BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25867_g1_i3 len=1646 path=[4456:0-187 9472:188-205 9490:206-231
4686:232-250 680:251-254 9526:255-309 9562:310-316 9569:317-321
4773:322-331 4783:332-333 718:334-358 9589:359-369 9600:370-383
9614:384-385 4832:386-394 496:395-397 2407:398-421 9639:422-426
9644:427-429 9647:430-438 9656:439-468 9680:469-492 9704:493-550
1999:551-596 5034:597-635 9763:636-664 5101:665-721 5158:722-750
5187:751-790 9849:791-802 5239:803-817 9879:818-832 5268:833-892
1864:893-910 9916:911-919 9925:920-926 5359:927-951 5384:952-964
5397:965-988 9978:989-994 5427:995-998 5431:999-1018 5451:1019-1057
5490:1058-1089 5522:1090-1123 10019:1124-1188 5620:1189-1206
2157:1207-1230 5661:1231-1291 2234:1292-1436 10211:1437-1442
5868:1443-1555 1550:1556-1560 5985:1561-1617 6042:1618-1645]

Length=1646
                                                                      Score     E

gb|ABC69397.1|  CYP71D48v1                                              585   0.0      Nicotiana tabacum [American tobacco]
dbj|BAC53923.1|  cytochrome P450                                        582   0.0      Petunia x hybrida [garden petunia]
ref|XP_009766832.1|  PREDICTED: premnaspirodiene oxygenase-like         582   0.0      
gb|ABC69395.1|  CYP71D47v2                                              582   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009612725.1|  PREDICTED: premnaspirodiene oxygenase-like         581   0.0      
gb|ABC69394.1|  CYP71D47v1                                              580   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004242036.1|  PREDICTED: premnaspirodiene oxygenase-like         579   0.0      
gb|ABC69396.1|  CYP71D48v2                                              578   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006361940.1|  PREDICTED: premnaspirodiene oxygenase-like         577   0.0      
ref|XP_006355983.1|  PREDICTED: premnaspirodiene oxygenase-like         576   0.0      
ref|XP_004237369.1|  PREDICTED: premnaspirodiene oxygenase              573   0.0      
ref|XP_004233564.1|  PREDICTED: premnaspirodiene oxygenase-like         572   0.0      
sp|A6YIH8.1|C7D55_HYOMU  RecName: Full=Premnaspirodiene oxygenase...    571   0.0      Hyoscyamus muticus
gb|AAF27282.1|AF122821_1  cytochrome P450                               570   0.0      Capsicum annuum
emb|CDP08465.1|  unnamed protein product                                570   0.0      
gb|ABC69405.1|  CYP71D51v3                                              568   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009758268.1|  PREDICTED: premnaspirodiene oxygenase              568   0.0      
ref|XP_009623936.1|  PREDICTED: premnaspirodiene oxygenase-like i...    568   0.0      
emb|CAC24711.1|  cytochrome P450                                        567   0.0      Solanum tuberosum [potatoes]
ref|XP_006365912.1|  PREDICTED: premnaspirodiene oxygenase-like         567   0.0      
dbj|BAN58140.1|  putative premaspirodiene oxygenase                     565   0.0      
ref|XP_006339043.1|  PREDICTED: premnaspirodiene oxygenase-like         565   0.0      
ref|XP_006350396.1|  PREDICTED: premnaspirodiene oxygenase-like         565   0.0      
gb|ABC69403.1|  CYP71D51v1                                              565   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006365938.1|  PREDICTED: premnaspirodiene oxygenase-like         563   0.0      
ref|XP_009770332.1|  PREDICTED: premnaspirodiene oxygenase-like         563   0.0      
ref|XP_006339046.1|  PREDICTED: premnaspirodiene oxygenase-like         559   0.0      
ref|XP_006350395.1|  PREDICTED: premnaspirodiene oxygenase-like         558   0.0      
ref|XP_006339044.1|  PREDICTED: premnaspirodiene oxygenase-like         558   0.0      
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like         556   0.0      
ref|XP_009608635.1|  PREDICTED: premnaspirodiene oxygenase-like         556   0.0      
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7             556   0.0      Solanum chacoense
ref|XP_006350393.1|  PREDICTED: cytochrome P450 71D7-like               555   0.0      
ref|XP_009764618.1|  PREDICTED: cytochrome P450 71D7-like isoform X1    555   0.0      
gb|ABC69402.1|  CYP71D5v2                                               555   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009765480.1|  PREDICTED: premnaspirodiene oxygenase-like         555   0.0      
gb|ABC69398.1|  CYP71D5v3                                               554   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009623934.1|  PREDICTED: premnaspirodiene oxygenase-like         554   0.0      
ref|XP_006359503.1|  PREDICTED: premnaspirodiene oxygenase-like         554   0.0      
ref|XP_006367966.1|  PREDICTED: premnaspirodiene oxygenase-like         553   0.0      
ref|XP_006355212.1|  PREDICTED: premnaspirodiene oxygenase-like         552   0.0      
ref|XP_004246079.1|  PREDICTED: cytochrome P450 71D7-like               551   0.0      
ref|XP_004243471.1|  PREDICTED: premnaspirodiene oxygenase-like         551   0.0      
ref|XP_004241764.1|  PREDICTED: premnaspirodiene oxygenase-like         550   0.0      
ref|XP_006367127.1|  PREDICTED: premnaspirodiene oxygenase-like i...    549   0.0      
ref|XP_006350394.1|  PREDICTED: cytochrome P450 71D6-like               548   0.0      
ref|XP_009772938.1|  PREDICTED: premnaspirodiene oxygenase-like         548   0.0      
ref|XP_009622900.1|  PREDICTED: cytochrome P450 71D7-like               548   0.0      
gb|ABC69399.1|  CYP71D49v1                                              547   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004245943.1|  PREDICTED: premnaspirodiene oxygenase-like         545   0.0      
gb|ABC69400.1|  CYP71D49v3                                              545   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004228510.1|  PREDICTED: premnaspirodiene oxygenase-like         545   0.0      
ref|XP_004249520.2|  PREDICTED: premnaspirodiene oxygenase-like         546   0.0      
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...    544   0.0      
ref|XP_009619325.1|  PREDICTED: premnaspirodiene oxygenase-like         544   0.0      
ref|XP_009598320.1|  PREDICTED: premnaspirodiene oxygenase-like         543   0.0      
ref|XP_006365962.1|  PREDICTED: cytochrome P450 71D7-like               543   0.0      
ref|XP_004250027.1|  PREDICTED: cytochrome P450 71D7                    543   0.0      
ref|XP_004242219.2|  PREDICTED: cytochrome P450 71D7-like               542   0.0      
ref|XP_006350417.1|  PREDICTED: cytochrome P450 71D7-like               541   0.0      
ref|XP_006365979.1|  PREDICTED: premnaspirodiene oxygenase-like         542   0.0      
ref|XP_006341699.1|  PREDICTED: premnaspirodiene oxygenase-like         541   0.0      
ref|XP_006341698.1|  PREDICTED: premnaspirodiene oxygenase-like         541   0.0      
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like         540   0.0      
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like         539   0.0      
ref|XP_006352953.1|  PREDICTED: premnaspirodiene oxygenase-like         539   0.0      
ref|XP_009606204.1|  PREDICTED: premnaspirodiene oxygenase-like         538   0.0      
ref|XP_009625417.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxylase    536   0.0      
ref|XP_009765039.1|  PREDICTED: premnaspirodiene oxygenase-like         536   0.0      
ref|XP_009611155.1|  PREDICTED: premnaspirodiene oxygenase-like         535   0.0      
ref|XP_009794456.1|  PREDICTED: premnaspirodiene oxygenase-like         533   0.0      
ref|XP_009801864.1|  PREDICTED: LOW QUALITY PROTEIN: 5-epiaristol...    533   0.0      
ref|XP_004249519.1|  PREDICTED: premnaspirodiene oxygenase-like         533   0.0      
sp|P93530.1|C71D6_SOLCH  RecName: Full=Cytochrome P450 71D6             533   0.0      Solanum chacoense
emb|CDP18841.1|  unnamed protein product                                532   0.0      
sp|Q94FM7.2|C71DK_TOBAC  RecName: Full=5-epiaristolochene 1,3-dih...    531   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004249812.1|  PREDICTED: premnaspirodiene oxygenase-like         531   1e-180   
emb|CDP07872.1|  unnamed protein product                                530   2e-180   
ref|XP_009803037.1|  PREDICTED: premnaspirodiene oxygenase-like         529   6e-180   
ref|XP_009771988.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    528   8e-180   
gb|ABC69421.1|  CYP71D20v2                                              528   9e-180   Nicotiana tabacum [American tobacco]
ref|XP_009587552.1|  PREDICTED: premnaspirodiene oxygenase-like         528   1e-179   
gb|KHN42275.1|  Cytochrome P450 71D8                                    528   2e-179   
ref|XP_003529672.2|  PREDICTED: cytochrome P450 71D8-like               528   3e-179   
ref|XP_009794009.1|  PREDICTED: premnaspirodiene oxygenase-like         525   1e-178   
emb|CDP07879.1|  unnamed protein product                                524   6e-178   
ref|XP_009612418.1|  PREDICTED: premnaspirodiene oxygenase-like         523   7e-178   
ref|XP_004228511.1|  PREDICTED: premnaspirodiene oxygenase-like         521   6e-177   
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like         521   7e-177   
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like         520   1e-176   
emb|CDP20259.1|  unnamed protein product                                519   7e-176   
ref|XP_006357930.1|  PREDICTED: cytochrome P450 71D7-like               518   1e-175   
ref|XP_009794007.1|  PREDICTED: premnaspirodiene oxygenase-like         518   1e-175   
ref|XP_009793271.1|  PREDICTED: premnaspirodiene oxygenase-like         517   2e-175   
gb|AHH25653.1|  cytochrome P450 CYP71D                                  517   2e-175   
ref|XP_009612417.1|  PREDICTED: premnaspirodiene oxygenase-like         517   2e-175   
gb|KDP39257.1|  hypothetical protein JCGZ_01014                         515   6e-175   
ref|XP_009624011.1|  PREDICTED: premnaspirodiene oxygenase-like i...    512   6e-174   
ref|XP_006339045.1|  PREDICTED: premnaspirodiene oxygenase-like         513   9e-174   
gb|AAD47832.1|  cytochrome P450                                         512   3e-173   Nicotiana tabacum [American tobacco]
ref|XP_009617877.1|  PREDICTED: premnaspirodiene oxygenase-like         512   4e-173   
ref|XP_011081964.1|  PREDICTED: premnaspirodiene oxygenase-like         511   5e-173   
ref|XP_002522721.1|  cytochrome P450, putative                          510   8e-173   Ricinus communis
emb|CDP07882.1|  unnamed protein product                                512   1e-172   
ref|XP_004228509.1|  PREDICTED: premnaspirodiene oxygenase-like         510   1e-172   
emb|CDP07881.1|  unnamed protein product                                521   4e-172   
ref|XP_004511998.1|  PREDICTED: cytochrome P450 71D8-like               509   5e-172   
ref|XP_009357363.1|  PREDICTED: premnaspirodiene oxygenase-like         509   5e-172   
ref|XP_007154033.1|  hypothetical protein PHAVU_003G085400g             509   6e-172   
ref|XP_011082249.1|  PREDICTED: premnaspirodiene oxygenase-like         509   1e-171   
ref|XP_011082374.1|  PREDICTED: premnaspirodiene oxygenase-like         508   2e-171   
ref|XP_007020549.1|  Cytochrome P450                                    506   5e-171   
gb|KDP26294.1|  hypothetical protein JCGZ_22279                         506   1e-170   
ref|XP_008385924.1|  PREDICTED: premnaspirodiene oxygenase-like         505   1e-170   
gb|KEH34024.1|  cytochrome P450 family 71 protein                       505   2e-170   
gb|KEH34017.1|  cytochrome P450 family 71 protein                       504   4e-170   
ref|XP_004231934.1|  PREDICTED: premnaspirodiene oxygenase-like         504   4e-170   
emb|CDP07887.1|  unnamed protein product                                503   4e-170   
ref|XP_003611883.1|  Cytochrome P450                                    504   5e-170   
ref|XP_003516583.1|  PREDICTED: cytochrome P450 71D8-like               503   6e-170   
emb|CDP10756.1|  unnamed protein product                                503   9e-170   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               503   1e-169   
ref|XP_011081934.1|  PREDICTED: cytochrome P450 71D95-like              502   2e-169   
ref|XP_003611886.1|  Cytochrome P450                                    501   3e-169   
gb|AFK45297.1|  unknown                                                 499   1e-168   
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         499   4e-168   
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like               498   6e-168   
ref|XP_003516584.1|  PREDICTED: cytochrome P450 71D8-like               497   2e-167   
ref|XP_006345633.1|  PREDICTED: premnaspirodiene oxygenase-like         497   2e-167   
ref|XP_004512032.1|  PREDICTED: cytochrome P450 71D8-like               497   3e-167   
gb|EYU21978.1|  hypothetical protein MIMGU_mgv1a004623mg                496   7e-167   
emb|CDP10758.1|  unnamed protein product                                495   9e-167   
ref|XP_003537457.1|  PREDICTED: cytochrome P450 71D8-like               495   1e-166   
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               494   1e-166   
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg                494   2e-166   
ref|XP_003550472.2|  PREDICTED: cytochrome P450 71D8-like               496   4e-166   
ref|XP_010653207.1|  PREDICTED: cytochrome P450 71D9-like               493   4e-166   
gb|KDP39256.1|  hypothetical protein JCGZ_01013                         493   5e-166   
ref|XP_011087047.1|  PREDICTED: premnaspirodiene oxygenase-like         493   7e-166   
ref|XP_006367128.1|  PREDICTED: premnaspirodiene oxygenase-like i...    489   3e-165   
gb|KHM99473.1|  Cytochrome P450 71D11                                   490   3e-165   
ref|XP_007147597.1|  hypothetical protein PHAVU_006G138100g             491   7e-165   
ref|XP_010655870.1|  PREDICTED: cytochrome P450 71D10-like              490   8e-165   
ref|XP_004511999.1|  PREDICTED: cytochrome P450 71D8-like               490   1e-164   
ref|XP_007146610.1|  hypothetical protein PHAVU_006G054700g             490   1e-164   
gb|KHN43612.1|  Cytochrome P450 71D9                                    488   2e-164   
emb|CDP07886.1|  unnamed protein product                                489   2e-164   
ref|XP_003517257.1|  PREDICTED: cytochrome P450 71D8-like               489   2e-164   
ref|XP_003551489.1|  PREDICTED: cytochrome P450 71D9-like               489   3e-164   
ref|XP_010655881.1|  PREDICTED: cytochrome P450 71D10-like              488   5e-164   
ref|XP_008779150.1|  PREDICTED: premnaspirodiene oxygenase-like         488   5e-164   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             488   6e-164   
ref|XP_009347232.1|  PREDICTED: cytochrome P450 71D11-like              488   7e-164   
ref|XP_003530791.1|  PREDICTED: cytochrome P450 71D9-like               488   9e-164   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       488   1e-163   
gb|AIZ01224.1|  epi-aristolochene dihydroxylase                         484   1e-163   
ref|XP_006363816.1|  PREDICTED: premnaspirodiene oxygenase-like i...    487   1e-163   
gb|AGB55871.1|  flavonoid 6-hydroxylase 2                               487   1e-163   
gb|KEH34016.1|  cytochrome P450 family 71 protein                       486   1e-163   
ref|XP_004247352.1|  PREDICTED: premnaspirodiene oxygenase-like         487   2e-163   
ref|XP_008791005.1|  PREDICTED: premnaspirodiene oxygenase-like         486   4e-163   
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like              486   4e-163   
gb|KHM99028.1|  Cytochrome P450 71D11                                   485   6e-163   
ref|XP_010644548.1|  PREDICTED: premnaspirodiene oxygenase-like         485   8e-163   
ref|XP_006605460.1|  PREDICTED: cytochrome P450 71D11-like              485   1e-162   
ref|XP_006475119.1|  PREDICTED: premnaspirodiene oxygenase-like         484   1e-162   
ref|XP_003611884.1|  Cytochrome P450                                    484   2e-162   
gb|KHM99475.1|  Cytochrome P450 71D9                                    483   2e-162   
ref|XP_003537455.1|  PREDICTED: cytochrome P450 71D8-like               484   2e-162   
gb|KEH26493.1|  cytochrome P450 family 71 protein                       484   2e-162   
gb|KDP39287.1|  hypothetical protein JCGZ_01044                         484   3e-162   
ref|XP_008777955.1|  PREDICTED: premnaspirodiene oxygenase-like         483   4e-162   
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                    484   6e-162   
gb|AGB55874.1|  flavonoid 6-hydroxylase 3                               482   6e-162   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    483   6e-162   
ref|XP_008778500.1|  PREDICTED: premnaspirodiene oxygenase-like         483   7e-162   
sp|O81974.1|C71D8_SOYBN  RecName: Full=Cytochrome P450 71D8; AltN...    483   8e-162   Glycine max [soybeans]
gb|KEH15784.1|  cytochrome P450 family 71 protein                       482   1e-161   
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              483   1e-161   
gb|AAO32822.1|  cytochrome P450 71D1                                    482   1e-161   Catharanthus roseus [chatas]
sp|E1B2Z9.1|C7AV8_CICIN  RecName: Full=Cytochrome P450 71AV8; Alt...    482   1e-161   
ref|XP_008807779.1|  PREDICTED: premnaspirodiene oxygenase-like         482   2e-161   
ref|XP_003600328.1|  Cytochrome P450                                    481   2e-161   
ref|XP_008807778.1|  PREDICTED: premnaspirodiene oxygenase-like         481   2e-161   
ref|XP_007146612.1|  hypothetical protein PHAVU_006G054900g             481   2e-161   
gb|ACD42776.1|  cytochrome P450 71D1                                    481   2e-161   Catharanthus roseus [chatas]
ref|XP_007146605.1|  hypothetical protein PHAVU_006G054200g             481   2e-161   
ref|XP_006452551.1|  hypothetical protein CICLE_v10010293mg             481   3e-161   
ref|XP_006351653.1|  PREDICTED: premnaspirodiene oxygenase-like         481   3e-161   
ref|XP_011081935.1|  PREDICTED: cytochrome P450 71D95-like              481   4e-161   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              481   4e-161   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               481   4e-161   
ref|XP_007156881.1|  hypothetical protein PHAVU_002G025000g             481   4e-161   
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like               481   4e-161   
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like         480   6e-161   
ref|XP_006346274.1|  PREDICTED: premnaspirodiene oxygenase-like         481   6e-161   
gb|KEH34014.1|  cytochrome P450 family 71 protein                       480   7e-161   
gb|KDP39024.1|  hypothetical protein JCGZ_00781                         481   7e-161   
gb|KDP29297.1|  hypothetical protein JCGZ_19400                         482   7e-161   
gb|AAK62343.2|  elicitor-inducible cytochrome P450                      478   2e-160   Nicotiana tabacum [American tobacco]
ref|XP_007153133.1|  hypothetical protein PHAVU_003G009500g             479   2e-160   
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...    479   2e-160   
gb|KDP39285.1|  hypothetical protein JCGZ_01042                         479   3e-160   
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g             479   3e-160   
ref|XP_008779112.1|  PREDICTED: premnaspirodiene oxygenase-like         478   3e-160   
ref|XP_007020553.1|  Cytochrome P450 71D10, putative                    479   3e-160   
ref|XP_008345750.1|  PREDICTED: cytochrome P450 71D8-like               479   3e-160   
ref|XP_003610580.1|  Cytochrome P450                                    478   4e-160   
ref|XP_004232610.1|  PREDICTED: premnaspirodiene oxygenase-like         478   6e-160   
ref|XP_009615716.1|  PREDICTED: premnaspirodiene oxygenase-like         478   6e-160   
gb|ADD84654.1|  CYP71D175                                               478   6e-160   Scoparia dulcis [escobilla]
gb|KDO38617.1|  hypothetical protein CISIN_1g045050mg                   478   8e-160   
gb|KHN36162.1|  Cytochrome P450 71D8                                    475   1e-159   
ref|XP_007156884.1|  hypothetical protein PHAVU_002G025300g             477   1e-159   
ref|XP_010910607.1|  PREDICTED: premnaspirodiene oxygenase-like         477   1e-159   
gb|AES59944.2|  cytochrome P450 family 71 protein                       476   1e-159   
ref|XP_002523467.1|  cytochrome P450, putative                          477   1e-159   Ricinus communis
ref|XP_003589693.1|  Cytochrome P450                                    476   2e-159   
ref|XP_007146608.1|  hypothetical protein PHAVU_006G054500g             477   2e-159   
ref|XP_010910161.1|  PREDICTED: premnaspirodiene oxygenase-like         476   2e-159   
ref|XP_008778208.1|  PREDICTED: premnaspirodiene oxygenase-like         477   2e-159   
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like               476   3e-159   
gb|KDO37182.1|  hypothetical protein CISIN_1g010699mg                   476   3e-159   
gb|KHM99472.1|  Cytochrome P450 71D11                                   476   4e-159   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              476   5e-159   
gb|AFP19100.1|  amorphadiene oxidase                                    475   5e-159   
gb|ABE57266.1|  amorpha-4,11-diene monooxygenase                        475   5e-159   Artemisia annua [sweet Annie]
gb|KHN36164.1|  Cytochrome P450 71D8                                    475   5e-159   
gb|AFO64615.1|  cytochrome P450 mono-oxygenase                          474   6e-159   
ref|XP_002522762.1|  cytochrome P450, putative                          475   7e-159   Ricinus communis
gb|ABC41927.1|  amorpha-4,11-diene monooxygenase                        474   7e-159   Artemisia annua [sweet Annie]
ref|XP_004512033.1|  PREDICTED: cytochrome P450 71D8-like               475   8e-159   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               475   1e-158   
sp|Q1PS23.1|AMO_ARTAN  RecName: Full=Amorpha-4,11-diene 12-monoox...    474   1e-158   Artemisia annua [sweet Annie]
ref|XP_006364814.1|  PREDICTED: premnaspirodiene oxygenase-like         475   1e-158   
ref|XP_003517259.1|  PREDICTED: cytochrome P450 71D8-like               474   1e-158   
gb|AJD25162.1|  cytochrome P450 CYP71D374                               474   2e-158   
dbj|BAM68808.1|  cytochrome P450 monooxygenase CYP71AV1                 474   2e-158   
ref|XP_002522903.1|  cytochrome P450, putative                          475   2e-158   Ricinus communis
gb|KHG02344.1|  Cytochrome P450                                         474   2e-158   
ref|XP_004304108.1|  PREDICTED: cytochrome P450 71D11-like              474   2e-158   
gb|KHN39921.1|  Cytochrome P450 71D8                                    474   2e-158   
ref|XP_007153130.1|  hypothetical protein PHAVU_003G009200g             474   2e-158   
ref|XP_006452560.1|  hypothetical protein CICLE_v10008075mg             473   3e-158   
ref|XP_004491491.1|  PREDICTED: premnaspirodiene oxygenase-like         474   3e-158   
gb|AGC29947.1|  CYP71BE30                                               473   3e-158   
ref|XP_011082254.1|  PREDICTED: premnaspirodiene oxygenase              474   3e-158   
gb|ABG91755.1|  amorpha-4,11-diene C-12 oxidase                         473   5e-158   Artemisia annua [sweet Annie]
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             473   7e-158   
gb|ABI31728.1|  amorpha-4,11-diene C-12 oxidase                         472   1e-157   Artemisia annua [sweet Annie]
gb|AGO03787.1|  cytochrome P450                                         472   1e-157   
sp|D5JBW9.1|GAO_SAUCO  RecName: Full=Germacrene A oxidase; Short=...    471   1e-157   
dbj|BAM68819.1|  putative cytochrome P450 monooxygenase CYP71AV1        472   1e-157   
ref|XP_007161221.1|  hypothetical protein PHAVU_001G052100g             472   1e-157   
gb|ADU25498.1|  cytochrome P450 monooxygenase                           471   1e-157   
ref|XP_003537216.1|  PREDICTED: cytochrome P450 71D8-like               472   1e-157   
gb|AGN04217.1|  cytochrome P450                                         472   1e-157   
gb|ABG49365.1|  P450 monooxygenase                                      471   2e-157   Artemisia annua [sweet Annie]
ref|XP_004295868.1|  PREDICTED: cytochrome P450 71D11-like              472   2e-157   
gb|KEH41118.1|  cytochrome P450 family 71 protein                       471   2e-157   
ref|XP_003600322.1|  Cytochrome P450                                    471   2e-157   
ref|XP_003589691.1|  Cytochrome P450                                    471   3e-157   
dbj|BAM68815.1|  cytochrome P450 monooxygenase CYP71AV2                 471   3e-157   
ref|XP_008794219.1|  PREDICTED: premnaspirodiene oxygenase-like         471   3e-157   
dbj|BAM68809.1|  putative CYP71AV1 ortholog                             470   4e-157   
ref|XP_010921587.1|  PREDICTED: premnaspirodiene oxygenase-like         470   5e-157   
ref|XP_003600339.1|  Cytochrome P450                                    471   5e-157   
dbj|BAM68810.1|  putative CYP71AV1 ortholog                             470   5e-157   
gb|AIA09039.1|  costunolide synthase                                    470   5e-157   
gb|KDP39254.1|  hypothetical protein JCGZ_01011                         470   9e-157   
gb|AEX07771.1|  cytochrome P450                                         469   9e-157   
gb|KHN42024.1|  Cytochrome P450 71D8                                    468   1e-156   
gb|EYU31465.1|  hypothetical protein MIMGU_mgv1a004885mg                469   1e-156   
ref|XP_007020556.1|  Cytochrome P450 71D10, putative                    469   1e-156   
gb|AIA09038.1|  costunolide synthase                                    469   1e-156   
ref|XP_010061472.1|  PREDICTED: cytochrome P450 71D11-like              469   1e-156   
gb|ABG49366.1|  P450 monooxygenase                                      468   2e-156   Artemisia annua [sweet Annie]
ref|XP_009775980.1|  PREDICTED: premnaspirodiene oxygenase-like         469   2e-156   
ref|XP_007156882.1|  hypothetical protein PHAVU_002G025100g             469   2e-156   
ref|XP_003617704.1|  Cytochrome P450                                    469   2e-156   
gb|KHG11859.1|  Cytochrome P450                                         469   2e-156   
gb|AET00662.2|  cytochrome P450 family 71 protein                       468   3e-156   
gb|KDP36253.1|  hypothetical protein JCGZ_09818                         468   3e-156   
ref|XP_007020557.1|  Cytochrome P450, putative                          468   3e-156   
emb|CDP17903.1|  unnamed protein product                                468   4e-156   
gb|KDP42338.1|  hypothetical protein JCGZ_02811                         468   4e-156   
ref|XP_006380104.1|  hypothetical protein POPTR_0008s21950g             467   4e-156   
gb|ACF74516.1|  amorpha-4,11-diene monooxygenase                        468   5e-156   
gb|AHN62855.1|  germacrene A oxidase                                    467   6e-156   
ref|XP_007099625.1|  Cytochrome P450 71D10, putative                    473   6e-156   
ref|XP_003600330.1|  Cytochrome P450                                    468   6e-156   
ref|XP_003617731.1|  Cytochrome P450                                    468   6e-156   
gb|KCW68416.1|  hypothetical protein EUGRSUZ_F02065                     468   8e-156   
ref|XP_003535170.1|  PREDICTED: cytochrome P450 71D8-like               467   8e-156   
sp|D5JBX1.1|GAO_BARSP  RecName: Full=Germacrene A oxidase; Short=...    467   9e-156   
gb|AES70585.2|  cytochrome P450 family 71 protein                       471   9e-156   
gb|KCW76838.1|  hypothetical protein EUGRSUZ_D01192                     467   1e-155   
ref|XP_003537212.1|  PREDICTED: cytochrome P450 71D8-like               467   1e-155   
gb|AIA09035.1|  germacrene A oxidase                                    466   1e-155   
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             466   2e-155   
gb|KHN08718.1|  Cytochrome P450 71D8                                    466   2e-155   
dbj|BAM68817.1|  putative cytochrome P450 monooxygenase CYP71AV1        466   2e-155   
gb|AGO03789.1|  germacrene A oxidase                                    466   2e-155   
ref|XP_010064672.1|  PREDICTED: cytochrome P450 71D11-like              466   2e-155   
ref|XP_010932987.1|  PREDICTED: premnaspirodiene oxygenase-like         466   2e-155   
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg             466   2e-155   
ref|XP_007216122.1|  hypothetical protein PRUPE_ppa018839mg             466   3e-155   
ref|XP_004247351.1|  PREDICTED: premnaspirodiene oxygenase-like         466   3e-155   
dbj|BAM68818.1|  putative cytochrome P450 monooxygenase CYP71AV1        466   3e-155   
ref|XP_007156883.1|  hypothetical protein PHAVU_002G025200g             466   3e-155   
ref|XP_003535171.1|  PREDICTED: cytochrome P450 71D8-like               465   4e-155   
dbj|BAM68816.1|  putative cytochrome P450 monooxygenase CYP71AV1        465   5e-155   
dbj|BAM68811.1|  putative CYP71AV1 ortholog                             464   8e-155   
ref|XP_003535169.1|  PREDICTED: cytochrome P450 71D8-like               464   9e-155   
ref|XP_003520242.1|  PREDICTED: cytochrome P450 71D8-like               464   1e-154   
gb|KHM99474.1|  Cytochrome P450 71D11                                   464   1e-154   
gb|KDP42339.1|  hypothetical protein JCGZ_02812                         464   1e-154   
emb|CDP07893.1|  unnamed protein product                                464   1e-154   
gb|KEH25843.1|  cytochrome P450 family 71 protein                       464   1e-154   
ref|XP_003600327.1|  Cytochrome P450                                    464   1e-154   
gb|EYU21953.1|  hypothetical protein MIMGU_mgv1a025918mg                464   2e-154   
gb|AIA09036.1|  germacrene A oxidase                                    463   2e-154   
ref|XP_003617706.1|  Cytochrome P450 71D10                              463   2e-154   
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              463   3e-154   
gb|KHN01537.1|  Cytochrome P450 71D11                                   463   3e-154   
gb|AHK60843.1|  CYP71D2                                                 463   4e-154   
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg             463   4e-154   
ref|XP_003549267.1|  PREDICTED: cytochrome P450 71D11-like              463   6e-154   
ref|XP_003636315.1|  Cytochrome P450                                    462   1e-153   
ref|XP_011081932.1|  PREDICTED: cytochrome P450 71D95-like              462   1e-153   
ref|XP_011073878.1|  PREDICTED: premnaspirodiene oxygenase-like         462   1e-153   
ref|XP_003520239.1|  PREDICTED: cytochrome P450 71D8-like               462   1e-153   
sp|G3GBK0.1|C7BL3_CICIN  RecName: Full=Costunolide synthase; Shor...    461   1e-153   
gb|KDP27295.1|  hypothetical protein JCGZ_20283                         461   2e-153   
ref|XP_007212707.1|  hypothetical protein PRUPE_ppa018666mg             461   2e-153   
gb|KEH34025.1|  cytochrome P450 family 71 protein                       461   2e-153   
gb|KDP39022.1|  hypothetical protein JCGZ_00779                         459   3e-153   
gb|KHN36161.1|  Cytochrome P450 71D8                                    459   3e-153   
ref|XP_010027348.1|  PREDICTED: cytochrome P450 CYP71D312-like          461   3e-153   
gb|KHN37234.1|  Cytochrome P450 71D11                                   461   3e-153   
ref|XP_003532168.1|  PREDICTED: cytochrome P450 71D11                   460   4e-153   
ref|XP_007213458.1|  hypothetical protein PRUPE_ppa024556mg             460   5e-153   
gb|AED99878.1|  cytochrome P450                                         461   5e-153   
ref|XP_003617705.1|  Cytochrome P450                                    460   5e-153   
ref|XP_004491658.1|  PREDICTED: uncharacterized protein LOC101503808    476   5e-153   
ref|XP_006474923.1|  PREDICTED: cytochrome P450 71D11-like              460   5e-153   
sp|O22307.1|C71DB_LOTJA  RecName: Full=Cytochrome P450 71D11            459   6e-153   
ref|XP_003555570.2|  PREDICTED: cytochrome P450 71D11-like              461   6e-153   
ref|XP_006596106.1|  PREDICTED: cytochrome P450 71D11-like              460   8e-153   
ref|XP_003617715.1|  Cytochrome P450                                    459   8e-153   
ref|XP_003615865.1|  Cytochrome P450                                    459   8e-153   
ref|XP_011077043.1|  PREDICTED: premnaspirodiene oxygenase-like         459   1e-152   
gb|KEH25835.1|  cytochrome P450 family 71 protein                       459   1e-152   
gb|KEH19671.1|  cytochrome P450 family 71 protein                       459   1e-152   
gb|KCW62217.1|  hypothetical protein EUGRSUZ_H04878                     459   1e-152   
ref|XP_003535173.1|  PREDICTED: cytochrome P450 71D8-like               458   2e-152   
ref|XP_010104090.1|  Cytochrome P450 71D10                              459   2e-152   
ref|XP_010027347.1|  PREDICTED: premnaspirodiene oxygenase-like         459   2e-152   
gb|ABO32531.1|  cytochrome P450-dependent monooxygenase-like protein    459   3e-152   
ref|XP_003617703.1|  Cytochrome P450                                    466   3e-152   
gb|KHN43883.1|  Cytochrome P450 71D10                                   457   3e-152   
ref|XP_003617701.1|  Cytochrome P450                                    459   3e-152   
ref|XP_003600334.1|  Cytochrome P450                                    461   3e-152   
ref|XP_006435925.1|  hypothetical protein CICLE_v10031280mg             458   3e-152   
ref|XP_006421138.1|  hypothetical protein CICLE_v10004785mg             458   4e-152   
gb|KCW68415.1|  hypothetical protein EUGRSUZ_F02064                     457   4e-152   
ref|XP_006575708.1|  PREDICTED: cytochrome P450 71D10-like              458   4e-152   
gb|ABO32530.1|  cytochrome P450-dependent monooxygenase-like protein    458   4e-152   
dbj|BAM68813.1|  cytochrome P450 monooxygenase CYP71AV11                457   4e-152   
ref|XP_010104087.1|  Premnaspirodiene oxygenase                         458   5e-152   
ref|XP_008219722.1|  PREDICTED: premnaspirodiene oxygenase-like         457   6e-152   
ref|XP_010061471.1|  PREDICTED: cytochrome P450 71D11-like              457   7e-152   
ref|XP_003519623.2|  PREDICTED: cytochrome P450 71D10-like              457   7e-152   
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...    457   7e-152   
ref|XP_007226700.1|  hypothetical protein PRUPE_ppa020463mg             456   8e-152   
dbj|BAM68814.1|  putative cytochrome P450 monooxygenase CYP71AV11       456   9e-152   
gb|KHN48844.1|  Cytochrome P450 71D8                                    457   1e-151   
gb|AED99876.1|  cytochrome P450                                         456   1e-151   
gb|EYU39554.1|  hypothetical protein MIMGU_mgv1a004505mg                457   2e-151   
ref|XP_006452559.1|  hypothetical protein CICLE_v10010637mg             458   2e-151   
dbj|BAM68812.1|  cytochrome P450 monooxygenase CYP71AV10                456   2e-151   
gb|KDP25063.1|  hypothetical protein JCGZ_22598                         456   2e-151   
ref|NP_001240107.1|  uncharacterized protein LOC100818520               455   2e-151   
ref|XP_006359946.1|  PREDICTED: premnaspirodiene oxygenase-like         456   2e-151   
sp|D5J9U8.1|GAO_LACSA  RecName: Full=Germacrene A oxidase; Short=...    455   3e-151   
ref|XP_003545101.1|  PREDICTED: cytochrome P450 71D10-like              455   4e-151   
dbj|BAM68821.1|  putative cytochrome P450 monooxygenase CYP71AV11v2     454   6e-151   
gb|KEH16965.1|  cytochrome P450 family 71 protein                       455   6e-151   
emb|CDP11812.1|  unnamed protein product                                454   8e-151   
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like              454   1e-150   
gb|KCW68417.1|  hypothetical protein EUGRSUZ_F02067                     453   1e-150   
gb|ADA70806.1|  cytochrome P450 CYP71D177                               454   1e-150   
gb|AED99873.1|  cytochrome P450                                         454   1e-150   
ref|XP_003600323.1|  Cytochrome P450                                    454   2e-150   
ref|XP_009616520.1|  PREDICTED: premnaspirodiene oxygenase-like         454   2e-150   
gb|KHN29541.1|  Cytochrome P450 71D11                                   454   2e-150   
sp|H2DH20.1|C7D13_PANGI  RecName: Full=Cytochrome P450 CYP71D313        453   2e-150   
emb|CDP07805.1|  unnamed protein product                                451   2e-150   
ref|XP_003636936.1|  Cytochrome P450                                    452   3e-150   
emb|CDP10755.1|  unnamed protein product                                450   4e-150   
gb|KDP39288.1|  hypothetical protein JCGZ_01045                         451   5e-150   
gb|AJD25166.1|  cytochrome P450 CYP71D413                               452   6e-150   
gb|KDP39016.1|  hypothetical protein JCGZ_00773                         450   7e-150   
dbj|BAM68820.1|  putative cytochrome P450 monooxygenase CYP71AV11v1     452   8e-150   
ref|XP_011095806.1|  PREDICTED: cytochrome P450 71D10-like              452   1e-149   
sp|F8S1I0.1|C7BL2_LACSA  RecName: Full=Costunolide synthase; Shor...    451   1e-149   
ref|XP_004501854.1|  PREDICTED: cytochrome P450 71A1-like               452   1e-149   
ref|XP_003615871.1|  Cytochrome P450                                    451   1e-149   
sp|D5JBW8.1|GAO_CICIN  RecName: Full=Germacrene A oxidase; Short=...    451   1e-149   
ref|XP_004305998.1|  PREDICTED: cytochrome P450 71D11-like              451   3e-149   
gb|KCW62218.1|  hypothetical protein EUGRSUZ_H04879                     449   4e-149   
gb|KCW62216.1|  hypothetical protein EUGRSUZ_H04877                     450   4e-149   
ref|XP_011097779.1|  PREDICTED: cytochrome P450 71D11-like              450   4e-149   
ref|XP_006841358.1|  hypothetical protein AMTR_s00181p00020940          450   5e-149   
gb|KHG00772.1|  Cytochrome P450                                         450   6e-149   
ref|XP_004516744.1|  PREDICTED: cytochrome P450 71D10-like              449   8e-149   
ref|XP_009344942.1|  PREDICTED: premnaspirodiene oxygenase-like         449   1e-148   
ref|XP_006447773.1|  hypothetical protein CICLE_v10014947mg             449   1e-148   
ref|XP_004516745.1|  PREDICTED: cytochrome P450 71D10-like              449   1e-148   
ref|XP_011097781.1|  PREDICTED: premnaspirodiene oxygenase-like         449   1e-148   
ref|XP_008370832.1|  PREDICTED: premnaspirodiene oxygenase-like         447   2e-148   
sp|D5JBX0.1|GAO_HELAN  RecName: Full=Germacrene A oxidase; Short=...    447   3e-148   
ref|XP_007033123.1|  Cytochrome P450 71D10, putative                    448   3e-148   
gb|KHN08732.1|  Cytochrome P450 71D9                                    447   4e-148   
ref|XP_007020552.1|  Cytochrome P450 71D10, putative                    448   4e-148   
ref|XP_006469495.1|  PREDICTED: premnaspirodiene oxygenase-like         447   4e-148   
gb|KDO58402.1|  hypothetical protein CISIN_1g010334mg                   447   5e-148   
gb|KHG19246.1|  Cytochrome P450                                         446   8e-148   
ref|XP_011002269.1|  PREDICTED: cytochrome P450 71D9-like               447   9e-148   
ref|XP_009594272.1|  PREDICTED: premnaspirodiene oxygenase-like         446   1e-147   
ref|XP_003551491.1|  PREDICTED: cytochrome P450 71D9-like               446   1e-147   
sp|O81971.1|C71D9_SOYBN  RecName: Full=Cytochrome P450 71D9; AltN...    446   1e-147   
gb|AGB55870.1|  flavonoid 6-hydroxylase 1                               446   1e-147   
ref|XP_002513339.1|  cytochrome P450, putative                          446   1e-147   
ref|XP_009344944.1|  PREDICTED: premnaspirodiene oxygenase-like         447   2e-147   
ref|XP_003617772.1|  Cytochrome P450                                    446   2e-147   
ref|XP_004516743.1|  PREDICTED: cytochrome P450 71D10-like              445   3e-147   
gb|KHN03535.1|  Cytochrome P450 71D8                                    442   4e-147   
gb|AGB55868.1|  flavonoid 6-hydroxylase 1                               445   4e-147   
gb|KEH34015.1|  cytochrome P450 family 71 protein                       442   4e-147   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             443   6e-147   
gb|ABC59080.1|  cytochrome P450 monooxygenase CYP71D64                  444   8e-147   
ref|XP_004305992.1|  PREDICTED: cytochrome P450 71D11-like              444   8e-147   
ref|XP_006474922.1|  PREDICTED: cytochrome P450 71D11-like isofor...    443   9e-147   
ref|XP_007148446.1|  hypothetical protein PHAVU_006G209500g             444   1e-146   
gb|ADA70805.1|  cytochrome P450 CYP71D176                               444   2e-146   
gb|AGO03790.1|  costunolide                                             442   2e-146   
ref|XP_007142403.1|  hypothetical protein PHAVU_008G277500g             442   3e-146   
ref|XP_008362104.1|  PREDICTED: premnaspirodiene oxygenase-like         443   5e-146   
ref|XP_007033124.1|  Cytochrome P450 71D10, putative                    442   5e-146   
ref|XP_009371764.1|  PREDICTED: premnaspirodiene oxygenase-like         443   6e-146   
ref|XP_006447873.1|  hypothetical protein CICLE_v10017726mg             441   6e-146   
gb|AJD25165.1|  cytochrome P450 CYP71D412                               442   7e-146   
gb|KDP39110.1|  hypothetical protein JCGZ_00867                         441   8e-146   
gb|KHN40981.1|  Premnaspirodiene oxygenase                              440   2e-145   
ref|XP_009344943.1|  PREDICTED: premnaspirodiene oxygenase-like         442   2e-145   
gb|KDO69448.1|  hypothetical protein CISIN_1g010315mg                   441   2e-145   
ref|XP_006476912.1|  PREDICTED: cytochrome P450 71A1-like               441   2e-145   
gb|KCW76712.1|  hypothetical protein EUGRSUZ_D01067                     440   2e-145   
gb|AHN62856.1|  costunolide synthase                                    440   2e-145   
ref|XP_003518341.1|  PREDICTED: premnaspirodiene oxygenase-like         440   3e-145   
ref|XP_006841384.1|  hypothetical protein AMTR_s00181p00056510          440   3e-145   
gb|ABF70062.1|  cytochrome P450 family protein                          440   4e-145   
ref|XP_007037782.1|  Cytochrome P450 71A1                               440   5e-145   
ref|XP_009388203.1|  PREDICTED: premnaspirodiene oxygenase-like         440   5e-145   
gb|KEH29697.1|  cytochrome P450 family 71 protein                       439   6e-145   
ref|XP_009780363.1|  PREDICTED: premnaspirodiene oxygenase-like         440   6e-145   
gb|AHB62239.1|  cytochrome P450                                         439   6e-145   
ref|XP_010907203.1|  PREDICTED: premnaspirodiene oxygenase-like         439   7e-145   
ref|XP_002310060.1|  hypothetical protein POPTR_0007s07420g             439   8e-145   
sp|H2DH19.1|C7D31_PANGI  RecName: Full=Cytochrome P450 CYP71D312        437   9e-145   
ref|XP_007148447.1|  hypothetical protein PHAVU_006G209600g             439   1e-144   
ref|XP_009795889.1|  PREDICTED: premnaspirodiene oxygenase-like         439   1e-144   
ref|XP_008372134.1|  PREDICTED: premnaspirodiene oxygenase-like         439   2e-144   
ref|XP_007142054.1|  hypothetical protein PHAVU_008G248600g             437   2e-144   
ref|XP_006856371.1|  hypothetical protein AMTR_s00047p00189560          437   3e-144   
gb|EYU21980.1|  hypothetical protein MIMGU_mgv1a004765mg                438   3e-144   
ref|XP_003600319.1|  Cytochrome P450                                    437   4e-144   
gb|KHN33492.1|  Cytochrome P450 71D10-like protein                      437   5e-144   
gb|KDO62257.1|  hypothetical protein CISIN_1g038414mg                   436   6e-144   
gb|EMS65365.1|  Cytochrome P450 99A2                                    436   1e-143   
gb|EYU27425.1|  hypothetical protein MIMGU_mgv1a024069mg                436   2e-143   
gb|KDP39255.1|  hypothetical protein JCGZ_01012                         435   2e-143   
ref|XP_002514827.1|  cytochrome P450, putative                          436   3e-143   
ref|XP_002276558.2|  PREDICTED: cytochrome P450 71A1-like               435   3e-143   
ref|XP_004288803.1|  PREDICTED: cytochrome P450 71D11-like              435   3e-143   
gb|KDP39284.1|  hypothetical protein JCGZ_01041                         433   3e-143   
emb|CDP20311.1|  unnamed protein product                                439   4e-143   
ref|NP_001236165.1|  cytochrome P450 71D10                              434   6e-143   
ref|XP_003617769.1|  Cytochrome P450                                    434   8e-143   
ref|XP_009371645.1|  PREDICTED: premnaspirodiene oxygenase-like         436   9e-143   
emb|CDP21437.1|  unnamed protein product                                434   9e-143   
gb|KCW76837.1|  hypothetical protein EUGRSUZ_D01190                     433   9e-143   
gb|KDP30978.1|  hypothetical protein JCGZ_11354                         434   1e-142   
gb|AED99871.1|  cytochrome P450                                         433   2e-142   
gb|KEH25844.1|  cytochrome P450 family 71 protein                       433   2e-142   
dbj|BAO45903.1|  cytochrome P450 71D10                                  432   2e-142   
gb|KHN12340.1|  Cytochrome P450 71D10                                   432   3e-142   
ref|XP_008353446.1|  PREDICTED: premnaspirodiene oxygenase-like         437   3e-142   
ref|XP_010027102.1|  PREDICTED: cytochrome P450 71A1-like               432   3e-142   



>gb|ABC69397.1| CYP71D48v1 [Nicotiana tabacum]
Length=504

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/477 (60%), Positives = 378/477 (79%), Gaps = 8/477 (2%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             K  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I T+VISSPQ+A
Sbjct  29    KLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLVISSPQMA  88

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + KTHDL FA+RPK++  DI+ Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK F 
Sbjct  89    KEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFS  148

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             S RQ+ELS +VSSIR  +    P NLT+K+ WFTSS+I + A G++C  DQ K I  +++
Sbjct  149   SIRQDELSKMVSSIR--TTPNLPVNLTDKIFWFTSSVICRSALGKICG-DQDKLIIFMRE  205

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
             ++SLAGGF + D FP+ K IH   G K KL+K H ++D+I + ++ +HK+N  A+    +
Sbjct  206   IISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILENVVNEHKQNR-ADGKKGN  264

Query  888   GK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1061
             G+   ED++DVLLRV+E GE+Q PIT+DNIK+++ DMFS G+ETS+TTIIWA++EM+K+P
Sbjct  265   GEFGGEDLIDVLLRVRESGEVQIPITDDNIKSILIDMFSAGSETSSTTIIWALAEMMKKP  324

Query  1062  SVMAKAQAEVRQALKGNK-TFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1238
             SV+AKAQAEVRQALKG K +F + D++ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI
Sbjct  325   SVLAKAQAEVRQALKGKKISFQEIDIDKLKYLKLVIKETLRMHPPIPLLVPRECMEDTKI  384

