGKPVPYSCCPSTLMDTASADYYKIPSFSKL  508
             +P  A A+P+  P+  SCG   +    N+N      +CCP    +    D+    + + L
Sbjct  81    SPRLAGAAPVATPDISSCGKPDLGLPPNANL----LTCCPPP-SNALPVDFSPPDASTPL  135

Query  509   NVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---Y  679
               RPAAH++  DY+ K   A+  MK LP++DPR+F  QA++HCAYCNG+Y + G P    
Sbjct  136   RTRPAAHSVGADYVAKLNRAMAAMKALPAEDPRSFAAQASIHCAYCNGSYGVEGFPGSDL  195

Query  680   QIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLY  859
             Q+H +WLF PFHR YLYF+ERIL SLI DP+F +P+WNWD P GM +P ++ D  +SPL+
Sbjct  196   QVHNSWLFLPFHRCYLYFFERILGSLIGDPSFAMPFWNWDAPGGMRMPAMYVD-PKSPLF  254

Query  860   DKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRK-  1036
             D +R+  H    + +L Y G+E + +D Q+V +NL +MYRQM++ +P P LFFG A R  
Sbjct  255   DPRRDARHAPPELINLDYNGREPTFTDRQQVDHNLRVMYRQMVSLSPTPSLFFGGAYRAG  314

Query  1037  ETGDTGPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTI  1216
             +  D GPG   +EN+PH  +H W GDP  P  E+MGNFYSA  DP+FY HH N+DRMW++
Sbjct  315   DEPDQGPG--PMENIPHGPVHIWCGDPNQPAGEDMGNFYSAGRDPLFYAHHGNIDRMWSV  372

Query  1217  WKTLGGNR-KDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFK  1393
             WK L   R +D+TDPDWL + FLFYDET  LV+++V D LD  +L Y FQ +P PW   +
Sbjct  373   WKGLDPRRHRDLTDPDWLDSSFLFYDETPKLVRIRVRDVLDTDRLRYRFQDVPMPWTTAR  432

Query  1394  PTrkrrakl----rskasvsasTSVLPATLNKITTFCVTRSPTSK-----TPGKEELL--  1540
             PT   RA+      + A+ +   +  P  L+  T+  V R  +SK        KEE+L  
Sbjct  433   PTVTPRARSFGTPTAVAASAKKATKFPIMLDSATSVTVRRPVSSKRSKLEKSAKEEVLVI  492

Query  1541  -----DLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANST  1705
                  D+ +A     F+                    E AGSF ++ H H+         
Sbjct  493   GGIEVDMDIAAKFDVFVNAGDDHAAVGSGGR------ELAGSFVSVPHRHRHDKKEKKIK  546

Query  1706  IKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTVNKAYTEIID  1852
                    LA++E LEDL  E D+ ++VTLVPR G   V +     E+ID
Sbjct  547   T---KLRLALNEQLEDLDAEGDESVVVTLVPRQGKGKVKIGSVKIELID  592



>gb|ABI96935.1| putative polyphenol oxidase [Heteromeles arbutifolia]
Length=453

 Score =   374 bits (961),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 235/359 (65%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A PI PP+   CG A +          +CCP   + ++D      +K+P+ +KL +
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEA---TNCCPPPATKIID------FKLPAPAKLRI  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    Q+
Sbjct  52    RPPAHAVDQAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYAD-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R+  H+   + DL Y G E + S    +  NL IMYRQM++N+    LFFG   R   G
Sbjct  171   FRSAKHQPPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DPVFY HHSNVDRMW+IWK
Sbjct  229   DEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R D+TD DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW   KPT
Sbjct  289   TLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPT  347



>gb|ABI96936.1| putative polyphenol oxidase [Holodiscus microphyllus]
Length=455

 Score =   374 bits (961),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 242/360 (67%), Gaps = 20/360 (6%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A P+ PP+   CG A +        P +CCP   + ++D      +K+P+ ++L +
Sbjct  1     PFAFAKPVLPPDISKCGAADLPTGAE---PMNCCPPPATKIID------FKLPATNRLRI  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RPAAHA+D  Y++KY  A++ MK LP  DPR+F  QA VHCAYC+GAY  AG P    QI
Sbjct  52    RPAAHAVDKAYIDKYNKAMELMKALPDSDPRSFKSQAAVHCAYCDGAYDQAGFPDLELQI  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYFYE+IL  LI+DP+F +P+WNWD P GM +P +F +  ++PLYDK
Sbjct  112   HNSWLFFPFHRYYLYFYEKILGKLINDPSFAIPFWNWDAPAGMQIPALFAN-PKAPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              RN +H+   + DL Y+G + + S+  ++  NL IMYR M++NA  P LFFG+  R   G
Sbjct  171   LRNASHQPPNMIDLDYSGTDENNSNQVQIDQNLNIMYRAMVSNAKNPQLFFGQPYR--AG  228