Query  1239  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1418
               Y IP KTRVI+NAWA+  +P+SW+DPE F PERFEN+S+DF+GNH++FIPFGAGRR+C
Sbjct  385   DGYNIPFKTRVIVNAWAIGRDPQSWDDPESFTPERFENNSIDFLGNHHQFIPFGAGRRIC  444

Query  1419  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             PG+ F   ++   LA LLYHF+W+LP+G S ++ DMTE+ G+ A++K DL LIA P+
Sbjct  445   PGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLIATPY  501



>dbj|BAC53923.1| cytochrome P450 [Petunia x hybrida]
Length=502

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/472 (61%), Positives = 366/472 (78%), Gaps = 5/472 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLV-GGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             LPPGPWKLP IGSLHHLV  G LPH  L NL+++YGP+M LQLGE  T+ ISSPQ+A+ +
Sbjct  32    LPPGPWKLPFIGSLHHLVFAGPLPHHGLTNLAKRYGPLMLLQLGEQPTVFISSPQMAKEV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FA+RPK+   +I+ Y STD+AFSPYG+YWRQ+RKICV+ELLS KMV SF S R
Sbjct  92    LKTHDLAFATRPKLTFAEIIKYGSTDIAFSPYGEYWRQIRKICVMELLSAKMVNSFSSIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++ELSN++S IRL      P NLTEKV WFTSS++ + A G++C +DQ K I L++++LS
Sbjct  152   EDELSNMISWIRL--RPNIPVNLTEKVKWFTSSVVCRSALGKIC-KDQNKLIILMREILS  208

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST-NSSGK  893
             LA   +  D FP  K++H   G K +LLK HH++D+I   I+ +HK+N +     N    
Sbjct  209   LAISVNFADFFPRWKFLHDLGGSKTRLLKEHHKIDEILQDIVNEHKQNRVNGKMGNGEFG  268

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED++DVLLRV+E G+ Q PIT+DNIKAVI DMFS GTETS+TTIIWA++EM+K+PSV+A
Sbjct  269   GEDLIDVLLRVRESGQHQLPITDDNIKAVIVDMFSAGTETSSTTIIWALAEMMKKPSVLA  328

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVRQA+KG K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE MEE KI  + I
Sbjct  329   KAQAEVRQAMKGKKGFQLIDLDELKYLKLVIKETLRMHPPIPLLIPRECMEETKINGFNI  388

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P KTRVI+N WA+  NPESWEDPE F+PERFEN+ +DF GNH++FIPFGAGRRMCPG+ F
Sbjct  389   PLKTRVIVNIWAIGRNPESWEDPESFMPERFENNPIDFTGNHHQFIPFGAGRRMCPGMLF  448

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
               T++A  LA LL+HF+W+LP+G SP+DLDMTE+ GV A++K DL  +A P+
Sbjct  449   GLTNVAQLLAQLLHHFDWKLPNGQSPQDLDMTESPGVSATRKDDLVFVATPY  500



>ref|XP_009766832.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=503

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/476 (60%), Positives = 373/476 (78%), Gaps = 7/476 (1%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             K  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I T++ISSPQ+A
Sbjct  29    KLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLIISSPQMA  88

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + KTHDL FA+RPK++  DI+ Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK F 
Sbjct  89    KEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFS  148

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             S RQ+ELS +VSSIR  +      NLT+K+ WFTSS+  + A G++C  DQ K I  +++
Sbjct  149   SIRQDELSKMVSSIR--TTPNLTVNLTDKIFWFTSSVTCRSALGKICG-DQDKLIIFMRE  205

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
             ++SLAGGF + D FP+ K IH   G K KL+K H ++D+I   ++ +HK+N  A+    +
Sbjct  206   IISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNR-ADGKKGN  264

Query  888   GK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1061
             G+   ED++DVLLRV+E GE+Q PIT+DNIK+++ DMFS G+ETS+TTIIWA++EM+K+P
Sbjct  265   GEFGGEDLIDVLLRVRESGEVQIPITDDNIKSILIDMFSAGSETSSTTIIWALAEMMKKP  324

Query  1062  SVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1241
             SV+AKAQAEVRQALK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI 
Sbjct  325   SVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKID  384

Query  1242  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1421
              Y IP KTRVI+NAWA+  +PESW+DPE F+PERFENSS+DF+GNH++FIPFGAGRR+CP
Sbjct  385   GYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERFENSSIDFLGNHHQFIPFGAGRRICP  444

Query  1422  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             G+ F   ++   LA LLYHF+W+LP+G S ++ DMTE+ G+ A++K DL LIA P+
Sbjct  445   GMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLIATPY  500



>gb|ABC69395.1| CYP71D47v2 [Nicotiana tabacum]
Length=503

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/476 (60%), Positives = 373/476 (78%), Gaps = 7/476 (1%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             K  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I T++ISSPQ+A
Sbjct  29    KLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLIISSPQMA  88

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + KTHDL FA+RPK++A DI+ Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK F 
Sbjct  89    KEVLKTHDLAFATRPKLVAADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFS  148

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             S RQ+ELS ++SSIR  +      NLT+K+ WFTSS+  + A G++C  DQ K I  +++
Sbjct  149   SIRQDELSKMLSSIR--TTPNLTVNLTDKIFWFTSSVTCRSALGKICG-DQDKLIIFMRE  205

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
             ++SLAGGF + D FP+ K IH   G K KL+K H ++D+I   ++ +HK+N  A+    +
Sbjct  206   IISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNR-ADGKKGN  264

Query  888   GK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1061
             G+   ED++DVLLRV+E GE+Q PIT DNIK+++ DMFS G+ETS+TTIIWA++EM+K+P
Sbjct  265   GEFGGEDLIDVLLRVRESGEVQIPITNDNIKSILIDMFSAGSETSSTTIIWALAEMMKKP  324

Query  1062  SVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1241
             SV+AKAQAEVRQALK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI 
Sbjct  325   SVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKID  384

Query  1242  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1421
              Y IP KTRVI+NAWA+  +PESW+DPE F+PERFENSS+DF+GNH++FIPFGAGRR+CP
Sbjct  385   GYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERFENSSIDFLGNHHQFIPFGAGRRICP  444

Query  1422  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             G+ F   ++   LA LLYHF+W+LP+G S ++ DMTE+ G+ A++K DL LIA P+
Sbjct  445   GMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLIATPY  500



>ref|XP_009612725.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=503

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/476 (59%), Positives = 376/476 (79%), Gaps = 8/476 (2%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             K  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I T+VISSPQ+A
Sbjct  29    KLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLVISSPQMA  88

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + KTHDL FA+RPK++  DI+ Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK F 
Sbjct  89    KEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFS  148

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             S RQ+ELS +VS IR  +    P NLT+K+ WFTSS+I + A G++C  DQ K I  +++
Sbjct  149   SIRQDELSKMVSYIR--TTPNLPVNLTDKIFWFTSSVICRSALGKICG-DQDKLIIFMRE  205

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
             ++SLAGGF + D FP+ K IH   G K KL+K H ++D+I + ++ +HK+N  A+    +
Sbjct  206   IISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILENVVNEHKQNR-ADGKKGN  264

Query  888   GK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1061
             G+   ED++DVLLRV+E GE+Q PIT+DNIK+++ DMFS G+ETS+TTIIWA++EM+K+P
Sbjct  265   GEFGGEDLIDVLLRVRESGEIQIPITDDNIKSILIDMFSAGSETSSTTIIWALAEMMKKP  324

Query  1062  SVMAKAQAEVRQALKGNK-TFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1238
             SV+AKAQAEVRQALKG K +F + D++ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI
Sbjct  325   SVLAKAQAEVRQALKGKKISFQEIDIDKLKYLKLVIKETLRMHPPIPLLVPRECMEDTKI  384

Query  1239  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1418
               Y IP KTRVI+NAWA+  +P+SW+DPE F PERFEN+S+DF+GNH++FIPFGAGRR+C
Sbjct  385   DGYNIPFKTRVIVNAWAIGRDPQSWDDPESFTPERFENNSIDFLGNHHQFIPFGAGRRIC  444

Query  1419  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             PG+ F   ++   LA LLYHF+W+LP+G + ++ DMTE+ G+ A++K DL LIA P
Sbjct  445   PGMLFGLANVGQPLAQLLYHFDWKLPNGQTHQNFDMTESPGISATRKDDLILIATP  500



>gb|ABC69394.1| CYP71D47v1 [Nicotiana tabacum]
Length=503

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/476 (59%), Positives = 372/476 (78%), Gaps = 7/476 (1%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             K  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I T++ISSPQ+A
Sbjct  29    KLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLIISSPQMA  88

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + KTHDL FA+RPK++  DI+ Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK F 
Sbjct  89    KEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFS  148

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             S RQ+ELS ++SSIR  +      NLT+K+ WFTSS+  + A G++C  DQ K I  +++
Sbjct  149   SIRQDELSKMLSSIR--TTPNLTVNLTDKIFWFTSSVTCRSALGKICG-DQDKLIIFMRE  205

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
             ++SLAGGF + D FP+ K IH   G K KL+K H ++D+I   ++ +HK+N  A+    +
Sbjct  206   IISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNR-ADGKKGN  264

Query  888   GK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1061
             G+   ED++DVLLRV+E GE+Q PIT DNIK+++ DMFS G+ETS+TTIIWA++EM+K+P
Sbjct  265   GEFGGEDLIDVLLRVRESGEVQIPITNDNIKSILIDMFSAGSETSSTTIIWALAEMMKKP  324

Query  1062  SVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1241
             SV+AKAQAEVRQALK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI 
Sbjct  325   SVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKID  384

Query  1242  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1421
              Y IP KTRVI+NAWA+  +PESW+DPE F+PERFENSS+DF+GNH++FIPFGAGRR+CP
Sbjct  385   GYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERFENSSIDFLGNHHQFIPFGAGRRICP  444

Query  1422  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             G+ F   ++   LA LLYHF+W+LP+G S ++ DMTE+ G+ A++K DL LIA P+
Sbjct  445   GMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLIATPY  500



>ref|XP_004242036.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/472 (62%), Positives = 375/472 (79%), Gaps = 5/472 (1%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
             KQ+LPPGPW+LP IG+LHHL+GG LPHR LR+LS++YGPIM+LQLG++ T+VI+SP +A+
Sbjct  26    KQRLPPGPWRLPFIGNLHHLIGGGLPHRVLRDLSQRYGPIMYLQLGQVPTVVITSPTIAQ  85

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              I KTHDL FA RP++++ +I+FY + DVAFS YGDYWRQMRKIC++ELLS KMVKSF  
Sbjct  86    EILKTHDLAFADRPQLVSTNIIFYNNKDVAFSQYGDYWRQMRKICIVELLSTKMVKSFSG  145

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              RQ+ELS+L+SSIR +   G   N+TEKV  FT+ +  + AFG++C +D+ +F+ALLK++
Sbjct  146   IRQDELSSLISSIRSTR--GTTINMTEKVFQFTNCVTCRSAFGKIC-KDRNEFVALLKKI  202

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST-NSS  887
             L  AGGFDL DLFPS K +H  SG+K +L+K H ++D I + II +H EN +A    N  
Sbjct  203   LVFAGGFDLADLFPSWKLLHNISGVKSRLVKAHQKIDAIMENIINEHIENKVAGKKGNGE  262

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
               DED+VDV LRVKE  ELQFPIT+++IKAVI+D+F  GTETS+ TIIWA+SE++K P+V
Sbjct  263   FGDEDLVDVFLRVKENAELQFPITKEHIKAVISDIFIAGTETSSATIIWALSELMKNPNV  322

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             MAKAQ+EVRQ LKG K + ++D+E LTYLKLVIKETLRLH P+PLI PRE  E+  I  Y
Sbjct  323   MAKAQSEVRQVLKGKKNYGEEDIEKLTYLKLVIKETLRLHTPVPLIGPRECREKTNIDGY  382

Query  1248  IIPPKTRVIINAWALATNPESWE-DPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1424
              IP   RV++NAWALA +P++W+ +PE F+PERFENSS+DFMGNH+EFIPFGAGRR+CPG
Sbjct  383   TIPHNARVLVNAWALARDPKNWDKNPESFIPERFENSSIDFMGNHFEFIPFGAGRRICPG  442

Query  1425  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             I F   ++AL LA LLYHF WELP GV+PKDLDM+E  G+ ASK KDL L A
Sbjct  443   IQFGLANVALPLAQLLYHFEWELPYGVNPKDLDMSETHGLTASKAKDLYLNA  494



>gb|ABC69396.1| CYP71D48v2 [Nicotiana tabacum]
Length=503

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/476 (59%), Positives = 375/476 (79%), Gaps = 8/476 (2%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             K  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I T+VISSPQ+A
Sbjct  29    KLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLVISSPQMA  88

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + KTHDL FA+RPK++  DI+ Y STD+A SPYG+YWRQ+RKIC+LELLS KMVK F 
Sbjct  89    KEVLKTHDLAFATRPKLVVADIIHYDSTDIALSPYGEYWRQIRKICILELLSAKMVKFFS  148

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             S RQ+ELS +VSSIR  +    P NLT+K+ WFTSS+I + A G++C  DQ K I  +++
Sbjct  149   SIRQDELSKMVSSIR--TTPNLPVNLTDKIFWFTSSVICRSALGKICG-DQDKLIIFMRE  205

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
             ++SLAGGF + D FP+ K IH   G K KL+K H ++D+I + ++ +HK+N  A+    +
Sbjct  206   IISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILENVVNEHKQNR-ADGKKGN  264

Query  888   GK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1061
             G+   ED++DVLLRV+E GE+Q PIT+DNIK+++ DMFS G+ETS+TTIIWA++EM+K+P
Sbjct  265   GEFGGEDLIDVLLRVRESGEVQIPITDDNIKSILIDMFSAGSETSSTTIIWALAEMMKKP  324

Query  1062  SVMAKAQAEVRQALKGNK-TFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1238
             SV+AKAQAEV QALKG K +F + D++ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI
Sbjct  325   SVLAKAQAEVSQALKGKKISFQEIDIDKLKYLKLVIKETLRMHPPIPLLVPRECMEDTKI  384

Query  1239  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1418
               Y IP KTRVI+NAWA+  +P+SW+DPE F PERFEN+S+DF+GNH++FIPFGAGRR+C
Sbjct  385   DGYNIPFKTRVIVNAWAIGRDPQSWDDPESFTPERFENNSIDFLGNHHQFIPFGAGRRIC  444

Query  1419  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             PG+ F   ++   LA LLYHF+W+LP+G + ++ DMTE+ G+ A++K DL LIA P
Sbjct  445   PGMLFGLANVGQPLAQLLYHFDWKLPNGQTHQNFDMTESPGISATRKDDLILIATP  500



>ref|XP_006361940.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/473 (60%), Positives = 372/473 (79%), Gaps = 6/473 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             LPPGPWKLP IGSLHHL V G LPH  L+NL++ YG +MHLQLGEI T++ISSP++A+ +
Sbjct  32    LPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKCYGALMHLQLGEIPTVIISSPRMAKEV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDLVFA+RPK++  DIV Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK F S R
Sbjct  92    LKTHDLVFATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             Q+ELS +VSSIR +     P NLT+K+ WFTSS+  + A G++C  DQ K I  +++++S
Sbjct  152   QDELSKMVSSIR-TMPNNLPVNLTDKIFWFTSSVTCRSALGKICC-DQDKLIIFMREIIS  209

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  893
             LAGGF + D FP+ K +H   G K +L+K H ++D+I + ++ +HK+N  A+    +G+ 
Sbjct  210   LAGGFSVADFFPTWKMLHDVGGSKTRLVKAHRKIDEILENVVNEHKQNR-ADGKKGNGEF  268

Query  894   -DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
               ED++DVLLRV+E GE+Q PIT+DNIKA++ DMFS G+ETS+TTIIWA++EM+K+PSV+
Sbjct  269   GGEDLIDVLLRVRESGEVQIPITDDNIKAILVDMFSAGSETSSTTIIWALAEMMKKPSVL  328

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
             AKAQAEVRQ LK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI  Y 
Sbjct  329   AKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYN  388

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP KTRVI+NAWA+  +PESW+DPE F PERFENSS+DF+G+H++FIPFGAGRR+CPG+ 
Sbjct  389   IPFKTRVIVNAWAIGRDPESWDDPESFSPERFENSSIDFLGSHHQFIPFGAGRRICPGML  448

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             F   ++   LA LLYHF+W+LP+G S ++LD+TE+ G+ A++K DL LIA P+
Sbjct  449   FGLANVGQPLAQLLYHFDWKLPNGQSHENLDLTESPGISATRKDDLVLIATPY  501



>ref|XP_006355983.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Solanum 
tuberosum]
Length=514

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/481 (60%), Positives = 368/481 (77%), Gaps = 7/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLV-GGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W+K+K   KQ+LPPGPW+LP IGSLHHL+ GG LPHR  RNL+R+YGPIM+LQLGEI  +
Sbjct  29    WSKNK---KQRLPPGPWRLPFIGSLHHLIIGGQLPHRVFRNLARRYGPIMYLQLGEIPVV  85

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             +ISSP +A+ I +THDL FA RP+ ++ +I+FY + D+ FS YGDYWRQMRKIC++ELLS
Sbjct  86    IISSPTIAQEILRTHDLAFADRPQFVSTNIIFYNNKDIVFSQYGDYWRQMRKICMVELLS  145

Query  504   MKMVKSFCSFRQEELSNLVSSIRLS-SETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQ  680
             +KMVKSF   RQ+ELS+L+SSI  +        N++EKV  F +S+  + AFG++C + +
Sbjct  146   VKMVKSFSGIRQDELSSLISSICSTRGGATVLINMSEKVFRFINSVTCRSAFGKIC-KGK  204

Query  681   GKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN  860
              +FI L+K+VL  AGGFD+ DLFPS K +H  SG+K +L+  H ++D I + II +H EN
Sbjct  205   DEFITLMKEVLFFAGGFDVADLFPSWKLLHNISGVKSRLMNAHQKVDAIMENIINEHIEN  264

Query  861   H-LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
               +    N    DED+VDVLLR+KE  +LQFPIT D+IKAVI D+F  GTE S+ TIIWA
Sbjct  265   KAIGKKRNGEFGDEDLVDVLLRIKENSQLQFPITNDHIKAVITDIFIAGTEASSLTIIWA  324

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             +SEM++ P+VMAKAQ EVRQ  KG K +D+KD+E LTYLKLVIKETLRLH P PL+ PRE
Sbjct  325   LSEMMRNPNVMAKAQHEVRQVFKGKKNYDEKDIEKLTYLKLVIKETLRLHTPGPLMGPRE  384

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               E   I  YIIP KTRV++N WALA +P+ W++P  F+PERFENSS+DFMGN +EFIPF
Sbjct  385   CRENTNIDGYIIPQKTRVLVNVWALARDPKYWQNPTSFIPERFENSSIDFMGNDFEFIPF  444

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             G+GRRMCPGI FA  ++  SLA LLYHF WELP+GV+PKDLDMTE  G+ ASKKKDL LI
Sbjct  445   GSGRRMCPGIQFALANVGFSLAQLLYHFEWELPNGVNPKDLDMTETHGLTASKKKDLYLI  504

Query  1578  A  1580
             A
Sbjct  505   A  505



>ref|XP_004237369.1| PREDICTED: premnaspirodiene oxygenase [Solanum lycopersicum]
Length=501

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/481 (58%), Positives = 371/481 (77%), Gaps = 3/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  22    WKNSNSQSK-KLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP +A+ + KTHD+ FASRPK++A +IV Y  +D+AF PYGDYWRQMRKICVLELLS 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYSRSDIAFCPYGDYWRQMRKICVLELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+S+ S R++E+  LV+ IR SS    P N TE++  FTSS+  + AFG+V  E Q K
Sbjct  140   KNVRSYSSIRRDEVDRLVNFIRSSSSFREPVNFTERLFLFTSSMTCRSAFGKVFKE-QDK  198

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+N  
Sbjct  199   FIQLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIVNAHHKVDAIVEDVINEHKKNIA  258

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DVLLR+   G LQFPIT DNIKA+I DMF+ GTETS++T++WAM +
Sbjct  259   MGKTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQ  318

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             ++K PSV AKAQAEVR+A K  +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  319   LMKNPSVFAKAQAEVREAFKDRETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECRE  378

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y +P KT+V++N WAL  +P+ W+D E F PERFE SSVDF+GN++E++PFG G
Sbjct  379   ETDINGYTVPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQSSVDFIGNNFEYLPFGGG  438

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++ L LA LLYHF+W+LP+G+ PKDL++TE VGV A++K DL L+A P
Sbjct  439   RRICPGISFGLANVYLPLAQLLYHFDWKLPNGMEPKDLNLTELVGVTAARKDDLILVATP  498

Query  1587  F  1589
             +
Sbjct  499   Y  499



>ref|XP_004233564.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/473 (59%), Positives = 372/473 (79%), Gaps = 6/473 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             LPPGPWKLP IGSLHHL + G LPH  L+NL+++YG +++LQLGEI T++ISSP++A+ +
Sbjct  32    LPPGPWKLPFIGSLHHLALAGPLPHHGLKNLAKRYGALIYLQLGEIPTVIISSPRMAKEV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDLVFA+RPK++  DIV Y S+D+AFSPYG+YWRQ+RKIC+LELLS KMVK F S R
Sbjct  92    LKTHDLVFATRPKLVVADIVHYDSSDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             Q+ELS +VSSIR +     P NLT+K+ WFTSS+  + A G++C  DQ K I  +++++S
Sbjct  152   QDELSKMVSSIR-TMPNNHPVNLTDKIFWFTSSVTCRSALGKICC-DQDKLIIFMREIIS  209

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  893
             LAGGF + D FP+ K +H   G K +LLK H ++D+I + ++ +HK+N  A+    +G+ 
Sbjct  210   LAGGFSVADFFPTWKMLHDVGGSKTRLLKAHRKIDEILENVVNEHKQNR-ADGKKGNGEF  268

Query  894   -DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
               ED++DVLLRV+E GE+Q PIT+DNIK+++ DMFS G+ETS+TTIIWA++EM+K+PSV+
Sbjct  269   GGEDLIDVLLRVRESGEVQIPITDDNIKSILVDMFSAGSETSSTTIIWALAEMMKKPSVL  328

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
             AKAQAEVRQ LK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI  Y 
Sbjct  329   AKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYN  388

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP KTRVI+NAWA+  +PESW+DPE F PERFENSSVDF+G+H++FIPFGAGRR+CPG+ 
Sbjct  389   IPFKTRVIVNAWAIGRDPESWDDPESFSPERFENSSVDFLGSHHQFIPFGAGRRICPGML  448

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             F   ++   LA LLYHF+W+LP+G S + LD+TE+ G+ A++K DL LIA P+
Sbjct  449   FGLANVGQPLAQLLYHFDWKLPNGQSHESLDLTESPGISATRKDDLVLIATPY  501



>sp|A6YIH8.1|C7D55_HYOMU RecName: Full=Premnaspirodiene oxygenase; Short=HPO; AltName: 
Full=Cytochrome P450 71D55 [Hyoscyamus muticus]
 gb|ABS00393.1| cytochrome P450 hydroxylase [Hyoscyamus muticus]
Length=502

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/481 (57%), Positives = 372/481 (77%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  22    WKNSNSQSK-KLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP +A+ + KTHD+ FASRPK++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  LV+ +R  S T  P N TE++  FTSS+  + AFG+V  E Q  
Sbjct  140   KNVRSFSSIRRDEVLRLVNFVR--SSTSEPVNFTERLFLFTSSMTCRSAFGKVFKE-QET  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+V+ LAGGFD+ D+FPS K++H  +GM+ K++K HH++D I + +I +HK+N  
Sbjct  197   FIQLIKEVIGLAGGFDVADIFPSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNLA  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DVLLR+   G LQFPIT DNIKA+I DMF+ GTETS++T++WAM +
Sbjct  257   MGKTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQ  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M++ P+++AKAQAEVR+A KG +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  317   MMRNPTILAKAQAEVREAFKGKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECRE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E +I  Y IP KT+V++N WAL  +P+ W+D + F PERFE  SVDF+GN++E++PFG G
Sbjct  377   ETEINGYTIPVKTKVMVNVWALGRDPKYWDDADNFKPERFEQCSVDFIGNNFEYLPFGGG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++ L LA LLYHF+W+LP G+ PKDLD+TE VGV A++K DL L+A P
Sbjct  437   RRICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTELVGVTAARKSDLMLVATP  496

Query  1587  F  1589
             +
Sbjct  497   Y  497



>gb|AAF27282.1|AF122821_1 cytochrome P450 [Capsicum annuum]
Length=502

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/476 (59%), Positives = 371/476 (78%), Gaps = 7/476 (1%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             K  LPPGPWKLP IGSLHHL V G LPH  L+NL++ YGP+MHL+LGEI T++ISSP++A
Sbjct  29    KLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKLYGPLMHLRLGEIPTVIISSPRMA  88

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + KTHDL FA+RPK++  DIV Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK F 
Sbjct  89    KEVLKTHDLAFATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFS  148

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             S RQ+ELS +VSSIR  +   FP NLT+K+ WFTSS+  + A G++C  DQ K I  +++
Sbjct  149   SIRQDELSMMVSSIR--TMPNFPVNLTDKIFWFTSSVTCRSALGKIC-RDQDKLIIFMRE  205

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
             ++SL GGF + D FP+ K +H   G K +LLK H ++D+I + ++ +HK+N  A+    +
Sbjct  206   IISLTGGFSIADFFPTWKMLHDVGGSKTRLLKAHRKIDEILEHVVNEHKQNR-ADGQKGN  264

Query  888   GK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1061
             G+   ED++DVLLRV+E GE+Q  IT+DNIK+++ DMFS G+ETS+TTIIWA++EM+K+P
Sbjct  265   GEFGGEDLIDVLLRVRESGEVQISITDDNIKSILVDMFSAGSETSSTTIIWALAEMMKKP  324

Query  1062  SVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1241
             SV+AKAQAEVRQ LK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE M++ KI 
Sbjct  325   SVLAKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMKDTKID  384

Query  1242  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1421
              Y IP KTRVI+NAWA+  +PESW+DPE F PERFENSSVDF+G+H++FIPFGAGRR+CP
Sbjct  385   GYNIPFKTRVIVNAWAIGRDPESWDDPESFSPERFENSSVDFLGSHHQFIPFGAGRRICP  444

Query  1422  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             G+ F   ++   LA LLYHF+ +LP+G S ++LDMTE+ G+ A++K DL LIA P+
Sbjct  445   GMLFGLANVGQPLAQLLYHFDRKLPNGQSHENLDMTESPGISATRKDDLVLIATPY  500



>emb|CDP08465.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/475 (58%), Positives = 362/475 (76%), Gaps = 4/475 (1%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
              K    QKLPPGPWKLP IG +HHL+G SLPHR L+NL++KYG +MHLQLGE+S I+++S
Sbjct  31    QKTKTIQKLPPGPWKLPFIGCMHHLIG-SLPHRCLKNLAQKYGSLMHLQLGEVSLIIVTS  89

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P LA+ I KTHDL FA+RP+++A  I+ Y + D+AFSPYGDYWRQMRKI VLELLS K V
Sbjct  90    PNLAKEIMKTHDLSFATRPELLAFKIICYDTKDIAFSPYGDYWRQMRKISVLELLSAKSV  149

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF + RQ+E+ +LV +IR     G   NLTE+V  + SS++ + AFG+V  EDQ +F+ 
Sbjct  150   RSFENIRQDEVLHLVEAIR--PLAGKKVNLTEQVFSYASSMVCRAAFGQVSKEDQYEFVQ  207

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             L+KQV +LAGGFD+ DLFPS K +H  +GMKPKLLK+HH++D IF+ +I +H +N   N 
Sbjct  208   LMKQVAALAGGFDIADLFPSYKILHVLTGMKPKLLKIHHKMDSIFEKLIEEHIKNQTRNK  267

Query  876   T-NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
                +    ED++DVLLR+++ G LQFPIT +NIKA+I DMF+ GTETS++T+ WAMSEMI
Sbjct  268   KLVADSNQEDLIDVLLRIRDSGNLQFPITNNNIKAIIFDMFAAGTETSSSTVEWAMSEMI  327

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             + P VMAKAQ E+RQ+ KG +  D+ D++ L YLKLVIKETLRLHPP PL+ PRE  E+ 
Sbjct  328   RNPDVMAKAQREIRQSFKGKQNIDEADVQGLRYLKLVIKETLRLHPPFPLLLPRECREQC  387

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
             ++  Y IP KT+V+IN WA+  +PE W DPE F+PERF+N+ VDF GNH+EF+PFGAGRR
Sbjct  388   ELNGYTIPIKTKVMINFWAIGRDPEHWSDPESFVPERFDNNPVDFTGNHFEFVPFGAGRR  447

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             +CPG+SFA  ++ L LA LL HFNW LPDG+  ++LDM E  G+ A++K +L L+
Sbjct  448   ICPGMSFALANVELPLALLLCHFNWRLPDGMKSRELDMLENNGITATRKNNLYLV  502



>gb|ABC69405.1| CYP71D51v3 [Nicotiana tabacum]
Length=514

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/481 (58%), Positives = 366/481 (76%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  34    WKNSNSQSK-KLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  91

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP  A+ + KTHD+ FASRP ++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS 
Sbjct  92    VTSPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSA  151

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V++F S R+ E+  L++ IR SS  G P N+TE++  FTSS+  + AFG+V  E Q K
Sbjct  152   KNVRTFSSIRRNEVLRLINFIRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKE-QDK  208

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+N  
Sbjct  209   FIQLIKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLA  268

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DVLLR+   G LQFPIT DNIKA+I DMF+ GTETS++TI+WAM E
Sbjct  269   IGKTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVE  328

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P+V AKAQAEVR+A +G +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  329   MVKNPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECRE  388

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT+V++N WAL  +P+ W D E F+PERFE  S DF+GN++E++PFG G
Sbjct  389   ETNINGYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERFEQCSKDFVGNNFEYLPFGGG  448

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   +  L LA LLYHF+W+LP G+ P DLD+TE VGV A++K DL L+A P
Sbjct  449   RRICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSDLYLVATP  508

Query  1587  F  1589
             +
Sbjct  509   Y  509



>ref|XP_009758268.1| PREDICTED: premnaspirodiene oxygenase [Nicotiana sylvestris]
 gb|ABC69404.1| CYP71D51v2 [Nicotiana tabacum]
 gb|AGK30193.1| cytochrome P450 CYP71D51 [Nicotiana tabacum]
Length=514

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/481 (58%), Positives = 366/481 (76%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  34    WKNSNSQSK-KLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  91

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP  A+ + KTHD+ FASRP ++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS 
Sbjct  92    VTSPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSA  151

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V++F S R+ E+  L++ IR SS  G P N+TE++  FTSS+  + AFG+V  E Q K
Sbjct  152   KNVRTFSSIRRNEVLRLINFIRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKE-QDK  208

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+N  
Sbjct  209   FIQLIKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLA  268

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DVLLR+   G LQFPIT DNIKA+I DMF+ GTETS++TI+WAM E
Sbjct  269   IGKTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVE  328

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P+V AKAQAEVR+A +G +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  329   MVKNPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECRE  388

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT+V++N WAL  +P+ W D E F+PERFE  S DF+GN++E++PFG G
Sbjct  389   ETNINGYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERFEQCSKDFVGNNFEYLPFGGG  448

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   +  L LA LLYHF+W+LP G+ P DLD+TE VGV A++K DL L+A P
Sbjct  449   RRICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSDLYLVATP  508

Query  1587  F  1589
             +
Sbjct  509   Y  509



>ref|XP_009623936.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/481 (59%), Positives = 356/481 (74%), Gaps = 4/481 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLP-HRSLRNLSRKYGPIMHLQLGEISTIVI  329
             K+     ++LPPGPW LPLIG+LH L+ G LP H +LR+LS++YGPI HL LGEIS IV+
Sbjct  28    KNSRIVTKRLPPGPWSLPLIGNLHQLMNGRLPIHHTLRSLSQRYGPIFHLCLGEISIIVV  87

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP++A+ I KT DL FA+RP+ M+ DI+FY  TD+   PYG+YWR MRK+CVLELLS K
Sbjct  88    SSPEMAKEIMKTQDLRFATRPEFMSGDIIFYNYTDIGTCPYGEYWRNMRKVCVLELLSAK  147

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
             MVKSF S RQEE+S+L+SSI  + +     NL++K+ WFTSS+  + AFG+V   DQ K 
Sbjct  148   MVKSFNSIRQEEMSSLISSINSTPDDSL-INLSDKMFWFTSSVTCRSAFGKVI-HDQDKL  205

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH-L  866
             I L+K V  LAGGFDL DLFPS+KW+H  SG+K K+LK+H ++D I + II +H+ N  +
Sbjct  206   IMLVKDVTLLAGGFDLADLFPSRKWLHEISGLKSKMLKVHTKIDVILENIINEHRNNRTI  265

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 N     ED++DVLLRV E GEL  PIT  NIK VI DMF  G ETS+TTIIWA++E
Sbjct  266   GKKGNGESGGEDLIDVLLRVMESGELGTPITNKNIKGVIFDMFLAGAETSSTTIIWALAE  325

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MI+ PSVMAKAQ EVR+ LKG +TF+D D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  326   MIRNPSVMAKAQLEVREVLKGKRTFEDSDIEELKYLKLVIKETLRLHPPIPLLLPRECRE  385

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E KI +Y IP KTRV++NAWA+  +   W D E F+PERFEN+S+DF GNH+EFIPFGAG
Sbjct  386   ETKIEQYTIPIKTRVLVNAWAIGRDTRYWHDSESFIPERFENNSIDFKGNHFEFIPFGAG  445

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RRMCPG+ F   ++   LA LLYHF+W+ P G+S    DMTE  GV A +K DLCLIA P
Sbjct  446   RRMCPGLLFGLVNVGHPLAQLLYHFDWKTPPGISSDSFDMTETDGVTARRKNDLCLIATP  505

Query  1587  F  1589
             F
Sbjct  506   F  506



>emb|CAC24711.1| cytochrome P450 [Solanum tuberosum]
Length=502

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/481 (58%), Positives = 369/481 (77%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWKLPL+GS+ H+ GG LPH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  22    WKNSNSQSK-KLPPGPWKLPLLGSMLHMAGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP +A+ + KTHD+ FASRPK++A +IV Y  +D+AF PYGDYWRQMRKICVLELLS 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+S+ S R++E+  LV+ IR SS  G P N TE++  FTSS+  + AFG+V  E Q K
Sbjct  140   KNVRSYGSIRRDEVDRLVNFIRSSS--GEPVNFTERLFLFTSSMTCRSAFGKVFKE-QDK  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+   
Sbjct  197   FIQLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVEDVINEHKKKFA  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DVL+R+   G LQFPIT DNIKA+I DMF+ GTETS++T++WAM +
Sbjct  257   IGKTNGALGGEDLIDVLIRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQ  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV+AKAQAEVR+A K  +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  317   MMKNPSVIAKAQAEVREAFKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECRE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF+GN++E++PFG G
Sbjct  377   ETDINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQRSVDFVGNNFEYLPFGGG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++ L LA LLYHF+W+LP G+ PKDL++TE VGV A++K DL L+A P
Sbjct  437   RRICPGISFGLANVYLPLAHLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILVATP  496

Query  1587  F  1589
             +
Sbjct  497   Y  497



>ref|XP_006365912.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=512

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/472 (62%), Positives = 349/472 (74%), Gaps = 4/472 (1%)
 Frame = +3

Query  183   PPGPWKLPLIGSLHHLVG-GSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             PPGPWKLP+IG+LH L   G LPH +LR LS+KYGP+ HLQLGEIS IV+SSP++A+ I 
Sbjct  39    PPGPWKLPIIGNLHQLASHGGLPHHTLRTLSQKYGPLTHLQLGEISAIVVSSPEMAKEIM  98

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KT D+ FA+RP+ M   I+FY  +D+A  PYGDYWR MRKICVLELLS KMVKSF S RQ
Sbjct  99    KTQDVRFATRPQSMTGSIIFYNYSDIALCPYGDYWRNMRKICVLELLSAKMVKSFNSIRQ  158

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE+S+LVSSI  S+      NL+ K+ WFT S+  + AFG+V   DQ K I L+K+ +SL
Sbjct  159   EEMSSLVSSIINSTPDESLVNLSNKIFWFTGSVTCRSAFGKVV-HDQDKLIMLVKEAVSL  217

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-ANSTNSSGKD  896
             + GFDL DLFPS KW+H  SGMK +LLK H ++D I + +I +H EN    N  N     
Sbjct  218   SSGFDLTDLFPSHKWLHGISGMKSRLLKAHEKVDVILEKLINEHCENRANGNKGNGESGA  277

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             ED++DVLLRV E GE   PIT  NIKAVI +MF  G ETS+TTIIWA SEMIK P VMAK
Sbjct  278   EDLIDVLLRVMESGEFGMPITNQNIKAVIFEMFMAGAETSSTTIIWAFSEMIKNPGVMAK  337

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQ EVR+A KG KTF+D DLE L YLKLVIKETLRLHP  PL+ PRE  EE +I  Y IP
Sbjct  338   AQLEVREAFKGKKTFEDIDLEELKYLKLVIKETLRLHPAAPLLIPRECREETQIDGYNIP  397

Query  1257  PKTRVIINAWALATNPESW-EDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
              KT+VI+NAWA+  +   W +DPE F+PERFENSS+DF GN++EFIPFGAGRRMCPG+  
Sbjct  398   IKTKVIVNAWAIGRDSRYWHDDPESFIPERFENSSIDFRGNNFEFIPFGAGRRMCPGMLS  457

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
                ++  SLA LLYHF+W+LPDGVS  D DMTEA GV AS+K DLCLIA PF
Sbjct  458   GLATVGHSLAKLLYHFDWKLPDGVSVDDFDMTEAEGVAASRKNDLCLIATPF  509



>dbj|BAN58140.1| putative premaspirodiene oxygenase [Hyoscyamus albus]
Length=502

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/481 (57%), Positives = 371/481 (77%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  22    WKNSNSQSK-KLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP +A+ + KTHD+ FASRPK++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  LV+ +R  S T  P N TE++  FTSS+  + AFG+V  E Q  
Sbjct  140   KNVRSFSSIRRDEVLRLVNFVR--SCTSKPVNFTERLFLFTSSMTCRSAFGKVFKE-QET  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+V+ LAGGFD+ D+FPS K++H  +GM+ K++K HH++D I + +I +HK+N  
Sbjct  197   FIQLIKEVIGLAGGFDVADIFPSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNLA  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DVLLR+   G LQFPIT +NIKA+I DMF+ GTETS++T++WAM +
Sbjct  257   MGKTNGALGGEDLIDVLLRLMNDGGLQFPITNNNIKAIIFDMFAAGTETSSSTLVWAMVQ  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M++ P+++AKAQ EVR+A KG +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  317   MMRNPTILAKAQEEVREAFKGKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECRE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E +I  Y IP KT+V++N WAL  +P+ WED + F PERFE  SVDF+GN++E++PFG G
Sbjct  377   ETEIDGYTIPVKTKVMVNVWALGRDPKYWEDADDFKPERFEQCSVDFIGNNFEYLPFGGG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++ L LA LLYHF+W+LP G+ PKDLD+TE VGV A++K DL L+A P
Sbjct  437   RRICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTELVGVTAARKSDLMLVATP  496

Query  1587  F  1589
             +
Sbjct  497   Y  497



>ref|XP_006339043.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=509

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 366/475 (77%), Gaps = 6/475 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLV-GGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
             +KLPPGPWKLP +GS+HHLV  G LPH +L NLS+KYGP+MHLQLGEIST+++SS  +AR
Sbjct  34    KKLPPGPWKLPFLGSIHHLVLEGGLPHHALTNLSKKYGPLMHLQLGEISTVIVSSTDMAR  93

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              + KTHDL FASRPK+ ++D + YKSTD+AF+PYG+YWRQMRK+CV+ELL+ K V+SF S
Sbjct  94    EVLKTHDLAFASRPKLASVDTICYKSTDIAFTPYGEYWRQMRKVCVMELLTAKNVRSFSS  153

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R++E S LV  I+ SS  G P N+TE++ W+ SS+  K AFG +  +DQ KFI ++K+V
Sbjct  154   IRKDEASGLVQFIQ-SSTCGEPINVTERILWYQSSITCKAAFGELL-KDQEKFIQMVKEV  211

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
             + LAGGF+L D+FPS K +   SG++ ++LK+H  +D I + +I +HK+N +A+    +G
Sbjct  212   MELAGGFNLADIFPSIKILQVLSGVRSRILKVHKNVDAIVEDVINEHKKN-IASGKKGNG  270

Query  891   K--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1064
                 ED+VDVLLR+ E GEL+ PIT DNIKA++ D+FS GTETS+TT  WAM+EM++ PS
Sbjct  271   AFGGEDLVDVLLRLMESGELKIPITNDNIKAIMIDLFSAGTETSSTTATWAMTEMMRNPS  330

Query  1065  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1244
             V+ KAQAEVR+A KG +TFD+  +E L YLK V+KET RLHPPLPL+ PRE  EE  I  
Sbjct  331   VLKKAQAEVREAFKGKETFDEDVIEELKYLKQVVKETFRLHPPLPLLVPRECREETNING  390

Query  1245  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1424
             Y IP KTRV++N W++  +P+ WED E F+PERFE SSVDFMGN++EF+PFGAGRRMCPG
Sbjct  391   YTIPLKTRVMVNVWSMGRDPKYWEDAESFIPERFEQSSVDFMGNNFEFLPFGAGRRMCPG  450

Query  1425  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             I+F   ++ L LA LLYHF+W+LPDG   +D+DMTE  G+ A++K +L LIA P+
Sbjct  451   ITFGLINVHLPLAKLLYHFDWKLPDGQKSEDMDMTEVSGITAARKSELYLIATPY  505



>ref|XP_006350396.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/481 (58%), Positives = 369/481 (77%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWKLPL+GS+ H+ GG LPH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  22    WKNSNSQSK-KLPPGPWKLPLLGSMLHMAGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP +A+ + KTHD+ FASRPK++A +IV Y  +D+AF PYGDYWRQMRKICVLELLS 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+S+ S R++E+  LV+ IR SS  G P N TE++  FTSS+  + AFG+V  E Q K
Sbjct  140   KNVRSYGSIRRDEVDRLVNFIRSSS--GEPVNFTERLFLFTSSMTCRSAFGKVFKE-QDK  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  H ++D I + +I +HK+N  
Sbjct  197   FIQLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHDKVDAIVEDVINEHKKNIA  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DVL+R+   G LQFPIT +NIKA+I DMF+ GTETS++T++WAM +
Sbjct  257   MGKTNGALGGEDLIDVLIRLMNDGGLQFPITNNNIKAIIFDMFAAGTETSSSTLVWAMVQ  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV AKAQAEVR+A K  +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  317   MMKNPSVFAKAQAEVREAFKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECRE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF+GN++E++PFG+G
Sbjct  377   ETDINSYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQRSVDFVGNNFEYLPFGSG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++ L LA LLYHF+W+LP G+ PKDL++TE VGV A++K DL L+A P
Sbjct  437   RRICPGISFGLANVYLPLAHLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILVATP  496

Query  1587  F  1589
             +
Sbjct  497   Y  497



>gb|ABC69403.1| CYP71D51v1 [Nicotiana tabacum]
Length=514

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/481 (57%), Positives = 365/481 (76%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  34    WKNSNSQSK-KLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  91

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP  A+ + KTHD+ FASRP ++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS 
Sbjct  92    VTSPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSA  151

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V++F S R+ E+  L++ IR SS  G P N+TE++  FTSS+  + AFG+V  E Q K
Sbjct  152   KNVRTFSSIRRNEVLRLINFIRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKE-QDK  208

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+N  
Sbjct  209   FIQLIKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLA  268

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DV LR+   G LQFPIT DNIKA+I DMF+ GTETS++TI+WAM E
Sbjct  269   IGKTNGALGGEDLIDVPLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVE  328

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P+V AKAQAEVR+A +G +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  329   MVKNPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECRE  388

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT+V++N WAL  +P+ W D E F+PERFE  S DF+GN++E++PFG G
Sbjct  389   ETNINGYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERFEQCSKDFVGNNFEYLPFGGG  448

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   +  L LA LLYHF+W+LP G+ P DLD+TE VGV A++K DL L+A P
Sbjct  449   RRICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSDLYLVATP  508

Query  1587  F  1589
             +
Sbjct  509   Y  509



>ref|XP_006365938.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=514

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/481 (57%), Positives = 364/481 (76%), Gaps = 6/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQ--KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEIST  320
             W+K K   ++  +LPPGPW+LPLIG+LHHL+GG LPH   R LS++YGP+M+LQLGE+ T
Sbjct  28    WSKPKNRNEKQFRLPPGPWRLPLIGNLHHLIGGGLPHHIFRKLSQRYGPLMYLQLGEVPT  87

Query  321   IVISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELL  500
             +VISS  +A+ I +THD  FA RP++ + +I+FY S D+AFSPYGDYWRQMRKIC LEL 
Sbjct  88    VVISSTTIAKEILRTHDHAFACRPQLTSTNIIFYNSIDIAFSPYGDYWRQMRKICTLELF  147

Query  501   SMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQ  680
             S+KM+K F + R++EL++L+SSIR  S  G P N+T+K+  FT+ +I + AFG+VC +D+
Sbjct  148   SIKMIKLFSAIREDELTSLISSIR--SMRGSPVNMTKKIFLFTNCIICRSAFGKVC-KDR  204

Query  681   GKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN  860
             G+F+  LK+VL LA GF + DL+PS K +H   G K +++  H ++D + + I+ +H EN
Sbjct  205   GEFLTTLKEVLLLAAGFFMADLYPSWKLLHNLRGEKTRMVNAHKKVDAVMEEILNEHIEN  264

Query  861   HLANST-NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
               A    N    DED+VDVLLRVKE  ELQ+PIT D+IKAVI D+F  GT +S++TIIWA
Sbjct  265   KAAGKKGNGEFGDEDLVDVLLRVKENAELQYPITNDHIKAVIFDIFLGGTGSSSSTIIWA  324

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             +SEMIK P+VM KAQ+EVRQ  KG + F ++++ENLTYLK VIKETLRLH P PL+  RE
Sbjct  325   LSEMIKNPNVMIKAQSEVRQVFKGKQNFSEEEVENLTYLKSVIKETLRLHTPAPLLGSRE  384

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               E+  I  Y IP K RV++NAWALA +PESW+DPE F+PERFENSS+DFMGNH+EFIPF
Sbjct  385   CREQRVIDGYTIPLKARVLVNAWALARDPESWDDPENFIPERFENSSIDFMGNHFEFIPF  444

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             G+GRR+CPG+     ++   LA LLYHF WELP+G +P+DLDMTE  G+ A KK++L LI
Sbjct  445   GSGRRVCPGLLLGVANVIHPLAQLLYHFEWELPNGTNPEDLDMTETHGLTAEKKENLYLI  504

Query  1578  A  1580
             A
Sbjct  505   A  505



>ref|XP_009770332.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=523

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/484 (59%), Positives = 363/484 (75%), Gaps = 7/484 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLP-HRSLRNLSRKYGPIMHLQLGEISTI  323
             W  SK   K  LPPGPW  PLIG+LH  + G LP H +LR+LSR+YGPI HL+LGEIS I
Sbjct  41    WKASKTFNKI-LPPGPWSPPLIGNLHLFMNGRLPVHHTLRSLSRRYGPIFHLRLGEISII  99

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SSP++A+ I KT DL FA+RP+ MA DI+FY  TD+   PYGD+WR MRK+C++ELLS
Sbjct  100   VVSSPEMAKEIMKTQDLRFATRPEFMAGDIIFYNYTDIITCPYGDHWRNMRKVCIVELLS  159

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              KMVKSF S RQ E+S+L+SS+    +     NL++K+ WFTSS+  + AFG+V   DQ 
Sbjct  160   AKMVKSFNSIRQAEMSSLISSVNSMPDDSL-INLSDKMFWFTSSVTCRSAFGKVI-HDQD  217

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             K I L+K + SLA GFDL D+FPS+KW+H  +G+K K+LK+H ++D I + I+ +H+E+ 
Sbjct  218   KLIMLVKDISSLAAGFDLADMFPSRKWLHKITGLKSKMLKVHKKVDAILENILNEHQESR  277

Query  864   LANSTNSSGKD--EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
              AN   S+G+   ED++DVLLRV E GEL  PIT +NIK+VI DMF  G ETSATTIIWA
Sbjct  278   -ANGKKSNGETGGEDLIDVLLRVMESGELGTPITNENIKSVIFDMFLAGAETSATTIIWA  336

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             M+EMI+ PSVMAKAQ EVR+ LKG +TF+D DLE L YL LVIKETLRLHPP+PL+ PRE
Sbjct  337   MAEMIRNPSVMAKAQLEVREVLKGKRTFEDIDLEELKYLNLVIKETLRLHPPVPLLIPRE  396

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               EE KI +YIIP KTRV++N WA+     +W +PE F+PERFEN+S+DF GNH+EFIPF
Sbjct  397   CREETKIDKYIIPIKTRVLVNVWAIGRESTNWHNPESFIPERFENNSIDFRGNHFEFIPF  456

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRRMCPG+ F   ++   LA LLYHF+W+ P G++P +L+MTE +GV   +K DLCLI
Sbjct  457   GAGRRMCPGLLFGLVNVGHPLAQLLYHFDWKTPHGIAPDNLNMTETIGVAGGRKDDLCLI  516

Query  1578  ARPF  1589
             A PF
Sbjct  517   ATPF  520



>ref|XP_006339046.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/484 (58%), Positives = 370/484 (76%), Gaps = 7/484 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W KS+   K KLPPGPWKLP IGS+HHL + G LPH +L NL +K+GP MHLQLGEISTI
Sbjct  26    WKKSRNLNK-KLPPGPWKLPFIGSVHHLPLEGGLPHHALTNLGKKHGPFMHLQLGEISTI  84

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SS  +AR + KTHDL FASR K++ALDI+ YKSTD+AFSPYGDYWRQM K+CVLELL+
Sbjct  85    VVSSMDMAREVLKTHDLAFASRSKLLALDIICYKSTDIAFSPYGDYWRQMCKVCVLELLT  144

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF S R++E S+LV  IR SS    P N+TE++ W+ SS+  K AFG +  +DQ 
Sbjct  145   TKNVRSFSSIRRDEASHLVQFIR-SSTRDEPINVTERILWYQSSITCKTAFGELL-KDQE  202

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             KF+ +L++++ +AGGF L D+FPS K +   SG+K K+LK+H   D I + +I +HK+N 
Sbjct  203   KFLGILRELMEVAGGFSLADIFPSIKILQVLSGLKSKILKVHKNADVIVEDVINEHKKN-  261

Query  864   LANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
             +A+    +G    E++VDVLLR+KE GEL+ PIT DNIKA+I D+FS G+ETS TT IWA
Sbjct  262   IASGKKGNGAFGGENLVDVLLRLKESGELKIPITNDNIKAIIIDLFSAGSETSGTTTIWA  321

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             MSEM+++PSV+AKAQAEVR+  KG +TFD+  +E L YLK V+KETLRLHPP+PL+ PR+
Sbjct  322   MSEMMRKPSVLAKAQAEVRETFKGKETFDEDVIEELKYLKQVVKETLRLHPPVPLLIPRK  381

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               EE  I  Y IP KTRV++N +A+  +P+ WED E F+PERFE SSVDFMGN++E++PF
Sbjct  382   CREETNINGYTIPLKTRVMVNVYAMGRDPKYWEDAEIFIPERFEQSSVDFMGNNFEYLPF  441

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRRMCPGI+F   ++ L LA LLYHF+W+LPDG+ PK +DMTE  G+ A++K +L LI
Sbjct  442   GAGRRMCPGITFGLINVYLPLAKLLYHFDWKLPDGLKPKYVDMTEFSGITAARKSELYLI  501

Query  1578  ARPF  1589
             A P+
Sbjct  502   ATPY  505



>ref|XP_006350395.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/481 (58%), Positives = 365/481 (76%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  22    WKNSNSQSK-KLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP +A+ + KTHD+ FASRPK++A +IV Y  +D+AF PYGDYWRQM KICVLELLS 
Sbjct  80    VTSPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMHKICVLELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+S+ S R++E+  LV+ IR SS  G P N  E++  FTSS+  + AFG+V  E Q K
Sbjct  140   KNVRSYGSIRRDEVDRLVNLIRSSS--GEPVNFIERLFLFTSSMTCRSAFGKVFKE-QDK  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+V+ LAGGFD+ DLFPS K +H  SGMK K++  HH++D I + +I +HK+N  
Sbjct  197   FIQLIKEVIGLAGGFDVADLFPSLKLLHVLSGMKGKIMNAHHKIDAIVEDVINEHKKNIA  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DVL+R+   G LQFPIT  NIKA+I DMF+  TETS++T+ WAM +
Sbjct  257   MGKTNGALGGEDLIDVLIRLMNDGGLQFPITNVNIKAIIFDMFAAETETSSSTLDWAMVQ  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV+AKAQAEVR+A K  +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  E
Sbjct  317   MMKNPSVIAKAQAEVREAFKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECRE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF+GN++E++PFG G
Sbjct  377   ETDINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFIGNNFEYLPFGGG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++ L LA LLYHF+W+LP G+ PKDL++TE VGV A++K DL L+A P
Sbjct  437   RRICPGISFGLANVYLPLAQLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILVATP  496

Query  1587  F  1589
             +
Sbjct  497   Y  497



>ref|XP_006339044.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/484 (58%), Positives = 366/484 (76%), Gaps = 7/484 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W KS+   K KLPPGPW LP +GSLHHL + G LPH +L NL +KYGP MHLQLGE S +
Sbjct  26    WKKSRNFNK-KLPPGPWNLPFLGSLHHLALEGGLPHHALTNLGKKYGPFMHLQLGETSMV  84

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SS  +AR + KTHDL FASRPK+++LDI+FYKSTD+AFS YG+YWRQMRKICVLEL +
Sbjct  85    VVSSLDMAREVMKTHDLAFASRPKLVSLDIIFYKSTDIAFSSYGEYWRQMRKICVLELFT  144

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF S R++E S+LV  IR SS  G P N+TE++SW+ SS  ++ AFG++  +DQ 
Sbjct  145   AKNVRSFSSIRRDEASSLVQFIR-SSTRGEPINVTEQISWYESSNTSRAAFGKLL-KDQE  202

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             KFI L+K+++ LA GF + D FPS K +H  SG++ ++LK+H  +D I + +I +HK+N 
Sbjct  203   KFIGLVKELVELASGFSVADFFPSIKILHVLSGVRSRILKVHKNVDAIVEDVINEHKKN-  261

Query  864   LANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
             +A+    +G    ED+VDVLLR+KE  EL+ PIT DNIKA++ D+F  GTETS TTIIWA
Sbjct  262   IASGKKGNGAFGGEDLVDVLLRLKESRELKIPITNDNIKAIMIDLFGAGTETSGTTIIWA  321

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             MSEM++ PSV+AKAQAEVR+A KG +TF++  +E L YLK V+KET RLHPP PL+ PRE
Sbjct  322   MSEMMRNPSVLAKAQAEVREAFKGKETFNEDVIEELKYLKQVVKETFRLHPPAPLLIPRE  381

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               EE  I  Y IP KTRVI+N +A+  +P+ WED E F+PERFE  SVDFMGN+++++PF
Sbjct  382   CREETSINGYTIPLKTRVIVNVYAMGRDPKYWEDAESFIPERFEQISVDFMGNNFKYLPF  441

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRRMCPGI F   ++ L LA LLYHF+W+LPDGV  +D+DMTE  G+ A++K +L LI
Sbjct  442   GAGRRMCPGILFGLINVYLPLANLLYHFDWKLPDGVKLEDVDMTEFFGITAARKSELYLI  501

Query  1578  ARPF  1589
             A P+
Sbjct  502   ATPY  505



>ref|XP_009796910.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/481 (57%), Positives = 363/481 (75%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  SK  AK +LPPGPWKLP++GS+ H+VGG LPHR LR+L++KYGP+MHLQLGE+S +V
Sbjct  22    WMNSKNQAK-RLPPGPWKLPILGSMLHMVGG-LPHRVLRDLAKKYGPLMHLQLGEVSVVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRPK++A +IV Y S+DVAF+PYGDYWRQMRKICVLE+LS 
Sbjct  80    VTSPEIAKEVLKTHDLAFASRPKLLAAEIVLYDSSDVAFAPYGDYWRQMRKICVLEVLST  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  L+   R SS  G P N T+++S F S +I + AFG V  E Q +
Sbjct  140   KNVRSFSSIRRDEVVRLIEFFRSSS--GKPVNFTKRISLFMSFIICRSAFGTVFKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI ++K V +L  GFD+ D+FPS K++H  +GM+ K + LHH++D I D II +HK+N  
Sbjct  197   FIQVMKDVTALLEGFDVADIFPSLKFLHVLTGMRAKAMNLHHKVDDIVDNIINEHKKNLA  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 N     ED++DVLLR+K+ G  QFPIT DNIKA+I DMF+ GTET++TTI WAM E
Sbjct  257   TGKFNGQLGGEDLIDVLLRLKKDGGFQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVE  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MI+  SV AKAQAEVR+     +TFD+ D+E L YLKLVIKETLRLHPPLPL+ PRE  E
Sbjct  317   MIRNASVFAKAQAEVREVFNRKETFDENDVEELKYLKLVIKETLRLHPPLPLMLPRECRE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP K++V++N WA+  +P++W+D E F PERFE SSVDF+GN++E++PFG+G
Sbjct  377   ETNINGYTIPLKSKVMVNVWAIGRDPKNWDDAESFKPERFEQSSVDFVGNNFEYLPFGSG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGI F   +I L LA LLY+F+W+LP G++P DLDMTE+ G   ++K +L LIA P
Sbjct  437   RRICPGILFGLANIYLPLAQLLYYFDWKLPTGINPSDLDMTESDGASCARKSNLYLIASP  496

Query  1587  F  1589
             +
Sbjct  497   Y  497



>ref|XP_009608635.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=511

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/479 (58%), Positives = 365/479 (76%), Gaps = 7/479 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W++++   KQ+LPPGPW+ P+IGSLHHL+G  +PHR+LR+L++KYGP+M+LQLG+  T++
Sbjct  30    WSRNR---KQRLPPGPWRFPIIGSLHHLMGREVPHRTLRSLAQKYGPLMYLQLGQAPTVI  86

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ISSP +A+ + KTHDL FA+R ++ + +I+FY + D+ FS Y DYWRQMRKIC+LELLS 
Sbjct  87    ISSPSMAKQVLKTHDLAFANRAQLTSSNIIFYNNKDIVFSQYSDYWRQMRKICILELLST  146

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             KMVKSF + RQ+ELS+L+SS  + S  G P NLTEK+   T+S+  + AFG V  +D+ +
Sbjct  147   KMVKSFSAIRQDELSSLISS--IRSMRGSPVNLTEKIFQLTNSITGRAAFGNVF-KDRHE  203

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F+ L+K+VL LAGGFD+ DLFPS K +H  SG+K +L+  H ++D+I + I+ +H EN  
Sbjct  204   FMKLMKEVLELAGGFDVADLFPSWKLLHKMSGVKSRLVNAHRKVDEIMEDILNEHIENKA  263

Query  867   A-NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
             A N        ED+VDV LR+KE  ELQFPIT DNIKAVI D+F  G+ETS+T IIWA+S
Sbjct  264   AGNKGIGEFGGEDLVDVFLRIKENAELQFPITNDNIKAVIFDIFLAGSETSSTAIIWALS  323

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             EMIK P++MAKAQ+EVRQ  KG K +D++DLE LTYL LVIKETLRLHP + L+ PRE  
Sbjct  324   EMIKNPNIMAKAQSEVRQVFKGKKKYDEEDLEKLTYLNLVIKETLRLHPSVSLLPPRECR  383

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             E+  I  Y IP KTR+I+NAWAL  +PESW DPE F+PERF+NSS++F GNH+EFIPFGA
Sbjct  384   EQTDIDGYTIPLKTRIIVNAWALGRDPESWHDPESFIPERFKNSSIEFTGNHFEFIPFGA  443

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             GRRMCPGI F   ++ L LA LL HF WELP   + +DLDMTE  G+ A+K+KDL L+A
Sbjct  444   GRRMCPGIQFGLVNVGLPLAQLLQHFEWELPHETNSQDLDMTETRGLSAAKQKDLYLVA  502



>sp|P93531.1|C71D7_SOLCH RecName: Full=Cytochrome P450 71D7 [Solanum chacoense]
 gb|AAB61965.1| putative cytochrome P450 [Solanum chacoense]
Length=500

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/471 (56%), Positives = 355/471 (75%), Gaps = 2/471 (0%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             +KLPPGPWKLP IG +HHL GG LPHR LR+L+ KYGP+MHLQLGE+S +V++SP++A+ 
Sbjct  29    KKLPPGPWKLPFIGGMHHLAGG-LPHRVLRDLAEKYGPLMHLQLGEVSAVVVTSPEMAKQ  87

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             + KTHD+ FASRPK++A+DI+ Y   D+AFSPYGDYWRQMRKIC++E+LS K V+SF S 
Sbjct  88    VLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGDYWRQMRKICIMEVLSAKSVRSFSSI  147

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             R +E+  L+ SI+    +G   N TE++ WFTSS+  + AFG+V  E Q  FI L+++V+
Sbjct  148   RHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKE-QEVFIKLIREVI  206

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK  893
             SLA GFD+ D+FPS K++H   G K KLL  H ++D I + +I +HK+N     ++ +  
Sbjct  207   SLAEGFDVADIFPSYKFLHGFGGAKQKLLNAHRKVDSIVEDVIKEHKKNLATRKSDDAIG  266

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED+VD L+R+     LQFPI  DNIKAVI D+F+ GTETS+TT +WAM+EM+K PSV A
Sbjct  267   GEDLVDALVRLMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMAEMLKNPSVFA  326

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQA+VR+A +   TFD+ D+E L YLKLVIKET+RLH P+PL+ PRE  EE +I  Y I
Sbjct  327   KAQAKVREAFRDKVTFDENDVEELKYLKLVIKETMRLHAPVPLLVPRECREETEINGYTI  386

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P KT+V++N WAL  +P+ W+D E F PERFE  S+DF+GN++E++PFG GRR+CPGISF
Sbjct  387   PVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSIDFIGNNFEYLPFGGGRRICPGISF  446

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
                ++ L LA LLYHF+W+LP G+ PKDLD+TE+ G+ A++K DL LIA P
Sbjct  447   GLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTESAGITAARKGDLYLIATP  497



>ref|XP_006350393.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/471 (56%), Positives = 354/471 (75%), Gaps = 2/471 (0%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             +KLPPGPWKLP IGS+HHL GG LPHR LR+L+ KYGP+MHLQLGE+S +V++SP++A+ 
Sbjct  29    KKLPPGPWKLPFIGSMHHLAGG-LPHRVLRDLAEKYGPLMHLQLGEVSAVVVTSPEMAKQ  87

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             + KTHD+ FASRPK++A+DI+ Y   D+AFSPYG+YWRQMRKIC++E+LS K V+SF S 
Sbjct  88    VLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGEYWRQMRKICIMEVLSAKNVRSFSSI  147

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             R +E+  L+ SI+    +G   N TE++ WFTSS+  + AFG+V  E Q  FI L+++V+
Sbjct  148   RHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKE-QEVFIKLIREVI  206

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK  893
             SLA GFD+ D+FPS K++H   G K KLL  H ++D I + +I +HK+N     ++ +  
Sbjct  207   SLAEGFDVADIFPSYKFLHGFGGAKKKLLNAHRKVDSIVEDVIKEHKKNIATRKSDDAIG  266

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED+VDVLLR+     LQFPI  DNIKAVI D+F+ GTETS+TT +WAM+EM+K PSV A
Sbjct  267   GEDLVDVLLRLMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMAEMLKNPSVFA  326

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVR+A +   TFD  D+E L YLKLVIKET+RLH P+PL+ PRE  EE +I  Y I
Sbjct  327   KAQAEVREAFRDKVTFDGNDVEELKYLKLVIKETMRLHAPVPLLVPRECREETEINGYTI  386

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P KT+V++N WAL  +P+ W+D E F PERFE  S+DF+GN++E++PFG GRR+CPGISF
Sbjct  387   PVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSIDFIGNNFEYLPFGGGRRICPGISF  446

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
                ++   LA LLYHF+W+LP G+ PKDLD+TE+ G+  ++K DL LIA P
Sbjct  447   GLANVYFPLAQLLYHFDWKLPTGMEPKDLDLTESAGITVARKGDLYLIATP  497



>ref|XP_009764618.1| PREDICTED: cytochrome P450 71D7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009764619.1| PREDICTED: cytochrome P450 71D7-like isoform X2 [Nicotiana sylvestris]
Length=504

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/468 (59%), Positives = 355/468 (76%), Gaps = 5/468 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPW+LP IGSLHHL  G LPH +LR+L+RKYGP+M+LQLGEI  +VISSP++A+A+
Sbjct  33    KLPPGPWRLPFIGSLHHL-KGKLPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRVAKAV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FA+RP+ M+ DIVFYKS D++F+P+GDYWRQMRKI   ELLS KM+KS+   R
Sbjct  92    LKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++ELS L+SSIRL  ETG   N+ EK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDELSKLLSSIRL--ETGSAVNINEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILT  208

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  893
             L+GGFD+GDLFPS K +H  S MK +L  +HH+ D + + II +H+ENH A    N+   
Sbjct  209   LSGGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFG  268

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED++D LLR KE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SE++K PSVMA
Sbjct  269   GEDMIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMA  328

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVR+  K N+ FD+ DL+ L YLK VIKETLR+HPP+PL+ PRE  ++ +I  Y +
Sbjct  329   KAQAEVRKVFKENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEIDGYTV  388

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P K RV++NAWA+  +PESWEDPE F PERFEN+SVD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  389   PIKARVMVNAWAIGRDPESWEDPESFKPERFENTSVDLTGNHYQFIPFGSGRRMCPGMSF  448

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                +    LA LLY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  449   GLVNTGHPLAQLLYCFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>gb|ABC69402.1| CYP71D5v2 [Nicotiana tabacum]
Length=504

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/468 (59%), Positives = 355/468 (76%), Gaps = 5/468 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPW+LP IGSLHHL  G LPH +LR+L+RKYGP+M+LQLGEI  +VISSP++A+A+
Sbjct  33    KLPPGPWRLPFIGSLHHL-KGKLPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRVAKAV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FA+RP+ M+ DIVFYKS D++F+P+GDYWRQMRKI   ELLS KM+KS+   R
Sbjct  92    LKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++ELS L+SSIRL  ETG   N+ EK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDELSKLLSSIRL--ETGSAVNINEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILT  208

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  893
             L+GGFD+GDLFPS K +H  S MK +L  +HH+ D + + II +H+ENH A    N+   
Sbjct  209   LSGGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFG  268

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED++D LLR KE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SE++K PSVMA
Sbjct  269   GEDMIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMA  328

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVR+  K N+ FD+ DL+ L YLK VIKETLR+HPP+PL+ PRE  ++ +I  Y +
Sbjct  329   KAQAEVRKVFKENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEIDGYTV  388

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P K RV++NAWA+  +PESWEDPE F PERFEN+SVD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  389   PIKARVMVNAWAIGRDPESWEDPESFKPERFENTSVDLTGNHYQFIPFGSGRRMCPGMSF  448

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                +    LA LLY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  449   GLVNTGHPLAQLLYCFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>ref|XP_009765480.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=511

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/473 (59%), Positives = 362/473 (77%), Gaps = 7/473 (1%)
 Frame = +3

Query  183   PPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGP-IMHLQLGEISTIVISSPQLARAI  356
             PPGPWKLP++GS+HHL + G  PH +L NL++KYGP +MHLQLGEIST+V+SS  +AR +
Sbjct  37    PPGPWKLPILGSVHHLALEGGHPHHALANLAKKYGPDLMHLQLGEISTVVVSSLDMAREV  96

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FASRPK++AL+I+FYKSTD+AFS YGDYWRQMRK+ VLELLS K V+SF S R
Sbjct  97    LKTHDLAFASRPKLLALEIIFYKSTDIAFSAYGDYWRQMRKVAVLELLSAKNVRSFTSIR  156

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++E S L+  IR SS T  P N+TE++ W+ SS+  K AFG +  +DQ KFI +++++  
Sbjct  157   RDEASRLIQIIR-SSPTDEPINVTERILWYESSMTCKAAFGELL-KDQKKFILIVRELTE  214

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  893
             L+GGF + D+FPS K +H  SGMK ++L  H  +D I + +I +H +N LAN    +G  
Sbjct  215   LSGGFSVADIFPSIKILHLLSGMKGRILNTHKRVDAIVEDVINEHIKN-LANGKAGNGAL  273

Query  894   -DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
               ED+VDVLLR+KE GELQ PIT DNIKAV+ D+FS GTETS+TT IWAM+EM++ P V 
Sbjct  274   GGEDLVDVLLRLKESGELQIPITNDNIKAVMIDLFSAGTETSSTTTIWAMTEMMRNPKVY  333

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
             AKAQAEVR+  KG +T D+ ++E L YLK V+KETLRLHPPLPL+ PRE  EE  I  Y 
Sbjct  334   AKAQAEVREVFKGKETIDEDNIEELKYLKQVVKETLRLHPPLPLLLPRECREETNINGYT  393

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP KTRV++NAWA+  +P+ WED E+F PERFE+ SVDFMGN++E++PFG+GRRMCPGIS
Sbjct  394   IPLKTRVMVNAWAIGRDPKYWEDAEQFKPERFEHGSVDFMGNNFEYLPFGSGRRMCPGIS  453

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             F   ++ L LA LLYH +W+LPDGV P+DLDMTE   + A++K +L LIA P+
Sbjct  454   FGLINVHLPLAKLLYHCDWKLPDGVKPEDLDMTEFTAITAARKSELYLIATPY  506



>gb|ABC69398.1| CYP71D5v3 [Nicotiana tabacum]
Length=504

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/468 (59%), Positives = 355/468 (76%), Gaps = 5/468 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPW+LP IGSLHHL  G LPH +LR+L+RKYGP+M+LQLGEI  +VISSP++A+A+
Sbjct  33    KLPPGPWRLPFIGSLHHL-KGKLPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRVAKAV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FA+RP+ M+ DIVFYKS D++F+P+GDYWRQMRKI   ELLS KM+KS+   R
Sbjct  92    LKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++ELS L+SSIRL  ETG   N+ EK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDELSKLLSSIRL--ETGSAVNINEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILT  208

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  893
             L+GGFD+GDLFPS K +H  S MK +L  +HH+ D + + II +H+ENH A    N+   
Sbjct  209   LSGGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFG  268

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED++D LLR KE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SE++K PSVMA
Sbjct  269   GEDMIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMA  328

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVR+  K N+ FD+ DL+ L YLK VIKETLR+HPP+PL+ PRE  ++ +I  Y +
Sbjct  329   KAQAEVRKVFKENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEIDGYTV  388

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P K RV++NAWA+  +PESWEDPE F PERFEN+SVD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  389   PIKARVMVNAWAIGRDPESWEDPESFKPERFENTSVDLTGNHYQFIPFGSGRRMCPGMSF  448

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                +    LA LLY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  449   GLVNTGHPLAQLLYCFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>ref|XP_009623934.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/483 (57%), Positives = 356/483 (74%), Gaps = 5/483 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLP-HRSLRNLSRKYGPIMHLQLGEISTI  323
             W  SK   K  LPPGPW LPLIG+LH L+ G LP H + R+LSR+YGPI HL+LGEIS I
Sbjct  27    WKASKTFNKL-LPPGPWSLPLIGNLHLLMNGRLPVHHTFRSLSRRYGPIFHLRLGEISII  85

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SSP++A+ I KT DL FA+RP+ M+ DI+FY  TD+   PYGD+WR MRK+C++ELLS
Sbjct  86    VVSSPEMAKEIMKTQDLRFATRPEFMSGDIIFYNYTDIITCPYGDHWRNMRKVCIVELLS  145

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              KMVKSF S RQ E+S+L+SSI    +     NL++K+ WFTSS+  + AFG+V   DQ 
Sbjct  146   AKMVKSFNSIRQAEMSSLISSINSMPDDSL-INLSDKMFWFTSSVTCRSAFGKVI-HDQH  203

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             K I L+K + SLA GFDL D+FPS+KW+H  +G+K K+LK+H ++D I + II +H+E+ 
Sbjct  204   KLIMLVKDIASLAAGFDLADMFPSRKWLHKITGLKSKMLKVHTKVDAILENIINEHRESR  263

Query  864   L-ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
                   N     ED++DVLLRV E GEL  P+T+ NIK VI DMF  G ETS+TTIIWA+
Sbjct  264   TNGKKGNGETGGEDLIDVLLRVMESGELGTPLTKKNIKGVIFDMFLAGAETSSTTIIWAL  323

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             +EMI+ PSVMAKAQ EVR+ LKG +TF+D DLE L YL LVIKETLRLHPP+PL+ PRE 
Sbjct  324   AEMIRNPSVMAKAQLEVREVLKGKRTFEDIDLEELKYLNLVIKETLRLHPPVPLLLPREC  383

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              EE KI +Y IP KTRV++N WA+    + W +PE F+PERFEN+S+DF GNH+EFIPFG
Sbjct  384   REETKIDKYTIPIKTRVLVNVWAMGRESKYWHNPESFIPERFENNSIDFKGNHFEFIPFG  443

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             AGRR+CPG+ F   ++   LA LLYH++W+ P G++P +LDMTE +GV   +K DLCLI 
Sbjct  444   AGRRICPGLLFGLVNVGHPLAQLLYHYDWKTPPGITPDNLDMTETIGVAGGRKDDLCLIV  503

Query  1581  RPF  1589
              PF
Sbjct  504   TPF  506



>ref|XP_006359503.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/483 (58%), Positives = 362/483 (75%), Gaps = 8/483 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W+++    K+KLPPGPW+LP+IGS+HHL  G+ PHR L NLS+KYGPIM+LQLGE+ T+V
Sbjct  23    WSRNSKTLKKKLPPGPWRLPIIGSVHHLTRGT-PHRVLGNLSQKYGPIMYLQLGEVPTVV  81

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP +A+ I KTHDL FASR   M   I+ Y STD+AFSPYGDYWR MRK+ VLELLS 
Sbjct  82    VSSPHMAKQILKTHDLAFASRSVTMLGKILCYNSTDIAFSPYGDYWRHMRKLSVLELLSA  141

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             KMVKSF S R +ELSNL+SSI   S  G P NL+EK+ WF ++   +  FG+ C ++Q +
Sbjct  142   KMVKSFSSIRHDELSNLLSSI--DSMVGSPINLSEKLFWFMNASTCRSTFGKTC-KNQNE  198

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              + L+++ +SL+ GF+L DLFPSK ++H  SGM+ KL+K  +++D + D II  H+ENH 
Sbjct  199   LVTLIQRAMSLSSGFELADLFPSKTFLHGISGMESKLMKARNKVDILLDNIINVHRENH-  257

Query  867   ANSTNSSGKD--EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
              N  N +G+   ED++DV LRV E GE QFP+T DNIKAVI DMF  G++TS+ T+IWA+
Sbjct  258   TNGKNYNGESGTEDLIDVFLRVMESGEFQFPLTNDNIKAVILDMFVAGSDTSSATVIWAL  317

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             SEM+K PSVMAKAQAEVR+  KG +T  DD DLE L YLKLVIKETLRLHPP PL+ PRE
Sbjct  318   SEMMKSPSVMAKAQAEVREVFKGKETCNDDTDLEKLNYLKLVIKETLRLHPPTPLLVPRE  377

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               EE KI  + IP K++V++N WA+  +P+SWE+PE F+PERFENSS++F GN ++ +PF
Sbjct  378   CREETKIDGFTIPLKSKVLVNVWAIGRDPKSWENPECFIPERFENSSIEFTGNCFQLLPF  437

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRRMCPGI F    + L LA LLY F+W+LP+G+  +DLDMTE+ G+ A ++ DL LI
Sbjct  438   GAGRRMCPGIHFGIALVTLPLAHLLYKFDWKLPEGIHVRDLDMTESNGITARRENDLYLI  497

Query  1578  ARP  1586
               P
Sbjct  498   GTP  500



>ref|XP_006367966.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/482 (59%), Positives = 350/482 (73%), Gaps = 5/482 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W KSK+  K  LPPGPW+LP IG+LH L+   LPHRSLRNLS+KYGPIMHL+LG ISTIV
Sbjct  37    WKKSKSPNKT-LPPGPWRLPFIGNLHQLMS-DLPHRSLRNLSKKYGPIMHLRLGNISTIV  94

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ISS ++A+ I KT DL F  RP+IM+  I+FY  TD+ FS YGDYWR MRK+CVLELLS 
Sbjct  95    ISSSEMAKEIMKTQDLHFVDRPQIMSTSIIFYDCTDIGFSSYGDYWRNMRKVCVLELLST  154

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             KMVKS  S RQEE+SNL+SS+R S+      NL+ K+ WFT+++  +   G++   D+ K
Sbjct  155   KMVKSLASIRQEEISNLISSLRSSTPDSL-INLSNKIFWFTNTVTCRAVSGKII-HDRNK  212

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K + SL GGFDL DLFPS+KW+H  SGMK KL K H ++D+I + I+ DH++N  
Sbjct  213   FIMLVKDIYSLIGGFDLTDLFPSQKWLHNISGMKYKLSKAHSKVDEILEQIVNDHRDNRA  272

Query  867   ANST-NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
               +  N    +ED VD LLRV E  E    IT  NIKAVI DMF  GTET++TT+IWA  
Sbjct  273   KGTKYNGESGNEDFVDALLRVMESEEFGPRITNQNIKAVILDMFLAGTETASTTLIWAFL  332

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             E+IK P VM KAQ EVR+ L G KTF+D DLE L YL+ VIKETLRLHPP PL+ PRE  
Sbjct  333   ELIKNPRVMVKAQLEVRERLNGKKTFNDTDLEELNYLQFVIKETLRLHPPAPLLIPRECR  392

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             EE KI  Y IP KT+V++NAW++  +P+ W + E F+PERFENSS+DF GNH+EFIPFGA
Sbjct  393   EETKIDGYTIPVKTKVLVNAWSIGRDPKYWHNSESFIPERFENSSIDFRGNHFEFIPFGA  452

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRRMCPG+ F   +IA  L+ LLYHF+W++P GV+P DLD  E  G+ A +K DL LIA 
Sbjct  453   GRRMCPGMLFGLVNIAHPLSQLLYHFDWKVPHGVNPNDLDTIETEGLTARRKNDLYLIAT  512

Query  1584  PF  1589
             PF
Sbjct  513   PF  514



>ref|XP_006355212.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=504

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/468 (59%), Positives = 352/468 (75%), Gaps = 5/468 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPW+LPLIGSLHHL  G LPH +LR+L+RK+GP+M+LQLGE+  +VISSP++A+A+
Sbjct  33    KLPPGPWRLPLIGSLHHL-KGKLPHHNLRDLARKHGPLMYLQLGEVPVVVISSPRIAKAV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FA+RP+ MA DIVFYKS D++F+PYGDYWRQMRK+   ELLS KM+KS+   R
Sbjct  92    LKTHDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLSNKMLKSYNMIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++ELS L+SSIRLS  TG   N+TEK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDELSKLLSSIRLS--TGSAVNITEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILA  208

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  893
             L+GGFD+ DLFPS K +H  S MK +L  +HH+ D+I + II +HKENH A    N+   
Sbjct  209   LSGGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYDQIMENIINEHKENHAAGIKGNNEFG  268

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED++D LLRVKE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SEM+K  +VMA
Sbjct  269   GEDMIDALLRVKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSEMMKHQNVMA  328

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVRQ  K  +  D+ DL+ L YLK VIKETLR+HPP+PL+ PRE  E+ +I  Y +
Sbjct  329   KAQAEVRQVFKEKENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTV  388

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P   RV++NAWA+  +PESWEDPE F PERFEN SVD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  389   PLNARVMVNAWAIGRDPESWEDPESFKPERFENISVDLTGNHYQFIPFGSGRRMCPGMSF  448

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                +    LA  LY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  449   GLVNTGHPLAQFLYQFDWKLPDKVNANDFSTTETSRVFAASKDDLYLI  496



>ref|XP_004246079.1| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/468 (58%), Positives = 353/468 (75%), Gaps = 5/468 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPW+LPLIG+LHHL  G LPH +LR+L+RK+GP+M+LQLGE+  +VISSP++A+A+
Sbjct  33    KLPPGPWRLPLIGNLHHL-KGKLPHHNLRDLARKHGPLMYLQLGEVPVVVISSPRIAKAV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FA+RP+ MA DIVFYKS D++F+PYGDYWRQMRK+   ELL+ KMVKS+   R
Sbjct  92    LKTHDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLNNKMVKSYNMIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++ELS L+SSIRL+  TG   N+TEK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDELSKLLSSIRLA--TGSAVNITEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILA  208

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  893
             L+GGFD+ DLFPS K +   S MK +L  +HH+ D+I + II +HK+NH A    N+   
Sbjct  209   LSGGFDVCDLFPSWKLLQNMSNMKARLTNVHHKYDQIMENIINEHKQNHAAGIKGNNEFG  268

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED++D LLR KE  ELQFPI  DN+KAVI D+F  GTETS T IIWA++EM+K P+VMA
Sbjct  269   GEDMIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALTEMMKHPNVMA  328

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVRQ  K N+ FD+ DL+ L YLK VIKETLR+HPP+PL+ PRE  E+ +I  Y +
Sbjct  329   KAQAEVRQVFKDNENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTV  388

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P   RV++NAWA+  +PESWEDPE F PERFEN +VD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  389   PLNARVMVNAWAIGRDPESWEDPESFKPERFENVAVDLTGNHYQFIPFGSGRRMCPGMSF  448

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                +    LA  LY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  449   GLVNTGHPLAQFLYQFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>ref|XP_004243471.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/478 (58%), Positives = 358/478 (75%), Gaps = 8/478 (2%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
             K +LPPGPW+LP+IGS+HHL  G LPH+ L+ LS KYGPIM+LQLGE+ T+V+SS  +A+
Sbjct  27    KNRLPPGPWRLPIIGSVHHLTSG-LPHQVLKKLSFKYGPIMYLQLGEVPTVVVSSSHMAK  85

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              I KTHDL FASRP+ M   I+ Y   D+AFSPYGDYWR MRK+ VLELLS KMVKSF  
Sbjct  86    QILKTHDLAFASRPETMMGKIICYNCKDIAFSPYGDYWRHMRKLTVLELLSAKMVKSFSP  145

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              RQ+ELSNL+SSIR S     P NL EK+ WF ++   + AFG VC +DQ + I L+ Q 
Sbjct  146   IRQDELSNLLSSIR-SMNLDSPINLVEKLLWFMNAATCRSAFGNVC-KDQRELITLIHQA  203

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-ANSTNSS  887
              SL+GGF+L DLFPSKK++H  SGM+ KL+   +++D++ D II  H+EN     S N  
Sbjct  204   QSLSGGFELADLFPSKKYLHGISGMESKLMNARYKIDQVLDNIINVHRENRANGKSCNGE  263

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
                ED++DV LRV E G+   P+T DNIKAVI DMF  G++TS++T+IWA+SE+++ P++
Sbjct  264   SGAEDLIDVFLRVMESGQFPVPLTNDNIKAVILDMFVAGSDTSSSTVIWALSELMRNPNI  323

Query  1068  MAKAQAEVRQALKGNKTFDDK---DLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1238
             MAKAQAEVR+ + G KT DD    DLEN++YL LVIKETLRLHPP PL+ PRE  EE KI
Sbjct  324   MAKAQAEVREVM-GKKTCDDDIDTDLENVSYLMLVIKETLRLHPPTPLLVPRECREETKI  382

Query  1239  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1418
              E+ IP K++V++N WA+  +PE+WE+PE F+PERFENSS++F GNH+EF+PFGAGRR+C
Sbjct  383   DEFTIPLKSKVMVNVWAIGRDPENWENPECFVPERFENSSIEFTGNHFEFLPFGAGRRIC  442

Query  1419  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
             PGI F    + L LA LLY+F+W+LP G+S  DLDMTEA G+ A ++KDL LIA P+V
Sbjct  443   PGIQFGLALVTLPLAHLLYNFDWKLPQGISASDLDMTEANGISARREKDLYLIATPYV  500



>ref|XP_004241764.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=513

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/480 (56%), Positives = 358/480 (75%), Gaps = 7/480 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGG-SLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             +  + AK+KLPPGPW+LP+IGSLHHL G  S PHR+L+NL+ KYGPIM+LQLGEI  +++
Sbjct  28    RKSSTAKEKLPPGPWRLPIIGSLHHLRGALSFPHRTLKNLATKYGPIMYLQLGEIPAVIV  87

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP + + I KTH+L FA++P++ ++DI  Y   D+AF+PYGD WRQMR ICV ELL  K
Sbjct  88    SSPIMVKEILKTHELAFATKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTELLGTK  147

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              VKSF S R++E++ L+SSIR ++ T    NLTE +  +T+S+  + AFG+VC+ +Q   
Sbjct  148   TVKSFSSIRKDEITRLLSSIRSTNGTRL-VNLTELILRYTNSVTCRSAFGKVCT-NQHHL  205

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I LL+ VL   GGFD+ DLFPS K +H  SG+K +LL++H ++D+  + I+ +H +N   
Sbjct  206   INLLRDVLDTLGGFDVSDLFPSWKLLHKMSGVKSELLRMHKKVDEALENIVNEHIKNRAL  265

Query  870   NSTNSSGK---DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
                 +  K    ED+VDVLLR+KE GELQFPIT D+IKA+I+DMF+ GTETSA TIIWA+
Sbjct  266   GCKGNGDKLIGGEDLVDVLLRIKENGELQFPITSDHIKAIISDMFAAGTETSAATIIWAL  325

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             SEM+++P +MAKAQ EVRQ  KG  TF + DL+ LTYLKLVIKETLRLHPP  L+   E 
Sbjct  326   SEMMRKPKIMAKAQNEVRQVFKGKITFYEDDLDKLTYLKLVIKETLRLHPPSTLLPR-EC  384

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              ++  I  Y IPPKTRV+IN WAL  + ESW+DPE F+PERFENS VD+MGN+Y+FIPFG
Sbjct  385   RKQTYINGYTIPPKTRVLINTWALGRDSESWDDPESFIPERFENSPVDYMGNYYKFIPFG  444

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             +GRR+CPG+ F  T++   LA LLYHF+W LP G +P+DLDM E  G+ A+K +DLCLIA
Sbjct  445   SGRRICPGMQFGLTNVKHPLAQLLYHFDWVLPYGANPEDLDMIEKNGLSAAKHRDLCLIA  504



>ref|XP_006367127.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
Length=505

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/481 (57%), Positives = 356/481 (74%), Gaps = 7/481 (1%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K+  K+ LPPGPW+LP+IGS+HHL  G +PH  L+NLS+K+GPIM+LQLGE+ TIV+SSP
Sbjct  29    KSRNKKILPPGPWRLPIIGSVHHLTKG-IPHHVLKNLSQKFGPIMYLQLGEVPTIVVSSP  87

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
              +A+ I KTHDL FASR + M   I  Y  TD+AFSPYG+YWR MRK+C++ELLS KMVK
Sbjct  88    HMAQKIMKTHDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRHMRKLCIMELLSAKMVK  147

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R +ELS+LVSSI+    T  P N++EK+ WF +S+  + +FG+ C +     I+L
Sbjct  148   SFSPIRLDELSSLVSSIKSMKNT--PINVSEKLFWFMNSVTCRSSFGKACKDQNEAMISL  205

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +  VLSLAGGF+L DL+PSKK++   SGM  KL++  +++D + D +I  H+ENH AN  
Sbjct  206   IHGVLSLAGGFELADLYPSKKFLSGISGMGSKLIEARNKVDTVLDKVIDVHRENH-ANGK  264

Query  879   NSS---GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
               +   G +ED++DV  RV   GEL F +T +NIKAVI DMF  G++TS++T+ WA+SEM
Sbjct  265   KCNAECGSNEDLIDVFFRVMGTGELPFTLTNNNIKAVILDMFVAGSDTSSSTVTWALSEM  324

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             +K PSVMAKAQAEVR+  KG KTFDD DLE + YLKLVIKETLRLHPP PL+ PRE  EE
Sbjct  325   MKSPSVMAKAQAEVREVFKGKKTFDDDDLEKVDYLKLVIKETLRLHPPTPLLVPRECREE  384

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              +I  YIIP K++V++N WA+  +PESWED E F+PERFENSSVDF G H++F+PFGAGR
Sbjct  385   TEIDGYIIPVKSKVLVNVWAIGRDPESWEDSESFIPERFENSSVDFSGTHFQFLPFGAGR  444

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R CPG  F    + L LA LLY+FNW LP+G+ P+DLDM EA G+ A + KDL LIA P+
Sbjct  445   RTCPGRLFGLALVTLPLAHLLYNFNWTLPNGMDPRDLDMNEANGMTARRDKDLYLIATPY  504

Query  1590  V  1592
              
Sbjct  505   T  505



>ref|XP_006350394.1| PREDICTED: cytochrome P450 71D6-like [Solanum tuberosum]
Length=501

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/483 (56%), Positives = 360/483 (75%), Gaps = 4/483 (1%)
 Frame = +3

Query  147   WAK-SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W K SK +  +KLPPGPWKLP IGS+HHL GG LPHR LR+L++KYGP+MHLQLGE+S +
Sbjct  19    WKKYSKYSQTKKLPPGPWKLPFIGSMHHLAGG-LPHRVLRDLAKKYGPLMHLQLGEVSAV  77

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V++SP +A+ I KTHD+ FASRPK++A+DI+ Y   D+AFSPYG+YW+QMRKICV+E+LS
Sbjct  78    VVTSPDIAKQILKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVMEVLS  137

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF S R +E+  L+ SI+ SS +G   NLTE+V WFTSS+  + AFG+V  E Q 
Sbjct  138   AKSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNLTERVIWFTSSMTCRSAFGQVPKE-QD  196

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
              FI L+++V+SLA GFD+ D+FPS K++H     K KLL +H ++D I + +I +HK+N 
Sbjct  197   MFIKLIREVISLAEGFDVADIFPSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNF  256

Query  864   LANSTNSSG-KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
                  +      ED+VDVLLR+     LQFPI  DNIKA+I DMF+ GTETS+TT +WAM
Sbjct  257   STRKNDDHALGGEDLVDVLLRLMNDKSLQFPINNDNIKAIIIDMFAAGTETSSTTTVWAM  316

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             +EM+K PSV+AKAQAEVR+A +   T D+ D+E L YLKLVIKET+RLH P+PL+ PRE 
Sbjct  317   AEMLKNPSVLAKAQAEVREAFRNKVTLDENDVEELKYLKLVIKETMRLHAPIPLLVPREC  376

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              EE +I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  S+DF+GN++E++PFG
Sbjct  377   REETEINGYTIPVKTKVMVNVWALGRDPKYWDDVESFKPERFEQCSIDFIGNNFEYLPFG  436

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
              GRR+CPGISF   ++ L LA LL  F+W+LP G+ PKDLD+TE  G+  ++K DL LIA
Sbjct  437   GGRRICPGISFGLANVYLPLAQLLCRFDWKLPAGMEPKDLDLTELAGMSVARKGDLYLIA  496

Query  1581  RPF  1589
              P+
Sbjct  497   TPY  499



>ref|XP_009772938.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 359/481 (75%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  SK   K +LPPGPWKLP+ GS  H+VGG LPHR LR+L++KYGP+MHLQLGE+S +V
Sbjct  22    WMNSKNQVK-RLPPGPWKLPIRGSTLHMVGG-LPHRVLRDLAKKYGPLMHLQLGEVSVVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRPK++A +IV Y S+DVAF+PYGDYWRQMRKICVLE+LS 
Sbjct  80    VTSPEIAKEVLKTHDLAFASRPKLLAAEIVLYDSSDVAFAPYGDYWRQMRKICVLEVLST  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  LV   R SS  G P N T+++S F S +I + AFG V  E Q +
Sbjct  140   KNVRSFSSIRRDEVFRLVEFFRSSS--GKPVNYTKRISLFMSFIICRSAFGTVFKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI ++K V +L  GFD+ D+FPS K++H  +GM+ K + LHH++D I D +I +HKEN  
Sbjct  197   FIQVMKNVTALLEGFDVADIFPSLKFLHVVTGMRAKAMNLHHKVDAIVDNVINEHKENLA  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 +     ED++DVLLR+ + G  QFPIT DNIKA+I DMF+ GTET++TTI WAM E
Sbjct  257   TGKFSGQLGGEDLIDVLLRLMKDGGFQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVE  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MI+  SV AKAQAEVR+     +TFD+ D+E L YLKLVIKETLRLHPPLPL+ P+E  E
Sbjct  317   MIRNASVFAKAQAEVREVFSRKETFDENDVEKLKYLKLVIKETLRLHPPLPLMLPKECRE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP K++V++N WA+  +P+ W+D E F PER+E SSVDF+GN++E++PFG+G
Sbjct  377   ETNINGYTIPLKSKVMVNVWAIGRDPKYWDDAESFKPERYEQSSVDFVGNNFEYLPFGSG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   +I L LA LLY+F+W+LP G++P DLDMTE+ G   ++K +L L+A P
Sbjct  437   RRICPGISFGIVNIYLPLAQLLYYFDWKLPTGINPSDLDMTESDGASCARKSNLYLVASP  496

Query  1587  F  1589
             +
Sbjct  497   Y  497



>ref|XP_009622900.1| PREDICTED: cytochrome P450 71D7-like [Nicotiana tomentosiformis]
 gb|ABC69401.1| CYP71D49v2 [Nicotiana tabacum]
Length=505

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/468 (58%), Positives = 352/468 (75%), Gaps = 4/468 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPW+LPLIGSLHHL  G LPH  LR+L+RKYGP+M+LQLGE+  +VISSP++A+A+
Sbjct  33    KLPPGPWRLPLIGSLHHL-KGKLPHHHLRDLARKYGPLMYLQLGEVPVVVISSPRIAKAV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FA+RP+ M+ DIVFYKS D++F+PYGDYWRQMRKI   ELLS KM+KSF + R
Sbjct  92    LKTHDLAFATRPRFMSSDIVFYKSRDISFAPYGDYWRQMRKILTQELLSNKMLKSFSTIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++ELS L+SSIRL++ +    N+ EK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDELSKLLSSIRLATASS-AVNINEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILA  209

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  893
             L+GGFD+ DLFPS K +H  S MK +L  +HH+ + I + II +HKENH A    N+   
Sbjct  210   LSGGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYNLIMENIINEHKENHAAGIKGNNEFG  269

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED++D LLRVKE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SE++K PSVMA
Sbjct  270   GEDMIDALLRVKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMA  329

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVR+  K N+  D+ DL+ L YLK VIKETLR+HPP+PL+ PRE  E+ +I  Y +
Sbjct  330   KAQAEVRKVFKENENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTV  389

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P K RV++NAWA+  +PESWEDPE F PERFEN SVD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  390   PLKARVMVNAWAIGRDPESWEDPESFKPERFENISVDLTGNHYQFIPFGSGRRMCPGMSF  449

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                +    LA LLY F+W+ P  V+  D   TE   V A+ K DL LI
Sbjct  450   GLVNTGHPLAQLLYFFDWKFPHKVNAADFHTTETSRVFAASKDDLYLI  497