Query  1046  DTG-PGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFY-CHHSNVDRMWTIW  1219
              T  PG G+IEN PH  IH W GD   P+ ENMGNFYSA  DP+FY   HSNVDRMW IW
Sbjct  229   STANPGPGSIENSPHGPIHLWAGDKTQPNYENMGNFYSAGKDPLFYYAIHSNVDRMWGIW  288

Query  1220  KTLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             K+LGG R DI+D DWL + FLFY+E   +V+V V+D LD+ K+GYT+Q +  PW   KPT
Sbjct  289   KSLGGKRVDISDSDWLNSGFLFYNENAEMVRVTVKDCLDSKKMGYTYQDVEVPWLKTKPT  348



>gb|ABI96927.1| putative polyphenol oxidase [Chaenomeles speciosa]
Length=453

 Score =   374 bits (961),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 186/359 (52%), Positives = 236/359 (66%), Gaps = 19/359 (5%)
 Frame = +2

Query  344   PFALASPIPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNV  514
             PFA A PI PP+   CG A +          +CCP   + ++D      +K+P+ +KL +
Sbjct  1     PFAFAKPIAPPDVSKCGSADLPPGAEF---TNCCPPPATKIID------FKLPAPTKLRI  51

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             RP AHA+D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    Q+
Sbjct  52    RPPAHAVDKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQV  111

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             H +WLFFPFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +SPLYDK
Sbjct  112   HNSWLFFPFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPAGMPLPAIYAD-PKSPLYDK  170

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R+  H+   + DL Y G E + S    +  NL IMYRQM++N+    LFFG   R   G
Sbjct  171   FRSAQHQPPTLVDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYR--AG  228

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G+IE  PH  +H W GD   P+ E+MGNFYSA  DPVFY HHSNVDRMW+IWK
Sbjct  229   DEPDPGGGSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWK  288

Query  1223  TLGGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
             TLGG R D+TD DWL + FLFY+E   LV+VKV D L+  +LGY +Q +  PW   KPT
Sbjct  289   TLGGKRTDLTDSDWLDSGFLFYNENAELVRVKVRDCLETKRLGYVYQDVDIPWLSSKPT  347



>ref|XP_010926766.1| PREDICTED: polyphenol oxidase, chloroplastic-like [Elaeis guineensis]
Length=592

 Score =   379 bits (973),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 245/556 (44%), Positives = 328/556 (59%), Gaps = 40/556 (7%)
 Frame = +2

Query  200   KIRCAAASSEGRENP---ADSSLSEAKLDRRNVllglgglygayniaggSNPFALASPIP  370
             +I C A  +E  E P    ++  S  KLDRR++L+GLGGLYGA    G  N  AL  PI 
Sbjct  44    RISCKATRNE-HEKPMPTTEAIGSSGKLDRRDMLIGLGGLYGAATGLGV-NRKALGLPIE  101

Query  371   PPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNVRPAAHAIDDDY  547
              P+   CGPA + +      P  CCP +   T+    +K+P  S  L +R AAH +D +Y
Sbjct  102   APDVSKCGPADLPSG---ATPTDCCPPS---TSKIIDFKLPPRSDPLRIRSAAHLVDSEY  155

Query  548   LEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHR  718
             L KY  A++ MK LP+DDPRNF QQANVHCAYC+G+Y   G P    Q+H +W+FFP+HR
Sbjct  156   LAKYAKAVELMKALPADDPRNFTQQANVHCAYCDGSYDQIGFPDIELQVHNSWIFFPWHR  215

Query  719   WYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYV  898
             +YLYF+E+IL  LI D TF LP+WNWD P GM +P I+ D   S LY+K R+  H+  Y+
Sbjct  216   FYLYFHEKILGKLIGDETFALPFWNWDAPAGMQMPSIYTDPSSS-LYNKLRDAKHQPPYL  274

Query  899   TDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGMGTIE  1075
              DL + GQ+ S +  Q++  NL IMYRQ++TN     LF G   R   GD   PG G++E
Sbjct  275   IDLDFNGQDPSFTYDQQIDYNLKIMYRQVITNGKTAQLFMGSPYR--AGDQPNPGAGSLE  332