>gb|ABC69399.1| CYP71D49v1 [Nicotiana tabacum]
Length=505

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/468 (58%), Positives = 352/468 (75%), Gaps = 4/468 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPW+LPLIGSLHHL  G LPH  LR+L+RKYGP+M+LQLGE+  +VISSP++A+A+
Sbjct  33    KLPPGPWRLPLIGSLHHL-KGKLPHHHLRDLARKYGPLMYLQLGEVPVVVISSPRIAKAV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FA+RP+ M+ DIVFYKS D++F+PYGDYWRQMRKI   ELLS KM+KSF + R
Sbjct  92    LKTHDLAFATRPRFMSSDIVFYKSRDISFAPYGDYWRQMRKILTQELLSNKMLKSFSTIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++ELS L+SSIRL++ +    N+ EK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDELSKLLSSIRLATASS-AVNINEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILA  209

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  893
             L+GGFD+ DLFPS K +H  S MK +L  +HH+ + I + II +HKENH A    N+   
Sbjct  210   LSGGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYNLIMENIINEHKENHAAGIKGNNEFG  269

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED++D LLRVKE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SE++K PSVMA
Sbjct  270   GEDMIDALLRVKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMA  329

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVR+  K N+  D+ DL+ L YLK VIKETLR+HPP+PL+ PRE  E+ +I  Y +
Sbjct  330   KAQAEVRKVFKENENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTV  389

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P K RV++NAWA+  +PESWEDPE F PERFEN SVD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  390   PLKARVMVNAWAIGRDPESWEDPESFKPERFENISVDLTGNHYQFIPFGSGRRMCPGMSF  449

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                +    LA LLY F+W+ P  V+  D   TE   V A+ K DL LI
Sbjct  450   GLVNTGHPLAQLLYLFDWKFPHKVNAADFHTTETSRVFAASKDDLYLI  497



>ref|XP_004245943.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=499

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/479 (56%), Positives = 352/479 (73%), Gaps = 5/479 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             + +    + QKLPPGPWKLP+IGS+HHL+G  LPH  LRNLS+KYGPIMHL+LGEI T+V
Sbjct  21    FVRKSKKSNQKLPPGPWKLPIIGSMHHLIG-VLPHHVLRNLSKKYGPIMHLKLGEIDTVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SS  +A+ + K HDL FA+RP++M+ DIVFY   D+ F+ YGDYW+QMRKIC+ ELLS 
Sbjct  80    VSSAHMAKQVLKVHDLCFAARPELMSSDIVFYNQNDIVFAKYGDYWKQMRKICISELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             KMVKSF   RQ+E+ +LV+SIR  S      N++EK+   TSS+I + AFG+V  +D+  
Sbjct  140   KMVKSFSLIRQDEVHDLVASIR--STPNVVVNISEKILRLTSSVICRSAFGKVW-DDRDN  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              + L+++VLSL+GGFD+ DLFPS   +H   GM+ +L  LH ++D I + II +HKEN  
Sbjct  197   LLMLMREVLSLSGGFDVADLFPSWTLLHGIGGMRNRLKSLHQKIDVILEKIIHEHKENRA  256

Query  867   -ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
                  NS    ED++DVLLRV E GELQFPIT D++KAV+ D+F  GTETS+  I WA+S
Sbjct  257   NGKKGNSEFGGEDLIDVLLRVMENGELQFPITNDSVKAVVLDLFFGGTETSSVIIQWALS  316

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             E++K P VMAKAQAEVR+  KG K  +D  +E L YLKLVI ETLRLHP  PL+  R+  
Sbjct  317   ELMKNPKVMAKAQAEVRRVCKGKKDLNDNVVEELKYLKLVINETLRLHPASPLLGLRQCR  376

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             EE KI  Y IP K++V++N WA+A +PESW+DPE F+PERFE +SVDF GNH+++IPFGA
Sbjct  377   EETKIDGYTIPLKSQVVVNGWAIARDPESWDDPEAFVPERFEKNSVDFNGNHFQYIPFGA  436

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             G RMCPG+ F   ++   LA LLYHF+W+LP G  P+DLDMTE +G+ A++K DL LIA
Sbjct  437   GSRMCPGMHFGLANVVYPLAQLLYHFDWKLPYGQQPEDLDMTETLGISATRKNDLNLIA  495



>gb|ABC69400.1| CYP71D49v3 [Nicotiana tabacum]
Length=505

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/468 (58%), Positives = 351/468 (75%), Gaps = 4/468 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPW+LPLIGSLHHL  G LPH  LR+L+RKYGP+M+LQLGE+  +VISSP++A+A+
Sbjct  33    KLPPGPWRLPLIGSLHHL-KGKLPHHHLRDLARKYGPLMYLQLGEVPVVVISSPRIAKAV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHDL FA+RP+ M+ DIVFYKS D++F+PYGDYWRQMRKI   ELLS KM+KSF + R
Sbjct  92    LKTHDLAFATRPRFMSSDIVFYKSRDISFAPYGDYWRQMRKILTQELLSNKMLKSFSTIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++ LS L+SSIRL++ +    N+ EK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDGLSKLLSSIRLATASS-AVNINEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILA  209

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  893
             L+GGFD+ DLFPS K +H  S MK +L  +HH+ + I + II +HKENH A    N+   
Sbjct  210   LSGGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYNLIMENIINEHKENHAAGIKGNNEFG  269

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED++D LLRVKE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SE++K PSVMA
Sbjct  270   GEDMIDALLRVKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMA  329

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVR+  K N+  D+ DL+ L YLK VIKETLR+HPP+PL+ PRE  E+ +I  Y +
Sbjct  330   KAQAEVRKVFKENENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTV  389

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P K RV++NAWA+  +PESWEDPE F PERFEN SVD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  390   PLKARVMVNAWAIGRDPESWEDPESFKPERFENISVDLTGNHYQFIPFGSGRRMCPGMSF  449

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                +    LA LLY F+W+ P  V+  D   TE   V A+ K DL LI
Sbjct  450   GLVNTGHPLAQLLYFFDWKFPHKVNAADFHTTETSRVFAASKDDLYLI  497



>ref|XP_004228510.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/478 (56%), Positives = 357/478 (75%), Gaps = 3/478 (1%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             S +   + LPPGPWKLP +GS+ H++GG LPHR LR+L++KYG I+HLQLGE+S +V++S
Sbjct  25    SNSQINKSLPPGPWKLPFVGSMFHMIGG-LPHRVLRDLAKKYGSILHLQLGEVSLVVVTS  83

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P +A+ + KTHDL FASRP+++A +IV Y  TD+AF PYGDYWRQMRKICVLE+LS K V
Sbjct  84    PIMAKQVLKTHDLAFASRPRLLAAEIVLYNCTDIAFCPYGDYWRQMRKICVLEVLSGKNV  143

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF S RQ+E   LV   R SS +  P N+T+++S FTS +I + AFG +  E Q +FI 
Sbjct  144   RSFGSIRQDETIRLVEFFRSSSSSE-PVNVTKRISLFTSFIICRSAFGTIFKE-QDEFIQ  201

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             ++K V SL  GF++ D+FPS K++H  SGMK K + LHH++D I + +I +HK+N +   
Sbjct  202   VMKGVTSLLEGFNVADIFPSLKFLHVLSGMKSKTMYLHHKVDTIVENVINEHKKNLVNGK  261

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
             TN     ED++DVLLR+ E G+LQFPIT DNIKA++ DMF+ GTET++TTI WAM EMIK
Sbjct  262   TNGELGGEDLIDVLLRLMEDGDLQFPITNDNIKAIVYDMFAAGTETTSTTIDWAMVEMIK  321

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
               S++ KAQ EVR+  +G  TFD+ D+E L YLKLV+KETLRLHPPLPL+ PRE  EE  
Sbjct  322   NSSILVKAQKEVREVFRGKDTFDENDVEELKYLKLVVKETLRLHPPLPLMLPRECREEVD  381

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             I  Y IP KT++I+N WA+  +P+ W+D E F PERFE SS+DF+GN++EF+PFG+GRR+
Sbjct  382   IDGYTIPSKTKLIVNVWAIGRDPKYWDDAESFKPERFEQSSLDFVGNNFEFLPFGSGRRI  441

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             CPGISF   ++ L LA LLYHF+W+LP G+ P DLDMTE+ G   ++K +L LI  P+
Sbjct  442   CPGISFGLANVYLPLANLLYHFDWKLPPGIKPSDLDMTESDGASCTRKSNLYLIMTPY  499



>ref|XP_004249520.2| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=536

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/483 (56%), Positives = 360/483 (75%), Gaps = 5/483 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W KS+   K KLPPGPWKLP +GSLHHL  G LPH +L  L +KYGP+MHLQLGEIST+V
Sbjct  53    WKKSRNLNK-KLPPGPWKLPFLGSLHHLAIGGLPHHALTKLGKKYGPLMHLQLGEISTVV  111

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SS  +AR + KTHDL FASRPK+ ++DI+ YKSTD+ FSPYG+YWRQMRK+CV+ELL+ 
Sbjct  112   VSSMDMAREVLKTHDLAFASRPKLASIDIICYKSTDIVFSPYGEYWRQMRKVCVMELLTA  171

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S   +E S LV  I+ SS  G P N+TE++ W+TSS+  K AFG    +DQ K
Sbjct  172   KNVRSFSSILHDEASRLVQFIQ-SSTHGEPINITERILWYTSSITCKTAFGDQLLKDQEK  230

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI ++K+++ LA GF L D+FPS K +   +G + ++LK+H  +D I + +I +HK+N L
Sbjct  231   FIQMVKKLVELASGFSLADIFPSIKILGVLTGARSRILKVHKNVDAIVEDVINEHKKN-L  289

Query  867   ANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
             A+    +G    E++VDVL+R+   GEL+ PIT DNIKA++ D+FS GTETS+TT  WAM
Sbjct  290   ASGKKGNGAFGGENLVDVLIRLMGSGELKIPITNDNIKAIMVDLFSAGTETSSTTATWAM  349

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             +EM++ P V+ KAQAEVR+A KG +TFD+  +E L YL+ V+KETLRLHPP+PL+ PRE 
Sbjct  350   TEMMRNPRVLKKAQAEVREAFKGKETFDEDVIEELKYLRQVVKETLRLHPPVPLLAPREC  409

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              EE  I  Y IP KTRV++N W++  +P+ WED E F+PERF  SSVDF+GN++E++PFG
Sbjct  410   REETNINGYTIPLKTRVMVNVWSMGRDPKYWEDAESFIPERFARSSVDFLGNNFEYLPFG  469

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             AGRRMCPGI+F   ++ L LA LLYHF+W+LPDG  P+D+DMTE   + A++K +L LIA
Sbjct  470   AGRRMCPGITFGLFNVYLPLAKLLYHFDWKLPDGQKPEDVDMTELSAITAARKSELYLIA  529

Query  1581  RPF  1589
              P+
Sbjct  530   TPY  532



>ref|XP_009624010.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=502

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/481 (55%), Positives = 363/481 (75%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  SK  AK +LPPGPWKLP++GS+ H+VGG LPHR LR+L++KYGP+MHL+LGE+S +V
Sbjct  22    WMNSKNQAK-RLPPGPWKLPILGSMLHMVGG-LPHRILRDLAKKYGPLMHLKLGEVSVVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRPK++A +IV Y S+D+AF+PYGDYWRQMRKICVLE+L+ 
Sbjct  80    VTSPEIAKEVLKTHDLAFASRPKLLAAEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNT  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  L+   R SS  G P N T+++S FTS +I + AFG V  E Q +
Sbjct  140   KNVRSFSSIRRDEVFRLIEFFRSSS--GKPVNFTKRISLFTSFIICRSAFGTVFKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI ++K V +L  G D+ D+FPS K++H  +G + K++ LHH++D I D +I +HK+N  
Sbjct  197   FIQVMKNVTALLEGLDVADIFPSLKFLHVLTGKRAKVMNLHHKVDSIVDNVINEHKKNLA  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 N     ED++DVLLR+ + G+LQFPIT DNIKA+I DMF+ GTET++TTI WAM E
Sbjct  257   TGKFNGQLGGEDLIDVLLRLMKDGDLQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVE  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             +I+  SV AKAQAEVR+  +  +TFD+ D+E L YLKLVIKETLRLHPPLPL+ PRE  E
Sbjct  317   LIRNASVFAKAQAEVREVFRRIETFDENDVEELKYLKLVIKETLRLHPPLPLMLPRECRE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  + IP K++V++N WA+  +P+ W+D E F PERFE SSVDF GN++E++PFG+G
Sbjct  377   ETNINGFTIPLKSKVMVNVWAIGRDPKYWDDAENFKPERFEQSSVDFTGNNFEYLPFGSG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGI F   +I L LA LLY+F+W+LP G++P DLD+TE+ G   ++K +L LIA P
Sbjct  437   RRICPGILFGLANIYLPLAQLLYYFDWKLPTGINPSDLDLTESDGASCARKSNLYLIASP  496

Query  1587  F  1589
             +
Sbjct  497   Y  497



>ref|XP_009619325.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/482 (57%), Positives = 369/482 (77%), Gaps = 9/482 (2%)
 Frame = +3

Query  147   WAKSKAAAK-QKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W  SK   + Q+LPPGPW+LP IGSLHHL+GG LPHRSL+ L++KYGP+M+LQLG++ TI
Sbjct  27    WRISKTRNQNQRLPPGPWRLPFIGSLHHLIGGELPHRSLKKLAQKYGPLMYLQLGQVPTI  86

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             +ISSP++A+ + KTHDL FA+RP++ +  I+FY + D+ FS YGDYWRQMRKIC++ELLS
Sbjct  87    IISSPRIAKEVLKTHDLAFANRPQLTSSTIIFYNNIDMVFSQYGDYWRQMRKICIVELLS  146

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              KMVKSF   R++ELS+L+SSIR  +E     N+TEK+  FT+S+  + AFG++C +D+G
Sbjct  147   SKMVKSFSGIREKELSSLISSIRSMTE----VNITEKIFMFTNSVTCRSAFGKIC-KDRG  201

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             +F  LLK+VL LAGGF + DLFP  K +H  SGM+ +L+  H ++D+I + II +H  N 
Sbjct  202   EFRTLLKEVLLLAGGFFVADLFPCWKLLHNLSGMESRLVNAHRKVDEIMENIINEHIANR  261

Query  864   LA-NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
              A N  N    DED+VDV LR+KE  +L FPIT D+IKA++ D+F  GTETS+T +IWA+
Sbjct  262   AAGNKRNGEFGDEDLVDVFLRIKEKDQLHFPITNDHIKAMLFDIFLGGTETSSTVLIWAL  321

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKD--LENLTYLKLVIKETlrlhpplplihpr  1214
             +E++K P+VMAKAQ+EVRQ  KG K +D++D  +E L+YLKLVI ETLRLH P PL+ PR
Sbjct  322   AELMKNPNVMAKAQSEVRQVFKGKKIYDEEDNIVEKLSYLKLVIMETLRLHTPAPLMGPR  381

Query  1215  ESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIP  1394
             E  EE  I  Y IP KT+V++NAWALA + ESW DPE F+PERF+NSS+DFMGN++E+IP
Sbjct  382   ECREETNIAGYNIPNKTKVLVNAWALARDVESWNDPESFIPERFDNSSIDFMGNYFEYIP  441

Query  1395  FGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCL  1574
             FG GRR+CPGI F   +I + LA LLY+F W+LP G++P+DLDMTE  G+  +K+KDL L
Sbjct  442   FGTGRRICPGIQFGLANIGVPLAQLLYNFEWKLPYGINPQDLDMTETHGLTGAKQKDLYL  501

Query  1575  IA  1580
             +A
Sbjct  502   VA  503



>ref|XP_009598320.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=502

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/481 (55%), Positives = 354/481 (74%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W KS    K +LPPGPWK+P +GS+ H++GG LPH  L NL++KYGP+MHLQLGE+S +V
Sbjct  22    WKKSNNQTK-RLPPGPWKVPFLGSMFHMLGG-LPHHVLTNLAKKYGPLMHLQLGEMSVVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRPK++A+DIV Y  TD+AFSPYGDYWRQMRKICV+ELLS 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKLVAVDIVGYNGTDIAFSPYGDYWRQMRKICVMELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+ +L+   R  S  G P N+T+++  F SS+I + AFG+V  E Q +
Sbjct  140   KNVRSFNSIRRDEVCSLIEFFR--SSAGEPVNVTKRIYVFASSMIFRSAFGKVIKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I L+K V  L GGFD+ D+FPS+K +H  SG K K + LHH++D I + +I +HK+N  
Sbjct  197   CIRLIKDVSGLVGGFDVADIFPSQKVLHVLSGKKGKTMYLHHKIDTIIENVINEHKQNLA  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 N     ED++DVLLR+ + G LQFPIT DNIKA+  D+F+ GTETS++T+ WAM E
Sbjct  257   TGKFNGQLGSEDLIDVLLRLMKDGSLQFPITTDNIKAIFIDLFAGGTETSSSTVTWAMVE  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PS++ KAQ+EVR A KG + FD+ D+E L YLKLVIKET RLHPPLPL+ PRE  E
Sbjct  317   MMKNPSILIKAQSEVRDAFKGKEAFDENDVEELKYLKLVIKETFRLHPPLPLLIPRECRE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT +++N WA+  +P+ W D E F PERF++S++DF GN++EF+PFG+G
Sbjct  377   ETNINGYTIPLKTTIMVNVWAMGRDPKYWVDAENFKPERFQHSTMDFTGNNFEFLPFGSG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   +I L LA LLYHF+W LP G++P DLD+ E+ G+   +K D  LIA P
Sbjct  437   RRICPGISFGLANIYLPLAQLLYHFDWNLPTGINPSDLDLAESAGLAVLRKSDFYLIATP  496

Query  1587  F  1589
             +
Sbjct  497   Y  497



>ref|XP_006365962.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=504

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 354/481 (74%), Gaps = 9/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W +S+   KQ LPPGPW+LPLIGSLHHL+ G  PHR  R+L+RKYGP+ +L+LGE+ T++
Sbjct  22    WRRSQ---KQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLARKYGPVTYLELGEVPTVI  78

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ISSP  ++ + KTHDL FASRP+  + DIV Y + D+AF+ YGDYW+QMRKIC++ELLS 
Sbjct  79    ISSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSA  138

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             KMVKSF S R++ELS+++SS+  S       N+TEK+  FTSS+  ++ FG++C  D+ +
Sbjct  139   KMVKSFSSIRKDELSSVLSSMD-SVGGSCEVNMTEKIVRFTSSVTCRLVFGKLC-RDRDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I L+K  L L GGFD+GD FPS K ++  SG K KL+K+H  +D + + I+ +H +N +
Sbjct  197   LINLMKDALFLVGGFDVGDFFPSWKLLYKMSGAKSKLVKMHQNIDLVLERIVNEHIKNRV  256

Query  867   AN-STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
             A    N +   ED+VD+ LR+KE  +LQFPI  D+IKAVI DMF+ GTETS+TTIIWA+S
Sbjct  257   AGIKGNGAYGGEDLVDIFLRIKENDQLQFPIINDHIKAVILDMFTAGTETSSTTIIWALS  316

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             E++K P+VMAKAQ+EVRQA K    FD++DL+NL YLKLVIKET  L    P I  RE  
Sbjct  317   ELMKHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVIKET--LRLHAPSIVHRECR  374

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             EE  +  Y IP K  V++N WA+  +PE W+DPE F+PERFENS +D++GN+YEF+PFGA
Sbjct  375   EETIVDGYTIPAKATVLVNTWAMGRDPEVWDDPESFIPERFENSPIDYLGNNYEFLPFGA  434

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGV-SPKDLDMTEAVGVIASKKKDLCLIA  1580
             G+R+CPG+ F   ++   LA LLYHFNW LP G+ +PKDLDM+E  G+ A+K+KDL LIA
Sbjct  435   GKRICPGMQFGLANVKQPLARLLYHFNWGLPCGINTPKDLDMSEKSGLSAAKEKDLYLIA  494

Query  1581  R  1583
             +
Sbjct  495   K  495



>ref|XP_004250027.1| PREDICTED: cytochrome P450 71D7 [Solanum lycopersicum]
Length=508

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/487 (55%), Positives = 362/487 (74%), Gaps = 8/487 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  SK+   +KLPPGPWK+P IGS+HH+VGG  PH  LR+L++KYGP+MHLQLGE+  +V
Sbjct  22    WKNSKSQTTKKLPPGPWKIPFIGSIHHIVGG-YPHHVLRDLAKKYGPLMHLQLGEVCVVV  80

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++S ++A+ I KTHDL FASRPK++ +DI+ Y S D+AFSPYGDYW+QMRKI V+ELL+ 
Sbjct  81    VTSSEMAKQIFKTHDLAFASRPKLLVMDIITYNSRDIAFSPYGDYWKQMRKISVMELLNA  140

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R +E+ +L+ SIR SS +G P N +E+V WF SS++ + AFG++  +DQ  
Sbjct  141   KNVRSFSSIRHDEVVHLIDSIRSSSSSGEPVNFSERVLWFASSMLCRSAFGKL-PKDQDI  199

Query  687   FIALLKQVLSLAG-GFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE--  857
             FI L++QVL L+  GFD+ D+FPS K++H   G+K K+L +H+++D I + +I +HK+  
Sbjct  200   FIKLVRQVLRLSNQGFDMADIFPSYKFLHGLGGLKKKILDVHYKIDSIVEDVINEHKKSF  259

Query  858   -NHLANSTNSS--GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTI  1028
              NH   S + +  G DED++DVLLR+ +   LQFPI    IKA+I D+F+ GT+T++  I
Sbjct  260   ANHKRTSDDDALGGGDEDLIDVLLRLMKDKSLQFPINNHTIKAIIVDIFAGGTDTTSIII  319

Query  1029  IWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplih  1208
             +WAM+EM++ PS++AKAQAEVR+A KG   FD  D+E L YLKLV+KETLRLHP +PL  
Sbjct  320   VWAMAEMMRNPSILAKAQAEVREAFKGKVKFDKYDVEELKYLKLVVKETLRLHPSVPLSV  379

Query  1209  prESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEF  1388
             PRE  EE  I  Y IP KT+++IN WAL  +PE W+DPE F PERFE  SVDF+GN++EF
Sbjct  380   PRECREETDINGYTIPLKTKILINVWALGRDPEYWDDPESFKPERFEQCSVDFIGNNFEF  439

Query  1389  IPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDL  1568
             +PFG+GRR+CPGISF   +I  SLA  LYHF+W+LP+G+ P DLD+TE+ G     K DL
Sbjct  440   LPFGSGRRVCPGISFGLANIYSSLAQSLYHFDWKLPNGMDPTDLDLTESDGGSTGMKNDL  499

Query  1569  CLIARPF  1589
              LIA P+
Sbjct  500   YLIATPY  506



>ref|XP_004242219.2| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 352/481 (73%), Gaps = 6/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             + K + + KQ LPPGPW+LPLIGSLHHL+ G  PHR  R+L+RKYGP+M+L+LGE+ T++
Sbjct  19    FRKLRRSQKQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLARKYGPVMYLELGEVPTVI  78

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ISSP  ++ + KTHDL FASRP+  + DIV Y + D+AF+ YGDYW+QMRKIC++ELLS 
Sbjct  79    ISSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSA  138

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             KMVKSF S R++ELS+++SSI  S       N+TE +  FTSS+  ++ FG++C  D+ +
Sbjct  139   KMVKSFSSIRKDELSSVLSSID-SVRGCCEVNMTEIIVRFTSSVTCRLVFGKLC-RDRDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I L+K  L L GGFD+GD FPS K ++  SG K KL+K+H ++D + + I+ +H +N  
Sbjct  197   LINLMKDALFLVGGFDIGDFFPSWKLLYKMSGAKSKLVKMHQKVDSVLERIVNEHIKNRE  256

Query  867   AN-STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
             A    N +   ED+VDV LR+KE  +LQFPIT D+IKAVI DMF+ GTETS+T IIWA+S
Sbjct  257   AGIKGNGAHGGEDLVDVFLRIKENDQLQFPITNDHIKAVILDMFTAGTETSSTAIIWALS  316

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             E++K P+VMAKAQ+EVRQA K    FD++DL+NL YLKLVIKET  L    P I  RE  
Sbjct  317   ELMKHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVIKET--LRLHAPSIVHRECR  374

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             EE  +  Y IP K  V++N WA+  +PE W+DPE F+PERFENS +D++GN+YEF+PFGA
Sbjct  375   EETTVDGYTIPAKATVLVNTWAMGRDPEVWDDPESFIPERFENSPIDYLGNNYEFLPFGA  434

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGV-SPKDLDMTEAVGVIASKKKDLCLIA  1580
             G+R+CPG+ F   ++   LA LLYHFNW LP G  +PK LDM+E  G+ A+K+KDL LIA
Sbjct  435   GKRICPGMQFGIANVKQPLARLLYHFNWGLPYGTNNPKHLDMSEKSGLSAAKEKDLYLIA  494

Query  1581  R  1583
             +
Sbjct  495   K  495



>ref|XP_006350417.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/482 (55%), Positives = 352/482 (73%), Gaps = 3/482 (1%)
 Frame = +3

Query  147   WAK-SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W K S     +KLPPGPWKLP IGS+HHL GG L HR LR+L++KYGP+MHLQLGE+S +
Sbjct  19    WKKYSNNTQTKKLPPGPWKLPFIGSMHHLAGG-LSHRVLRDLAKKYGPLMHLQLGEVSAV  77

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V +SP +A+ + K HD+ FASRP ++A DI+ Y   D+AF PYG+YWRQMRKICV+E+L 
Sbjct  78    VATSPDMAKQVLKIHDIAFASRPSLLATDIICYNRRDIAFIPYGEYWRQMRKICVMEVLG  137

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF S R++E+  L+ SI+ SS +G P N TEK+ WFTSS+  + AFG+V  E Q 
Sbjct  138   AKNVRSFSSIRRDEVVRLIDSIQSSSFSGEPVNFTEKIIWFTSSMTCRSAFGQVLKE-QE  196

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
              FI L+++V+SL  GFD+ D+FPS K++H   G K +LL  H ++D I + +I +HK+N 
Sbjct  197   VFIKLIREVISLTEGFDVADIFPSYKFLHGFGGAKKQLLNAHRKVDSIVEDVIKEHKKNL  256

Query  864   LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
                 ++ S   ED+VDVLLR+     LQFPI  DNIKAVI D+F+ GTETS+TT +WAM+
Sbjct  257   ATRKSDDSIGGEDLVDVLLRLMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMA  316

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             EM K P++++KAQAEVR+A +    F + D+E+L YLKLVIKETLR+H P+PL+ PRE  
Sbjct  317   EMFKNPTLLSKAQAEVREAFRNKVKFGENDVEDLKYLKLVIKETLRIHAPIPLLVPRECR  376

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             EE KI  Y IP KT+V++N WAL  +P+ W++ E F PERFE  S+DF+GN++EF+PFG 
Sbjct  377   EETKINGYTIPMKTKVMVNVWALGRDPKYWDNAESFKPERFEECSMDFVGNNFEFLPFGG  436

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRR+CPGISF   +I L LA LLYHF+W+LP G+ P+DLD+ E   + AS+K DL LI  
Sbjct  437   GRRICPGISFGLANIYLPLAQLLYHFDWKLPTGIEPRDLDLIELSRITASRKGDLYLIVT  496

Query  1584  PF  1589
             P+
Sbjct  497   PY  498



>ref|XP_006365979.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=521

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/485 (57%), Positives = 358/485 (74%), Gaps = 14/485 (3%)
 Frame = +3

Query  159   KAAAKQ-KLPPGPWKLPLIGSL------HHLVGGSL-PHRSLRNLSRKYGPIMHLQLGEI  314
             K+ AKQ KLPPGPW+LP+IGSL      HHL G  L PHR+L+NL+ KYGPIM+LQLGEI
Sbjct  31    KSLAKQEKLPPGPWRLPIIGSLPIIGSLHHLRGALLFPHRTLKNLATKYGPIMYLQLGEI  90

Query  315   STIVISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLE  494
               +++SSP + + I KTH+L FA++P++ ++DI  Y   D+AF+PYGD WRQMR ICV E
Sbjct  91    RAVIVSSPNMVKEILKTHELAFATKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTE  150

Query  495   LLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSE  674
             LLS KMVKSF S +++E+  L+SSIR S+      NLTE +  +T+S+  + AFG+V + 
Sbjct  151   LLSTKMVKSFSSIQKDEIMRLLSSIR-STNGSHLVNLTELILRYTNSVTCRSAFGKVYT-  208

Query  675   DQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHK  854
             +Q + I LL+ VL   GGFD+ DLFPS K +H  SG+K KLLK+H ++D+  + I+ +H 
Sbjct  209   NQDQLINLLRDVLDTLGGFDVADLFPSWKLLHKMSGVKSKLLKMHKKVDEALENIVNEHI  268

Query  855   ENHLANSTNSSGK---DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATT  1025
             +N       +  K    ED+VDVLLRVKE GELQFPIT D+IKA+I+DMF+ GTETSA T
Sbjct  269   KNRSLGCKGNGEKLVGGEDLVDVLLRVKENGELQFPITSDHIKAIISDMFAAGTETSAAT  328

Query  1026  IIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplpli  1205
             IIWA+SEM++RP++MAKAQ EVRQ  KGN T ++ DL+ L YLKLVIKETLRLHPP  L+
Sbjct  329   IIWALSEMMRRPNIMAKAQNEVRQVFKGNTTINEDDLDKLIYLKLVIKETLRLHPPSTLL  388

Query  1206  hprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYE  1385
                E  ++  I  Y IPPKTRV+IN WAL  + ESW+D E F+PERFENS VD+MGN++E
Sbjct  389   PR-ECRKQTYINGYTIPPKTRVLINTWALGRDSESWDDTESFIPERFENSHVDYMGNYFE  447

Query  1386  FIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKD  1565
             FIPFG+GRR+CPG+ F  T++   LA LLYHF+W LP G +P+DLDM E  G+ A+K KD
Sbjct  448   FIPFGSGRRICPGMQFGLTNVKHPLAQLLYHFDWVLPYGANPEDLDMIEKNGLSAAKHKD  507

Query  1566  LCLIA  1580
             LCLIA
Sbjct  508   LCLIA  512



>ref|XP_006341699.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=501

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/480 (57%), Positives = 345/480 (72%), Gaps = 4/480 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K      +KLPPGPWKLP IG+LH L+ G LPH + R+LSRKYGPI HL+LGE+S +V+S
Sbjct  22    KQSKIFNKKLPPGPWKLPFIGNLHQLMNGRLPHHTFRDLSRKYGPIFHLRLGEVSHVVVS  81

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP  A+ I K  DL FA+RP+++  +I+ Y  +D+   PYGDYWR MRK+C LELLS KM
Sbjct  82    SPDTAKEIMKIQDLHFATRPQLLFGEIIMYNHSDIGTCPYGDYWRNMRKVCTLELLSTKM  141

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V+SF S RQ E+S+L+SSI  +S      NLT+K+ WFT  +  + AFG++    Q K I
Sbjct  142   VRSFDSIRQAEMSSLISSI--NSMPDSLINLTDKIFWFTGPVTCRSAFGKII-HGQDKLI  198

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-A  869
              LLK +  LAGGFDL D+FPS+KW+H   G+K K+LK+H+E+D I + II +H  N    
Sbjct  199   MLLKDITLLAGGFDLTDVFPSRKWLHGICGLKSKILKVHNEMDAILENIINEHCRNRANG  258

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                NS  + ED++DVLLRV E GEL  PIT +NIKAVI DMF  G ETS+TTIIWA +EM
Sbjct  259   KKGNSESEGEDLIDVLLRVMESGELGTPITNNNIKAVIFDMFLAGAETSSTTIIWAFAEM  318

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             I+ PS+MAKAQ EVR+ LKG K F+D DLE L YLKLVIKETLRLHPPLPL+ PRE  EE
Sbjct  319   IRNPSIMAKAQLEVREVLKGKKVFEDIDLEELKYLKLVIKETLRLHPPLPLLLPRECREE  378

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              +IGEY IP KTRV++NAWA+  +P+ W + E F+PERF+NSS+DF GNH+EFIPFGAGR
Sbjct  379   TRIGEYTIPIKTRVLVNAWAIGRDPKYWHNSESFIPERFDNSSIDFRGNHFEFIPFGAGR  438

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             RMCPG  F   ++  SLA LLYHF+W+ P     ++ DMT   G  A +K DLC IA PF
Sbjct  439   RMCPGWLFCLMNVEHSLAQLLYHFDWKSPYEGPLENFDMTVTNGATARRKDDLCSIATPF  498



>ref|XP_006341698.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/482 (57%), Positives = 347/482 (72%), Gaps = 5/482 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W +SK   K KLPPGPW+LP IG+LH L+ G LPH + R+LS+ YGPI HL+LGE+S +V
Sbjct  24    WKQSKTLNK-KLPPGPWRLPFIGNLHQLMNGRLPHHTFRDLSQNYGPIFHLRLGEVSHVV  82

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP +A+ I K  DL FA+RP++M  +I+ Y  +D+   PYGDYWR MRK+C+LELLS 
Sbjct  83    VSSPDIAKEIMKIQDLNFATRPQLMVGEIIMYNYSDIGTCPYGDYWRSMRKVCILELLST  142

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             KMVKSF S RQ E+S+L+SSI  +S      NL++K+ WFT S+  + AFG++ +  Q K
Sbjct  143   KMVKSFDSIRQAEMSSLISSI--NSMPDSLINLSDKIFWFTGSVTCRSAFGKIIN-GQDK  199

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I L+K +  LAG  +L DLFPS+KW+H   G+K K+LK+H E D I + II +H++N  
Sbjct  200   LIMLIKDITLLAGATELADLFPSRKWLHQIYGLKSKILKVHKEADVILENIINEHQKNRA  259

Query  867   -ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
                  NS    ED+VDVLLRV E GEL  PIT +NIKAVI DMF  G ETS+  IIWA++
Sbjct  260   NGKKGNSEYGGEDLVDVLLRVMESGELGTPITNNNIKAVIFDMFVAGAETSSAIIIWALA  319

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             EMI+ PS+MAKA+ EVR+ LKG   F+D DLE L YLKLVIKETLRLHPP PL+ PRE  
Sbjct  320   EMIRNPSIMAKAKFEVREVLKGKTIFEDTDLEELKYLKLVIKETLRLHPPFPLLLPRECR  379

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             EE +IGEY IP KTRV+INAWA+  +PE W +PE F+PERF+NSS+DF GNH+EFIPFGA
Sbjct  380   EETRIGEYTIPIKTRVLINAWAIGRDPEYWHNPESFIPERFDNSSIDFRGNHFEFIPFGA  439

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRRMCPG  F   ++   LA LLYHF+W  P     ++ DMTE  G+ A +K DLCLIA 
Sbjct  440   GRRMCPGWLFGLMNVEHPLAQLLYHFDWRTPYEGPLENFDMTETDGITAIRKDDLCLIAT  499

Query  1584  PF  1589
             PF
Sbjct  500   PF  501



>ref|XP_009769208.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/479 (56%), Positives = 357/479 (75%), Gaps = 7/479 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K+  +  ++LPPGPWKLP+IGS+ HL+GG LPH  LR+L++KYGPIMHLQLGE+S +VI+
Sbjct  23    KNSNSQTKRLPPGPWKLPIIGSMLHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIT  81

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP++A+ + KTHDL FASRP ++A  IVFY  TD+AFSPYG+YWRQMRKIC+LELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKN  141

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             VKSF S RQ+E+  ++   R  S  G P N+T++ + FTSS+  + AFG+   E Q +F 
Sbjct  142   VKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRFALFTSSMTCRSAFGQEYKE-QDEFA  198

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
              L+K+V +L  GFD+ D+FPS K++H  +GMK K++  H+ELD+I D II +HK+     
Sbjct  199   RLVKKVSNLMEGFDVADIFPSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHKK---VA  255

Query  873   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
              TN     E I+DVLLR+ + G LQFPIT DNIKA+I DMF+ GTETSATTI WAM EM+
Sbjct  256   KTNCESGSEGIIDVLLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSATTINWAMVEMM  315

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             K PSV AK QAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PRE  EE 
Sbjct  316   KNPSVFAKTQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREET  375

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
              +  Y IP KT+V++N WA+  +P+ W+D E F PERFEN+S+D+ GN++E++PFG+GRR
Sbjct  376   DLNGYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERFENNSMDYTGNNFEYLPFGSGRR  435

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             +CPGISF   ++   LA LLYHF+W+LP  ++P +LD+TEA G   ++K DL LIA P+
Sbjct  436   ICPGISFGLANVYFPLAQLLYHFDWKLPTEINPSELDLTEAAGAACARKNDLHLIATPY  494



>ref|XP_009776868.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/479 (56%), Positives = 357/479 (75%), Gaps = 7/479 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K+  +  ++LPPGPWKLP+IGS+ HL+GG LPH  LR+L++KYGPIMHLQLGE+S +VIS
Sbjct  23    KNSNSQTKRLPPGPWKLPIIGSMLHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIS  81

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP++A+ + KTHDL FASRP ++A  IVFY  TD+AFSPYG+YWRQMRKIC+LELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKN  141

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             VKSF S RQ+E+  ++   R  S  G P N+T++ + FTSS+  + AFG+   E Q +F 
Sbjct  142   VKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRFALFTSSMTCRSAFGQEYKE-QDEFA  198

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
              L+K+V +L  GFD+ D+FPS K++H  +GMK K++  H+ELD+I D II +HK+     
Sbjct  199   RLVKKVSNLMEGFDVADIFPSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHKK---VA  255

Query  873   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
              TN     E I+DVLLR+ + G LQFPIT DNIKA+I DMF+ GTETSATTI WAM EM+
Sbjct  256   KTNCESGSEGIIDVLLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSATTINWAMVEMM  315

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             K PSV AK QAEVR+ L+G +TF + D++   YLK+VIKET RLHPPLPL+ PRE  EE 
Sbjct  316   KNPSVFAKTQAEVRKILRGKETFGEIDVDEFKYLKMVIKETFRLHPPLPLLLPRECREET  375

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
              +  Y IP KT+V++N WA+  +P+ W+D E F PERFEN+S+D+ GN++E++PFG+GRR
Sbjct  376   DLNGYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERFENNSMDYTGNNFEYLPFGSGRR  435

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             +CPGISF   ++   LA LLYHF+W+LP  ++P +LD+TEA G   ++K DL LIA P+
Sbjct  436   ICPGISFGLANVYFPLAQLLYHFDWKLPTEINPSELDLTEAAGAACARKNDLHLIATPY  494



>ref|XP_006352953.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/479 (57%), Positives = 353/479 (74%), Gaps = 5/479 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K K   ++ LPPGPWKLPLIGSLHHL+G +LPH  LRNLS+KYGP+MHL+LGEI  +++S
Sbjct  26    KWKEMNQRLLPPGPWKLPLIGSLHHLIG-ALPHHVLRNLSKKYGPLMHLKLGEIDAVIVS  84

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP LA+ + K HDL FA+RPK++A DIVFY+  D+AF+ YGDYW+QMRKIC  ELLS K+
Sbjct  85    SPHLAKQVLKVHDLSFAARPKLVASDIVFYRQNDIAFAEYGDYWKQMRKICTSELLSSKI  144

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             VKSF   RQ+E+ NLV+SI   S      N++EKV   TSS+I + AFG+V  +D+   +
Sbjct  145   VKSFSLIRQDEVHNLVASI--CSMPNVVVNMSEKVLQLTSSVICRSAFGKVW-DDRDNLL  201

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-A  869
              +++++L+L  GFD+ DLFPS K +H  SG + +L+ +H++LD I + II DHK++    
Sbjct  202   MIMRELLALLAGFDVVDLFPSWKLLHKISGKRNRLMNMHYKLDVILENIINDHKQSKANG  261

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                N+  + E+++DVLLRV E  ELQFP+T DNIKAVI D+F  GTETSATTI W +SE+
Sbjct  262   GKGNNEFEGENLIDVLLRVMENDELQFPMTNDNIKAVILDIFFRGTETSATTIQWTLSEL  321

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             +K P+VMAK Q EVR+     K +DD  L+ L YLKLVIKETLRLHPP PL+ PRE  EE
Sbjct  322   MKNPNVMAKVQEEVRKTFDRKKVYDDNILKELKYLKLVIKETLRLHPPGPLLPPRECREE  381

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
               I  Y I  KT++I+N WA+  +PESW+DPE F+PERFENS VDF GNHY+FIPFGAG 
Sbjct  382   TTIEGYTISLKTKLIVNCWAMGRDPESWDDPENFMPERFENSCVDFKGNHYQFIPFGAGS  441

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RMCPG+ F   ++   LA LLYHF+W+LP G  P+DLDMTE +G+ A++K DL LIA P
Sbjct  442   RMCPGMHFGLANVVYPLAQLLYHFDWQLPYGQQPEDLDMTETLGLSATRKHDLRLIAIP  500



>ref|XP_009606204.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=527

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/481 (56%), Positives = 358/481 (74%), Gaps = 6/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K +LPPGPWKLP++GS+ HL+GG  PH  L +L++KYGP+MHLQLGE+S + 
Sbjct  48    WKNSHSQTK-RLPPGPWKLPVLGSMFHLLGGP-PHHVLGDLAKKYGPLMHLQLGEVSVVS  105

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRP ++A  IV Y  TD+ FSPYGDYWRQMRKIC+LELLS 
Sbjct  106   VTSPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSA  165

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+ +++   R SS  G P N+++++S FT+S+  + AFG+   E Q +
Sbjct  166   KNVRSFSSVRRDEVFHMIEYFRSSS--GKPVNVSKRISLFTTSMTCRSAFGQEYKE-QDE  222

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F  L+K+V SL  GFD+ D+FPS K++H  SGMK K++  HHELD I + II +HK+   
Sbjct  223   FARLVKKVSSLMEGFDVADIFPSLKFLHVLSGMKAKVMDAHHELDAILENIINEHKKIAT  282

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               + N  G  E ++DVLLR+ + G LQFPIT DNIKA+I DMF  GTETS+TTI WAM E
Sbjct  283   GKNNNELG-GEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFGAGTETSSTTIDWAMVE  341

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MIK PSV AKAQAEVR+A +  +TFD+ D+E L YLKLVIKET RLHPP PL+ PRES E
Sbjct  342   MIKNPSVFAKAQAEVREAFREKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRESRE  401

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT++++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+G
Sbjct  402   ETDINGYTIPFKTKLMVNVWAIGRDPKYWDDVESFKPERFEHNSMDFIGNNFEYLPFGSG  461

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RRMCPGISF   ++ L LA LLYHF+W+LP G++  DLDMTE+ GV  ++K DL L A P
Sbjct  462   RRMCPGISFGLANVYLPLAQLLYHFDWKLPTGINSSDLDMTESSGVTCARKSDLYLTATP  521

Query  1587  F  1589
             +
Sbjct  522   Y  522



>ref|XP_009625417.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase [Nicotiana tomentosiformis]
Length=504

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/481 (55%), Positives = 355/481 (74%), Gaps = 3/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K KLPPGPWK+P++GS+ H+VGG  PH  LR+L++KYGP+MHLQ GEIS +V
Sbjct  22    WKNSNSQTK-KLPPGPWKIPILGSMLHMVGGE-PHHVLRDLAKKYGPLMHLQFGEISAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++S ++A+ + KTHD+VFASRPKI+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ 
Sbjct  80    VTSREMAKEVLKTHDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  
Sbjct  140   KNVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDV  198

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F   +++V+ LA GFD+ D+FPS K++H  SGMK KLL  H ++D I + +I +HK+N  
Sbjct  199   FAKKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLA  258

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                TN +   ED++DVLLR+     LQFPIT DNIKA+I DMF+ GTETS+TT +WAM+E
Sbjct  259   TGKTNGALGGEDLIDVLLRLMNDTSLQFPITNDNIKAIIVDMFAAGTETSSTTTVWAMAE  318

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV  KAQAEVR+A K   TFD+ D E L YLKLVIKETLRLHPP PL+ PRE  E
Sbjct  319   MMKNPSVFTKAQAEVREAFKNKVTFDENDAEELKYLKLVIKETLRLHPPSPLLVPRECRE  378

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             +  I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG G
Sbjct  379   DTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGG  438

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPG+SF   ++ L LA LLYHF+W+LP G+ P+DLD+TE  G+  ++K D+ L A P
Sbjct  439   RRICPGMSFGLANLYLPLAQLLYHFDWKLPTGMKPRDLDLTELAGITIARKGDIYLKATP  498

Query  1587  F  1589
             +
Sbjct  499   Y  499



>ref|XP_009765039.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=501

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/481 (56%), Positives = 356/481 (74%), Gaps = 6/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K +LPPGPWKLPL+G++ HL+GG  PH  L +L++KYGP+MHLQLGE+S + 
Sbjct  22    WKNSNSHTK-RLPPGPWKLPLLGNMFHLLGGP-PHHVLGDLAKKYGPLMHLQLGEVSVVA  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRP ++A  IV Y  TD+ FSPYGDYWRQMRKIC+LELLS 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  ++   R SS  G P N+T+++S FTSS+  + AFG+   E Q +
Sbjct  140   KNVRSFSSVRRDEVFRMIEFFRSSS--GKPVNVTKRISVFTSSMTCRSAFGQEYKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F  L+K+V SL  GFD+ D+FPS K++H  SGMK K++  HHELD I + II +HK+   
Sbjct  197   FARLVKKVSSLMEGFDIADIFPSLKFLHVLSGMKAKVMDAHHELDAILEKIINEHKKIAT  256

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               + +  G  E ++DVLLR+ + G LQFPIT DNIKA+I DMF  GTETS+TTI WAM E
Sbjct  257   GKNNDELG-GEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFGAGTETSSTTIDWAMVE  315

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P+V AKAQAEVR+A +G +TFD+ D+E L YLKLVIKET RLHPP PL+ PRES E
Sbjct  316   MMKNPTVFAKAQAEVRKAFRGKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRESRE  375

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y I  KT++++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+G
Sbjct  376   ETDINGYTISLKTKLMVNVWAIGRDPKYWDDVESFKPERFEHNSMDFIGNNFEYLPFGSG  435

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RRMCPGISF   ++ L LA LLYHF+W+LP G++P DLDM E+ G   S+K DL L A P
Sbjct  436   RRMCPGISFGLANVYLPLAQLLYHFDWKLPTGINPCDLDMIESSGATCSRKSDLYLTATP  495

Query  1587  F  1589
             +
Sbjct  496   Y  496



>ref|XP_009611155.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/479 (54%), Positives = 359/479 (75%), Gaps = 7/479 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K+ ++  ++LPPGPWKLP++GS+ HL+GG  PH  LR+L++KYGP+MHLQLGE+S +V++
Sbjct  23    KNSSSQTKRLPPGPWKLPILGSMLHLLGGH-PHHVLRDLAKKYGPLMHLQLGEVSLVVVT  81

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP++A+ + KTHDL FASRP ++A  IV Y  TD+ FSPYG+YWRQMRKIC+LELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKN  141

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             VKSF S RQ+E+  ++   R  S  G P N+T++ + FTSS+  + AFG+   E + +F+
Sbjct  142   VKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRFALFTSSMTCRSAFGQEHKE-KDEFV  198

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
              L+K+V +   GFD+ D+FPS K++H  +G+K K++  HHELD+IF+ II + K+     
Sbjct  199   RLVKKVSNYMEGFDVADIFPSLKFLHVVTGLKAKVMDAHHELDEIFENIISERKK---VA  255

Query  873   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
              TN   + E IVDVLLR+ + G LQFPIT DNIKA++ DMF+ GTETS+TTI WAM EM+
Sbjct  256   KTNCESRGEGIVDVLLRLMKEGGLQFPITNDNIKAIVFDMFAAGTETSSTTINWAMVEMM  315

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             K+PSV AKAQAEVR+ L+G +TFD+ D+E   YLK+VIKET RLHPPLPL+ PRE  EE 
Sbjct  316   KKPSVFAKAQAEVRKILRGKETFDEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREET  375

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
              +  Y IP KT+V++N WA+  +P+ W+D E F PERFEN+ +D++GN++E++PFG GRR
Sbjct  376   DLNGYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERFENNPMDYIGNNFEYLPFGGGRR  435

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             +CPGISF   ++   LA +LYHF+W+LP G++P +LD+TEA G   ++K DL LIA P+
Sbjct  436   ICPGISFGLANVYFPLAQMLYHFDWKLPTGINPSELDLTEAAGAACARKNDLHLIATPY  494



>ref|XP_009794456.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/485 (57%), Positives = 363/485 (75%), Gaps = 13/485 (3%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W KSK     +LPPGPW+LP+IGS+HHL  G + HR LRNLS+K+GPIM+LQLGE+ T+V
Sbjct  23    WRKSK-----RLPPGPWRLPIIGSVHHLTSG-VSHRVLRNLSQKFGPIMYLQLGEVPTVV  76

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP +A+ I KTHDL FASRP+IM   I+ Y   D+AFSPYGDYWR MRK+  LELLS 
Sbjct  77    VSSPHMAKQILKTHDLAFASRPEIMMGKIICYDCKDIAFSPYGDYWRHMRKLSTLELLSA  136

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             KMVKSF   R++ELS+L+SSI   S    P NL EK+ WF ++   + AFG+VC +DQ +
Sbjct  137   KMVKSFSPIRRDELSSLLSSI--ESMGDLPINLVEKLLWFMNAATCRSAFGKVC-KDQKE  193

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I L+ +  SL+GGF+L DLFPSKK++H  SGM+ KL++  +++D + D II  H+EN  
Sbjct  194   LITLIHRAQSLSGGFELADLFPSKKFLHGISGMRSKLMEARNKIDVVLDNIINVHRENR-  252

Query  867   ANSTNSSGKD--EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
             AN    +G+   ED +DV  RV E GEL FP+  DNIKAVI DMF  G++TS++T+IWA+
Sbjct  253   ANGKCCNGESGAEDFIDVFQRVMESGELPFPLENDNIKAVILDMFVAGSDTSSSTVIWAL  312

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFD-DKDLENLTYLKLVIKETlrlhpplplihprE  1217
             +EMIK PSVMAKAQAEVR+A KG KT D D DLE L+YL LVIKETLRLHPP PL+ PRE
Sbjct  313   AEMIKNPSVMAKAQAEVREAFKGKKTCDEDTDLEKLSYLNLVIKETLRLHPPTPLLVPRE  372

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               EE +I  + IP K++V++N WA+  +PE+W +PE F+PERFENSS++F GNH++ +PF
Sbjct  373   CREETEIDGFTIPLKSKVLVNVWAIGRDPENWGNPECFIPERFENSSIEFTGNHFQLLPF  432

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRR+CPGI F    + L LA LL++F+W+LP+G++ +DLDMTEA G+ A ++KDL LI
Sbjct  433   GAGRRICPGIQFGMALVTLPLAHLLHNFDWKLPEGINARDLDMTEANGISARREKDLYLI  492

Query  1578  ARPFV  1592
             A P V
Sbjct  493   ATPCV  497



>ref|XP_009801864.1| PREDICTED: LOW QUALITY PROTEIN: 5-epiaristolochene 1,3-dihydroxylase-like 
[Nicotiana sylvestris]
Length=504

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 358/481 (74%), Gaps = 3/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWK+P++GS+ H++GG  PH  LR+L++KYGP+MHLQLGEIS +V
Sbjct  22    WKNSNSQSK-KLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++S  +A+ + KTHD+VFASRPKI+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ 
Sbjct  80    VTSRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  
Sbjct  140   KNVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDI  198

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F   +++V+ LA GFD+ D+FP+ K++H  SGMK KLL  H ++D I + +I +HK+N  
Sbjct  199   FAKKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLA  258

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             A  +N +   ED++DVLLR+     LQFPIT DNIKAV+ DMF+ GTETS+TT +WAM+E
Sbjct  259   AGKSNGALGGEDLIDVLLRLMNDTSLQFPITNDNIKAVVVDMFAAGTETSSTTTVWAMAE  318

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV  KAQAEVR+A +   +FD+ D+E L YLKLVIKETLRLHPP PL+ PRE  E
Sbjct  319   MMKNPSVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECRE  378

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             +  I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG G
Sbjct  379   DTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGG  438

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPG+SF   ++ L LA LLYHF+W+LP G+ P+DLD+TE  G+  ++K DL L A P
Sbjct  439   RRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIKPRDLDLTELSGITIARKGDLYLNATP  498

Query  1587  F  1589
             +
Sbjct  499   Y  499



>ref|XP_004249519.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=510

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/475 (57%), Positives = 359/475 (76%), Gaps = 6/475 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
             +KLPPGPWKLP+IGS+HHL +   LPH +L  L +K+GP+MHLQLGEISTIV+SS ++AR
Sbjct  34    KKLPPGPWKLPIIGSIHHLALEDGLPHHALTKLGKKHGPLMHLQLGEISTIVVSSMEMAR  93

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              + K HDL FASRPK+++LDI+ YKSTD+AF  YGDYWRQMRKICVLEL + K V+SF S
Sbjct  94    EVMKIHDLAFASRPKLVSLDIILYKSTDIAFCSYGDYWRQMRKICVLELFTAKNVRSFSS  153

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R+EE SNLV  IR SS  G P N+T+++SW+ SS+  K AFG +  +DQ KFI +++++
Sbjct  154   IRREEGSNLVQFIR-SSTRGEPINVTKQISWYESSITCKAAFGELL-KDQEKFIGIVREL  211

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
               L GGF + ++FPS K +H  SG++ ++LK+H  +D I + II DHK N +A+    +G
Sbjct  212   AELTGGFSVANIFPSIKILHVLSGVRSRILKVHENVDAIVEDIISDHKRN-IASGKRGNG  270

Query  891   K--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1064
                 ED+VDVLLR+ E G L+ PIT DNIKA++ D+FS GTETS TT IWAM+EMI+ PS
Sbjct  271   AFGGEDLVDVLLRLMESGALKIPITNDNIKAIMIDLFSAGTETSTTTTIWAMTEMIRNPS  330

Query  1065  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1244
             V+AKAQ EVR+A KG +T ++  +E L YLK V+KET RLHPPLPL+ PRE  EE  I  
Sbjct  331   VLAKAQTEVREAFKGKETSNEDVIERLKYLKQVVKETFRLHPPLPLLIPRECREETNING  390

Query  1245  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1424
             Y IP KTRV++N +++  +P+ WED E F+PERFE SSVDFMGN++E++PFGAGRR+CPG
Sbjct  391   YTIPLKTRVVVNVYSMGRDPKYWEDAESFIPERFEGSSVDFMGNNFEYLPFGAGRRICPG  450

Query  1425  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             I+F   ++ L LA LLYHF+W+LP GV  +D+DM E  G+ A++K +L LIA P+
Sbjct  451   ITFGLINVYLPLANLLYHFDWKLPHGVKLEDVDMNEFSGITAARKSELYLIATPY  505



>sp|P93530.1|C71D6_SOLCH RecName: Full=Cytochrome P450 71D6 [Solanum chacoense]
 gb|AAB61964.1| putative cytochrome P450 [Solanum chacoense]
Length=501

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/483 (54%), Positives = 354/483 (73%), Gaps = 4/483 (1%)
 Frame = +3

Query  147   WAK-SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W K SK +  +KLPPGPWKLP IGS+HHL GG  PHR LR+L++KYGP+MHLQLGE+S +
Sbjct  19    WKKYSKNSQTKKLPPGPWKLPFIGSMHHLAGGR-PHRVLRDLAKKYGPLMHLQLGEVSAV  77

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V++SP +A+ + KTHD+ FASRPK++A+DI+ Y   D+AFSPYG+YW+QMRKICV E+LS
Sbjct  78    VVTSPDMAKEVLKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVTEVLS  137

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF S R +E+  L+ SI+ SS +G   N  E+V WFTSS+  + AFG++  E Q 
Sbjct  138   AKSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNFKERVIWFTSSMTCRSAFGQLPKE-QD  196

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
              FI L+++V+ LA GFD+ D+FPS K++H     K KLL +H ++D I + +I +HK+N 
Sbjct  197   MFIKLIREVIRLAEGFDVADIFPSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNF  256

Query  864   LANSTNSSG-KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
                  +      E+++DVLL++     LQFPI  DNIKA+I DMF+ GTETS+TT +WAM
Sbjct  257   ATRKNDDHALGGENLIDVLLKLMNDKSLQFPINNDNIKAIIIDMFAAGTETSSTTTVWAM  316

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
              EM+K P V+AKAQAEVR+A +   TFD+ D+E+L YLKLVIKET+RLH P+PL+ PRE 
Sbjct  317   VEMLKNPRVLAKAQAEVREAFRNKVTFDENDVEDLKYLKLVIKETMRLHAPIPLLVPREC  376

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              +E +I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  S+DF+GN++E++PFG
Sbjct  377   RKETEINGYTIPVKTKVMVNVWALGRDPKYWDDVECFKPERFEQCSIDFIGNNFEYLPFG  436

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
              GRR+CPG SF   +  L LA LL HF+W+LP G+ PKDLD+TE  G+ A+ K DL LIA
Sbjct  437   GGRRICPGTSFGLANDYLPLAQLLCHFDWKLPTGMEPKDLDLTELAGMSAASKDDLYLIA  496

Query  1581  RPF  1589
              P+
Sbjct  497   TPY  499



>emb|CDP18841.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/481 (56%), Positives = 355/481 (74%), Gaps = 6/481 (1%)
 Frame = +3

Query  147   WAKSKAA-AKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W KSK   A QKLPPGP K+P IG+LH+L+G SLPH +L  L++K+G +MHLQLGE+S +
Sbjct  24    WMKSKTVNATQKLPPGPKKIPFIGNLHNLLG-SLPHHALAKLAKKHGDLMHLQLGEVSAV  82

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SSP  A+ I KTHD VF  RP+I+   I+ Y S+ +AFS YGDYWRQMRKIC +E+LS
Sbjct  83    VVSSPHSAKEILKTHDHVFVDRPEILVGKIICYDSSSIAFSQYGDYWRQMRKICAMEVLS  142

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF S RQ+E+ +L+SSIR S+  G P NLTE++S FTSS+I + A G+V  E + 
Sbjct  143   AKSVRSFGSIRQDEVLHLISSIRGSTIGGQPINLTEEISSFTSSMICRAACGKVFRE-RI  201

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
               I L+K+VLS   GFD+ DLFPSKK +H+ S MKP L KLHH++D I + +I +H EN 
Sbjct  202   TLIELMKEVLSRTSGFDISDLFPSKKILHHLSSMKPTLQKLHHKIDVILESVINEHIEN-  260

Query  864   LANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
             LA S   +G+   ED++DVLLR+KE G+LQFPIT   IKA++ DMF+ GTETSAT + WA
Sbjct  261   LARSKTVNGEFGQEDLIDVLLRIKESGDLQFPITNKTIKAIMFDMFTGGTETSATLVEWA  320

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             MSEMI+ P+VM+KAQ E+R+A  G +  ++ D+E L YLKLVIKETLRLHPPLPL+ P E
Sbjct  321   MSEMIRNPNVMSKAQNEIRKAFLGKEKIEEMDIEGLRYLKLVIKETLRLHPPLPLLVPME  380

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               ++ +I  YIIP KTRV +NAWA+  +P+ W+DPE F PERF N+ VDF G  +E++PF
Sbjct  381   CRKQCEIDGYIIPSKTRVFVNAWAIQRDPKYWDDPESFKPERFHNNPVDFTGTQFEYLPF  440

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             G GRR+CPGISF   ++   LA LLY+F+W+LP G++   LDMTE  G+ A +K  LCL+
Sbjct  441   GGGRRICPGISFGLANVEFPLAQLLYNFDWKLPGGINSNGLDMTETCGITAPRKNKLCLV  500

Query  1578  A  1580
             A
Sbjct  501   A  501



>sp|Q94FM7.2|C71DK_TOBAC RecName: Full=5-epiaristolochene 1,3-dihydroxylase; Short=NtEAH; 
AltName: Full=Cytochrome P450 71D20 [Nicotiana tabacum]
 gb|AAK62342.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=504

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 357/481 (74%), Gaps = 3/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWK+P++GS+ H++GG  PH  LR+L++KYGP+MHLQLGEIS +V
Sbjct  22    WKNSNSQSK-KLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++S  +A+ + KTHD+VFASRPKI+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ 
Sbjct  80    VTSRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  
Sbjct  140   KNVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDI  198

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F   +++V+ LA GFD+ D+FP+ K++H  SGMK KLL  H ++D I + +I +HK+N  
Sbjct  199   FAKKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLA  258

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             A  +N +   ED++DVLLR+     LQFPIT DNIKAVI DMF+ GTETS+TT +WAM+E
Sbjct  259   AGKSNGALGGEDLIDVLLRLMNDTSLQFPITNDNIKAVIVDMFAAGTETSSTTTVWAMAE  318

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV  KAQAEVR+A +   +FD+ D+E L YLKLVIKETLRLHPP PL+ PRE  E
Sbjct  319   MMKNPSVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECRE  378

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             +  I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG G
Sbjct  379   DTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGG  438

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPG+SF   ++ L LA LLYHF+W+LP G+ P+DLD+TE  G+  ++K  L L A P
Sbjct  439   RRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIMPRDLDLTELSGITIARKGGLYLNATP  498

Query  1587  F  1589
             +
Sbjct  499   Y  499



>ref|XP_004249812.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
 ref|XP_010312277.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=511

 Score =   531 bits (1368),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 275/485 (57%), Positives = 359/485 (74%), Gaps = 8/485 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W KS+   K KLPPGPWKLP IGS+HHL + G LPH +L NL +KYGP MHLQ+GEIST+
Sbjct  26    WKKSRNLNK-KLPPGPWKLPFIGSVHHLALEGGLPHHALTNLGKKYGPFMHLQVGEISTV  84

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SS  +AR + KTHDL FASR KI+A DI+ YKSTD+ F  YGDYWRQMRK+CVLELL+
Sbjct  85    VVSSMDMAREVLKTHDLAFASRHKILAFDIILYKSTDIGFCSYGDYWRQMRKVCVLELLT  144

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF S R++E S LV  IR SS  G P N+TE++SW+ SS+  K AFG +  +DQ 
Sbjct  145   TKNVRSFSSIRRDEASRLVQFIR-SSTCGEPINVTERISWYQSSITCKTAFGELL-KDQE  202

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             KF+ +L++   +AGGF   D+FPS K +   SG+K ++LK H  +D I + +I +HK+N 
Sbjct  203   KFLGILREFTEVAGGFSTADIFPSIKILQVLSGLKSRILKFHKNVDVIVEDVINEHKKN-  261

Query  864   LANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
             LA+    +G    E++VDVLLR+KE GEL+ PIT DNIKA+I D+F  GTET+ TT IWA
Sbjct  262   LASGKKGNGAFGGENLVDVLLRLKESGELKIPITNDNIKAIIIDLFIAGTETTTTTTIWA  321

Query  1038  MSEMIKRPSVMAKAQAEVRQALKG-NKTFDDKDLENLTYLKLVIKETlrlhpplplihpr  1214
             M+EMI+ PSV+AKAQ EVR+A KG  + F++  +E L YLK V+KETLRLHPPLPL+ PR
Sbjct  322   MTEMIRNPSVLAKAQTEVREAFKGKEEIFNEDVIEELKYLKQVVKETLRLHPPLPLLIPR  381

Query  1215  ESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIP  1394
             E  EE  I  Y IP KTRV++N +++  +P+ WED E F+PERFE SSVDFMGN++E++P
Sbjct  382   ECREETNINGYTIPLKTRVVVNVYSMGRDPKYWEDAESFIPERFEGSSVDFMGNNFEYLP  441

Query  1395  FGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCL  1574
             FG+GRRMCP +SF   ++ L LA LLYHF+W+LPD V  +D+DM E  G+ A++K +L L
Sbjct  442   FGSGRRMCPALSFGLINVYLPLANLLYHFDWKLPDCVKLEDMDMNEFSGIAAARKSELYL  501

Query  1575  IARPF  1589
             IA P+
Sbjct  502   IATPY  506



>emb|CDP07872.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   530 bits (1365),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 267/478 (56%), Positives = 359/478 (75%), Gaps = 6/478 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             +SK A  QKLPP PWKLP+IG +HHL  GS PH +LR L++KYGP+MH+QLGEIS+IV++
Sbjct  26    RSKTA--QKLPPSPWKLPIIGHMHHL-SGSPPHHALRKLAQKYGPLMHIQLGEISSIVVT  82

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP+LA+ I KTHDL FA+R + +A  I+ Y  +D+A  PYGDYWRQMRKIC LELLS K 
Sbjct  83    SPRLAKEIMKTHDLAFANRGETLAGKIMLYNCSDIACCPYGDYWRQMRKICTLELLSSKS  142

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V+S  S RQEE  +LVSSI+  +  G   ++TEK+S + S+++ + AFG+V ++D   F 
Sbjct  143   VRSCGSIRQEEALHLVSSIKALANAGKSIDVTEKMSSYASAVLYRAAFGKVSNDDHFAFF  202

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
              L+K+  S+A  FD+ DL PS K +H    +K K+L + ++LDK+ D II  H +N LA 
Sbjct  203   QLIKESSSIASAFDVSDLLPSFKILHPFLSVKNKMLNIRYKLDKVLDKIIDQHMDN-LAR  261

Query  873   STNSSG--KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             +  ++G   +EDI+DVLLRVKE GELQ P+T+DNIKAV++D+F+ GTETS+TT+ WAMSE
Sbjct  262   TKIATGASDNEDIIDVLLRVKESGELQIPLTKDNIKAVLSDVFAGGTETSSTTVEWAMSE  321

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MI+ P VMAKAQ+E+R A +G  T ++ D++ L YL+ VIKETLRLHPP+PL+ PRE  E
Sbjct  322   MIRNPGVMAKAQSEIRNAFRGKNTIEETDIQRLQYLRSVIKETLRLHPPIPLLIPRECRE  381

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E +I  YIIP KTRV++NAWA+  +PE W+D E F PERFENSS+DF G+H+E++PFGAG
Sbjct  382   ECEIDGYIIPVKTRVLVNAWAIGRDPEYWDDAESFKPERFENSSIDFNGSHFEYLPFGAG  441

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             RR+CPGI+F   ++ L LA LLYHF+W LP+G+   DLDMTE V + AS+  +L L+A
Sbjct  442   RRICPGIAFGLANVELPLALLLYHFDWRLPNGLDSNDLDMTETVVITASRANNLRLLA  499



>ref|XP_009803037.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=512

 Score =   529 bits (1363),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 265/484 (55%), Positives = 357/484 (74%), Gaps = 14/484 (3%)
 Frame = +3

Query  147   WAKSKAAA-KQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W  S+ ++ KQ+LPPGPW+LPLIGSLHHL+G   PHR  R+L+RKYGP+M+L+LGE+ T+
Sbjct  29    WRNSETSSQKQRLPPGPWRLPLIGSLHHLIGAH-PHRIFRDLARKYGPVMYLELGEVPTV  87

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             +ISSP  A+   KTHDL F++RP+  +  IV Y + D+AF+ YGDYW+QMRKIC++ELLS
Sbjct  88    IISSPSAAKETLKTHDLAFSNRPQFTSTYIVMYNNKDIAFAEYGDYWKQMRKICIMELLS  147

Query  504   MKMVKSFCSFRQEELSNL---VSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSE  674
              +MVKSF S R++ELS+L   V S++ +SE     N+TEK+  F SS+  ++ FG++ S+
Sbjct  148   ARMVKSFSSIRKDELSSLLSSVQSVKGTSEV----NMTEKIVRFASSVTCRLVFGKL-SK  202

Query  675   DQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDH-  851
             D+   I L+K+ L LAGG D+GDLFPS K ++  SG K +L+K+H E+D + D I+ +H 
Sbjct  203   DRELLIELMKKTLLLAGG-DVGDLFPSWKLLYKMSGAKSRLVKMHQEVDSVLDNIVNEHI  261

Query  852   KENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  1031
             +     N  N     ED+VDV LR++E  +LQFPIT D+IKAVI DMF+ GTETS+T II
Sbjct  262   RSRADGNKGNGEYGGEDLVDVFLRIQENDQLQFPITNDHIKAVILDMFTAGTETSSTAII  321

Query  1032  WAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihp  1211
             WAMSE++K P+VMAKAQ+EVRQA KG  +FD++DL+NL YL LV+KETLRLH P  L   
Sbjct  322   WAMSELMKNPNVMAKAQSEVRQAFKGKSSFDEEDLDNLPYLMLVVKETLRLHAPSILHR-  380

Query  1212  rESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFI  1391
              E  E+  I  Y IP K  V++N WA+  +PE W +PE F+PERFENS +D++GNH+EFI
Sbjct  381   -ECREQTCIDGYTIPSKATVLVNTWAIGRDPEVWNNPESFIPERFENSFIDYLGNHFEFI  439

Query  1392  PFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLC  1571
             PFG+G+R+CPG+ F   +    LA LLYHFNWELP G SPKDLDM+E  G+ A+K+KDL 
Sbjct  440   PFGSGKRICPGMQFGLANFRYPLARLLYHFNWELPYGTSPKDLDMSEKPGMSAAKEKDLY  499

Query  1572  LIAR  1583
             +IA+
Sbjct  500   VIAK  503



>ref|XP_009771988.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Nicotiana 
sylvestris]
Length=504

 Score =   528 bits (1361),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 261/480 (54%), Positives = 353/480 (74%), Gaps = 2/480 (0%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
              K+  +  ++LPPGPWK+P++GS+ H++GG  PH  LR+L++KYGPIMHLQ GEIS +V+
Sbjct  22    CKNSNSQTKQLPPGPWKIPILGSMLHMLGGE-PHHILRDLAKKYGPIMHLQFGEISAVVV  80

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             +S ++A+ + KTHD+VFASRPKI+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K
Sbjct  81    TSREMAKEVLKTHDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAK  140

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  F
Sbjct  141   NVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDVF  199

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
                +++V+ LA GFD+ D+FPS K++H  SGMK KLL  H ++D I + +I +HK+N   
Sbjct  200   AKKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAT  259

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
               TN +   ED++DVLLR+     LQFPIT D IKAVI DMF+ GTETS+TT +WAM+EM
Sbjct  260   GKTNGALGGEDLIDVLLRLMNDTSLQFPITNDKIKAVIVDMFAAGTETSSTTTVWAMAEM  319

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             +K P+V  KAQAEVR+  K   TFD+ D E L YLKLVIKETLRLHPP PL+ PRE  E+
Sbjct  320   MKNPNVFNKAQAEVRETFKDKVTFDEIDAEELEYLKLVIKETLRLHPPSPLLVPRECRED  379

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
               I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG GR
Sbjct  380   TDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGGR  439

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R+CPG+SF   ++ L LA LLYHF+W+LP G+ P DLD+TE  G+  ++K DL L+A P+
Sbjct  440   RICPGMSFGLANLYLPLAQLLYHFDWKLPSGMMPGDLDLTELAGITIARKGDLYLMATPY  499



>gb|ABC69421.1| CYP71D20v2 [Nicotiana tabacum]
Length=504

 Score =   528 bits (1361),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 262/481 (54%), Positives = 357/481 (74%), Gaps = 3/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K KLPPGPWK+P++GS+ H++GG  PH  LR+L++K GP+MHLQLGEIS +V
Sbjct  22    WKNSNSQSK-KLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKDGPLMHLQLGEISAVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++S  +A+ + KTHD+VFASRPKI+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ 
Sbjct  80    VTSRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  
Sbjct  140   KNVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDI  198

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F   +++V+ LA GFD+ D+FP+ K++H  SGMK KLL  H ++D I + +I +HK+N  
Sbjct  199   FAKKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLA  258

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             A  +N +   ED++DVLLR+     LQFPIT DNIKAV+ DMF+ GTETS+TT +WAM+E
Sbjct  259   AGKSNGALGGEDLIDVLLRLMNDTSLQFPITNDNIKAVVVDMFAAGTETSSTTTVWAMAE  318

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV AKAQAEVR+A +   +FD+ D+E L YLKLVIKETLRLHPP PL+ PRE  E
Sbjct  319   MMKNPSVFAKAQAEVREAFRDKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECRE  378

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             +  I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVD  GN++EF+PFG G
Sbjct  379   DTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDIFGNNFEFLPFGGG  438

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPG+SF   ++ L LA LLYHF+W+LP G+ P+DLD+TE  G+  ++K DL L A P
Sbjct  439   RRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIKPRDLDLTELSGITIARKGDLYLNATP  498

Query  1587  F  1589
             +
Sbjct  499   Y  499



>ref|XP_009587552.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   528 bits (1360),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 258/481 (54%), Positives = 353/481 (73%), Gaps = 8/481 (2%)
 Frame = +3

Query  147   WAKSKAAA-KQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W KS+ ++ KQ+LPPGPW+LPLIGSLHHL+G   PHR  R+L+RKYGP+M+L+LGE+ T+
Sbjct  29    WRKSETSSQKQRLPPGPWRLPLIGSLHHLIGAH-PHRIFRDLARKYGPVMYLELGEVPTV  87

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             +ISSP  A+   KTHDL FA+RP+  +  IV Y + D+AFS YGDYW+QMRKIC++ELLS
Sbjct  88    IISSPSAAKETLKTHDLAFANRPQFTSTYIVMYNNKDIAFSEYGDYWKQMRKICIMELLS  147

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              +MVKSF S R++E+SNL+SS+     T    N+TEK+  +   +  ++ FG++  +D+ 
Sbjct  148   ARMVKSFSSIRKDEISNLLSSVHSVKGTS-EVNMTEKIVRYACFVTCRLVFGKL-GKDRE  205

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
               I L+K++L LAGG D+ DLFPS K ++  +G K +L+K+H  +D + + I+ +H  + 
Sbjct  206   VLIDLMKKMLLLAGG-DVCDLFPSWKLLYKMTGAKSRLVKMHQVVDSVLENIVNEHIRSR  264

Query  864   LA-NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
              A N  N     ED+VDV LR++E  +LQFPIT D+IKAVI DMF+ GTETS+T I+WA+
Sbjct  265   AAGNKGNGEYGGEDLVDVFLRIQENDQLQFPITNDHIKAVIFDMFTAGTETSSTAIVWAL  324

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             SE++K P+VMAKAQ+EVRQA KG  +FD++DL+NL YL LV+KETLRLH P  L    + 
Sbjct  325   SELMKNPNVMAKAQSEVRQAFKGKSSFDEEDLDNLPYLMLVVKETLRLHAPGILHR--QC  382

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              E+  I  Y IP +  V++N WA+  +PE W DPE F+PERFENSS+D+MGNH+EFIPFG
Sbjct  383   REQTCIDGYTIPSRATVLVNTWAIGRDPEVWHDPESFIPERFENSSIDYMGNHFEFIPFG  442

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             +G+R+CPG+ F   +    LA LLYHFNWELP G SPKDLDM++  G+  +K+KDL LIA
Sbjct  443   SGKRICPGMQFGLANFRYPLARLLYHFNWELPYGTSPKDLDMSQIPGMSVAKEKDLYLIA  502

Query  1581  R  1583
             +
Sbjct  503   K  503



>gb|KHN42275.1| Cytochrome P450 71D8 [Glycine soja]
Length=511

 Score =   528 bits (1359),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 264/473 (56%), Positives = 346/473 (73%), Gaps = 7/473 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLVG-GSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
              KLPPGPWKLPLIG+LH L G G+LPH +L+NLSRKYGP+MHLQLGEIS +V+SS  +A+
Sbjct  35    HKLPPGPWKLPLIGNLHQLAGAGTLPHHTLQNLSRKYGPLMHLQLGEISAVVVSSSDMAK  94

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              I KTHDL F  RP+++   I+ Y STD+AF+PYGDYWRQMRKIC LELLS K V+SF  
Sbjct  95    EIMKTHDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSF  154

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R+EE++ L+ SI+L +  G P N+++ V +  S+LI++ AFG+  SE + K +ALLK+ 
Sbjct  155   IREEEVAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKK-SEYEDKLLALLKKA  213

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
             + L GGFDL DLFPS K IH  + MK KL  +  ELDKI + II  H+ NH         
Sbjct  214   VELTGGFDLADLFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQSNH-----GKGE  268

Query  891   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
              +E++VDVLLRV++ G L+  +T +NIKAVI D+F  GT+TSAT + WAMSE++K P VM
Sbjct  269   AEENLVDVLLRVQKSGSLEIQVTINNIKAVIWDIFGAGTDTSATVLEWAMSELMKNPRVM  328

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
              KAQAE+R+A +G KT  + D+  L+YLK VIKET+RLHPP+PL+ PRE  E  KIG Y 
Sbjct  329   KKAQAEIREAFRGKKTIRESDVYELSYLKSVIKETMRLHPPVPLLLPRECREPCKIGGYE  388

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP KT+VI+NAWAL  +P+ W D E+F+PERF+ +S DF G+++E+IPFGAGRRMCPGI 
Sbjct  389   IPIKTKVIVNAWALGRDPKHWYDAEKFIPERFDGTSNDFKGSNFEYIPFGAGRRMCPGIL  448

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
                 ++ L L  LLYHF+WELP+G+ P+DLDMTE  G    +K +L L+  P+
Sbjct  449   LGIANVELPLVALLYHFDWELPNGMKPEDLDMTEGFGAAVGRKNNLYLMPSPY  501



>ref|XP_003529672.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=522

 Score =   528 bits (1359),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 264/473 (56%), Positives = 346/473 (73%), Gaps = 7/473 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLVG-GSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
              KLPPGPWKLPLIG+LH L G G+LPH +L+NLSRKYGP+MHLQLGEIS +V+SS  +A+
Sbjct  46    HKLPPGPWKLPLIGNLHQLAGAGTLPHHTLQNLSRKYGPLMHLQLGEISAVVVSSSDMAK  105

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              I KTHDL F  RP+++   I+ Y STD+AF+PYGDYWRQMRKIC LELLS K V+SF  
Sbjct  106   EIMKTHDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSF  165

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R+EE++ L+ SI+L +  G P N+++ V +  S+LI++ AFG+  SE + K +ALLK+ 
Sbjct  166   IREEEVAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKK-SEYEDKLLALLKKA  224

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
             + L GGFDL DLFPS K IH  + MK KL  +  ELDKI + II  H+ NH         
Sbjct  225   VELTGGFDLADLFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQSNH-----GKGE  279

Query  891   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
              +E++VDVLLRV++ G L+  +T +NIKAVI D+F  GT+TSAT + WAMSE++K P VM
Sbjct  280   AEENLVDVLLRVQKSGSLEIQVTINNIKAVIWDIFGAGTDTSATVLEWAMSELMKNPRVM  339

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
              KAQAE+R+A +G KT  + D+  L+YLK VIKET+RLHPP+PL+ PRE  E  KIG Y 
Sbjct  340   KKAQAEIREAFRGKKTIRESDVYELSYLKSVIKETMRLHPPVPLLLPRECREPCKIGGYE  399

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP KT+VI+NAWAL  +P+ W D E+F+PERF+ +S DF G+++E+IPFGAGRRMCPGI 
Sbjct  400   IPIKTKVIVNAWALGRDPKHWYDAEKFIPERFDGTSNDFKGSNFEYIPFGAGRRMCPGIL  459

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
                 ++ L L  LLYHF+WELP+G+ P+DLDMTE  G    +K +L L+  P+
Sbjct  460   LGIANVELPLVALLYHFDWELPNGMKPEDLDMTEGFGAAVGRKNNLYLMPSPY  512



>ref|XP_009794009.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   525 bits (1353),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 262/484 (54%), Positives = 358/484 (74%), Gaps = 16/484 (3%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K +LPPGPWKLPLIGS+ H++GG LPH  LRNL++K+GP+MHLQLGE+S +V
Sbjct  22    WKNSNSQTK-RLPPGPWKLPLIGSMFHILGG-LPHHVLRNLAKKFGPLMHLQLGEMSVVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRPK++A +IV Y  +D+AFSPYGDYWRQMRKIC++ELLS 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKLLAAEIVIYNCSDIAFSPYGDYWRQMRKICMIELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  ++   R  S TG   N+T+++  F SS+  + AFG+V  E Q +
Sbjct  140   KNVRSFSSIRRDEVHRMIEFFR--SSTGKQVNVTKRIYQFASSMTCRSAFGKVFKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE---  857
              I L+K+  +L  GFD+ D+FPS K++H  SGMK K++ +HH+LD I + II + K+   
Sbjct  197   LILLVKRNTALVEGFDVADIFPSLKFLHVLSGMKTKVMDVHHKLDAILENIINERKKIAT  256

Query  858   NHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
             + LA        DE ++DVLLR+ + G LQFPIT DNIKA+I D+FS GT+TS+ T+ WA
Sbjct  257   DELA--------DEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDIFSAGTDTSSATVDWA  308

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             M EM+K  S++AKAQAEVR+  +G +TFD+ ++E L YLKLVIKETLRLHPPLPL+ PRE
Sbjct  309   MVEMMKNQSILAKAQAEVRKTFRGKETFDENNVEELKYLKLVIKETLRLHPPLPLLLPRE  368

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               EE  I  Y IP KT+V+IN WA+  +P+ W+D E F PERFE++S+DF GN++E++PF
Sbjct  369   CREETNINGYTIPLKTKVMINVWAIGRDPKYWDDAEIFKPERFEHNSMDFTGNNFEYLPF  428

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             G+GRR CPGISF   ++   LA LLYHF+W+LP   +P DLD+TE+ G   S+K +L LI
Sbjct  429   GSGRRNCPGISFGLANVYFPLAQLLYHFDWKLPTETNPSDLDLTESAGATCSRKSNLYLI  488

Query  1578  ARPF  1589
             A P+
Sbjct  489   ATPY  492



>emb|CDP07879.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   524 bits (1350),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 261/481 (54%), Positives = 359/481 (75%), Gaps = 6/481 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             +SK A  QKLPP PWKLP+IG +HHL+G S PH +LR L++KYGP+M++QLG+++ IV++
Sbjct  26    RSKTA--QKLPPSPWKLPIIGHMHHLLG-SPPHHALRKLAQKYGPLMNIQLGQMTAIVVT  82

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP+LA+ I KTHDL FA R + ++  I+ Y  +D+A   YGDYWRQMRKIC LELLS K 
Sbjct  83    SPRLAKEIMKTHDLAFADRAEFLSGKIMCYDCSDIACCRYGDYWRQMRKICTLELLSAKS  142

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V+SF S RQ+E  +L+SSI++ +    P +LTEKVS +TSS++ + AFG+V  +D   F+
Sbjct  143   VRSFVSVRQDEALHLISSIKVLAGAREPIDLTEKVSSYTSSVVCRAAFGKVSKDDHAAFL  202

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
              L+K+ L +A  FD+ DL PS K +H    ++ KLLK+H + D+I + II  H +N  A 
Sbjct  203   QLMKEALPIASAFDISDLLPSFKILHPLLSVESKLLKMHDKEDEILEKIIDQHIDNQ-AR  261

Query  873   STNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                S+G+   ED++DVLLRVKE GELQFPIT++NIKAVI+D+F  GTETS++ + WAMSE
Sbjct  262   RNISTGEYGQEDLIDVLLRVKESGELQFPITKNNIKAVIHDVFGAGTETSSSIVDWAMSE  321

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MI+ P VMAKAQ+E+R A +G  T ++ D++ L YL+ VIKETLRLHPP+PL+ PRE  E
Sbjct  322   MIRNPGVMAKAQSEIRNAFRGKNTIEETDIQQLQYLRSVIKETLRLHPPIPLLIPRECRE  381

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E +I  YIIP KT++++NAWA+  +PE W+DPE F PERFE S +DF G+ +EF+PFGAG
Sbjct  382   ECEIDGYIIPVKTKILVNAWAIGRDPEYWDDPECFKPERFEESPIDFTGSRFEFLPFGAG  441

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++ ++LA LLYHF+W+LP+G+  KDLDM E VG+ AS+  +L L+A  
Sbjct  442   RRICPGISFGLANVEVALALLLYHFDWKLPNGLDTKDLDMKETVGITASRTNNLRLLATS  501

Query  1587  F  1589
             +
Sbjct  502   Y  502



>ref|XP_009612418.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   523 bits (1348),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 261/481 (54%), Positives = 355/481 (74%), Gaps = 10/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S    K +LPPGPWKLPL+GS+ H++GG LPH  L NL++KYGP+MHLQLGE+S +V
Sbjct  22    WKNSNNQTK-RLPPGPWKLPLLGSMFHILGG-LPHHVLTNLAKKYGPLMHLQLGEMSVVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRPK++A +IV Y  +D+AF PYGDYWRQMRKIC++ELLS 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKLLAAEIVIYNCSDIAFCPYGDYWRQMRKICMIELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K VKSF S R++E+  ++   R  S TG   N+T+++  F SS+  + AFG+V  E Q +
Sbjct  140   KNVKSFSSIRRDEVHGMIEFFR--SSTGKQVNITKRIYQFASSMTCRSAFGKVFKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I L+K+  +L  GFD+ D+FPS K++H  SGMK K++ +HH+LD I + II + K+   
Sbjct  197   LILLVKRNTALVEGFDVADIFPSLKFLHVLSGMKAKVMDVHHKLDVILENIINERKKI--  254

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               +T+  G DE ++DVLLR+ + G LQFPIT DNIKA+I D+FS GTETS+ T+ WAM E
Sbjct  255   --ATDELG-DEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDIFSAGTETSSATVDWAMVE  311

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K  S++AKAQAEVR+  +G +TFD+ D+E L YLKLVIKETLRLHPP PL+ PRE  E
Sbjct  312   MMKNQSILAKAQAEVRKTFRGKETFDENDVEELKYLKLVIKETLRLHPPFPLLLPRECRE  371

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT+V+IN WA+  +P+ W D E F PERFE++S+DF+GN++E++PFG+G
Sbjct  372   ETDINGYTIPFKTKVMINVWAIGRDPKYWNDAEIFKPERFEHNSMDFVGNNFEYLPFGSG  431

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR CPGISF   ++   LA LLYHF+W+LP G++  +LD TE+ G   S+K +L LIA P
Sbjct  432   RRNCPGISFGLANVYFPLAQLLYHFDWKLPTGINSSELDFTESAGATCSRKSNLYLIATP  491

Query  1587  F  1589
             +
Sbjct  492   Y  492



>ref|XP_004228511.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=493

 Score =   521 bits (1341),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 254/481 (53%), Positives = 348/481 (72%), Gaps = 11/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S    ++KLPPGPWKLPL+G++ HL+GG  PHR LR+L++KYG IMHLQLGE+S +V
Sbjct  23    WKNSNDQIRKKLPPGPWKLPLLGNIFHLLGGP-PHRVLRDLAKKYGSIMHLQLGEVSLVV  81

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP +A+ + KTHD+ FASRP ++A +IV Y  +D+ FSPYGDYWRQMRKIC++ELLS 
Sbjct  82    VTSPDMAKQVLKTHDIAFASRPMLIAAEIVCYNGSDIVFSPYGDYWRQMRKICIMELLSA  141

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K VKSF S RQ+E+  ++   R SS  G   N T ++  F SS+  + AFG+V  E Q +
Sbjct  142   KNVKSFSSIRQDEVLRMIEFFRSSS--GETVNATRRIFQFASSMTCRSAFGKVFKE-QDE  198

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I L+K+V  L  GFD+ D+FPS K++H   GMK K++ +HHELD I + II +HK    
Sbjct  199   LIQLVKKVSRLTEGFDVADIFPSLKFLHVLCGMKSKIMDVHHELDAILENIINEHK----  254

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 N     E +V  LLR+ + G LQFPIT DNIKA+I D+F+ GTETS+ TI W M E
Sbjct  255   ---NNGELGGEGLVSTLLRLMKEGGLQFPITNDNIKAIIFDIFAAGTETSSATIDWIMVE  311

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M++ P+V++KAQ EVR A KG +TFD+ D+E L YLKLV+KE+ RLHPP PL+ PRE  E
Sbjct  312   MMRNPNVLSKAQEEVRNAFKGKETFDENDVEELKYLKLVVKESFRLHPPFPLLLPRECRE  371

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E +I  Y IP KT+V++NAWA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+G
Sbjct  372   EVEINGYTIPLKTKVMVNAWAIGRDPKYWDDAESFKPERFEDNSMDFIGNNFEYLPFGSG  431

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR CPGISF   ++   LA LLYHF+W+LP+G++  +LD+TE+ G   ++K +L LIA P
Sbjct  432   RRNCPGISFGLANVYFPLAQLLYHFDWKLPNGINSSELDLTESAGSTCARKNNLYLIATP  491

Query  1587  F  1589
             +
Sbjct  492   Y  492



>ref|XP_009619866.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   521 bits (1341),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 261/481 (54%), Positives = 358/481 (74%), Gaps = 8/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K +LPPGPWKLP++GS+ HL+GG  PH  LR+L++KYGP+MHLQLGE+S +V
Sbjct  22    WRNSSSQTK-RLPPGPWKLPILGSMLHLLGGH-PHHVLRDLAKKYGPLMHLQLGEVSLVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRP ++A  IV Y  TD+ FSPYG+YWRQMRKIC+LELLS 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPLLVAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K VKSF S RQ+E+  ++   R  S  G P N+T++ + FTSS+  + AFG+   E Q +
Sbjct  140   KNVKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRFALFTSSMTCRSAFGQEHKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F+ L+K+V +L  GFD+ ++FPS  ++H  +GMK K++ +HHELD+I + II +HK+  +
Sbjct  197   FVRLVKKVSNLMEGFDVANIFPSLNFLHVLTGMKAKVMNVHHELDEILENIITEHKK--V  254

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             A +   SG  E IVDVLLR+ + G LQFPIT DNIKA++ DMF+ GTETS+TTI WAM E
Sbjct  255   AKTICESG-GEGIVDVLLRLMKEGGLQFPITNDNIKAIVFDMFAAGTETSSTTINWAMVE  313

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K+PSV AKAQAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PR+  E
Sbjct  314   MMKKPSVFAKAQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLIPRKCRE  373

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  +  Y IP KT V++N WA+  +P+ W+D E F PERFEN+S+D++GN++E++PFG+G
Sbjct  374   ETDLNGYTIPLKTTVVVNVWAMGRDPKYWDDVESFKPERFENNSMDYIGNNFEYLPFGSG  433

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+ PGISF   ++   LA LLYHF+ +LP G++P  LD+TEA G   ++K DL LIA P
Sbjct  434   RRIYPGISFGLANVYFPLAQLLYHFDGKLPSGINPSALDLTEATGAACARKNDLHLIATP  493

Query  1587  F  1589
             +
Sbjct  494   Y  494



>ref|XP_009780029.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   520 bits (1340),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 360/481 (75%), Gaps = 8/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K +LPPGPWKLP++GS+ H++GG LPH  LR+L++KYGPIMHLQLGE+S +V
Sbjct  22    WKNSNSQTK-RLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ISSP++A+ + KTHDL FA+RP ++A  IV Y  TD+AFSPYG+YWRQMRKIC+LELLS 
Sbjct  80    ISSPEMAKEVLKTHDLAFANRPLLVAAKIVCYNGTDIAFSPYGNYWRQMRKICLLELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K VKSF S RQ+E+  ++   R SS  G P N+T++++ FT+S+  + AFG+   + Q +
Sbjct  140   KTVKSFNSIRQDEVHRMIEFFRSSS--GKPVNVTKRIALFTNSMTCRSAFGQE-YKKQDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F+ L+K+V  L  GFD+ D+FPS K++H  +GMK K++ +H+E+D I + II +HK+   
Sbjct  197   FVELVKKVSHLIEGFDVADIFPSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHKK---  253

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
              + ++     E I+ VLLR+ + G LQFPIT DNIKA+I D+F  GTETS+TTI WAM+E
Sbjct  254   TSKSDGESGGEGIIGVLLRLMKEGGLQFPITNDNIKAIIFDIFGGGTETSSTTINWAMAE  313

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P V +KAQAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PRE  E
Sbjct  314   MMKNPCVFSKAQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECRE  373

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  +  Y IP KT+V++NAWA+  +P+ W+D E F PERFE++S+D++GN+YE++PFG+G
Sbjct  374   EIDLNGYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSG  433

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++   LA LL HF+W+LP G++P +LD+TEA GV  + K DL LIA P
Sbjct  434   RRICPGISFGLANVYFPLAQLLNHFDWKLPTGINPSELDLTEAAGVACATKNDLHLIATP  493

Query  1587  F  1589
             +
Sbjct  494   Y  494



>emb|CDP20259.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   519 bits (1336),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 268/483 (55%), Positives = 356/483 (74%), Gaps = 10/483 (2%)
 Frame = +3

Query  147   WAK-SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W K  K  A QKLPPGP KLP IG+LH+L+G SLPH++L NL++K+G +MHLQLGE+S I
Sbjct  24    WKKPRKVNATQKLPPGPRKLPFIGNLHNLLG-SLPHQALTNLAKKHGDLMHLQLGEVSAI  82

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SSP+ A+ I KTHDL FA RP+++   I+ Y  + +AF PYG+YWRQMRKIC LELLS
Sbjct  83    VVSSPRSAKEILKTHDLAFADRPEVLVGKIICYDYSSIAFCPYGEYWRQMRKICTLELLS  142

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              KMV+SF S RQ+E+ +L+SSIR S+  G P NLTE+VS FTSS++ + AFG++  E   
Sbjct  143   AKMVRSFGSIRQDEVLHLLSSIRASTGGGKPINLTEEVSSFTSSMVCRSAFGKMFGEKNT  202

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
               I L+K+VLS   GFD+ DLFPS+K +H+ S MKP LLK+HH++D I D II +H  N 
Sbjct  203   ILIQLVKEVLSRTSGFDISDLFPSQKILHHLSWMKPTLLKVHHKIDVILDNIINEHIRN-  261

Query  864   LANSTNSSGK--DEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIW  1034
             LA     +G+   ED++D+LLR+KE GG+L+FPIT   +KA++ DMF+  TETSAT + W
Sbjct  262   LARGKGGNGESGQEDLIDILLRIKESGGDLRFPITNKIVKAIMFDMFTAATETSATVVEW  321

Query  1035  AMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihpr  1214
             AMSEMI+ P VM+KAQ E+R+A  G    ++ D+E L YLK VIKETLRLHPPLPL+ P 
Sbjct  322   AMSEMIRNPDVMSKAQNEIRKAFMGKAKIEEMDIEGLIYLKSVIKETLRLHPPLPLLVPM  381

Query  1215  ESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIP  1394
             E  E+  +  Y+IP KTRV++NAWA+  +P+ W+ PE F PERF+N+ VDF G H+ ++P
Sbjct  382   ECREQRVLDGYVIPIKTRVLVNAWAIHRDPKYWDYPESFKPERFDNNPVDFTGTHFHYLP  441

Query  1395  FGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKD-LDMTEAVGVIASKKKDLC  1571
             FG GRR+CPGISF   ++ L LA LLY+F+W+LP G   KD LDMTEA G+  ++K +L 
Sbjct  442   FGGGRRICPGISFGLANVELPLAQLLYNFDWKLPPG---KDGLDMTEAFGITVARKSNLH  498

Query  1572  LIA  1580
             L+A
Sbjct  499   LVA  501



>ref|XP_006357930.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=498

 Score =   518 bits (1333),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 267/479 (56%), Positives = 355/479 (74%), Gaps = 8/479 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K   + +LPPGPW+LP IGSLHHL+G    H +LRNL+++YGP+M+LQLGEI  ++ISS 
Sbjct  24    KNKKQTRLPPGPWRLPFIGSLHHLIGRGHLHPNLRNLAQRYGPLMYLQLGEIPVVIISSS  83