Query  1076  NVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRKDITD  1255
             NVPH ++H W GD   P+ E+MG  YSAA D +FY HHSNVDRMW +WK LGG  KD  D
Sbjct  333   NVPHGTVHVWTGDRNQPNGEDMGTLYSAARDAIFYAHHSNVDRMWNVWKMLGGKHKDFED  392

Query  1256  PDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT--rkrraklrsk  1429
              DWL + FLFYDE   LV+VKV++ LD   L YT+Q +  PW   +PT      AK  ++
Sbjct  393   KDWLNSSFLFYDENADLVRVKVKNCLDTQGLRYTYQDVEIPWLKTRPTPKGTAAAKKGAR  452

Query  1430  asvsasTSVLPATLNKITTFCVTRSPTSKT-----PGKEELLDLHLAFDDTQFIRfdvfv  1594
             +  + + +  P TL+   +  V R   S++       +E L+   + FD   FI+     
Sbjct  453   SLRAVTEATFPVTLDSSVSATVRRPKVSRSRKEKEDEEEVLVVEGIEFDRDMFIK-----  507

Query  1595  nedddvnTKELDRV-----EYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISelledlr  1759
                  +NT E D V     E+AGSF N+   HK++ +     ++T    L I++LLEDL 
Sbjct  508   -FAVYINTPEEDGVDPGSTEFAGSFVNVP--HKNSHSKKEKKVRT-ALRLGITDLLEDLG  563

Query  1760  lenddKILVTLVPRAG  1807
              E DD +LVTLVPR G
Sbjct  564   AEADDSVLVTLVPRKG  579



>ref|XP_006370128.1| hypothetical protein POPTR_0001s39950g [Populus trichocarpa]
 gb|AEH41424.1| polyphenol oxidase [Populus trichocarpa]
 gb|ERP66697.1| hypothetical protein POPTR_0001s39950g [Populus trichocarpa]
Length=573

 Score =   378 bits (971),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 227/515 (44%), Positives = 309/515 (60%), Gaps = 30/515 (6%)
 Frame = +2

Query  338   SNPFALASPIPPPETKSCGPATISNSNGKPVPYSCCPSTLMDTASADYYKIPSFSK-LNV  514
             S+PFA A PI PP+   C   ++ N      P +CCP     T     +K+PS ++ L +
Sbjct  76    SDPFAYAKPIQPPDIADC---SVINEPDPENPTNCCPPL---TRKIIDFKLPSQNEPLRI  129

Query  515   RPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQI  685
             R  AH +DD+Y+ KY  AI  MK LP DDPRNF QQANVHCAYC+G Y   G P   YQ+
Sbjct  130   RRPAHLVDDNYIAKYNRAIALMKQLPEDDPRNFTQQANVHCAYCDGGYHQVGMPDLNYQV  189

Query  686   HFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDK  865
             HF+WLFFP+HR+YLYFYERIL  LI+DPTF LP+WNWD+PQGM +P  F  D +S +YD 
Sbjct  190   HFSWLFFPWHRYYLYFYERILGKLINDPTFALPFWNWDSPQGMQIPAFF-ADPKSAVYDP  248

Query  866   KRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETG  1045
              R+++H+   + DL + G +    D  +V +NL +MYRQ++T A  P LF G+  R   G
Sbjct  249   LRDKSHQPPKIIDLDFPGVDFPLPDPVQVASNLNVMYRQVVT-AKYPTLFMGRPYR--AG  305

Query  1046  DT-GPGMGTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWK  1222
             D   PG G++E+VPH ++H W GD   P+ ENMG FY+AA DP+F+ HH N+DR+W +WK
Sbjct  306   DEPEPGAGSLEDVPHTTVHIWTGDADQPNRENMGVFYAAARDPIFFAHHGNIDRLWEVWK  365

Query  1223  TL-GGNRKDITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT  1399
              L GG R++ TDPDWL   FLFYDE   LV+VK+ D LD  KL Y FQ + +PW + +P 
Sbjct  366   KLPGGKRENFTDPDWLDAAFLFYDENANLVRVKIRDCLDTTKLRYGFQDVASPWINARPK  425

Query  1400  rkrraklrskasvsasTSVLPATLNKITTFCVT-----RSPTSKTPGKEELLDLHLAFDD  1564
             RK      +    +A  +     LNK  +  V      RS   K   +E L+   + +  
Sbjct  426   RKPNKPKPTVPVDTADPTKPIGLLNKTVSVVVQRPNKKRSKKDKDEAEEVLVIEGIEYRI  485