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
              +A+ +  THDL FA RP+  +  I+FY + D+ FSPY +Y +QMRKIC ++L S KMVK
Sbjct  84    TIAKELLTTHDLAFADRPQSTSTTIIFYNNKDIVFSPYDNYCKQMRKICKVQLFSAKMVK  143

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF + R++E+S+L+SSIR + ++  P N+TEK+ WFT+S+    AFG++  +D+ +FI L
Sbjct  144   SFSTIRKDEISSLISSIRSTRDS--PINMTEKIFWFTNSVTCSAAFGKMF-KDRDEFIKL  200

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             LK +L LA GF + DLFPS K +H  SG + +L+  H ++D+I + I+ +H EN  AN  
Sbjct  201   LKDILILASGFCVTDLFPSWKLLHKLSGAESRLMNAHKKVDEIMEDILKEHLENK-ANRN  259

Query  879   NSSGKD---EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                G     ED+VDVLL+V E  EL+ PIT D+IKAVI D+F  G+ETS+T  IW +SEM
Sbjct  260   KGIGDQFGGEDLVDVLLKVMEDAELECPITNDHIKAVILDIFIAGSETSSTITIWVLSEM  319

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDK-DLENLTYLKLVIKETlrlhpplplihprESME  1226
             +K  ++MAKAQ EVRQ L+G K +D++ DLE LTYLKLVIKETLRLH P PL+ PRE  E
Sbjct  320   MKNSTIMAKAQKEVRQVLRGKKNYDNEEDLEKLTYLKLVIKETLRLHTPAPLLGPRECRE  379

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             +  I  Y IP KT++++NAWALA +PESW DPE F+PERFENSS+DF+GNH+EFIPFGAG
Sbjct  380   QTNIDGYTIPLKTKILVNAWALARDPESWHDPECFIPERFENSSIDFLGNHFEFIPFGAG  439

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             RRMCPG+ F  T++ LSLA LLYHF WELP G+ PKDLDMTE  G+   K++DL L+AR
Sbjct  440   RRMCPGVLFGLTNVELSLAQLLYHFEWELPYGMKPKDLDMTETYGLSGGKQRDLYLVAR  498



>ref|XP_009794007.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   518 bits (1333),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 253/481 (53%), Positives = 352/481 (73%), Gaps = 10/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K +LPPGPWKLPLIGS+ H++GG  PH  L NL++KYGP+MHLQLGE+  +V
Sbjct  22    WKNSNSQIK-RLPPGPWKLPLIGSMFHMLGGH-PHHVLTNLAKKYGPLMHLQLGEMPVVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRPK +A +IVFY  +D+AF PYGDYWRQMRKICV+ELL+ 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKFLATEIVFYNCSDIAFCPYGDYWRQMRKICVIELLTA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF + RQ+E+  ++   R S++     N+T+++  FTSS+  + AFG+V  E Q +
Sbjct  140   KNVRSFSAIRQDEVHRMIEFFRSSTDQQI--NVTKRICQFTSSMTCRSAFGKVIKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+  +L  GFD+ D+FPS K++H  SG K +++ +HH++D I + II + KE   
Sbjct  197   FILLVKRNTALVEGFDVADIFPSLKFLHVLSGKKARVMDVHHKIDAILENIINERKEI--  254

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               +T   G  + ++DVLLR+ + G LQFPIT DNIKA+I DMF+ GTETS+  I WAM E
Sbjct  255   --ATGELG-GKGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSSVAIDWAMVE  311

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P+V+AKAQ EVR+A +G +TFD+ D+E L YLKLVIKET RLHPP PL+ PRE  E
Sbjct  312   MMKNPNVLAKAQTEVRKAFRGKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRECRE  371

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP K +V++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+G
Sbjct  372   ETDINGYTIPLKAKVMVNVWAIGRDPKYWDDAEIFKPERFEHNSMDFVGNNFEYLPFGSG  431

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR CPGISF   ++   LA LLYHFNW+LP G++P +LD+TE+ G   ++K +L L   P
Sbjct  432   RRNCPGISFGLANVYFPLAQLLYHFNWKLPTGINPSELDLTESAGASCARKSNLYLFPTP  491

Query  1587  F  1589
             +
Sbjct  492   Y  492



>ref|XP_009793271.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   517 bits (1332),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 259/481 (54%), Positives = 358/481 (74%), Gaps = 8/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K +LPPGPWKLP++GS+ H++GG LPH  LR+L++KYGPIMHLQLGE+S +V
Sbjct  22    WKNSNSQTK-RLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ISSP++A+ + KTHDL FA+RP ++A  IV Y   D+AFSPYG+YWRQMRKIC+LELLS 
Sbjct  80    ISSPEMAKEVLKTHDLAFANRPLLVAAKIVSYNCMDIAFSPYGNYWRQMRKICLLELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K VKSF S RQ+E+  ++   R  S  G P N+T+++S FT+S+  + AFG+   + Q +
Sbjct  140   KNVKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRISLFTNSMTCRSAFGQE-YKKQDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F+ L+K+V  L  GFD+ D+FPS K++H  +GMK K++ +H+E+D I + II +HK+   
Sbjct  197   FVELVKKVSHLIEGFDVADIFPSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHKK---  253

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
              + ++     E I+ VLLR+ + G LQFPIT DNIKA+I D+F  GTETS+TTI WAM+E
Sbjct  254   TSKSDGESGGEGIIGVLLRLMKEGGLQFPITNDNIKAIIFDIFGGGTETSSTTINWAMAE  313

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P V +KAQAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PRE  E
Sbjct  314   MMKNPCVFSKAQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECRE  373

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  +  Y IP KT+V++NAWA+  +P+ W+D E F PERFE++S+D++GN+YE++PFG+G
Sbjct  374   EIDLNGYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSG  433

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++   LA LL HF+W+LP G++P +LD+TEA GV  + K DL LIA P
Sbjct  434   RRICPGISFGLANVYFPLAQLLNHFDWKLPTGINPSELDLTEAAGVACATKNDLHLIATP  493

Query  1587  F  1589
             +
Sbjct  494   Y  494



>gb|AHH25653.1| cytochrome P450 CYP71D [Nicotiana tabacum]
Length=497

 Score =   517 bits (1332),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 253/481 (53%), Positives = 356/481 (74%), Gaps = 10/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K +LPPGPWKLPL+GS+ H++GG  PH  L NL++KYGP++HLQLGE+S +V
Sbjct  22    WKNSNSKIK-RLPPGPWKLPLLGSMFHMLGGH-PHHVLTNLAKKYGPLVHLQLGEMSVVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRPK +A +IVFY  +D+AF PYGDYWRQMRKIC++ELL+ 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  ++   R S +     N+T+++  FTSS+  + AFG+V  E Q +
Sbjct  140   KNVRSFSSIRRDEVHRMIEFFRSSIDQ--QVNVTKRIYQFTSSMTCRSAFGKVFKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+  +L  GFD+ D+FPSKK++H  SG K +++ +HH++D I + II + K+   
Sbjct  197   FILLVKRNTALMEGFDVADIFPSKKFLHVLSGKKARVMDVHHKIDAILENIINERKKI--  254

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               +T   G  + ++DVLLR+ + G LQFPIT DNIKA+I D F+ GTETS+ TI WAM E
Sbjct  255   --ATGEVG-GKGLIDVLLRLMKEGGLQFPITNDNIKAIIFDTFAAGTETSSVTIDWAMVE  311

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV+AKAQAEVR+A +G +TFD+ D+E L YLKLVIKE  RLHPP PL+ PRE  E
Sbjct  312   MMKNPSVLAKAQAEVRKAFRGKETFDENDVEELNYLKLVIKEAFRLHPPFPLLLPRECRE  371

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP K +V++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+G
Sbjct  372   ETDINGYTIPLKAKVMVNVWAIGRDPKYWDDVESFKPERFEHNSMDFVGNNFEYLPFGSG  431

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR CPGISF   ++   LA LLYHF+W+LP+G++P +LD+TE+ G   ++K +L LIA P
Sbjct  432   RRNCPGISFGLANVYYPLAQLLYHFDWKLPNGINPNELDLTESAGATCARKSNLHLIATP  491

Query  1587  F  1589
             +
Sbjct  492   Y  492



>ref|XP_009612417.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   517 bits (1331),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 253/481 (53%), Positives = 356/481 (74%), Gaps = 10/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K  LPPGPWKLPL+GS+ H++GG  PH  L NL++KYGP++HLQLGE+S +V
Sbjct  22    WKNSNSKIKI-LPPGPWKLPLLGSMFHMLGGH-PHHVLTNLAKKYGPLVHLQLGEMSVVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++SP++A+ + KTHDL FASRPK +A +IVFY  +D+AF PYGDYWRQMRKIC++ELL+ 
Sbjct  80    VTSPEMAKEVLKTHDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+  ++   R S +     N+T+++  FTSS+  + AFG+V  E Q +
Sbjct  140   KNVRSFSSIRRDEVHRMIEFFRSSIDQ--QVNVTKRIYQFTSSMTCRSAFGKVFKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI L+K+  +L  GFD+ D+FPSKK++H  SG K +++ +HH++D I + II + K+   
Sbjct  197   FILLVKRNTALMEGFDVADIFPSKKFLHVLSGKKARVMDVHHKIDAILENIINERKKI--  254

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               +T   G  + ++DVLLR+ + G LQFPIT DNIKA+I DMF+ GTETS+ TI WAM E
Sbjct  255   --ATGEVG-GKGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSSVTIDWAMVE  311

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV+AKAQAEVR+A +G +TFD+ D+E L YLKLVIKE  RLHPP PL+ PRE  E
Sbjct  312   MMKNPSVLAKAQAEVRKAFRGKETFDENDVEELNYLKLVIKEAFRLHPPFPLLLPRECRE  371

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP K +V++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+G
Sbjct  372   ETDINGYTIPLKAKVMVNVWAIGRDPKYWDDAESFKPERFEHNSMDFVGNNFEYLPFGSG  431

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR CPGISF   ++   LA LLYHF+W+LP+G++P +LD+TE+ G   +++ +L LIA P
Sbjct  432   RRNCPGISFGLANVYYPLAQLLYHFDWKLPNGINPNELDLTESAGATCARESNLHLIATP  491

Query  1587  F  1589
             +
Sbjct  492   Y  492



>gb|KDP39257.1| hypothetical protein JCGZ_01014 [Jatropha curcas]
Length=485

 Score =   515 bits (1327),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 345/483 (71%), Gaps = 5/483 (1%)
 Frame = +3

Query  147   WAKSKA-AAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W KSK   A + LPPGP KLP+IG++H L+G SLPH  LR+L++K+G IMHLQLGE+S I
Sbjct  2     WRKSKTKEATKNLPPGPRKLPIIGNIHQLIG-SLPHHCLRDLAKKHGGIMHLQLGEVSNI  60

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             VISSP+ A+ + KTHD+VFA RP ++A  I+ Y  TD+AFSPY DYWRQ+RKIC+LELLS
Sbjct  61    VISSPEAAKEVMKTHDIVFAQRPFLLAASIISYNFTDIAFSPYADYWRQLRKICILELLS  120

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF   R+EE+SNL+++I  SS +G   N + K+   T  + A+  FG  C EDQ 
Sbjct  121   AKRVQSFRFIREEEVSNLITAI--SSSSGKAFNFSRKLFSLTYGIAARATFGEKC-EDQE  177

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             +FI +++++  +AGGF L DLFPS K++H  SGM+ +L++L  E D++   II DH+  +
Sbjct  178   EFIPIVEEITEVAGGFSLADLFPSVKFLHSISGMRSRLIRLQKEADRVIGNIIDDHRAKN  237

Query  864   LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
                     G+D+D+VDVLLR++E G L+FP+T DNIKAVI D+F  G+ETS+TT+ WAMS
Sbjct  238   KTGKVGGEGQDDDLVDVLLRLQEHGNLEFPLTTDNIKAVILDIFVAGSETSSTTVEWAMS  297

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             EM++ P VM KAQ EVR+        ++ DL+   YLKLVIKETLRLHPP PL+ PRES 
Sbjct  298   EMLRNPRVMYKAQEEVRKLFDKKGNVEETDLQESKYLKLVIKETLRLHPPAPLLLPREST  357

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             E+ +I  Y IP K++VI+NAWA+  +P  W + E F PERF +SS+D+ GN++EFIPFGA
Sbjct  358   EKCEINGYDIPEKSKVIVNAWAIGRDPNHWTEAETFYPERFLDSSIDYKGNNFEFIPFGA  417

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRRMCPGI F   ++ L LA LLYHF+WELP G+  + LDM E+ G    +K DL LI  
Sbjct  418   GRRMCPGILFGIANVELPLAQLLYHFDWELPSGLKAETLDMIESFGATVRRKNDLHLIPN  477

Query  1584  PFV  1592
             P+ 
Sbjct  478   PYT  480



>ref|XP_009624011.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=458

 Score =   512 bits (1318),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 250/455 (55%), Positives = 343/455 (75%), Gaps = 4/455 (1%)
 Frame = +3

Query  225   HLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAITKTHDLVFASRPKIMA  404
             H+VGG LPHR LR+L++KYGP+MHL+LGE+S +V++SP++A+ + KTHDL FASRPK++A
Sbjct  3     HMVGG-LPHRVLRDLAKKYGPLMHLKLGEVSVVVVTSPEIAKEVLKTHDLAFASRPKLLA  61

Query  405   LDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSE  584
              +IV Y S+D+AF+PYGDYWRQMRKICVLE+L+ K V+SF S R++E+  L+   R SS 
Sbjct  62    AEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVRSFSSIRRDEVFRLIEFFRSSS-  120

Query  585   TGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKW  764
              G P N T+++S FTS +I + AFG V  E Q +FI ++K V +L  G D+ D+FPS K+
Sbjct  121   -GKPVNFTKRISLFTSFIICRSAFGTVFKE-QDEFIQVMKNVTALLEGLDVADIFPSLKF  178

Query  765   IHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGEL  944
             +H  +G + K++ LHH++D I D +I +HK+N      N     ED++DVLLR+ + G+L
Sbjct  179   LHVLTGKRAKVMNLHHKVDSIVDNVINEHKKNLATGKFNGQLGGEDLIDVLLRLMKDGDL  238

Query  945   QFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFD  1124
             QFPIT DNIKA+I DMF+ GTET++TTI WAM E+I+  SV AKAQAEVR+  +  +TFD
Sbjct  239   QFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVELIRNASVFAKAQAEVREVFRRIETFD  298

Query  1125  DKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNP  1304
             + D+E L YLKLVIKETLRLHPPLPL+ PRE  EE  I  + IP K++V++N WA+  +P
Sbjct  299   ENDVEELKYLKLVIKETLRLHPPLPLMLPRECREETNINGFTIPLKSKVMVNVWAIGRDP  358

Query  1305  ESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFN  1484
             + W+D E F PERFE SSVDF GN++E++PFG+GRR+CPGI F   +I L LA LLY+F+
Sbjct  359   KYWDDAENFKPERFEQSSVDFTGNNFEYLPFGSGRRICPGILFGLANIYLPLAQLLYYFD  418

Query  1485  WELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             W+LP G++P DLD+TE+ G   ++K +L LIA P+
Sbjct  419   WKLPTGINPSDLDLTESDGASCARKSNLYLIASPY  453



>ref|XP_006339045.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   513 bits (1322),  Expect = 9e-174, Method: Compositional matrix adjust.
 Identities = 272/484 (56%), Positives = 363/484 (75%), Gaps = 7/484 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W KS+   K KLPPGPWKLP +GS+HHL + G LPH +L  L +K+GP MHLQLGEISTI
Sbjct  26    WKKSRNLNK-KLPPGPWKLPFLGSIHHLALEGGLPHHALTKLGKKHGPFMHLQLGEISTI  84

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SS ++AR + K HDL FASRPK+++LD++ Y STD+ FSPYGDYWRQMRKIC LEL S
Sbjct  85    VVSSLEMAREVMKIHDLAFASRPKLVSLDVICYNSTDIVFSPYGDYWRQMRKICFLELFS  144

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF S R+EE S+LV  I  SS  G   N+TE++SW+ SS   K AFG +  +DQ 
Sbjct  145   AKNVRSFSSIRREEASSLVQFIG-SSPRGETINVTERISWYESSNTCKAAFGELL-KDQE  202

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             KFI +++++  L GGF + ++FPS K +H  SG++ +++K+H  +D I + II +HK+N 
Sbjct  203   KFIGIVRELAELTGGFSVANIFPSIKILHVLSGLRSRIMKVHKNVDVIVEDIINEHKKN-  261

Query  864   LANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
             +A+    +G    ED+VDVLLR++E GEL+ PIT DNIKA++ D+F+ GTETS TT IW 
Sbjct  262   IASGKKGNGAFGGEDLVDVLLRLRESGELKTPITNDNIKAIMIDLFAAGTETSTTTTIWT  321

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             M+EM++ PSV+AKAQ EVR+A KG +TF++  +E+L YLK V+KE+LRLHPP PL+ PRE
Sbjct  322   MTEMMRNPSVLAKAQVEVREAFKGKETFNEDIIEDLKYLKQVVKESLRLHPPAPLLVPRE  381

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               EE  I  Y IP KTRV++N  A+  +P+ WED E F+PERFE SSVDFMGN++E++PF
Sbjct  382   CREETNINGYTIPLKTRVLVNVSAIMRDPQYWEDAESFIPERFEQSSVDFMGNNFEYLPF  441

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRRMCP I+F   ++ L LA LLYHF+W+LPDG+ P++LDMTE  G+ AS+K +L LI
Sbjct  442   GAGRRMCPAITFGLINVYLPLAKLLYHFDWKLPDGLKPENLDMTECDGINASRKSELYLI  501

Query  1578  ARPF  1589
             A P+
Sbjct  502   ATPY  505



>gb|AAD47832.1| cytochrome P450 [Nicotiana tabacum]
Length=499

 Score =   512 bits (1318),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 257/481 (53%), Positives = 355/481 (74%), Gaps = 8/481 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S +  K +LPPGPWKLP++GS+ H++GG LPH  LR+L++KYGPIMHLQLGE+S +V
Sbjct  22    WKNSNSQTK-RLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ISSP +A+ + KTHDL FA+RP ++A  I  Y   D+A SPYG+YWRQMRKIC+LELLS 
Sbjct  80    ISSPGMAKEVLKTHDLAFANRPLLVAAKIFSYNCMDIALSPYGNYWRQMRKICLLELLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K VKSF S RQ+E+  ++   R  S  G P N+T+++S FT+S+  + AFG+   E Q +
Sbjct  140   KNVKSFNSIRQDEVHRMIKFFR--SSPGKPVNVTKRISLFTNSMTCRSAFGQEYKE-QDE  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F+ L+K+V +L  GFD+ D+FPS K++H  +GMK K++  H+ELD I + II +HK+   
Sbjct  197   FVQLVKKVSNLIEGFDVADIFPSLKFLHVLTGMKAKVMNTHNELDAILENIINEHKK---  253

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
              + ++     E I+ VLLR+ + G LQFPIT DNIKA+I+D+F  GTETS+TTI WAM E
Sbjct  254   TSKSDGESGGEGIIGVLLRLMKEGGLQFPITNDNIKAIISDIFGGGTETSSTTINWAMVE  313

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV +KAQAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PRE  E
Sbjct  314   MMKNPSVFSKAQAEVREILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECRE  373

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  +  Y IP KT+V++NAWA+  +P+ W+D E F PERFE++S+D++GN+YE++PFG+G
Sbjct  374   EIDLNGYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSG  433

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   ++   LA LL HF+W+LP G++P++ D+TEA G   ++K DL LIA  
Sbjct  434   RRICPGISFGLANVYFPLAQLLNHFDWKLPTGINPRNCDLTEAAGAACARKNDLHLIATA  493

Query  1587  F  1589
             +
Sbjct  494   Y  494



>ref|XP_009617877.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   512 bits (1318),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 258/489 (53%), Positives = 358/489 (73%), Gaps = 13/489 (3%)
 Frame = +3

Query  156   SKAAAKQ---KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             SK  AK     LPPGPWKLPL+GS+HHL+   LPH +LR+L++K+GP+MHLQLGEISTIV
Sbjct  25    SKKLAKNPNLNLPPGPWKLPLLGSIHHLIS-ILPHHTLRDLAKKHGPLMHLQLGEISTIV  83

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             IS+PQ A+ + K  D+ F +RP+++++ I+ Y  +D+AF+PYG+YWRQMRK+C LELLS 
Sbjct  84    ISTPQAAKEVLKVQDIAFTNRPELLSVKILCYNYSDIAFAPYGNYWRQMRKLCTLELLSA  143

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R+EE  +LV  ++  S++G   NLTEK+   T+++I + AFG+   E+   
Sbjct  144   KNVQSFASIREEEAFDLVEYVK--SKSGSTINLTEKLYALTNAVICRAAFGKRRKEESAY  201

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F++L+K+V  +  G D+ ++FPS K++H  +G K KL+KLH +LDK+ D+II +HKEN  
Sbjct  202   FMSLIKEVSLMVTGLDISEVFPSLKFLHAITGTKAKLVKLHKKLDKVLDMIIEEHKENLQ  261

Query  867   ANSTNSSGKDE-----DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  1031
               S   +G++E     D+V++LLR++E G L+FP T DNIKAVI+DMF  GTETSAT + 
Sbjct  262   LVSLKKNGEEESIRKEDLVNLLLRLQESGTLEFPFTADNIKAVISDMFVAGTETSATVLD  321

Query  1032  WAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihp  1211
             WAM EM++ P VM KAQ E+RQ LKG +   + DL+ + YLKLVIKETLRLHPPLPL+ P
Sbjct  322   WAMVEMMRNPKVMEKAQIELRQILKGKRRVKENDLKEVRYLKLVIKETLRLHPPLPLLLP  381

Query  1212  rESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENS--SVDFMGNHYE  1385
             RE  E+  I  Y IP KT+VI+NAWA+  + E WED ERF+PERF +S  +++F+G  +E
Sbjct  382   RECREQCAINGYDIPIKTKVIVNAWAINRDVEFWEDAERFVPERFNDSRNNMEFIGQEFE  441

Query  1386  FIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKD  1565
             ++PFG GRRMCPGISF   +I L+LA LLY+FNW+LP+ + P+DLD+TE  G    +K +
Sbjct  442   YLPFGGGRRMCPGISFGLANIELTLAQLLYYFNWKLPNEMKPEDLDVTETPGSSCRRKCN  501

Query  1566  LCLIARPFV  1592
             L +IA P +
Sbjct  502   LYVIATPVI  510



>ref|XP_011081964.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=513

 Score =   511 bits (1317),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 258/487 (53%), Positives = 355/487 (73%), Gaps = 16/487 (3%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W K    ++ KLPPGPWKLP+IG LHH+  G+LPHRS + L++KYGP+MH +LGE++ +V
Sbjct  26    WKKFSTRSR-KLPPGPWKLPVIGHLHHI--GTLPHRSFQELAKKYGPLMHFKLGEVTAVV  82

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP L++ + K HD  FA RP+ +A +I++Y S++++FS YGDYWRQMRKIC+LELLS 
Sbjct  83    VSSPTLSKEVLKVHDPTFADRPENIAGEILWYNSSNISFSQYGDYWRQMRKICILELLSA  142

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K VKSF S R +E+S+LV SI  SS  G P +LTEK+   TSS+  + AFG+VC  D+ +
Sbjct  143   KNVKSFGSIRNDEVSHLVDSIGASS--GAPVDLTEKIFMLTSSITCRAAFGKVC-RDKDQ  199

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN--  860
              I + K+ ++L  GFD+ DL+PS K +   S  + KLL++  +LD I D IIG+H+ N  
Sbjct  200   LIEMFKEGITLVSGFDVSDLYPSSKILRAISCNRRKLLRMRRKLDLILDDIIGEHRRNLA  259

Query  861   -------HLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSA  1019
                    +L    N    +ED+VDVLLRV++ GEL+FPIT+DNIKAVI D+F+ GTETS+
Sbjct  260   KIAADKDNLERRGNGEFGNEDLVDVLLRVQQSGELEFPITDDNIKAVIYDIFAAGTETSS  319

Query  1020  TTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplp  1199
             TT+ W M+E+I+ P VM K Q E+RQ  KGNKT +D D++NL YLKLVIKE LRLH P+P
Sbjct  320   TTVDWIMAELIRNPHVMGKVQNEIRQTFKGNKTIEDADVQNLKYLKLVIKEGLRLHAPIP  379

Query  1200  lihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNH  1379
             LI    S E+ +I  Y+IP + +V++NAW +  +PE W +PE F PERF+N+S DF GNH
Sbjct  380   LIPRV-SREDTEIAGYLIPARAKVLVNAWGMGRDPEIWSNPESFEPERFDNNSTDFTGNH  438

Query  1380  YEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKK  1559
             +E+IPFGAGRRMCPG++F   S+ L LA LLY+F+W+LPDG+SP DLDM E   + A+++
Sbjct  439   FEYIPFGAGRRMCPGMTFGLASVELPLAHLLYNFDWKLPDGMSPNDLDMVERPAITAARR  498

Query  1560  KDLCLIA  1580
             ++L L+A
Sbjct  499   QNLELVA  505



>ref|XP_002522721.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39572.1| cytochrome P450, putative [Ricinus communis]
Length=499

 Score =   510 bits (1314),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 254/479 (53%), Positives = 346/479 (72%), Gaps = 4/479 (1%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             + SK +  + LPPGP KLPLIG++H L+G SLPH  LR+L++KYG IMHLQLGE+  +V+
Sbjct  23    SNSKHSTLKNLPPGPTKLPLIGNMHQLLG-SLPHHRLRDLAKKYGSIMHLQLGEVPHVVV  81

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP+ A+ + KTHD+VFA RP ++A  ++ Y  TD+AFSPY DYWRQ+RKICVLELLS K
Sbjct  82    SSPEAAKEVMKTHDIVFAQRPFLLAASVITYNFTDIAFSPYSDYWRQLRKICVLELLSAK  141

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+SF S R+EE+SNL+++  L+S +G P N + K+   T  + A+ +FG+   +DQ +F
Sbjct  142   RVQSFRSIREEEVSNLINT--LTSFSGKPFNFSRKLFSSTYGIAARASFGKKY-KDQEEF  198

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I + +Q+  +AGGF L DLFPS  ++H  SGMK +LL+L  + D I + II DH+  ++ 
Sbjct  199   IKVAQQMTEVAGGFSLADLFPSIAFLHVISGMKSRLLRLRDDGDNILENIIDDHRARNMT  258

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
               T+  G+D+D+VDVLLR ++GG+L+FP+T +NIKAVI D+F  G+ETS+TT+ WAMSEM
Sbjct  259   GKTSGEGEDDDLVDVLLRFQKGGQLEFPLTTNNIKAVILDIFIAGSETSSTTVEWAMSEM  318

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             ++ P VM KAQ EVR+        D+ +L  L YLKLVIKETLRLHPP PL+ PRES E 
Sbjct  319   LRNPRVMEKAQEEVRRVFGKKGNVDEAELHELNYLKLVIKETLRLHPPAPLLLPRESRES  378

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              +I  Y IP  ++VI+NAWA+  +P +W + E F PERF +S++D+ GN++EFIPFGAGR
Sbjct  379   CEINGYYIPVNSKVIVNAWAIGRDPNNWTEAETFYPERFLDSAIDYKGNYFEFIPFGAGR  438

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RMCPGI F   ++ L LA  LYHF+W+LPDG+  + LDM E  G    +K DL LIA P
Sbjct  439   RMCPGILFGMANVELPLAQFLYHFDWKLPDGLEAESLDMMEGFGATVRRKNDLHLIAIP  497



>emb|CDP07882.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   512 bits (1319),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 258/481 (54%), Positives = 355/481 (74%), Gaps = 3/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W +S+AA  +KLPP P KLP+IG++HHL+G S PH++L  L++K+G +MHLQLGEIS+I+
Sbjct  24    WRRSQAA--KKLPPSPSKLPIIGNMHHLIG-SQPHQALTKLAQKHGALMHLQLGEISSII  80

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SS  LA+ I KTHDL FA+R +I+   I+ Y S+D+ F PYGDY RQ+RKIC LELLS 
Sbjct  81    VSSSHLAKEIMKTHDLSFANRSEILLSKIIMYNSSDIGFCPYGDYLRQVRKICALELLSA  140

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S RQ+E  +LV SIR  ++ G   + T+KV  +T S + + AFG+V  +   K
Sbjct  141   KKVQSFGSIRQDEALHLVKSIRNLADAGEVIHFTDKVHSYTCSTVCRAAFGKVSKDVHSK  200

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F+ L+ +++ L+  FD+ DL PS K +H    +K +L+K+H ++D++   II  H  N  
Sbjct  201   FLQLMCEIVPLSSTFDISDLLPSFKMLHPLLSVKRQLVKIHLKMDRLLVNIIDQHTNNLQ  260

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
              N +     +ED++DVLLRVK  G+LQ PIT DNIKA++ D+FS GTETS+TT+ WAMSE
Sbjct  261   RNMSTGEYGNEDLIDVLLRVKHSGDLQIPITNDNIKAIVIDVFSAGTETSSTTVDWAMSE  320

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MI+ PSVMAKAQ+E+R A KG + F++ D++ L YLKLVI+ETLRLHPPLPL+ PRE  E
Sbjct  321   MIRNPSVMAKAQSEIRTAFKGKQMFEEDDVQELKYLKLVIRETLRLHPPLPLLVPRECRE  380

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E +I  Y+IP +TRV++NAWA+  +P+ W+DPE F PERFEN+ VDF G H+E++PFGAG
Sbjct  381   ECEIDGYVIPVQTRVLVNAWAMGRDPQYWDDPESFKPERFENNPVDFAGTHFEYLPFGAG  440

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RRMCPGI F   ++ + LA LLYHFNW+LP+G+ P DLDM+E+ G+ AS+K  L L+A P
Sbjct  441   RRMCPGIQFGLANVYVPLAFLLYHFNWKLPNGLDPNDLDMSESTGITASRKDKLRLLATP  500

Query  1587  F  1589
             +
Sbjct  501   Y  501



>ref|XP_004228509.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=495

 Score =   510 bits (1313),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 258/480 (54%), Positives = 344/480 (72%), Gaps = 12/480 (3%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  S + +K +LPPGPWKLPLIGS+ HL+GG LPH   R+L++KYGPIMHLQLGE+S +V
Sbjct  22    WKNSNSKSK-RLPPGPWKLPLIGSMFHLLGG-LPHHVFRDLAKKYGPIMHLQLGEVSLVV  79

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ++S  +A+ + KTHDL FA RPK++  +I+FYK TD+ FSPYGDYWRQMRKIC+LE LS 
Sbjct  80    VTSADMAKQVLKTHDLAFAFRPKLLVGEILFYKGTDIVFSPYGDYWRQMRKICLLEFLSA  139

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K VKSF S RQ+E+ +++   R  S +G   N+T+++  F+SS+  +  FG+V  E Q K
Sbjct  140   KNVKSFNSIRQDEVHHMIEFFR--SSSGETINVTKRIYQFSSSMTCRSVFGKVFKE-QNK  196

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              + L K+      GFD+ D+FPS K++H   GMK K++  HHELD I + II +HK N  
Sbjct  197   LMELAKEASRFLKGFDVADIFPSLKFLHVLCGMKGKIMDAHHELDAILENIINEHKNN--  254

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                    G +  +V +L  +KEGG LQFPIT DNIKA+I DMF+ GT+TS+T I WAM E
Sbjct  255   ----GELGGEGLLVALLSLMKEGG-LQFPITNDNIKAIIFDMFAGGTDTSSTLIDWAMVE  309

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K PSV+ KAQ E+R A  G +TF++ D+E L YLKLV+KET RLHPP PL+  RE  E
Sbjct  310   MMKNPSVLLKAQDEIRNAFTGKETFNENDVEELKYLKLVVKETFRLHPPAPLLVARECRE  369

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             E  I  Y IP KT+V++NA+A+  +P+ W D E F PERFE  SVDF+GN++EF+PFG+G
Sbjct  370   EVDIDGYNIPLKTKVLVNAYAIGRDPKYWIDAECFKPERFEQISVDFIGNNFEFLPFGSG  429

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGISF   +I   LA LLYHF+W+LP G++P DLD+TE+ G+  ++K +L LIA P
Sbjct  430   RRICPGISFGLANIFFPLAKLLYHFDWKLPIGINPSDLDLTESAGIACARKSNLYLIATP  489



>emb|CDP07881.1| unnamed protein product [Coffea canephora]
Length=844

 Score =   521 bits (1341),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 266/475 (56%), Positives = 350/475 (74%), Gaps = 5/475 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             +LPP PWKLPLIG++H L+G S P  +LR L++K+G +MHLQLGEIS+IVISSP+LA  +
Sbjct  371   ELPPSPWKLPLIGNMHRLIG-SPPQHALRRLAQKHGSLMHLQLGEISSIVISSPRLAEEV  429

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              K HDL FASR +I+   I  Y  +DV  SPYG+YWRQMRKIC LELLS K V+SF S R
Sbjct  430   MKNHDLAFASRAEILVTKIGRYNCSDVVSSPYGEYWRQMRKICTLELLSAKRVRSFGSVR  489

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++E  +L+SSI+    TG   NL+E VS +TSS++ + AFG+V  +DQ  F+ L+K+ L 
Sbjct  490   KDEAFHLISSIKALVGTGEQINLSELVSLYTSSVLCRAAFGKVSKDDQNAFLQLIKESLL  549

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  893
             L+  FD  DLFPS K +H    +K K++ +HH +D + D II  H ++       +SG+ 
Sbjct  550   LSSAFDFSDLFPSLKILHPLLSVKSKMVHVHHMIDMMLDGIIDQHIDDQ-GRPKLASGES  608

Query  894   -DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
               ED++DVLLRVK+G  LQ PIT+DNIKAV+ DMF+ GTETS+TT+ WAM+EMI+ P VM
Sbjct  609   YQEDLIDVLLRVKDGDNLQVPITKDNIKAVLIDMFAGGTETSSTTVEWAMAEMIRSPDVM  668

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
             AKAQ E+R+ALKG K  ++ D++   YLKLVIKETLRLHPPLPL+ PRE  EE ++  Y+
Sbjct  669   AKAQNEIRKALKGKKAVEETDIQQARYLKLVIKETLRLHPPLPLLVPRECREECELHGYV  728

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP KTRV+INAWA+  +PE W+D + F PERFENS+ DF G H+E++PFGAGRRMCPGIS
Sbjct  729   IPVKTRVMINAWAIGRDPEYWDDADGFKPERFENSAADFSGTHFEYLPFGAGRRMCPGIS  788

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVD  1595
             F   ++ L LA LLYHF+W+LP+ ++  DLDMTE +G+ AS+K +L L AR F D
Sbjct  789   FGLANVELPLALLLYHFDWQLPNDLNSNDLDMTETIGITASRKNNLWLQAR-FAD  842


 Score =   333 bits (854),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 194/380 (51%), Positives = 258/380 (68%), Gaps = 15/380 (4%)
 Frame = +3

Query  225   HLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAITKTHDLVFASRPKIMA  404
             H + GS PH +LR L++K+GP+MHLQLGEISTIV+SSP+LA+ I KTHDL FA+R + +A
Sbjct  2     HQLTGSRPHYALRKLAQKHGPLMHLQLGEISTIVVSSPRLAKEIMKTHDLDFANRAEFLA  61

Query  405   LDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSE  584
               IV Y  +D+  +PYG+YWRQMRKIC LELLS K V+SF   R +E  +L+SSI+  + 
Sbjct  62    CKIVCYNCSDIVCAPYGEYWRQMRKICTLELLSTKNVRSFGCIRLDEAKHLISSIQAHAA  121

Query  585   TGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKW  764
              G   NLT+ +S +TSS++   AF +V    Q  F+ LL  V  L     + DLFPS + 
Sbjct  122   AGELINLTDHLSTYTSSMVLTAAFRKVSKVHQMTFLRLLNMVRRLGRAVTVSDLFPSYRI  181

Query  765   IHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKEGG  938
             +H  S +KPKL+K+H  +DKIFD II +H EN L  +    G+  +ED+VDVLLRVKE G
Sbjct  182   LHPLSRVKPKLMKVHQRIDKIFDTIIAEHVEN-LKRTKRGMGESGNEDLVDVLLRVKESG  240

Query  939   ELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKT  1118
             +L FP+T +NIKAV+ D+F+ GTETS+TT+ WAMSEMI+ P+VMA AQ E+R+A  G KT
Sbjct  241   DLTFPVTNNNIKAVLTDIFTGGTETSSTTVEWAMSEMIRNPNVMATAQNEIRKAFMGMKT  300

Query  1119  FDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRV---------  1271
              ++ D+E L YLKLVIKETLRLHPP+PL+ PR   E+ +I  YI+P   R+         
Sbjct  301   IEETDVEKLPYLKLVIKETLRLHPPIPLLVPRGCREQCEIDGYIVPQLIRLANELFNIQL  360

Query  1272  ---IINAWALATNPESWEDP  1322
                II   +L   P  W+ P
Sbjct  361   KIGIILETSLELPPSPWKLP  380



>ref|XP_004511998.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   509 bits (1310),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 261/476 (55%), Positives = 342/476 (72%), Gaps = 6/476 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
              KLPPGP KLPLIG+LH L +   LPH +L+ LS KYGP+MHLQLGEIST+++SSP+LA+
Sbjct  32    NKLPPGPRKLPLIGNLHQLAMSKKLPHYALKELSHKYGPLMHLQLGEISTVIVSSPKLAK  91

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              + KTHD+ FA+RPK+++ +I+ Y S D+ FSPYGDYWRQMRKICVLELL+ K V+SF  
Sbjct  92    EVMKTHDVAFANRPKLLSPEIMAYGSKDIVFSPYGDYWRQMRKICVLELLNAKRVQSFSY  151

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R++E +  + SI+ S +T    NLT ++    SS I++ AFG   S+DQ +F+ L+++V
Sbjct  152   IREDETNKFIKSIQSSIDTTI--NLTSRILSMVSSTISRAAFGD-KSKDQDEFVDLVRKV  208

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH--LANSTNS  884
             + L+GGFD+ DLFPS K++H  +GM+PKL K+H   D I   I+  H+EN        N 
Sbjct  209   VELSGGFDVDDLFPSMKFLHVITGMRPKLEKIHKRADTIMGNIVRQHEENRGRPKEDNNI  268

Query  885   SGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1064
               ++ED+VDVLLRV++ G L   IT +NIKAVI D+F  GT+T+AT I W MSE++K PS
Sbjct  269   DVQNEDLVDVLLRVQQSGSLDVQITTNNIKAVIWDVFVAGTDTTATIIEWTMSELMKNPS  328

Query  1065  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1244
             V  KAQAE+R+ L+G +   + DL  LTYL LVIKET+RLHPP PL+ PRE  E   IG 
Sbjct  329   VREKAQAELRKVLRGKEKISEIDLHELTYLNLVIKETMRLHPPSPLLVPRECSESTIIGG  388

Query  1245  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1424
             Y IP  T+V+INAWALA +PE W D ERF+PERF+ S +DF GN++E+IPFGAGRRMCPG
Sbjct  389   YEIPKNTKVMINAWALARDPEYWSDAERFIPERFDGSFIDFKGNNFEYIPFGAGRRMCPG  448

Query  1425  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
             +SF   SI L LA LLYHFNWELP+ + P D DM E  G+   +K +L LI   +V
Sbjct  449   MSFGLASIMLPLALLLYHFNWELPNHMKPHDFDMIEHFGLAVGRKNELSLIPTNYV  504



>ref|XP_009357363.1| PREDICTED: premnaspirodiene oxygenase-like [Pyrus x bretschneideri]
Length=506

 Score =   509 bits (1310),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 256/476 (54%), Positives = 345/476 (72%), Gaps = 6/476 (1%)
 Frame = +3

Query  168   AKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             AK  LPPGPWKLP IG+LH LVG S+PH  LR+L++ YGP+MHL+LGE+STIV+SS + A
Sbjct  28    AKINLPPGPWKLPFIGNLHQLVG-SIPHHGLRDLAKNYGPLMHLKLGEVSTIVVSSAEFA  86

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + KTHD++FASRP I+A  I+ Y  T++ F+PYGDYWRQ+RKIC LELLSMK V+SF 
Sbjct  87    KEVMKTHDVIFASRPHILANSILTYGDTNIGFAPYGDYWRQLRKICTLELLSMKRVQSFR  146

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             S R+EE+ NL++ IRL +ET  P N+TE++  FT    ++ AFG + S+DQ KFI ++KQ
Sbjct  147   SLREEEVLNLINLIRLRAET--PINITEQIYSFTYGFTSRAAFG-IKSKDQDKFIDIVKQ  203

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
              + +AGGFD+ D+FPS   +H  SGM+PKL +LH E D+I + II +HK++   + ++  
Sbjct  204   AMKVAGGFDVADIFPSVSLLHLISGMRPKLERLHKEADRIMENIIKEHKKDMATSESHDI  263

Query  888   GKDEDIVDVLLRV-KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1064
                ED++DVLL+  +E   L+F +T DN+KA+I + F  G ET+ATT+ WA+SEMIK P 
Sbjct  264   EAREDLIDVLLKFHEEESGLEFSLTADNVKAIILETFGAGGETAATTVNWAISEMIKNPR  323

Query  1065  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1244
             +M KAQAEVR+        D+  ++ + +L LVIKETLRLHPP PL+ PR   E  KIG 
Sbjct  324   IMQKAQAEVREVFNTKGQVDETGIKEMIFLNLVIKETLRLHPPFPLLLPRXCRESCKIGG  383

Query  1245  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1424
             Y IP KT+V+INAWA+  +P  W +PE F PERF +SS+D  G ++EFIPFGAGRRMCPG
Sbjct  384   YEIPVKTKVVINAWAIGRDPNYWTNPESFYPERFLDSSIDLKGKNFEFIPFGAGRRMCPG  443

Query  1425  ISFAYTSIALSLAGLLYHFNWELPDGVS-PKDLDMTEAVGVIASKKKDLCLIARPF  1589
             +SF   S+   LA LLYHF+W+L +G+   +DLDMTEA GV   +K+DL LI  P+
Sbjct  444   MSFGLASVEFPLASLLYHFDWKLSNGMKHDEDLDMTEAFGVSVRRKQDLHLIPIPY  499



>ref|XP_007154033.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
 gb|ESW26027.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
Length=511

 Score =   509 bits (1310),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 253/469 (54%), Positives = 340/469 (72%), Gaps = 7/469 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLV-GGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
              KLPPGPWKLP+IG+LH L    +LPH +L++LS KYGP+MHLQLGEIS +++SSP +A+
Sbjct  35    HKLPPGPWKLPVIGNLHQLARADTLPHHTLQSLSHKYGPLMHLQLGEISAVIVSSPDMAK  94

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              I KTHDL F  RP+++   I+ Y STD+AF+PYG+YWRQMRKIC LELLS K V SF  
Sbjct  95    EIMKTHDLNFVQRPQLLCPKILAYGSTDIAFAPYGEYWRQMRKICTLELLSAKRVHSFSF  154

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R+EE++ L+ SI+L +  G   N++E V  F S+L+++ AFG+  SE   + + LLK+ 
Sbjct  155   IREEEVAKLIRSIQLCACAGSQVNVSENVFSFLSTLVSRTAFGKK-SEKGNELLCLLKKG  213

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
               LAGGFDL DLFPS K +H+ + MK KL  +H ELDKI + II +H+  H      +  
Sbjct  214   AELAGGFDLADLFPSLKAVHFLTRMKTKLENMHKELDKILESIISEHQSKH-----RNGD  268

Query  891   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
              +E++VDVLLRV++   L+ P+T +NIKAVI D+F  GT+TSAT + W MSE++K P VM
Sbjct  269   AEENLVDVLLRVQQSATLEVPLTINNIKAVIWDIFGAGTDTSATVLEWGMSELLKNPRVM  328

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
              KAQ E+R+A +G K   + ++  L+YLKLVIKETLRLHPP+PL+ PRE  +  KIG Y 
Sbjct  329   KKAQVEIREAFRGKKRIGESEVYELSYLKLVIKETLRLHPPVPLLLPRECRDSCKIGGYD  388

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP KT+VIINAWAL  +P+ W D ++F+PERF+ +  DF GN++E+IPFGAGRR+CPGI 
Sbjct  389   IPRKTKVIINAWALGRDPKHWYDAQKFIPERFDGTGFDFKGNNFEYIPFGAGRRICPGIL  448

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                 ++ L LA LLYHF+W+LP+G+ P+DLDMTEA G    +K +L LI
Sbjct  449   LGLANVELPLAALLYHFDWKLPNGMKPQDLDMTEAFGATVGRKNNLYLI  497



>ref|XP_011082249.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=530

 Score =   509 bits (1310),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 260/484 (54%), Positives = 358/484 (74%), Gaps = 8/484 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W KSK+  K+KLPPGPWKLPLIG L H+VG SLPH SLR+LS KYGP+MHL+ GE+STIV
Sbjct  50    WKKSKSVKKKKLPPGPWKLPLIGHLLHVVG-SLPHHSLRDLSNKYGPLMHLKFGEVSTIV  108

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP++A+ + KT D   A RP+ +A  I++Y   D+AFSPYG+YWRQMRKIC+LELLS+
Sbjct  109   VSSPKVAKEVLKTVDPACADRPQSLASQIMWYNYIDIAFSPYGEYWRQMRKICILELLSV  168

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF   R++E S LV SIR SS  G P NLT+K   FTS++  + AFG+V  +D+  
Sbjct  169   KNVRSFDYIRKDEASRLVESIRASS--GRPINLTDKTFLFTSAITCRAAFGKVL-KDRET  225

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I+LLK+ + LAGGFD+ DLFPS K ++  +  K KLLK+  ++D I D +I +HK+N L
Sbjct  226   LISLLKEAVVLAGGFDMADLFPSLKILNIINWNKYKLLKMRSKMDAILDRLIDEHKDN-L  284

Query  867   ANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
             A S   +G+   ED+VDVLLR+K+ GE +FPI  +NIKAV+ DMFS GTETS+TT+ WAM
Sbjct  285   ATSKKGNGEMGSEDLVDVLLRLKQSGEFEFPIANNNIKAVLFDMFSAGTETSSTTVDWAM  344

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             +E+++ P V+AKAQAEVR+  KG +T ++ D+  L YLKLVIKETLR+HPP+PL+     
Sbjct  345   AELMRNPHVLAKAQAEVRETFKGKETIEECDVHALKYLKLVIKETLRMHPPIPLLPRA-C  403

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              EE ++  Y IP K +V++N WA+  +P  W  PE F PERFE +S+D++G HY+++PFG
Sbjct  404   REECEVEGYTIPLKAKVMVNTWAMGRDPNYWPQPENFKPERFEENSIDYLGAHYQYLPFG  463

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             +GRR+CPG++F   ++ L LA LLYHF+W+LP+G+ P D+DM +A G+   +K +L +I 
Sbjct  464   SGRRICPGMTFGLANVELPLAQLLYHFDWKLPNGMKPSDMDMADAEGIAVGRKHNLLVIP  523

Query  1581  RPFV  1592
              P++
Sbjct  524   TPYI  527



>ref|XP_011082374.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=517

 Score =   508 bits (1307),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 259/498 (52%), Positives = 350/498 (70%), Gaps = 21/498 (4%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W KSK  +  KLPPGP KLP+IG LH +   +LP RS R+L+++YGPIMHL+LGE+ TIV
Sbjct  26    WKKSKPVS-VKLPPGPKKLPIIGDLHLI--SALPFRSFRDLAKQYGPIMHLKLGEVPTIV  82

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP++A+ + + HD  FA RP+ +A+ I++Y   D+AFSPYGDYWRQMRKIC++ELL+ 
Sbjct  83    VSSPEIAKEVLREHDPNFADRPEAIAMKIMWYNYIDIAFSPYGDYWRQMRKICIIELLNA  142

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R +E+S L+ SIRLSS  G P NLTEK+   TSS+  + AFG+VC +D   
Sbjct  143   KNVRSFSSIRNDEVSRLIKSIRLSS--GEPVNLTEKIFSLTSSITCRAAFGKVC-KDSDA  199

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN--  860
              I LLK+ + +AGGF++ DLFPS K I+  S  K +L+ +  +LD I D II +HKEN  
Sbjct  200   LIKLLKEGIQMAGGFEIADLFPSSKIINALSWSKLRLVMMRRKLDVILDDIIKEHKENLA  259

Query  861   ------------HLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTG  1004
                           A   N    +ED+VDV LR++E GEL+FPI  DNIKAVI DMFS G
Sbjct  260   KMARENGDGEGKESARRGNGEFGNEDLVDVFLRIQESGELEFPIGNDNIKAVIYDMFSAG  319

Query  1005  TETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrl  1184
             TETS+T I W M+E+++ P VMAKAQAEVR+   G++   + D++ L YLKLVI+E+LRL
Sbjct  320   TETSSTAIDWTMAELVRNPRVMAKAQAEVREFFNGSEIIQENDVQKLKYLKLVIRESLRL  379

Query  1185  hpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVD  1364
             HPP+P++    S EE +I  Y IP K +V++N WA+  +P+ W +PE F PERFEN S+D
Sbjct  380   HPPVPILPRA-SREEREISGYTIPAKVKVLVNNWAMQRDPKYWTNPETFEPERFENQSLD  438

Query  1365  FMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGV  1544
             F+G  ++++PFG GRRMCPG++F   S+ L LA LLY FNW+LPDGV  +DLDM E  G+
Sbjct  439   FLGADFQYLPFGTGRRMCPGMTFGLASVELPLAQLLYSFNWKLPDGVKAEDLDMIENPGI  498

Query  1545  IASKKKDLCLIARPFVDL  1598
              AS+K +L ++A P+  L
Sbjct  499   TASRKDNLFVVATPYESL  516



>ref|XP_007020549.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY12074.1| Cytochrome P450 [Theobroma cacao]
Length=504

 Score =   506 bits (1303),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 248/471 (53%), Positives = 339/471 (72%), Gaps = 5/471 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LPPGPWKLP+IG++H L  GSLPH SL +L++KYGP+MHLQLGE+S I++SSP+ A  + 
Sbjct  34    LPPGPWKLPVIGNMHQL-AGSLPHHSLSDLAKKYGPLMHLQLGEVSNIIVSSPETAAEVM  92

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD++FA+RP ++  +IV Y +TD+AFSPYG YWRQ+RKIC LE+L+ K V+SF   R+
Sbjct  93    KTHDILFANRPYLLCANIVSYNATDIAFSPYGAYWRQLRKICTLEMLTSKRVQSFSPIRE  152

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE+S LV +I  SS+ G P NL++ +   T  ++++ AFG  C +D+G+F  L ++ + L
Sbjct  153   EEVSKLVRAI--SSKAGSPVNLSKMLYSLTYEIVSRTAFGGKC-KDKGEFTLLFREAIKL  209

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
               GF + DLFPS K + + +G++PKL +LH ++DKI + +I +HK +    + +  G+ +
Sbjct  210   GAGFTVSDLFPSVKLLQFLNGLRPKLERLHQKVDKILENVINEHKASK-GMAKSGEGESD  268

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+VDVLL ++E G L+FP+T DNIKAV+ D+F  G++TS T + WAMSEM+K P V+ KA
Sbjct  269   DLVDVLLTLQEHGNLEFPLTTDNIKAVLLDIFIAGSDTSFTAVEWAMSEMLKNPRVLQKA  328

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             QAEVRQ        D + L  L YLKLVI ETLRLHPP+PL+ PRE  E  KI  Y IP 
Sbjct  329   QAEVRQVFNRKGDVDGEGLHELEYLKLVINETLRLHPPIPLLLPRECSERCKINGYDIPV  388

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
             K++VIINAWA+  NP+ W + ERF PERF NSS+D+ G H+EFIPFGAGRRMCPG+ +  
Sbjct  389   KSKVIINAWAIGRNPDYWTEAERFYPERFLNSSIDYKGAHFEFIPFGAGRRMCPGMLYGI  448

Query  1440  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
              ++ L LA LLYHF+WELP G   +DLDM E  G +  +K DLCL+  P+ 
Sbjct  449   ANVELPLAQLLYHFDWELPGGRKIEDLDMDEVFGAVVRRKNDLCLVPIPYC  499



>gb|KDP26294.1| hypothetical protein JCGZ_22279 [Jatropha curcas]
Length=528

 Score =   506 bits (1303),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 257/475 (54%), Positives = 348/475 (73%), Gaps = 7/475 (1%)
 Frame = +3

Query  168   AKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             A +KLPPGP KLP IG+LH+L GGSLPH  L++L+ +YGP+MHLQLGE+  IVISS ++A
Sbjct  43    AIKKLPPGPKKLPFIGNLHNL-GGSLPHHVLKDLANQYGPLMHLQLGEVPAIVISSSKMA  101

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + +T D VFA RP+++A  I+ Y STD+ F+  G+YW+QMRK C  ELL  K VKS  
Sbjct  102   QEVLRTQDHVFAQRPELLASKILSYDSTDLVFA-KGEYWKQMRKFCFNELLGAKKVKSLA  160

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
               R++E+SNL+ SIR  S  G P NLTEK+ W TS +  + AFG    EDQ   I++ ++
Sbjct  161   PLREDEVSNLLESIR--SAGGSPVNLTEKIFWMTSVIAVRAAFGNKW-EDQKTIISIARE  217

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
              LSLAGGFDL DL+P ++++H  + MKP+L K+  +LD + D I+ +HKE  L+  T   
Sbjct  218   SLSLAGGFDLADLYPEREFLHIITNMKPRLEKMRVKLDGVLDRIVNEHKEKLLSGQTQPD  277

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
               +E +VDVLLR +E G L+ P+T DN+KAVI DMF  GT+TS+TT  WA+SEMI+ P V
Sbjct  278   --NEVLVDVLLRFQETGNLRCPVTIDNVKAVIWDMFVAGTDTSSTTTEWALSEMIRNPKV  335

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             M KAQ EVRQA KG  T D++D+++L YLK VIKETLRLHPP+PL+ PRES ++++I  Y
Sbjct  336   MKKAQEEVRQAAKGKTTIDEEDIQDLPYLKQVIKETLRLHPPVPLLLPRESNQDSEIEGY  395

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP +T+VI+NAWA+  +P  WEDPE F+PERF +SS+DF GN++ +IPFGAGRR+CPG+
Sbjct  396   YIPERTKVIVNAWAIGRDPAYWEDPESFIPERFSDSSIDFKGNNFTYIPFGAGRRICPGM  455

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
             +F   ++ L LA LLYHF+++LPDG+  +DLDMTEA G    +K  L +IA P+V
Sbjct  456   TFGLANVELPLAKLLYHFDFKLPDGIRGEDLDMTEAFGATVGRKNQLTVIATPYV  510



>ref|XP_008385924.1| PREDICTED: premnaspirodiene oxygenase-like [Malus domestica]
Length=506

 Score =   505 bits (1300),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 256/476 (54%), Positives = 342/476 (72%), Gaps = 6/476 (1%)
 Frame = +3

Query  168   AKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             AK  LPPGPWKLP IG+LH LVG S+PH  LR+L++KYG +MHL+LGE+STIV+SS + A
Sbjct  28    AKINLPPGPWKLPFIGNLHQLVG-SIPHHGLRDLAKKYGXLMHLKLGEVSTIVVSSAEFA  86

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + + KTHD+ FASRP I+A  I+ Y  T++ F+PYGDYWRQ+RKIC LELLSMK V+SF 
Sbjct  87    KEVMKTHDVXFASRPHILANSILTYGDTNIGFAPYGDYWRQLRKICTLELLSMKRVQSFR  146

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             S R+EE+ NL+  IRL +ET  P N+TE++  FT    ++ AFG + S+DQ KFI ++KQ
Sbjct  147   SLREEEVFNLIKLIRLRAET--PINITEQIYSFTYGFTSRAAFG-IKSKDQDKFIDIVKQ  203

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
              + +AGGFD+ D+FPS   +H  SGM+PKL +LH E D+I + II +HK++   + +   
Sbjct  204   AMKVAGGFDVADVFPSVSLLHLISGMRPKLERLHKEADRIMENIIKEHKKDMATSKSQDV  263

Query  888   GKDEDIVDVLLRV-KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1064
                ED++DVLL+  +E   L+F +T DN+KA+I + F  G ET+ATT+ WA+SEMIK P 
Sbjct  264   EAREDLIDVLLKFHEEESGLEFSLTADNVKAIILETFGAGGETAATTVNWAISEMIKNPR  323

Query  1065  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1244
             +M KAQAEVR+        D+ +++ + YL LVIKETLRLHPP PL+ PRE  E  KI  
Sbjct  324   IMQKAQAEVREIFNXKXQVDETEIKEMMYLNLVIKETLRLHPPFPLLLPRECRESCKIDG  383

Query  1245  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1424
             Y IP KT+V+INAWA+  +P  W +P+ F PERF +SS+D  G ++EFIPFGAGRRMCPG
Sbjct  384   YEIPVKTKVVINAWAIGRDPNYWTNPDSFYPERFLDSSIDLKGKNFEFIPFGAGRRMCPG  443

Query  1425  ISFAYTSIALSLAGLLYHFNWELPDGVS-PKDLDMTEAVGVIASKKKDLCLIARPF  1589
             +SF   S+   LA LLYHF+W+L  G+   +DLDMTEA GV   +K+DL LI  P+
Sbjct  444   MSFGLASVEFPLASLLYHFDWKLSXGMKHDEDLDMTEAFGVSVRRKQDLHLIPIPY  499



>gb|KEH34024.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   505 bits (1300),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 248/481 (52%), Positives = 350/481 (73%), Gaps = 7/481 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K K+ +   +PPGP KLP+IG++H+L+  S PH+ LR+L++KYGP+MHLQLGE+S +VIS
Sbjct  26    KKKSYSAYNIPPGPRKLPIIGNIHNLLS-SQPHQKLRDLAKKYGPVMHLQLGEVSAMVIS  84

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP+ A  + KTHD+ F+SRP+I+A +I+ Y ST +AF+PYG+YWRQ+RKIC LELLS+K 
Sbjct  85    SPECASEVMKTHDIHFSSRPQILATEIMSYNSTSIAFAPYGNYWRQLRKICTLELLSLKR  144

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V S+   R+E   NL   I  +S+ G P N+TE V     +++++ AFG  C +DQ KFI
Sbjct  145   VNSYQPIREEVFFNLAKWI--ASQVGIPINITEAVRSSIYTIVSRAAFGNEC-KDQDKFI  201

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
             +++KQ + +AGGFDLGDLFPS KW+   +GM+PKL + H + D+IF+ II +HKE     
Sbjct  202   SVVKQSIKVAGGFDLGDLFPSAKWLQLVTGMRPKLERFHRQTDQIFENIINEHKEEKYTK  261

Query  873   STNSSGK-DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
             + +  GK +ED++DVLL+ ++G   +F +T++NIKA+I D+F+ G ETSA+TI WAM E+
Sbjct  262   AKDDQGKVEEDLIDVLLKYEDGSNQEFTLTKNNIKAIILDIFAAGGETSASTIDWAMVEL  321

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             +K P +M KAQ EVR+  K     D+  +  L YLKLV+KETLRLHPP PL+ PRE  +E
Sbjct  322   VKDPRIMKKAQDEVREVFKMKGRVDENCINELNYLKLVVKETLRLHPPAPLLLPRECSQE  381

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
               I  Y IP KT+V++NAWA+A +P  W +PERF PERF +S +D+ G+++E+IPFGAGR
Sbjct  382   CDINGYHIPIKTKVLVNAWAVARDPNYWTEPERFYPERFIDSDIDYKGSNFEYIPFGAGR  441

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R+CPG +F  T+I L LA LLYHF+W+LP G++ +++DMTE  G+   +K DL L   PF
Sbjct  442   RICPGSTFGLTNIELVLAMLLYHFDWKLPSGITGEEMDMTEEFGLTVRRKDDLLLC--PF  499

Query  1590  V  1592
             V
Sbjct  500   V  500



>gb|KEH34017.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=504

 Score =   504 bits (1297),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 345/478 (72%), Gaps = 5/478 (1%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
                K+ +   +PPGP KLP+IG++H+L+  S PHR LR+L++KYGP+MHLQLGE+S +VI
Sbjct  25    GNKKSYSTYNIPPGPIKLPIIGNIHNLLT-SQPHRKLRDLAKKYGPLMHLQLGEVSAMVI  83

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP+ A  + KTHD+ FASRP+I+A +I+ Y ST++AF+PYG+YWRQ+RKIC LELLS+K
Sbjct  84    SSPECAGEVMKTHDIHFASRPQILATEIMSYNSTNIAFAPYGNYWRQLRKICTLELLSLK  143

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V S+   R+E  SNLV  I  +S  G P N+TE V     +++++ AFG  C +DQ KF
Sbjct  144   RVNSYQPIREEVFSNLVKWI--ASRDGIPINITEAVRSSIYTIVSRAAFGNEC-KDQDKF  200

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I+++KQ + +AGGFDLGDLFPS KW+   +GM+PKL + H + D+I + II +HKE    
Sbjct  201   ISVVKQSIKVAGGFDLGDLFPSAKWLQLVTGMRPKLERFHRQTDQILENIINEHKEEKYT  260

Query  870   NSTNSSGK-DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
              + +  GK +ED+VDVLL+ ++G   +F +T++NIKA+I D+F  G ETSA+TI WAM E
Sbjct  261   KAKDDQGKVEEDLVDVLLKYEDGSNQEFTLTKNNIKAIILDVFGAGGETSASTIDWAMVE  320

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MI+ P +M KAQ EVR+  K     D+  +  L YLK V+KETLRLHPP PL+ PRE  +
Sbjct  321   MIRDPRIMKKAQDEVREVFKMKGRVDENCINELNYLKSVVKETLRLHPPTPLLLPRECRQ  380

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
               +I  Y IP K++VI+NAWA+A +P  W +PERF PERF +S++D+ G++YE+IPFGAG
Sbjct  381   TCEINGYHIPIKSKVIVNAWAIARDPNYWTEPERFYPERFLDSAIDYKGSNYEYIPFGAG  440

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             RR+CPG +F   SI L+LA LLYHF+W+LP G+  +DLDMT+  G    +K DL L +
Sbjct  441   RRICPGSTFGLRSIELALAMLLYHFDWKLPSGIRSEDLDMTDEFGATMRRKDDLLLFS  498



>ref|XP_004231934.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   504 bits (1297),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 252/482 (52%), Positives = 352/482 (73%), Gaps = 6/482 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W KSK   + KLPPGP KLP IG+LH L   SLPH + +NLS KYGP+MHLQLGE+S ++
Sbjct  25    WKKSKI--QYKLPPGPRKLPFIGNLHQL-SSSLPHHTFKNLSNKYGPMMHLQLGEVSAVI  81

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSPQ+A+ + KTHDL+FA+RP+++++ I+   S  ++FSPYG  WRQ+RK+CVLELLS 
Sbjct  82    VSSPQVAKEVLKTHDLIFANRPQLLSVQILSNNSPTLSFSPYGANWRQLRKVCVLELLSA  141

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R+EE+ NL+ +I L  +   P +++E +   T+++ A+ AFG+ C + + +
Sbjct  142   KRVQSFESIREEEVDNLIEAISLI-QPQVPIDISEMIFSMTNNITARAAFGKKC-KHKDE  199

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI  +K +  L+GGFD+ DLFPS K  H  SG+KP L K+H ++DKIF+ II +HKEN  
Sbjct  200   FIKAMKTITELSGGFDIPDLFPSLKIFHSLSGVKPALEKVHQKVDKIFEDIIQEHKENKR  259

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               S+N   K ED+VDVLLRV+E G+L+ PI+ + +K+VI +MF  GT+TS+T + WA+SE
Sbjct  260   DMSSNMLYK-EDLVDVLLRVQESGDLEIPISRNTLKSVILEMFIGGTDTSSTVLEWAISE  318

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P VM KAQAEVR+  KG     + +++ L Y+K+VIKETLR+HPPLPL+ PRE++E
Sbjct  319   MMKNPQVMEKAQAEVREVFKGKSKITESEIQKLDYIKMVIKETLRMHPPLPLLLPREAIE  378

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             + +IG Y IP KT+VIINAWA+  +P+ WE+ E F PERF++  +DF+G + E+IPFG G
Sbjct  379   KCEIGGYDIPAKTKVIINAWAIGRHPQHWENAECFEPERFQDLDLDFVGTNLEYIPFGGG  438

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RRMCPG  F   ++ L LA LL+HF+WELPDG+   DLDMTE  G    +K DL L+A+P
Sbjct  439   RRMCPGSLFGIANVELPLAKLLFHFDWELPDGIEASDLDMTETFGATVGRKNDLYLVAKP  498

Query  1587  FV  1592
              +
Sbjct  499   HI  500



>emb|CDP07887.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   503 bits (1294),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 335/482 (70%), Gaps = 29/482 (6%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W +SKAA  QKLPP P KLP+IG++HHLVG S PH +LR L+R++G +M+LQLGEIS+IV
Sbjct  24    WKRSKAA--QKLPPSPSKLPVIGNMHHLVG-SPPHHALRKLARQHGALMYLQLGEISSIV  80

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP LA+ I KTHDL FA+R + +   I+ Y S+D+A  PYGDYWRQMRKIC LELLS 
Sbjct  81    VSSPHLAKEIMKTHDLAFANRAEFLTSKILMYNSSDIACCPYGDYWRQMRKICTLELLSA  140

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S RQ+E S+L++S++  +  G   N++EK+  +TSS++ + AFG+V  +   +
Sbjct  141   KNVRSFGSIRQDEASHLLASVQALAAAGKLINISEKLYSYTSSMVCRAAFGKVSKDLHRE  200

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             F+ L  +   L+  FD+ DLFPS K +H    +K +L+K+H ++DK+   II  H +N  
Sbjct  201   FLQLTSESAPLSSTFDISDLFPSFKILHPLLSVKSQLVKIHLKMDKLLGNIIDQHVDNRA  260

Query  867   -ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
               N       +ED++DVLLRVKE G+LQFPIT +NIKA++ D+FS GTETS+TT+ WAMS
Sbjct  261   RTNMATGESGNEDLIDVLLRVKESGDLQFPITNNNIKAIVIDVFSAGTETSSTTVEWAMS  320

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             EM++ P+VMAKAQ+E+R A KG K  ++ D++ L                          
Sbjct  321   EMVRNPNVMAKAQSEIRTAFKGKKKIEETDIQELK-------------------------  355

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             E+ +I  Y IP KTRV++NAWA+  +PE W+DPE F P+RF+ + VDF G H+E++PFGA
Sbjct  356   EQCEIEGYTIPVKTRVLVNAWAIGRDPEYWDDPESFKPDRFKTNPVDFTGTHFEYLPFGA  415

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRRMCPGISF   ++ L LA LLYHFNW+LP+G+ P DLDM+E VG+ AS+K  L L+A 
Sbjct  416   GRRMCPGISFGLANVDLPLALLLYHFNWKLPNGLDPCDLDMSETVGITASRKDSLRLLAT  475

Query  1584  PF  1589
              +
Sbjct  476   SY  477



>ref|XP_003611883.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94841.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   504 bits (1297),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 256/473 (54%), Positives = 334/473 (71%), Gaps = 9/473 (2%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVG-GSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             KLPPGP KLPLIG+LH +   GSLPHR+ + L+ KYGPI+HL+LGE S +VISSP+LA+ 
Sbjct  33    KLPPGPMKLPLIGNLHQIAALGSLPHRAFKQLAHKYGPIVHLKLGETSAVVISSPKLAKE  92

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             I KTHD++FA+RP + A  I+ Y S D+AFSPYGDYWRQMRKIC+LELLS K V+SF   
Sbjct  93    ILKTHDVIFANRPHLQASHIMTYGSKDIAFSPYGDYWRQMRKICMLELLSNKRVQSFSYI  152

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             R++E  N + SI+  S  G   NLT ++    SS +++ AFG   +EDQ +F++++++ +
Sbjct  153   REDETRNFIKSIQ--SSEGSSVNLTNRIFSLVSSTVSRSAFGDK-TEDQDEFVSVIRKAI  209

Query  714   SLAGGFDLGDLFPS-KKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
                GG +  DLFPS K  I   +G K K+LK+H + DKI +II+  H+E           
Sbjct  210   ESVGGLEPADLFPSMKSIIQMLTGTKSKVLKMHKKADKILEIIVRKHQEKQRRAKEGKVS  269

Query  891   KDE----DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1058
              DE    D+VDVLLR++E G L+ PIT  NIKAVI D F+ GT+T+ +TI+WAMSE++K 
Sbjct  270   SDEVEQEDLVDVLLRIQESGSLEIPITTSNIKAVIFDAFAAGTDTTTSTIVWAMSELMKN  329

Query  1059  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1238
             PSVM KAQAE+R+A KG +   + D++ L YLKLVIKETLRLH P PL+ PRE  E   I
Sbjct  330   PSVMNKAQAEIREACKGKEIISENDIQELPYLKLVIKETLRLHSPTPLLLPRECTELTNI  389

Query  1239  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1418
               Y IP KT+V+IN WA+A +P+ W D E F PERFE SS+DF GN++E++PFGAGRR+C
Sbjct  390   DGYDIPKKTKVMINVWAMARDPQYWTDAEMFNPERFEGSSIDFRGNNFEYLPFGAGRRIC  449

Query  1419  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             PG+ F    I L +A LLYHFNWELP+ + P DLDMTE  G+   KK DLCLI
Sbjct  450   PGLQFGIAGIMLPVALLLYHFNWELPNKMKPMDLDMTEHYGLAIGKKSDLCLI  502



>ref|XP_003516583.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   503 bits (1296),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 254/482 (53%), Positives = 344/482 (71%), Gaps = 11/482 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             + K K     KLPPGP KLPLIG+LH L + GSLPHR+LR+L+ KYGP+MHLQLGEIS++
Sbjct  25    YYKPKTTLSHKLPPGPKKLPLIGNLHQLAMAGSLPHRTLRDLALKYGPLMHLQLGEISSV  84

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SSP +A+ I KTHDL F  RP+ +   I+ Y  +D+AF+PYGDYWRQM+KICV ELLS
Sbjct  85    VVSSPNMAKEIMKTHDLAFVQRPQFLPAQILTYGQSDIAFAPYGDYWRQMKKICVSELLS  144

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF   R++E +  + S+R S   G P NLT K+    SS I++VAFG  C +DQ 
Sbjct  145   AKRVQSFSDIREDETAKFIESVRTSE--GSPVNLTNKIYSLVSSAISRVAFGNKC-KDQE  201

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             +F++L+K+++ +  GF+L DLFPS K +H  +G K KL K+  ++DKI D I+ +H+E  
Sbjct  202   EFVSLVKELVVVGAGFELDDLFPSMK-LHLINGRKAKLEKMQEQVDKIVDNILKEHQEKR  260

Query  864   LANSTNSSGK----DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  1031
                     G+    +ED+VDVLLR+++   L+  IT  NIKA+I D+F+ GT+TSA+T+ 
Sbjct  261   --ERARREGRVDLEEEDLVDVLLRIQQSDNLEIKITTTNIKAIILDVFTAGTDTSASTLE  318

Query  1032  WAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihp  1211
             WAM+EM++ P V  KAQAEVRQA +  K  ++ D+E L YLKLVIKETLRLH P PL+ P
Sbjct  319   WAMAEMMRNPRVREKAQAEVRQAFRELKIINETDVEELIYLKLVIKETLRLHTPSPLLLP  378

Query  1212  rESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFI  1391
             RE  +   I  Y IP KT+V+INAWA+A +P+ W D ERF+PERF+ SS+DF GN++E++
Sbjct  379   RECSKRTIIDGYEIPVKTKVMINAWAIARDPQYWTDAERFVPERFDGSSIDFKGNNFEYL  438

Query  1392  PFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLC  1571
             PFGAGRRMCPG++    +I L LA LLYHFNWELP+ + P+ +DM E  G+   +K +LC
Sbjct  439   PFGAGRRMCPGMTLGLANIMLPLALLLYHFNWELPNEMKPEYMDMVENFGLTVGRKNELC  498

Query  1572  LI  1577
             LI
Sbjct  499   LI  500



>emb|CDP10756.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   503 bits (1295),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 256/468 (55%), Positives = 343/468 (73%), Gaps = 8/468 (2%)
 Frame = +3

Query  186   PGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAITKT  365
             PGPWKLPLIGS+HHL  GSLPH +LR+L+ K+GPIMHLQ+GEIST+VIS+PQ A+ + K 
Sbjct  39    PGPWKLPLIGSMHHL-AGSLPHHALRDLAEKFGPIMHLQMGEISTVVISAPQEAKEVLKV  97

Query  366   HDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEE  545
             HD++FA RP+ +A  I+ Y + D+AFSPYGDYW+QMRKIC+LELLS K V+SF + R++E
Sbjct  98    HDIIFADRPEFLASKILGYDNLDIAFSPYGDYWKQMRKICLLELLSPKSVRSFGTLREDE  157

Query  546   LSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAG  725
                ++ SI+ S+    P N+T+K   FT+ ++ + AFG+  +  Q + I L+   +S +G
Sbjct  158   ALKVIRSIKSSNS---PVNITDKAFTFTNDIVCRAAFGKSFAH-QDRLITLINGAISASG  213

Query  726   GFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST--NSSGKDE  899
             GFD+ DLFPS K++H  SG+KPKL+KLH+E+D++ + II + K+     ST   S  + E
Sbjct  214   GFDIADLFPSLKFLHSLSGLKPKLIKLHNEIDQMLETIISERKQKRANQSTPVGSQSEVE  273

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+VDVLLR+KE G+   PI+ D++KAVI D+F+ GTETSA TI +AM+E+I+ P  M K 
Sbjct  274   DLVDVLLRLKESGDFNIPISTDSVKAVIWDIFAAGTETSAATIDYAMAELIRNPGAMEKV  333

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             QAE+RQ LKG +T  + DL+ L YLK VIKETLRLHPPLPLI PRE  E  KIG Y IP 
Sbjct  334   QAELRQVLKGKETVQETDLKELNYLKAVIKETLRLHPPLPLILPREGREPCKIGGYDIPA  393

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
             KT+V+INAWA+  +PE W +PE+F PERF +S  D +G ++E+IPFG GRR+CPG+SF  
Sbjct  394   KTKVMINAWAIHRHPEVWPNPEKFKPERFLDSGSDSIGMNFEYIPFGGGRRICPGVSFGS  453

Query  1440  TSIALSLAGLLYHFNWELPDG-VSPKDLDMTEAVGVIASKKKDLCLIA  1580
               + L LA LLYHF+W LP+G VSP+  DMTE  G  A +K  L L+A
Sbjct  454   AGVELLLAKLLYHFDWSLPNGTVSPETPDMTEVFGATARRKSSLILVA  501



>ref|XP_004506715.1| PREDICTED: cytochrome P450 71D9-like [Cicer arietinum]
Length=507

 Score =   503 bits (1294),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 247/480 (51%), Positives = 352/480 (73%), Gaps = 7/480 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K K+ +   LPPGP KLP+IG++H+L+  S PH+ LR+L++KYGP+MHLQLGE+STI+IS
Sbjct  26    KKKSYSTYNLPPGPIKLPIIGNIHNLLS-SQPHKKLRDLAKKYGPLMHLQLGEVSTIIIS  84

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP+ A  + KTHD+ FASRP+I+A +I+ Y +T++AF+PYG+YWRQ+RKIC LELLS+K 
Sbjct  85    SPECASEVMKTHDINFASRPQILATEIMSYNTTNIAFAPYGNYWRQLRKICTLELLSLKR  144

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V S+ S R+E   NLV   R+ SE G   NLT+ V     +++++ AFG  C +DQ KFI
Sbjct  145   VNSYKSIREEVFFNLVE--RIGSENGSVVNLTQAVISSIYTIVSRTAFGNEC-KDQEKFI  201

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
             ++LKQ + +A GF+LGDLFPS KWI + +G++PKL + H + D+I + II +H+E     
Sbjct  202   SILKQSIKVASGFNLGDLFPSSKWIQHVTGLRPKLEEFHRQTDQIVENIINEHREAKYTK  261

Query  873   STNSSGK-DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
             + +  G+ +ED+VDVLL+ ++G   +F +T+ NIKA+I D+F  G ETSA+TI WAM+EM
Sbjct  262   AKDDQGEVEEDLVDVLLKYEDGSNQEFSLTKSNIKAIIMDIFGAGGETSASTIDWAMAEM  321

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             ++ P +M KA+ EVR+     +  D+  +  L YLKLVIKETLRLHPP PL+ PRE  + 
Sbjct  322   VRDPRIMQKAKTEVREVFNMKEKVDENCINELNYLKLVIKETLRLHPPAPLLLPRECSKG  381

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              +I  Y IP K++V+INAWA+A +P  W +PERF PERF +S+VD+ GN++E+IPFGAGR
Sbjct  382   CEIHGYHIPSKSKVLINAWAIARDPNYWIEPERFYPERFIDSTVDYKGNNFEYIPFGAGR  441

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             RMCPG +F   ++ ++LA LLYHF+W+LP G++ +++DMTE  GV   +K DL L+  PF
Sbjct  442   RMCPGSTFGLRNVEVALAMLLYHFDWKLPCGITSEEMDMTEEFGVTVRRKDDLLLL--PF  499



>ref|XP_011081934.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=501

 Score =   502 bits (1292),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 257/478 (54%), Positives = 348/478 (73%), Gaps = 11/478 (2%)
 Frame = +3

Query  147   WAKSKAAAK-QKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W K K+  K +KLPP P +LP+IG LHHLVGG LPH +LR +++KYGP+++L+LGE+S +
Sbjct  26    WMKPKSPRKYEKLPPSPPQLPVIGHLHHLVGG-LPHHALRRVAQKYGPVLYLKLGEVSAV  84

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             VISS +  + + K  D   A RP+ +   I++Y  TD+AFS Y +YWRQMRKIC+LELLS
Sbjct  85    VISSREATKEVVKVQDPACADRPESIGSKIMWYDYTDIAFSAYNEYWRQMRKICILELLS  144

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K VKSF S RQ+E+S L+ S  L S +G   NLTEKV  FTSS+  + AFG+V   D+ 
Sbjct  145   AKNVKSFGSIRQDEVSRLMKS--LQSSSGQAINLTEKVFAFTSSITCRAAFGKVM-RDRD  201

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
               IA+LK+ +++AGGF+L DLFPS K +H  S  K KLL++  +LD I D I+ +HK   
Sbjct  202   VLIAMLKKAVTMAGGFELADLFPSSKLLHVLSWNKYKLLRMRRKLDTILDAILEEHK---  258

Query  864   LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
             L  S    G  EDIVDVLLR+++ GELQFPIT DN+KAVI DMFS GTETS+TTI WAM+
Sbjct  259   LKQSGEFGG--EDIVDVLLRMQKTGELQFPITNDNVKAVIFDMFSAGTETSSTTIDWAMA  316

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             E+++ P VMAK QAEVR+A KG  T ++ D++ L YLKLVIKET RLHPP+PL+      
Sbjct  317   ELMRNPRVMAKVQAEVREAFKGKTTVEESDVQALKYLKLVIKETFRLHPPIPLLPRA-CR  375

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             +E K+  Y IP K++V+IN WA+  +P  W+ P+ F PERF+N+S+DF+GN++E+IPFGA
Sbjct  376   DECKVNGYTIPLKSKVMINIWAMGRDPAYWDQPDTFQPERFDNNSIDFLGNNFEYIPFGA  435

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GRR+CPG++F   ++ L LA LLYHF+W++P G++P D+DMTEA G+  S++  L L+
Sbjct  436   GRRICPGMNFGLANVELPLAQLLYHFDWKMPKGMTPDDIDMTEAEGIAVSRRNALLLV  493



>ref|XP_003611886.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94844.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   501 bits (1291),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 261/485 (54%), Positives = 345/485 (71%), Gaps = 7/485 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             ++K+K +   KLPPGP K PLIG+L  L +    PH +L  LS KYGP+MH+QLGEIST+
Sbjct  24    YSKTKKS-HSKLPPGPMKFPLIGNLPQLAMSKKRPHHALHELSHKYGPLMHIQLGEISTV  82

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             ++SSP+LA+ I KTHD  FA+RPK+++ +I+ Y S D+ FSPYGD+WRQMRKICV ELLS
Sbjct  83    IVSSPKLAKEIMKTHDAAFANRPKLLSPEIMAYGSKDIVFSPYGDFWRQMRKICVFELLS  142

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF   R++E   L+ SI+  S TG   NLT ++    SS I++ AFG   S+DQ 
Sbjct  143   AKRVQSFSYIREDETKKLIQSIQ--SSTGSTINLTSRIFSMVSSNISRAAFGD-KSKDQD  199

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE--  857
             +F+ L+++V+ ++ GF + DLFPS K +H  SGMKPKL K+H  +DKI + II  H+E  
Sbjct  200   EFVDLVRKVVEMSSGFGVDDLFPSIKPLHILSGMKPKLEKIHKRVDKIIENIIRQHQEKR  259

Query  858   NHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
                    N+   +ED++DVLLRV++   L   IT +NIKAVI D+F  GT+T++TTI WA
Sbjct  260   ERAKEDDNNEVDNEDLLDVLLRVQQSDNLDIKITTNNIKAVIWDVFVAGTDTTSTTIEWA  319

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             MSEM+K PSV  KAQAE+R+A KG K   + DL  LTY KLVIKET+RLHPP PL+ PRE
Sbjct  320   MSEMMKNPSVREKAQAELREAFKGKKIISESDLNELTYFKLVIKETMRLHPPSPLLVPRE  379

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               E   I  Y IP  T+V+INAWA+A +P+ W D E F+PERF+ S +DF GN++E+IPF
Sbjct  380   CTELTIIDGYEIPKNTKVMINAWAVARDPQYWTDAEMFIPERFDGSLIDFKGNNFEYIPF  439

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRRMCPG+SF   S+ L LA LLYHFNWELP+ + P+DLDMTE VG+   ++ +LCLI
Sbjct  440   GAGRRMCPGMSFGIASVMLPLALLLYHFNWELPNQMKPEDLDMTENVGLAVGRENELCLI  499

Query  1578  ARPFV  1592
                +V
Sbjct  500   PNVYV  504



>gb|AFK45297.1| unknown [Lotus japonicus]
Length=489

 Score =   499 bits (1286),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 252/461 (55%), Positives = 334/461 (72%), Gaps = 10/461 (2%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVG-GSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             K  + A  KLPPGPWKLPLIG+LH +   GSLPH SLR L+ KYGP+MHLQLGE ST+V+
Sbjct  29    KVTSTAVHKLPPGPWKLPLIGNLHQMAAAGSLPHHSLRELANKYGPLMHLQLGESSTVVV  88

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP +A+ I KTH L FA RP++++  I+ Y STD+AF+PYGDYWRQMRKIC LELLS K
Sbjct  89    SSPDMAKEIMKTHGLAFAQRPELLSPKILAYGSTDIAFAPYGDYWRQMRKICTLELLSAK  148

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+SF   R++E++ L+ SI LS+  G P NL++ V    ++ +++V FG+  SE + + 
Sbjct  149   RVQSFSFIREDEVAKLIQSIHLSASAGSPFNLSKSVFSLVNTFLSRVVFGKK-SECEDEL  207

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             ++L+K+ + L  GFD+ +LFPS K +H  + M+ KL  +H +LDKIFD I+ +H+ +H  
Sbjct  208   LSLIKKAVELTAGFDVAELFPSFKPLHLITRMEAKLENMHKKLDKIFDSIVNEHQSDH--  265

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                   GK E++VDVLLR++  G L  PIT +NIKAVI D+ + GT+TSAT + WAM+E+
Sbjct  266   ------GKGENLVDVLLRMQHSGNLYIPITVNNIKAVIWDIIAAGTDTSATALEWAMAEL  319

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             +K P V  KAQAE+R+A KG KT ++ DL  L+YLK VIKETLRLHPP PL+ PRE  E 
Sbjct  320   MKNPRVREKAQAELREAFKGKKTINETDLCKLSYLKSVIKETLRLHPPAPLLVPRECREA  379

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              KIG Y IP KT+VI+NAWAL  +P  W D E+F+PERF  +SVDF GN++E+IPFGAGR
Sbjct  380   CKIGGYEIPVKTKVIVNAWALGRDPNHWYDAEKFIPERFHETSVDFKGNNFEYIPFGAGR  439

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTE  1532
             R+CPGI     +I L LA  LYHF+W LP+G+  +DLDM E
Sbjct  440   RICPGILLGLANIELPLAAFLYHFDWALPNGMKSEDLDMIE  480



>ref|XP_010644547.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   499 bits (1284),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 255/466 (55%), Positives = 341/466 (73%), Gaps = 4/466 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LPPGPWKLP+IG++H LVG SLPH SLRNL++K+GP+MHLQLGE+S IV+SS ++A+ + 
Sbjct  37    LPPGPWKLPIIGNMHQLVG-SLPHHSLRNLAKKHGPLMHLQLGEVSAIVVSSREMAKEVM  95

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD++F+ RP I+A  IV Y  TD+AF+PYGDYWRQ+RKI +LELLS K V+SF S R+
Sbjct  96    KTHDIIFSQRPCILAASIVSYDCTDIAFAPYGDYWRQIRKISILELLSAKRVQSFRSVRE  155

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE+ NLV SI  SS+ G   NLTE +   T S+I++ AFG+ C +DQ  F   L++    
Sbjct  156   EEVLNLVRSI--SSQEGVSINLTESIFSLTFSIISRAAFGKKC-KDQEAFSVTLEKFAGS  212

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
              GGF + D+FPS K +H  SG++ KL K+H +LD I + II +HK    A+  + +  DE
Sbjct  213   GGGFTIADVFPSIKLLHVVSGIRHKLEKIHKKLDTILENIINEHKARSEASEISEAEVDE  272

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+VDVLL+V++ G+L+FP+T DNIKA++ D+F  G+ETS+T + WAM+EM+K P VMAKA
Sbjct  273   DLVDVLLKVQKQGDLEFPLTTDNIKAILLDLFIAGSETSSTAVEWAMAEMLKNPGVMAKA  332

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             QAEVR         D+  +  L +LKLVIKETLRLHPP+PL+ PRES E  +I  Y IP 
Sbjct  333   QAEVRDIFSRKGNADETMIHELKFLKLVIKETLRLHPPVPLLIPRESRESCEINGYEIPV  392

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
             KTRVIINAWA+A +PE W D E F PERF +SS+D+ G ++E+IPFGAGRRMCPGI F  
Sbjct  393   KTRVIINAWAVARDPEHWNDAESFNPERFLDSSIDYQGTNFEYIPFGAGRRMCPGILFGM  452

Query  1440  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
              ++ ++LA LLY+F+W+LP+G   ++LDMTE       +K +L LI
Sbjct  453   ANVEIALAQLLYYFDWKLPNGTQHEELDMTEDFRTSLRRKLNLHLI  498



>ref|XP_004511997.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=506

 Score =   498 bits (1283),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 248/474 (52%), Positives = 339/474 (72%), Gaps = 5/474 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLVG-GSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
              KLPPGP KLP IG+LH +   GSLPHR+ + L+ KYGPIMHL+LG+ISTIVI+SP+LA+
Sbjct  32    HKLPPGPMKLPFIGNLHQIASLGSLPHRAFQQLAHKYGPIMHLKLGQISTIVITSPKLAK  91

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              I KTHD+VFA+RP + +  I+ Y S D+AFSPYGDY+RQMRKIC+LELLS K V+SF  
Sbjct  92    EILKTHDIVFANRPHLESAHIMSYGSKDIAFSPYGDYYRQMRKICMLELLSAKRVQSFSY  151

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R++E +  +  I+  S  G   NLT ++    SS++++ AFG   +EDQ +F+ ++++ 
Sbjct  152   IREDETNIFIELIK--SSAGSEVNLTNRIFSLVSSIVSRSAFGD-KTEDQDEFVRVIRKT  208

Query  711   LSLAGGFDLGDLFPSKKWI-HYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
             +   GG +  DLFPS K+I H  +G K KL K+  + DKI +II+G H+E        S 
Sbjct  209   IESVGGLEPADLFPSMKYIIHVLTGNKSKLEKMQKQSDKILEIIVGKHQEKQRRAKEGSD  268

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
              + ED+VDVLLRV++ G L  PIT  NIKA+I D F+ GT+T+ +TI+WAM+E++K P V
Sbjct  269   EEQEDLVDVLLRVQQSGTLDIPITTSNIKAIIFDTFAAGTDTTTSTIVWAMAELMKNPRV  328

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             M K Q+E+R A KG +   + D+++L YLKLVIKETLRLH P PL+ PRES +   IG Y
Sbjct  329   MEKLQSELRDACKGKEIITEVDVQDLPYLKLVIKETLRLHSPTPLLLPRESTQLTNIGGY  388

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP KT+V++N WA+A +P  W D E F+PERF+ +S+D+ GNH+E++PFGAGRR+CPG+
Sbjct  389   DIPKKTKVMVNVWAMARDPYYWNDAEMFIPERFDANSIDYKGNHFEYLPFGAGRRICPGM  448

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             SF    I L LA LLYHF+W+LP+ + P+DLDMTE  G+   +K DLCLI R +
Sbjct  449   SFGIAGIMLPLALLLYHFDWKLPNQMKPQDLDMTEHYGLAIGRKTDLCLIPRVY  502



>ref|XP_003516584.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN36163.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   497 bits (1280),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 259/485 (53%), Positives = 341/485 (70%), Gaps = 7/485 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             + K K     KLPPGP KLPLIG++H L V GSLPHR+L+ L+  YGP+MHLQLGEIS +
Sbjct  24    YLKLKPNVAHKLPPGPKKLPLIGNMHQLAVAGSLPHRALQKLAHIYGPLMHLQLGEISAV  83

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SSP +A+ ITKTHD+ F  RP+I++  I+ Y   DV F+PYGDYWRQMRK+ V ELLS
Sbjct  84    VVSSPNMAKEITKTHDVAFVQRPQIISAQILSYGGLDVVFAPYGDYWRQMRKVFVSELLS  143

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF   R++E +  + SIR S   G P NLT KV    S+ +++ A G   S+DQ 
Sbjct  144   AKRVQSFSFIREDETAKFIDSIRASE--GSPINLTRKVFSLVSASVSRAAIGN-KSKDQD  200

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             +F+  L++V+   GGFDL DLFPS K IH+ +G K KL KL + +DK+ + I+ +H E  
Sbjct  201   EFMYWLQKVIGSVGGFDLADLFPSMKSIHFITGSKAKLEKLLNRVDKVLENIVREHLERQ  260

Query  864   L-ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
             + A       +DED+VDVLLR+++   L   +T  ++KA+I D+F+ G +TSA+T+ WAM
Sbjct  261   IRAKDGRVEVEDEDLVDVLLRIQQADTLDIKMTTRHVKALILDVFAAGIDTSASTLEWAM  320

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             +EM+K   V  KAQAE+R+     K   + D+E LTYLKLVIKETLRLHPP PL+ PRE 
Sbjct  321   TEMMKNSRVREKAQAELRKVFGEKKIIHESDIEQLTYLKLVIKETLRLHPPTPLLIPREC  380

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              EE  IG Y IP KT+V+IN WA+  +P+ W D ERF+PERFE+SS+DF GN++E++PFG
Sbjct  381   SEETIIGGYEIPVKTKVMINVWAICRDPKYWTDAERFVPERFEDSSIDFKGNNFEYLPFG  440

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             AGRR+CPGI+F   SI L LA LL HFNWELPDG+ P+ +DMTE  G+   +K DLCLI 
Sbjct  441   AGRRICPGITFGLASIMLPLAQLLLHFNWELPDGMKPESIDMTERFGLAIGRKHDLCLI-  499

Query  1581  RPFVD  1595
              PFVD
Sbjct  500   -PFVD  503



>ref|XP_006345633.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   497 bits (1280),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 258/473 (55%), Positives = 336/473 (71%), Gaps = 9/473 (2%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             QKL PGPWKLP+IG+L  +  GSLPH SL NL+ K+GP+MHL+LG++S IVISSPQLA+ 
Sbjct  35    QKLAPGPWKLPIIGNLLQM--GSLPHISLANLATKHGPLMHLKLGQLSAIVISSPQLAKE  92

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             + KTHDL FA+RP++    I+FY   D+AFSPYGDYW+Q+RKICV+ELLS K + SF   
Sbjct  93    MMKTHDLTFANRPQLSVAKIMFYDCQDIAFSPYGDYWKQIRKICVMELLSTKNITSFFPM  152

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
               +E   LV+SI+  SE   P N++EK+   TS++I + + GR C +DQ   I L+KQV 
Sbjct  153   MVDETYLLVNSIKAMSER--PINISEKMYLLTSAIICRASIGRTC-KDQESVIMLMKQVA  209

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK  893
             S AG F++ DLFPS K +H+ SG   KLL+LH ++D + + II +H+   LA  T   G 
Sbjct  210   SFAGVFNVVDLFPSLKILHFISGTNRKLLQLHRKVDPVLERIINEHETEQLA--TEHVG-  266

Query  894   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
              ED+VDVLLR++   E Q PIT +NIKA+I DMF  G+ TS+T + WAMSE++K PS+M 
Sbjct  267   -EDLVDVLLRLQNNNEFQIPITRNNIKAIILDMFVAGSATSSTVLEWAMSELLKNPSMME  325

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQAEVR+A  G  T D  DL+ L YLK+VIKETLR HPP PL  PRES ++  I  Y I
Sbjct  326   KAQAEVREAFNGKTTIDQTDLKKLKYLKMVIKETLRFHPPGPLSIPRESRQQCHINGYTI  385

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P KT  I+N WAL  + E WE+ E+F PERF  + +D  GNH++FIPFGAGRR+CPGI+F
Sbjct  386   PNKTIGIVNMWALGRDSEYWEEAEKFEPERFNENPLDVSGNHFQFIPFGAGRRICPGINF  445

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
             +  S+ L LA LL HF+W+L +GVSP+ LDMT   G +AS+K  L L+A PFV
Sbjct  446   SMASMELCLAQLLCHFDWKLVNGVSPQQLDMTVNFGNVASRKNSLYLLASPFV  498



>ref|XP_004512032.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=508

 Score =   497 bits (1279),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 253/470 (54%), Positives = 336/470 (71%), Gaps = 6/470 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGS-LPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             KLPPGP KLPLIG+LH L   S LPH +L+ LS KYGP+MHLQLGEIST+++SSP+ A+ 
Sbjct  36    KLPPGPRKLPLIGNLHQLAFASKLPHHALKILSHKYGPLMHLQLGEISTVIVSSPKFAKE  95

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             + KTHD+VFA+RPK+++  I+ Y   D+ FSPYGDYWRQMRKICVLE+LS+K V+SF   
Sbjct  96    VMKTHDVVFANRPKLLSPQILAYGFKDIVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYI  155

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             R++E +  + SI+  S +G   NLT ++    +S+I++ AFG   SEDQ +F++L+++ +
Sbjct  156   REDETTKFIKSIK--SFSGSTINLTSRIFSVINSIISRAAFGD-KSEDQDEFVSLIRKAI  212

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH--LANSTNSS  887
             +L+GG +L DLFPS K IH  +GMK K  K+H  +DKI D ++  H+E      +     
Sbjct  213   ALSGGLELDDLFPSMKPIHILTGMKSKFEKIHKRVDKILDNVVRKHEEKRAITKDEKKIE  272

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
              + ED+VDVLLRV++ G L   +T +NIKAVI D+F  GT+TS+TTI W+MSEM+K P V
Sbjct  273   AEKEDLVDVLLRVQQSGSLDIQMTINNIKAVIWDIFVAGTDTSSTTIEWSMSEMMKNPRV  332