Query  1565  TQFIRfdvfvnedddvnTKELDRVEYAGSFSNLAHVHKDTSTTANSTIKTPTFSLAISel  1744
               +I+F+V +N+  D   K  D  E+AG+F N+ H         N T+KT +  L ISEL
Sbjct  486   DLYIKFNVLINDVPDTPGKA-DDAEFAGTFVNVPH-------NRNKTVKT-SLRLGISEL  536

Query  1745  ledlrlenddKILVTLVPRAGGSFVTVNKAYTEII  1849
             LEDL  E+D+ ++VTLVP       T+     E++
Sbjct  537   LEDLEAEDDESVVVTLVPVTNIGEATIGTLRIELL  571



>gb|EYU34166.1| hypothetical protein MIMGU_mgv1a003279mg [Erythranthe guttata]
Length=594

 Score =   379 bits (973),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 238/534 (45%), Positives = 325/534 (61%), Gaps = 36/534 (7%)
 Frame = +2

Query  266   AKLDRRNVllglgglygayniaggSNPFALASPIPPPETKSCGPATISNSNGKPVPYSCC  445
             +K+DRRN+LLGLGG+YGA N+    +  A A+PI  P+   CG +T   S G     +CC
Sbjct  61    SKVDRRNMLLGLGGMYGAANLLSTPDS-ASANPIQAPQIDKCGNSTYDTSAGVATQINCC  119

Query  446   P---STLMDTASADYYKIPSFSKLNVRPAAHAIDDDYLEKYKTAIQKMKDLPSDDPRNFY  616
             P    T++D      YK+P+F K  VRP+AH +  +YL K+ TA+ +M+ LP DDPR+F 
Sbjct  120   PPFTGTIID------YKLPNFPKTKVRPSAHRLSPEYLFKFNTAVDRMRRLPKDDPRSFM  173

Query  617   QQANVHCAYCNGAYQLAGKP---YQIHFTWLFFPFHRWYLYFYERILQSLIDDPTFTLPY  787
             QQAN+HCAYCNG Y   G+     Q+H  WLFFPFHRWYLYFYERIL  LI DPTF LP+
Sbjct  174   QQANIHCAYCNGGYDQPGQGTLDLQVHNGWLFFPFHRWYLYFYERILGKLIGDPTFALPF  233

Query  788   WNWDNPQGMILPEIFDDDEESPLYDKKRNQAHRRGYVTDLAYAGQETSASDFQKVKNNLA  967
             WNWDNP+GM +P  F  D +S LYD KRN  +    V DL + G   S    Q V NNL 
Sbjct  234   WNWDNPKGMTIPPAF-IDPKSALYDAKRNPDNMPPAVVDLGFTG---STDPLQVVSNNLT  289

Query  968   IMYRQMLTNAPCPLLFFGKAIRKETGDTGPGMGTIENVPHNSIHRWVGDPRS-PHNENMG  1144
             IMY +M+        F GKA R+ T    PG G+ E   H +IH +VGD ++ P  E+MG
Sbjct  290   IMYTEMVRGNSDVYDFMGKAYREGT-PVNPGPGSSERGSHTAIHAFVGDYKNQPAGEDMG  348

Query  1145  NFYSAAIDPVFYCHHSNVDRMWTIWK-TLGGNR---KDITDPDWLQTEFLFYDETKTLVK  1312
             NFYSA  DP+FY HHSNVDRMWT+W+  L  N+   K ITDPD+L T FLFYDE   LV+
Sbjct  349   NFYSAGRDPLFYSHHSNVDRMWTLWQFFLPSNKIPDKKITDPDFLNTAFLFYDENAQLVR  408

Query  1313  VKVEDSLDNVKLGYTFQKMPTPWKDFKP---TrkrraklrskasvsasTSVLPATLNKIT  1483
             V V+D LDN+K+G+ ++++  PW D++P       +     K +V    +V P  L+KI 
Sbjct  409   VTVKDCLDNLKMGFEYERVDLPWLDYRPPAQAASAKVTRAGKTTVKVEDTVFPIVLDKIV  468

Query  1484  TFCVTRSPTSKTPGKEELLDLHLAFDDTQFIRfdvfvnedddvnTKELDRVEYAGSFSNL  1663
                + +  T K    E L+  ++  D ++F++       D+D N  E+D+  YAG+++ +
Sbjct  469   RVLLPK--TKKGKADELLVIENIVVDTSKFLK-FDVFVNDEDDNVAEIDKASYAGTYAQI  525

Query  1664  AHVHKDTSTTANSTIKTPTFSLAISelledlrlenddKILVTLVPRAGGSFVTV  1825
                HK    TA ++I+     L ++++ ED+ + +DD ILVTLVPR  G  VT+
Sbjct  526   P--HKTKEKTATTSIR-----LKLTDVYEDMDVTDDDTILVTLVPRHEGPGVTI  572



>gb|ABY84850.1| polyphenol oxidase [Cydonia oblonga]
Length=504

 Score =   375 bits (964),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 222/510 (44%), Positives = 300/510 (59%), Gaps = 48/510 (9%)
 Frame = +2

Query  365   IPPPETKSCGPATISNSNGKPVPYSCCP---STLMDTASADYYKIPSFSKLNVRPAAHAI  535
             I PP+   CG A +    G  V  +CCP   + ++D      +K+P+ +KL VRP AHA+
Sbjct  3     IAPPDVSKCGSADLPP--GAEV-TNCCPPPATKIID------FKLPAPAKLRVRPPAHAV  53

Query  536   DDDYLEKYKTAIQKMKDLPSDDPRNFYQQANVHCAYCNGAYQLAGKP---YQIHFTWLFF  706
             D  Y +K+  A++ MK LP DDPR+F QQA VHCAYC+GAY  AG P    Q+H +WLFF
Sbjct  54    DKAYRDKFYKAMELMKALPDDDPRSFKQQAAVHCAYCDGAYDQAGFPELELQVHNSWLFF  113

Query  707   PFHRWYLYFYERILQSLIDDPTFTLPYWNWDNPQGMILPEIFDDDEESPLYDKKRNQAHR  886
             PFHR+YLYF+E+IL  LI+DPTF +P+WNWD+P GM LP I+ D  +SPLYDK R+  H+
Sbjct  114   PFHRYYLYFFEKILGKLINDPTFAMPFWNWDSPPGMPLPTIYTD-PKSPLYDKFRSAKHQ  172

Query  887   RGYVTDLAYAGQETSASDFQKVKNNLAIMYRQMLTNAPCPLLFFGKAIRKETGDT-GPGM  1063
                + DL Y G E + S    +  NL IMYRQM++N+    LFFG   R   GD   PG 
Sbjct  173   PPTLIDLDYNGTEDNVSKETTINANLKIMYRQMVSNSKNAQLFFGNPYR--AGDEPDPGG  230

Query  1064  GTIENVPHNSIHRWVGDPRSPHNENMGNFYSAAIDPVFYCHHSNVDRMWTIWKTLGGNRK  1243
             G+IE  PH  +H W GD   P+ E+MGNFYSA  DPVFY HHSNVDRMW+IWKTLGG R 
Sbjct  231   GSIEGTPHGPVHLWTGDNTQPNFEDMGNFYSAGRDPVFYAHHSNVDRMWSIWKTLGGKRT  290

Query  1244  DITDPDWLQTEFLFYDETKTLVKVKVEDSLDNVKLGYTFQKMPTPWKDFKPT--------  1399
             D+TD DWL + FLFY+E   LV+VKV D L+   LGY +Q +  PW   KPT        
Sbjct  291   DLTDSDWLDSGFLFYNENAELVRVKVRDCLETKNLGYVYQDVDIPWLSSKPTPRRAKVAL  350

Query  1400  ------rkrraklrskasvsasTSVLPATL-NKITTFCVTRSPTSKTPGKEELLDLH--L  1552
                           + +S   + +  P +L +KI+T  V + P  K   K+   D    L
Sbjct  351   SKIAKKLGVAHAAVASSSKVVAGTEFPISLGSKIST--VVKRPQQKKRSKKAKEDEEEIL  408

Query  1553  AFDDTQFIRfdvfvnedddvnTKEL----DRVEYAGSFSNLAHVHKDTSTTANSTIKTPT  1720
               +  +F R      +    +  +L    D+ E+AGSF ++ H HK      N+ ++   
Sbjct  409   VIEGIEFDRDVAVKFDVFVNDVDDLPSGPDKTEFAGSFVSVPHRHKHKKKI-NTILR---  464

Query  1721  FSLAISelledlrlenddKILVTLVPRAGG  1810
               L +++LLE++  E+DD ++VTLVP+ G 
Sbjct  465   --LGLTDLLEEIEAEDDDSVVVTLVPKYGA  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6907580157645