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
               KAQAE+R+A +G     + D+  LTYL LVIKETLRLHPP PL+ PRE  E   I  Y
Sbjct  333   RDKAQAELREAFRGKDKICETDMHQLTYLNLVIKETLRLHPPSPLLVPRECYELTNIDGY  392

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP KT ++INAWA+  +PE W D ERF+PERF+ S +DF GN++E+IPFGAGRRMCPG+
Sbjct  393   DIPKKTTILINAWAMGRDPEHWSDAERFIPERFDGSFIDFKGNNFEYIPFGAGRRMCPGM  452

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             SF   S+   LA LLYHFNWELP+ + P D DM E  G+   +K +LCLI
Sbjct  453   SFGLASVMFPLALLLYHFNWELPNHMKPHDFDMIEHFGMTVGRKNELCLI  502



>gb|EYU21978.1| hypothetical protein MIMGU_mgv1a004623mg [Erythranthe guttata]
Length=517

 Score =   496 bits (1277),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 250/482 (52%), Positives = 342/482 (71%), Gaps = 17/482 (4%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPP PWKLPLIG LHH+  G LPHRS + LS K+GP+MH+ LGE++ IV+SSP LA+ +
Sbjct  36    KLPPSPWKLPLIGHLHHI--GKLPHRSFQKLSEKHGPLMHVMLGEVTAIVVSSPALAKQV  93

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              K HD  FA RP  +A +I++Y S++++FS YGDYWRQMRKIC+LELLS K VKSF S R
Sbjct  94    LKAHDPTFADRPVTIAGEILWYNSSNISFSQYGDYWRQMRKICILELLSAKNVKSFSSIR  153

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
              +E+S L+ SI++SS T    +LTEK+   TSS+  + AFG+VC +D+ + I + K+ ++
Sbjct  154   NDEVSQLIESIKISSST---VDLTEKIFGMTSSITCRAAFGKVC-KDKDQLIGMFKEGIT  209

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH----LANSTNS  884
             L  GFD+ DL+PS K +   S  + +L+K+  +LD I D +I +H+ N      A+  NS
Sbjct  210   LVSGFDVSDLYPSSKMLKALSCNRMRLMKMRLKLDLILDDVIDEHRRNLEKIVFADEENS  269

Query  885   SGK------DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               +      +ED+VDVLLRVKE GEL+FPI++DNIKAVI D+F+ GTETS+TTI W M+E
Sbjct  270   ERRGNGEFGNEDLVDVLLRVKESGELEFPISDDNIKAVIYDIFAAGTETSSTTIDWIMAE  329

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             +I+ P VM+K Q E+R+  K N  F + D++ L YLKLVIKE  RLH P+PLI    S  
Sbjct  330   LIRNPRVMSKLQTEIRETFKDNPNFGESDVQKLKYLKLVIKEGFRLHAPIPLIPRV-SRA  388

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             + +I  Y+IP   +V++NAWA+  +P  W DPERF PERFEN   DF GN +E+IPFGAG
Sbjct  389   DTEIEGYVIPIGAKVLVNAWAMGRDPGLWSDPERFEPERFENDPRDFTGNDFEYIPFGAG  448

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RRMCPG++F   S+ L LA LLY F+W+LP G+S  DLDMTE   + A+++++L L+A P
Sbjct  449   RRMCPGMTFGLASVELPLAHLLYSFDWKLPAGMSSGDLDMTERPAITAARRQNLELVATP  508

Query  1587  FV  1592
             ++
Sbjct  509   YI  510



>emb|CDP10758.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   495 bits (1275),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 256/478 (54%), Positives = 342/478 (72%), Gaps = 8/478 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             SK+    +  PGPWKLPLIGS+HHL  GSLPH +LR+L+ K+GPIMHLQ+GEIST+VIS+
Sbjct  29    SKSTDSPRKLPGPWKLPLIGSMHHL-AGSLPHHALRDLAEKFGPIMHLQMGEISTVVISA  87

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             PQ A+ + K HD+ FA RP+ ++  I+ Y + D+AFSPYGDYW+QMRKIC+LELLS K V
Sbjct  88    PQEAKEVLKVHDISFADRPEFLSSKILGYDNLDIAFSPYGDYWKQMRKICLLELLSPKSV  147

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF + R++E S ++ SI+ S+    P N+T+K   FT+ ++ + AFG+  +  Q + I 
Sbjct  148   RSFGTLREDEASKVIRSIKSSNS---PVNITDKAFTFTNDIVCRAAFGKSFAH-QDRLIT  203

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             L+   +  +GGFD+ DLFPS K++H  SG+KP LLKLHHE+D++ + II + K+     S
Sbjct  204   LINGAILASGGFDIADLFPSLKFLHSLSGLKPTLLKLHHEIDQMLENIISERKQKRANQS  263

Query  876   --TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                 S  + ED+VDVLLR+KE G+   PI+ D++KAVI D+F+ GTETSA TI +AM+E+
Sbjct  264   IPVGSQSEVEDLVDVLLRLKESGDFNIPISTDSVKAVIWDIFAAGTETSAATIDYAMAEL  323

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             I+   VM   QAE+RQ LKG +T  + DL+ L YLK VIKETLRLHPPLPLI PRE  E 
Sbjct  324   IRNAGVMENVQAELRQVLKGRETVQETDLKELNYLKAVIKETLRLHPPLPLILPRECREP  383

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              KI  Y IP KT+V+INAWA+  +PE W  PERF PERF +S  D +G ++E+IPFG GR
Sbjct  384   CKIAGYDIPVKTKVMINAWAIHRHPEVWPSPERFKPERFLDSGSDSIGMNFEYIPFGGGR  443

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDG-VSPKDLDMTEAVGVIASKKKDLCLIA  1580
             R+CPG+SF    + L LA LLYHF+W LP+G +SP+  DMTEA G  A +K  L L+A
Sbjct  444   RICPGVSFGSAGVELLLAKLLYHFDWSLPNGTISPQMPDMTEAFGATARRKSSLILVA  501



>ref|XP_003537457.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42026.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   495 bits (1274),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 245/477 (51%), Positives = 337/477 (71%), Gaps = 8/477 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             K  +  KLPPGPWKLP+IG+LH + +  SLPH +L+ L+RKYGP+MHLQLGEIST+V+SS
Sbjct  26    KPKSSHKLPPGPWKLPIIGNLHQVALAASLPHHALQKLARKYGPLMHLQLGEISTLVVSS  85

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P++A  I KTHDL F  RP+++A   + Y +TD+AF+PYG+YWRQMRKIC LELLS K V
Sbjct  86    PKMAMEIMKTHDLAFVQRPQLLAPQYMAYGATDIAFAPYGEYWRQMRKICTLELLSAKRV  145

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF   RQ+E   L+ SI+  S  G P +L+ K+     + +++ AFG   ++DQ +F++
Sbjct  146   QSFSHIRQDENRKLIQSIQ--SSAGSPIDLSSKLFSLLGTTVSRAAFGNK-NDDQDEFMS  202

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL---  866
             L+++ +++ GGF+L D+FPS K +H  +G K K+ ++H   D+I + I+  H E      
Sbjct  203   LVRKAVAMTGGFELDDMFPSLKPLHLLTGQKAKVEEIHKRADRILEDILRKHVEKRTRAK  262

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 NS  + ED+VDVLLR+++ G L+  +T  ++KAVI D+F+ GT+TSA+T+ WAM+E
Sbjct  263   EEGNNSEAQQEDLVDVLLRIQQSGSLEVQMTTGHVKAVIWDIFAAGTDTSASTLEWAMAE  322

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P V  KAQA +RQA KG +T  + DLE L+YLK VIKETLRLHPP  LI   E ++
Sbjct  323   MMKNPRVREKAQAVIRQAFKGKETIRETDLEELSYLKSVIKETLRLHPPSQLIPR-ECIK  381

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
                I  Y IP K++V+IN WA+  +P+ W D ERF+PERF+ S +DF GN YE+IPFGAG
Sbjct  382   STNIDGYEIPIKSKVMINTWAIGRDPQYWSDAERFIPERFDGSYIDFKGNSYEYIPFGAG  441

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             RRMCPG++F   SI L LA LLYHFNWELP+ + P+DLDM E  G+   +K  LCLI
Sbjct  442   RRMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDMNEHFGMTVGRKNKLCLI  498



>ref|XP_004506686.1| PREDICTED: cytochrome P450 71D9-like [Cicer arietinum]
Length=495

 Score =   494 bits (1273),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 249/473 (53%), Positives = 340/473 (72%), Gaps = 11/473 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K+ +   LPPGPWKLP+IG++H+LVG SLPH  LR LS KYGP+MHL+LGEISTI++SS 
Sbjct  28    KSKSTPNLPPGPWKLPIIGNIHNLVG-SLPHHRLRELSTKYGPLMHLKLGEISTIIVSSA  86

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             + A+ + KTHDL+F+SRP I A  I+ Y +  +AF+PYGDYWRQ+RKIC LELLS K V+
Sbjct  87    ECAKQVMKTHDLIFSSRPPIQASTIMSYNNVGIAFAPYGDYWRQLRKICTLELLSSKSVQ  146

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R EE++NL+  I  +S+ G   NLT++V    S++ ++ AFG+ C E+  KFI+L
Sbjct  147   SFQPIRDEEVTNLIKWI--TSKEGSSINLTKEVFSTISTITSRTAFGKKCEENT-KFISL  203

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +++ + +AGGF+LGDL+PS KW+   SG+KPKL KLH + D I   II +H+E +   + 
Sbjct  204   VREAVKVAGGFNLGDLYPSYKWLQNISGLKPKLEKLHQQADIIMQKIINEHREVNKLRAN  263

Query  879   NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1058
                  +ED+VDVLL+       Q  +++D++KAVI D++  G+ETSATTI WAM+EMIK 
Sbjct  264   EDQEVEEDLVDVLLK-------QNCLSDDSVKAVILDVYGGGSETSATTIAWAMAEMIKN  316

Query  1059  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1238
             P +M K QAEVR+     K  + +D+E LTYLK V+KETLRLHPP PL+ PRE  ++ +I
Sbjct  317   PRIMEKVQAEVREVFDKEKNLNGRDIEKLTYLKYVVKETLRLHPPAPLLLPRECGQDCEI  376

Query  1239  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1418
               Y IP K+++I+NAWA+  +P  W DPE F PERF  S VD+ GN++EFIPFGAGRRMC
Sbjct  377   NGYNIPFKSKIIVNAWAIGRDPNYWVDPEIFYPERFVESCVDYKGNNFEFIPFGAGRRMC  436

Query  1419  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             PG++F   ++   LA LLYHF+W+LP+GV  +DLDM+E  G   ++K DL LI
Sbjct  437   PGLTFGLINVEFPLAMLLYHFDWKLPNGVKNEDLDMSETFGSAVTRKDDLYLI  489



>gb|EYU21988.1| hypothetical protein MIMGU_mgv1a004711mg [Erythranthe guttata]
Length=513

 Score =   494 bits (1273),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 249/492 (51%), Positives = 352/492 (72%), Gaps = 15/492 (3%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W KSK+ + + LPPGP  LP+IG LHHL   +LP RS R LS+KYGP+MHL+LG++STIV
Sbjct  26    WRKSKSDSVKNLPPGPTPLPIIGDLHHLT--ALPFRSFRELSKKYGPLMHLKLGQVSTIV  83

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP++A+ + K HD  FA RP+ + ++I++Y  T++AFSPYG+YWRQMRKICV+ELLS 
Sbjct  84    VSSPEIAKQMLKEHDPSFADRPRSVGIEIMWYDYTNIAFSPYGNYWRQMRKICVIELLSP  143

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R++E+S LV S+R  + +G P NLT+K+    SS+  + AFG+V S+D   
Sbjct  144   KSVRSFASIRKDEVSGLVDSLRRCAASGEPINLTDKIFSLMSSITCRAAFGKV-SKDNEA  202

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I LLK+ + +A GF++ DLFP  K I+  S  + KLLK+  +LD+I D II +HK N  
Sbjct  203   LIKLLKEGIEMASGFEISDLFPGSKIINALSKGRFKLLKMRRKLDEILDSIIDEHKANLA  262

Query  867   ANST----------NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETS  1016
               +T          N    +ED+VDV LR++E GEL+FPI  +NIKAV+ DMFS GT+TS
Sbjct  263   KMATENAESAVKRGNGDDGNEDLVDVFLRIQENGELEFPIGNNNIKAVLQDMFSAGTDTS  322

Query  1017  ATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhppl  1196
             +T I W M+E+++ P VMAKAQAEVR+A K  +  D+ + ++L YLK+VIKE+LRLHPP+
Sbjct  323   STAIEWTMTELMRNPRVMAKAQAEVREAFKETEPIDEGNTQHLKYLKMVIKESLRLHPPV  382

Query  1197  plihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE-NSSVDFMG  1373
             PL+    S EE  +  Y IP   +V++N WA+  +P+ WE+P+ F PERFE  +S DF+G
Sbjct  383   PLLPRA-SREETVVNGYTIPANVKVLVNNWAIQRDPKHWENPDSFEPERFEKKNSRDFLG  441

Query  1374  NHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIAS  1553
               +E++PFG+G+RMCPGI+F+  S+ L LA LLY FNW+LPDGV+P ++D+TE  G+ A 
Sbjct  442   GDFEYLPFGSGKRMCPGITFSLASVELFLAQLLYSFNWKLPDGVNPGNMDLTENPGITAQ  501

Query  1554  KKKDLCLIARPF  1589
             +K++L ++A P 
Sbjct  502   RKENLYVVALPL  513



>ref|XP_003550472.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=559

 Score =   496 bits (1276),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 340/478 (71%), Gaps = 12/478 (3%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGS-LPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             K  +  KLPPGPWKLP+IG+L  L   S LPH ++R L++KYGP+MHLQLGEIS +++SS
Sbjct  79    KQKSLHKLPPGPWKLPIIGNLLQLAAASSLPHHAIRELAKKYGPLMHLQLGEISAVIVSS  138

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P +A+ I KTHDL FA RPK +A DI+ Y S D+AF+PYGDYWRQMRKIC LELLS K V
Sbjct  139   PNMAKEIMKTHDLAFAQRPKFLASDIMGYGSVDIAFAPYGDYWRQMRKICTLELLSAKKV  198

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF + R++E++ L+  I+  S  G P NLT  ++ F S+ +++  FG + ++D  +F+ 
Sbjct  199   QSFSNIREQEIAKLIEKIQ--SSAGAPINLTSMINSFISTFVSRTTFGNI-TDDHEEFLL  255

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             + ++ + +A GFDL D+FPS K +H  +G+K K+ K+H ++DKI D II   KEN  AN 
Sbjct  256   ITREAIEVADGFDLADMFPSFKPMHLITGLKAKMDKMHKKVDKILDKII---KENQ-ANK  311

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
                  K+E++V+VLLRV+  G L  PIT +NIKAVI D+F+ GT+TSA  I WAMSEM++
Sbjct  312   GMGEEKNENLVEVLLRVQHSGNLDTPITTNNIKAVIWDIFAAGTDTSAKVIDWAMSEMMR  371

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P V  KAQAE+R    G +T  + +L  L+YLK VIKET+RLHPPLPL+ PRE +E  +
Sbjct  372   NPRVREKAQAEMR----GKETIHESNLGELSYLKAVIKETMRLHPPLPLLLPRECIEACR  427

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             I  Y +P KT+VI+NAWA+  +PE+W D + F+PERF  +S+DF G  +E+IPFGAGRRM
Sbjct  428   IDGYDLPTKTKVIVNAWAIGRDPENWHDADSFIPERFHGASIDFKGIDFEYIPFGAGRRM  487

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             CPGISF   ++  +LA LLYHFNWEL  G  P++ DM E+ G +  +K +L LI  P+
Sbjct  488   CPGISFGIANVEFALAKLLYHFNWELQQGTKPEEFDMDESFGAVVGRKNNLHLIPIPY  545



>ref|XP_010653207.1| PREDICTED: cytochrome P450 71D9-like [Vitis vinifera]
Length=504

 Score =   493 bits (1270),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 251/474 (53%), Positives = 336/474 (71%), Gaps = 5/474 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             K PPGPWKLPLIG+LH LVG SLPH SLR+L++KYGP+MHLQLG++S +V+SSP++A+ +
Sbjct  33    KRPPGPWKLPLIGNLHQLVG-SLPHHSLRDLAKKYGPLMHLQLGQVSMLVVSSPEIAKEV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHD+ FA RP ++A  IV Y STDVAFSPYGDYWRQ+RKICV+ELLS K VKSF   R
Sbjct  92    MKTHDINFAQRPHLLATRIVSYDSTDVAFSPYGDYWRQLRKICVVELLSAKRVKSFQVIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             +EE+S L+  I  SS   FP NL +++S FT S I++ A G+ C +D     A   +   
Sbjct  152   KEEVSKLIRIINSSSR--FPINLRDRISAFTYSAISRAALGKEC-KDHDPLTAAFGESTK  208

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  896
             LA GF L DL+PS KWI   SG++ KL K+   +D I  I++ +H+E  +  +T    ++
Sbjct  209   LASGFCLADLYPSVKWIPLVSGVRHKLEKVQQRIDGILQIVVDEHRER-MKTTTGKLEEE  267

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             +D+VDVLL++++ G+L+ P+T+DNIKAVI D+F  G +T +T + W M+EM+K P VM K
Sbjct  268   KDLVDVLLKLQQDGDLELPLTDDNIKAVILDIFGGGGDTVSTAVEWTMAEMMKNPEVMKK  327

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQAEVR+   G    D+  ++ L +LK VI ETLRLHPP PL+ PRE  E+ KI  Y +P
Sbjct  328   AQAEVRRVFDGKGNVDEAGIDELKFLKAVISETLRLHPPFPLLLPRECREKCKINGYEVP  387

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              KTRV+INAWA+   P+ W + ERF PERF +SS+D+ G  + FIPFG+GRR+CPGI F 
Sbjct  388   VKTRVVINAWAIGRYPDCWSEAERFYPERFLDSSIDYKGADFGFIPFGSGRRICPGILFG  447

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVDL  1598
                I L LA LL+HF+W+LP+G+ P+DLDMTE  G+   KK +L LI  P+  L
Sbjct  448   IPVIELPLAQLLFHFDWKLPNGMRPEDLDMTEVHGLAVRKKHNLHLIPIPYSPL  501



>gb|KDP39256.1| hypothetical protein JCGZ_01013 [Jatropha curcas]
Length=488

 Score =   493 bits (1268),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 242/470 (51%), Positives = 348/470 (74%), Gaps = 4/470 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LPPGP KLP+IG++H+LVG SLPH  L+NL++KYGP+MHLQLGE++TIV++S ++A+ + 
Sbjct  17    LPPGPLKLPIIGNIHNLVG-SLPHHRLQNLAKKYGPLMHLQLGEVTTIVVTSAEIAKEVM  75

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             + HD+VF++RP I+A +I+ Y +T + FSPYG+YWRQ+RKICVLELLS K V+SF S R+
Sbjct  76    RAHDIVFSNRPSILAANIISYNATSIVFSPYGEYWRQLRKICVLELLSAKRVQSFKSIRE  135

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE+SN+V   R+SS +    NL+  +   T S+ ++ AFG++  E Q  FI L+++++ +
Sbjct  136   EEVSNIVR--RISSSSDSLINLSRMLFSLTYSITSRAAFGKIRKE-QEAFIPLVEEIIEV  192

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
              GGF + DLFPS K ++  +GMK ++ +LH E DKI + II +H+ +       S G+ +
Sbjct  193   GGGFSIADLFPSIKLLNRINGMKSRVERLHQEADKILENIINEHRASKARAKPGSKGEAD  252

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+VDVLL ++E G+L F +T +NIKAVI D+F  G+ETS+TT+ WAMSE++K  SVM KA
Sbjct  253   DLVDVLLNIQEQGDLGFALTTNNIKAVILDLFIAGSETSSTTVEWAMSELLKNTSVMKKA  312

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             QAE+RQ  K     D++ +  L YLKL++KETLRLHPP+PL+ PRE+ E  +I  Y IP 
Sbjct  313   QAELRQVFKNKGYVDEEGVCELNYLKLIVKETLRLHPPVPLLVPRENSELCEINGYFIPV  372

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
             K+RV+IN WA+  +P  W++PERF PERF ++S+D+ G+++EFIPFGAGRR+CPGI F  
Sbjct  373   KSRVLINVWAIGRDPNYWKEPERFNPERFLDNSIDYKGSNFEFIPFGAGRRICPGILFGI  432

Query  1440  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
              ++ L LA LLYHF+W+LP  ++P++L+MTEA G+   +K DL LI   F
Sbjct  433   ANVELPLANLLYHFDWKLPGEINPENLEMTEASGIAVRRKNDLNLIPITF  482



>ref|XP_011087047.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=498

 Score =   493 bits (1268),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 248/474 (52%), Positives = 340/474 (72%), Gaps = 6/474 (1%)
 Frame = +3

Query  168   AKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             ++ KLPPGPWKLPLIGSLHHL GGS PH +LRNL+RKYGPIMHLQLGEIS +VIS+P++A
Sbjct  29    SRPKLPPGPWKLPLIGSLHHLSGGSGPHYALRNLARKYGPIMHLQLGEISAVVISAPRVA  88

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + +  THDL F+SR ++ +L I+ Y   D+  +PYGDYW+QMR+IC  ELLS K V+SF 
Sbjct  89    KELLTTHDLAFSSRARLPSLAIITYNYQDMVMAPYGDYWKQMRRICFSELLSSKNVRSFS  148

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
             + R EE  NLV SIR S  +  P +L +KV  +T+ ++ + AFG+     + +F+ L+ +
Sbjct  149   TIRDEEAVNLVESIR-SHPSLMPMDLAQKVLSYTNDVLCRAAFGK-SRGGKDEFLPLIIE  206

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
               + +GGFD+ DLFPS  ++   +G++ KL+KLHH+LD++ ++II +H E          
Sbjct  207   FGTSSGGFDVADLFPSITFLPAVTGLRTKLMKLHHKLDQVLNVIIDEHMER----LRFGQ  262

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
               +EDIVDVLLR KE G L+FPIT DNIKA+  DMF  GT T+A T+ +AM +MIK  +V
Sbjct  263   HAEEDIVDVLLRFKEKGNLEFPITLDNIKAITLDMFIAGTHTTAATVEFAMVQMIKHANV  322

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             M KAQ+E+R   +G +   + DLE ++YLK+VIKETLRL+PP+PL+ PR+  +  K+  Y
Sbjct  323   MEKAQSELRHVFRGKERILESDLEKVSYLKMVIKETLRLNPPVPLLLPRDCKDWQKVYGY  382

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IPPKT+V++N  A+  +PE W + E F PERF  SS++F+G ++EFIPFG GRRMCPGI
Sbjct  383   DIPPKTKVVLNVLAINRDPEYWVNAEAFEPERFAESSIEFIGTNFEFIPFGGGRRMCPGI  442

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             SF   S+ L LA LLYHFNW+LPDG+ P+DLDMTE +G+ A  K +L L+   +
Sbjct  443   SFGLASVELLLAQLLYHFNWKLPDGLMPQDLDMTEILGLAAKMKNNLSLLVTSY  496



>ref|XP_006367128.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=434

 Score =   489 bits (1258),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 248/437 (57%), Positives = 320/437 (73%), Gaps = 6/437 (1%)
 Frame = +3

Query  291   MHLQLGEISTIVISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQ  470
             M+LQLGE+ TIV+SSP +A+ I KTHDL FASR + M   I  Y  TD+AFSPYG+YWR 
Sbjct  1     MYLQLGEVPTIVVSSPHMAQKIMKTHDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRH  60

Query  471   MRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKV  650
             MRK+C++ELLS KMVKSF   R +ELS+LVSSI+    T  P N++EK+ WF +S+  + 
Sbjct  61    MRKLCIMELLSGKMVKSFSPIRLDELSSLVSSIKSMENT--PINVSEKLFWFMNSVTCRS  118

Query  651   AFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIF  830
             +FG+ C +     I+L+  VLSLAGGF+L DL+PSKK++   SGM  KL++  +++D + 
Sbjct  119   SFGKACKDQNEAMISLIHGVLSLAGGFELADLYPSKKFLSGISGMGSKLIEARNKVDTVL  178

Query  831   DIIIGDHKENHLANSTNSS---GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFST  1001
             D +I  H+ENH AN    +   G +ED++DV  RV   GEL F +T +NIKAVI DMF  
Sbjct  179   DKVIDVHRENH-ANGKKCNAECGSNEDLIDVFFRVMGTGELPFTLTNNNIKAVILDMFVA  237

Query  1002  GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1181
             G++TS++T+ WA+SEM+K PSVMAKAQAEVR+  KG KTFDD DLE + YLKLVIKETLR
Sbjct  238   GSDTSSSTVTWALSEMMKSPSVMAKAQAEVREVFKGKKTFDDDDLEKVDYLKLVIKETLR  297

Query  1182  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSV  1361
             LHPP PL+ PRE  EE +I  YIIP K++V++N WA+  +PESWED E F+PERFENSSV
Sbjct  298   LHPPTPLLVPRECREETEIDGYIIPVKSKVLVNVWAIGRDPESWEDSESFIPERFENSSV  357

Query  1362  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVG  1541
             DF G H++F+PFGAGRR CPG  F    + L LA LLY+FNW LP+G+ P+DLDM EA G
Sbjct  358   DFSGTHFQFLPFGAGRRTCPGRLFGLALVTLPLAHLLYNFNWTLPNGMDPRDLDMNEANG  417

Query  1542  VIASKKKDLCLIARPFV  1592
             + A + KDL LIA P+ 
Sbjct  418   MTARRDKDLYLIATPYT  434



>gb|KHM99473.1| Cytochrome P450 71D11 [Glycine soja]
Length=473

 Score =   490 bits (1262),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 244/470 (52%), Positives = 343/470 (73%), Gaps = 5/470 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             +P GP KLP+IG++++L+  S PHR LR+L+ KYGP+MHLQLGE+STIVISSP  A+ + 
Sbjct  3     MPHGPRKLPIIGNIYNLIC-SQPHRKLRDLAIKYGPVMHLQLGEVSTIVISSPDCAKEVM  61

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
              THD+ FA+RP+I+A +I+ Y ST +AFSPYG+YWRQ+RKIC+LELLS+K V S+   R+
Sbjct  62    TTHDINFATRPQILATEIMSYNSTSIAFSPYGNYWRQLRKICILELLSLKRVNSYQPVRE  121

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EELSNLV  I  +SE G P NLT+ V     ++ ++  FG+ C +DQ KFI++L + + +
Sbjct  122   EELSNLVKWI--ASEKGSPINLTQAVLSSVYTISSRATFGKKC-KDQEKFISVLTKSIKV  178

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
             + GF++GDLFPS  W+ + +G++PKL +LH + D+I + II DHKE   + +     + +
Sbjct  179   SAGFNMGDLFPSSTWLQHLTGLRPKLERLHQKADQILENIINDHKEAK-SKAKGDDSEAQ  237

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+VDVL++ ++G +  F +T++NIKA+I D+F+ G ETSATTI WAM+EMIK P VM KA
Sbjct  238   DLVDVLIQYEDGSKQDFSLTKNNIKAIIQDIFAAGGETSATTIDWAMAEMIKDPRVMKKA  297

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             QAEVR+    N   D+  +  L YLKL++KETLRLHPP PL+ PRE  +  +I  Y IP 
Sbjct  298   QAEVREVFGTNGRVDENCINELQYLKLIVKETLRLHPPAPLLLPRECGQTCEIHGYHIPA  357

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
             KT+VI+NAWA+  +P+ W + ERF PERF +S++D+ GN +EFIPFGAGRR+CPG + A 
Sbjct  358   KTKVIVNAWAIGRDPKYWTESERFYPERFIDSTIDYKGNSFEFIPFGAGRRICPGSTSAL  417

Query  1440  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
              +I L+LA LLYHF+W LP+G+   +LDM+E  GV   +K DL L+  P+
Sbjct  418   RTIDLALAMLLYHFDWNLPNGMRSGELDMSEEFGVTVRRKDDLILVPFPY  467



>ref|XP_007147597.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
 gb|ESW19591.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
Length=506

 Score =   491 bits (1263),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 337/478 (71%), Gaps = 8/478 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             K    ++LPPGPWKLP+IG+LH L V  +LPHR+L  L++KYGP+MHLQLG+IS +++SS
Sbjct  25    KQKCLRRLPPGPWKLPIIGNLHQLAVASTLPHRALGELAQKYGPLMHLQLGQISAVIVSS  84

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P +A+ I KTHDL FA RPK +A DI+ Y S D+AF+PYGDYWRQMRK+C LELLS K V
Sbjct  85    PSIAKEIMKTHDLAFAQRPKFLASDIMGYGSGDIAFAPYGDYWRQMRKLCTLELLSAKKV  144

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF   R+EE++ L+ +I+  S  G P +L+ +   F S+ +++  FG++ +ED  +F+ 
Sbjct  145   QSFFHIREEEVAKLIKTIQ--SSAGEPIDLSSRFGSFISTFVSRATFGKI-NEDHEEFVL  201

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
              +K+ + +A GFDL D FPS K IH  +G+K KL K+H + DKI + II   +EN  AN 
Sbjct  202   TVKEAIEVADGFDLADAFPSFKPIHLITGLKAKLDKMHKKSDKILEKII---RENQ-ANE  257

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
                   +E++V+VLLR +  G L  PIT +NIKAVI D+FS GT+TS   + WAMSEM++
Sbjct  258   GMGEENNENLVEVLLRFQHRGNLDTPITNNNIKAVIWDIFSAGTDTSTKVLEWAMSEMMR  317

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P V  KAQ E+RQ     +T  + +L  LTYLK VI+ETLRLHPPLPL+ PRE +E   
Sbjct  318   NPRVREKAQYEIRQKFSLKETTHESNLGELTYLKAVIRETLRLHPPLPLLLPRECIETCS  377

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             I  Y IP KT+VI+NAWA+  + + W D E F+PERF ++ +DF G  +E+IPFGAGRRM
Sbjct  378   IDGYDIPIKTKVIVNAWAIGRDADHWHDSESFIPERFHDTCIDFKGTDFEYIPFGAGRRM  437

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             CPGISF   ++ L+LA LLYHFNWELP+G+ P +LDM EA G +  +K +L LI  P+
Sbjct  438   CPGISFGIANVELALAKLLYHFNWELPEGMKPGELDMDEAFGAVVGRKNNLHLIPIPY  495



>ref|XP_010655870.1| PREDICTED: cytochrome P450 71D10-like [Vitis vinifera]
 emb|CBI39021.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   490 bits (1262),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 251/474 (53%), Positives = 343/474 (72%), Gaps = 8/474 (2%)
 Frame = +3

Query  168   AKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLA  347
             + QKLPPGPWKLPLIG++H L+ GSLPH SL  L+++YGP+M LQLGEIST++ISSP++A
Sbjct  31    SSQKLPPGPWKLPLIGNMHQLIDGSLPHHSLSRLAKQYGPLMSLQLGEISTLIISSPEMA  90

Query  348   RAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  527
             + I KTHD+ FA R   +A + V Y STD+ FSPYGDYWRQ+RKICV+ELL+ K VKSF 
Sbjct  91    KQILKTHDINFAQRASFLATNTVSYHSTDIVFSPYGDYWRQLRKICVVELLTSKRVKSFQ  150

Query  528   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  707
               R+EELSNL+++  L+S +  P NLT+K+S  T ++IA+ AFG  C E Q  FI++LK+
Sbjct  151   LIREEELSNLITT--LASCSRLPINLTDKLSSCTFAIIARAAFGEKCKE-QDAFISVLKE  207

Query  708   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  887
              L L  G  + D++PS KW+   SGM+ K+ K+    D+I   I+ +H+E     +    
Sbjct  208   TLELVSGPCVADMYPSVKWLDLISGMRHKIEKVFKRTDRILQNIVDEHREKMKTEAGKLQ  267

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
             G +ED+VDVLL++++ G+L+FP+T++NIKAVI D+F+ G ET++ ++ WAMSEM+K P V
Sbjct  268   G-EEDLVDVLLKLQQHGDLEFPLTDNNIKAVILDIFAGGGETTSISVEWAMSEMLKNPRV  326

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             M KAQAEVR+   G    D    E L +LK+V+KETLRLHPP PL+ PRE  E  +I  Y
Sbjct  327   MDKAQAEVRRVFDGKGNAD----EELKFLKVVVKETLRLHPPFPLLIPRECREMCEINGY  382

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP KT +I+NAWA+  + + W + ERF PERF +SS+D+ G  + +IPFGAGRRMCPGI
Sbjct  383   EIPKKTLIIVNAWAIGRDSDHWVEAERFYPERFLDSSIDYKGTDFGYIPFGAGRRMCPGI  442

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
              F+   I LSLA LLY+F+W+LP+G+   DLDMTEA+G+   +K+DL LI  P+
Sbjct  443   LFSLPIIELSLAHLLYNFDWKLPNGMKADDLDMTEALGIAVRRKQDLHLIPIPY  496



>ref|XP_004511999.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 252/470 (54%), Positives = 334/470 (71%), Gaps = 6/470 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGS-LPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             KLPPGP KLPLIG+LH L   S LPH +L+ LS KYGP+MHLQLGEIST+V+SSP+LA+ 
Sbjct  33    KLPPGPRKLPLIGNLHQLAFASKLPHHALKILSHKYGPLMHLQLGEISTVVVSSPKLAKE  92

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             + KTHD+VFA+RPK+++  I+ Y   D+ FSPYGDYWRQMRKICVLE+LS+K V+SF   
Sbjct  93    VMKTHDVVFANRPKLLSPQILAYGFKDIVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYI  152

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             R++E +  + SI+  S +G   NLT ++    +S+I++ AFG   SEDQ +F++L+++ +
Sbjct  153   REDETTKFIKSIK--SFSGSTINLTSRIFSVINSIISRAAFGD-KSEDQDEFVSLIRKAI  209

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL--ANSTNSS  887
             +++GG +L DLFPS K I+  +GMK K  K+H  +DKI D +I  H+E      +     
Sbjct  210   AMSGGLELDDLFPSMKPINILTGMKSKFEKIHKRIDKILDNVIRKHEEKRTITKDEKKIE  269

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
              + ED+VDVLLRV++ G L   +T +NIKAVI D+F  GT+TS+TTI W+MSEM+K P V
Sbjct  270   AEKEDLVDVLLRVQQSGSLDIQMTINNIKAVIWDIFVAGTDTSSTTIEWSMSEMMKNPRV  329

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
               KAQAE+RQA +G     + D+  LTYL LVIKETLRLHPP PL+ PRE  E   I  Y
Sbjct  330   RDKAQAELRQAFRGKDKICESDMHQLTYLNLVIKETLRLHPPSPLLVPRECYELTNIDGY  389

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP KT ++INAW    +P+ W D ERF+PERF+ S +DF GN++E+IPFGAGRRMCPG+
Sbjct  390   DIPKKTIILINAWTKGRDPQYWSDAERFIPERFDGSFIDFKGNNFEYIPFGAGRRMCPGM  449

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             SF   S+   LA LLYHFNWELP+ + P   DM E  G+   +K +LCLI
Sbjct  450   SFGLASVMFPLALLLYHFNWELPNHMKPDHFDMIEHFGMTVGRKNELCLI  499



>ref|XP_007146610.1| hypothetical protein PHAVU_006G054700g [Phaseolus vulgaris]
 gb|ESW18604.1| hypothetical protein PHAVU_006G054700g [Phaseolus vulgaris]
Length=508

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 348/482 (72%), Gaps = 5/482 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             + +     K+P GP KLP+IG++H+L+  S PHR LR+L+ KYGP+MHLQLGE+STIVIS
Sbjct  29    RKRDETTSKIPHGPTKLPIIGNIHNLLS-SQPHRKLRDLALKYGPLMHLQLGEVSTIVIS  87

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP+ A+ + KTHD+ FASRPK+ A+D++ Y  TD+AF+PYG+YWRQ+RKIC LELLS+K 
Sbjct  88    SPECAKEVMKTHDINFASRPKVPAMDLMTYNCTDIAFAPYGNYWRQLRKICTLELLSLKR  147

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V S+   R+EELSNLV  I   SE G P NLT+ +     ++ ++ AFG+ C +DQ  FI
Sbjct  148   VNSYQPIREEELSNLVKWI--YSEKGSPINLTQALLSSIYTIASRSAFGKKC-KDQENFI  204

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
             +++K+ + L GGF +GDLFPS  W+ + +G +PKL + + + D+I + II +HKE   + 
Sbjct  205   SVVKKTIKLVGGFHIGDLFPSATWLQHVTGTRPKLERFYQQTDQIIENIINEHKEAK-SK  263

Query  873   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
             + +   + ED+VDVL++ ++G +  F +T +NIKA+I D+F+ G ETSATTI+WAM+E++
Sbjct  264   AKDYEREAEDLVDVLIQYEDGSKQDFALTRNNIKAIIVDIFAAGGETSATTIVWAMAEIM  323

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             K   VM KAQAEVR+     +  D+  +  L YLKLV+KETLRLHPP PL+ PRE  +  
Sbjct  324   KDSRVMRKAQAEVREVFNMKRRVDENCITELKYLKLVVKETLRLHPPAPLLLPRECGKTC  383

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
             +I  Y IP K++VI+NAWA+  +P  W +PERF PERF +S+VD+ GN++E+IPFGAGRR
Sbjct  384   EIHGYNIPAKSKVIVNAWAIGRDPNYWTEPERFYPERFIDSTVDYKGNNFEYIPFGAGRR  443

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
             +CPGI FA   + ++LA LLYHF+W+LP G+  ++LDM+E  G+   +K DL L+  P++
Sbjct  444   ICPGIIFASRVVEVTLAMLLYHFDWKLPSGMISEELDMSEEFGITVRRKHDLFLVPFPYL  503

Query  1593  DL  1598
              L
Sbjct  504   PL  505



>gb|KHN43612.1| Cytochrome P450 71D9 [Glycine soja]
Length=481

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 249/480 (52%), Positives = 344/480 (72%), Gaps = 14/480 (3%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K A+   LPPGPWK+P+IG++H++VG SLPH  LR+LS KYGP+MHL+LGE+STIV+SSP
Sbjct  11    KPASTPNLPPGPWKIPIIGNIHNVVG-SLPHHRLRDLSAKYGPLMHLKLGEVSTIVVSSP  69

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             + A+ +  THDL+F+SRP I+A  I+ Y S  ++F+PYGDYWR++RKIC  ELLS K V+
Sbjct  70    EYAKEVLSTHDLIFSSRPPILASKIMSYDSMGMSFAPYGDYWRRLRKICASELLSSKRVQ  129

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R EEL+N +   R++S+ G P NLT++V    S+++++ A G  C  D  KFI+ 
Sbjct  130   SFQPIRGEELTNFIK--RIASKEGSPINLTKEVLLTVSTIVSRTALGNKC-RDHKKFISA  186

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +++    AGGFDLGDL+PS +W+ + SG+KPKL K H + D+I   I+ +H+E   A S+
Sbjct  187   VREATEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADRIMQNIVNEHRE---AKSS  243

Query  879   NSSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
              + G+ E++ D L+ V  KE    +F +++++IKAVI DMF  GT+TS+TTI WAM+EMI
Sbjct  244   ATHGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDMFGGGTQTSSTTITWAMAEMI  299

Query  1053  KRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             K P VM K  AEVR+   G     D+ D+ENL YLK V+KETLRLHPP PL+ PR+  + 
Sbjct  300   KNPRVMKKVHAEVREVFGGKVGHPDESDMENLKYLKSVVKETLRLHPPGPLLLPRQCGQA  359

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              +I  Y IP K++VIINAWA+  +P  W + ERF PERF  SSVD+ GN +E+IPFGAGR
Sbjct  360   CEINGYYIPIKSKVIINAWAIGRDPNHWSEAERFYPERFIGSSVDYQGNSFEYIPFGAGR  419

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R+CPG++F  T++   LA L+Y+F+W+LP+ +  +DLDMTEA GV A +K DLCLI   F
Sbjct  420   RICPGLTFGLTNVEFPLALLMYYFDWKLPNEMKNEDLDMTEAFGVSARRKDDLCLIPITF  479



>emb|CDP07886.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 253/478 (53%), Positives = 340/478 (71%), Gaps = 23/478 (5%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             ++ + A QKLPP PWKLPLIG+LHHL+G S PH +LRNLS+K+GP+MH QLGE+S+IV+S
Sbjct  24    RNGSKAAQKLPPSPWKLPLIGNLHHLIG-SPPHHALRNLSKKHGPLMHFQLGEVSSIVVS  82

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             S +LA+ + KTHDL F +R + +A  I+ Y   D+A +PYGDYWRQMRKI          
Sbjct  83    SSRLAKEVLKTHDLEFGNRAEFLATKILCYDYGDIASAPYGDYWRQMRKIY---------  133

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
                       E   L+SSI+  +  G   NL EK++ +TSS++ + AFG+V  +D   F+
Sbjct  134   ----------EALKLMSSIKTLAGAGKIVNLKEKLASYTSSMVCRAAFGKVSKDDHKAFL  183

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
              L+ + L L+  F++ DLFPS K +H     K KL+K+HH++D I D II  H +N LA 
Sbjct  184   QLVMEALPLSSAFEISDLFPSLKILHPLFSAKTKLMKVHHKMDVILDKIIDQHIDN-LAR  242

Query  873   STNSSGKD--EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             +  + G+   ED+ DVLLRVKE G+LQFPIT++N+KAV+ DMF  GTETS+TT+ WAMSE
Sbjct  243   TRMAMGESGHEDLTDVLLRVKESGDLQFPITKNNVKAVLFDMFLGGTETSSTTLEWAMSE  302

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             +IK P+VM K Q EVR+A  G KT ++ +++ L YLKLVIKETLRLHPP PL  P++  E
Sbjct  303   LIKNPNVMTKVQNEVRKAFTGKKTIEENEIQQLQYLKLVIKETLRLHPPAPLSVPKQCRE  362

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             + +I  Y IP KTR+ +N WA+A +PE W+DPE F PERFENSS+DF GNH+E +PFG+G
Sbjct  363   QCEIDGYSIPVKTRLFVNTWAIARDPEYWDDPESFKPERFENSSIDFTGNHFELLPFGSG  422

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             RR+CPGISF   ++ L L  LLYHF+W LP+G+SP DLDM E+VG+  ++K DLCL+A
Sbjct  423   RRICPGISFGIANVELPLTLLLYHFDWRLPNGLSPDDLDMIESVGIATTRKNDLCLLA  480



>ref|XP_003517257.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   489 bits (1260),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 258/488 (53%), Positives = 346/488 (71%), Gaps = 13/488 (3%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             + K K     KLPPGP KLPLIG+LH L + GSLPHR+LR+L+ KYGP+MHLQLGEIS++
Sbjct  25    YYKPKTTLSHKLPPGPKKLPLIGNLHQLAMAGSLPHRTLRDLALKYGPLMHLQLGEISSV  84

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V+SSP +A+ I KTHDL F  RP+ +   I+ Y   D+ F+PYGDYWRQM+KICV ELLS
Sbjct  85    VVSSPNMAKEIMKTHDLAFVQRPQFLPAQILTYGQNDIVFAPYGDYWRQMKKICVSELLS  144

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF   R++E S  + SIR+S   G P NLT K+    SS +++VAFG   S+DQ 
Sbjct  145   AKRVQSFSHIREDETSKFIESIRISE--GSPINLTSKIYSLVSSSVSRVAFGDK-SKDQE  201

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
             +F+ +L++++   GGF+  DLFPS K +H  +G K KL K+H ++DKI D I+ +H+E  
Sbjct  202   EFLCVLEKMILAGGGFEPDDLFPSMK-LHLINGRKAKLEKMHEQVDKIADNILREHQEKR  260

Query  864   LANSTNSSGK----DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  1031
                     GK    +ED+VDVLLR+++   L+  I+  NIKAVI D+F+ GT+TSA+T+ 
Sbjct  261   --QRALREGKVDLEEEDLVDVLLRIQQSDNLEIKISTTNIKAVILDVFTAGTDTSASTLE  318

Query  1032  WAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihp  1211
             WAM+EM++ P V  KAQAEVRQA +  K   + D+  LTYLKLVIKETLRLH P PL+ P
Sbjct  319   WAMAEMMRNPRVREKAQAEVRQAFRELKIIHETDVGKLTYLKLVIKETLRLHAPSPLLVP  378

Query  1212  rESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFI  1391
             RE  E   I  Y IP KT+V+IN WA+  +P+ W D ERF+PERF+ SS+DF GN++E++
Sbjct  379   RECSELTIIDGYEIPVKTKVMINVWAIGRDPQYWTDAERFVPERFDGSSIDFKGNNFEYL  438

Query  1392  PFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLC  1571
             PFGAGRRMCPG++F   +I L LA LLYHFNWELP+ + P+D+DM+E  G+  ++K +LC
Sbjct  439   PFGAGRRMCPGMTFGLANIMLPLALLLYHFNWELPNEMKPEDMDMSENFGLTVTRKSELC  498

Query  1572  LIARPFVD  1595
             LI  P V+
Sbjct  499   LI--PIVN  504



>ref|XP_003551489.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
 gb|AGB55872.1| flavonoid 6-hydroxylase 2 [Glycine max]
 gb|AGB55873.1| flavonoid 6-hydroxylase 2 [Glycine max]
Length=498

 Score =   489 bits (1258),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 249/480 (52%), Positives = 344/480 (72%), Gaps = 14/480 (3%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K A+   LPPGPWK+P+IG++H++VG SLPH  LR+LS KYGP+MHL+LGE+STIV+SSP
Sbjct  28    KPASTPNLPPGPWKIPIIGNIHNVVG-SLPHHRLRDLSAKYGPLMHLKLGEVSTIVVSSP  86

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             + A+ +  THDL+F+SRP I+A  I+ Y S  ++F+PYGDYWR++RKIC  ELLS K V+
Sbjct  87    EYAKEVLSTHDLIFSSRPPILASKIMSYDSMGMSFAPYGDYWRRLRKICASELLSSKRVQ  146

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R EEL+N +   R++S+ G P NLT++V    S+++++ A G  C  D  KFI+ 
Sbjct  147   SFQPIRGEELTNFIK--RIASKEGSPINLTKEVLLTVSTIVSRTALGNKC-RDHKKFISA  203

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +++    AGGFDLGDL+PS +W+ + SG+KPKL K H + D+I   I+ +H+E   A S+
Sbjct  204   VREATEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADRIMQNIVNEHRE---AKSS  260

Query  879   NSSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
              + G+ E++ D L+ V  KE    +F +++++IKAVI DMF  GT+TS+TTI WAM+EMI
Sbjct  261   ATHGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDMFGGGTQTSSTTITWAMAEMI  316

Query  1053  KRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             K P VM K  AEVR+   G     D+ D+ENL YLK V+KETLRLHPP PL+ PR+  + 
Sbjct  317   KNPRVMKKVHAEVREVFGGKVGHPDESDMENLKYLKSVVKETLRLHPPGPLLLPRQCGQA  376

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              +I  Y IP K++VIINAWA+  +P  W + ERF PERF  SSVD+ GN +E+IPFGAGR
Sbjct  377   CEINGYYIPIKSKVIINAWAIGRDPNHWSEAERFYPERFIGSSVDYQGNSFEYIPFGAGR  436

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R+CPG++F  T++   LA L+Y+F+W+LP+ +  +DLDMTEA GV A +K DLCLI   F
Sbjct  437   RICPGLTFGLTNVEFPLALLMYYFDWKLPNEMKNEDLDMTEAFGVSARRKDDLCLIPITF  496



>ref|XP_010655881.1| PREDICTED: cytochrome P450 71D10-like [Vitis vinifera]
Length=505

 Score =   488 bits (1257),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 249/480 (52%), Positives = 346/480 (72%), Gaps = 6/480 (1%)
 Frame = +3

Query  153   KSKA-AAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             +SKA  + QKLPPGPWKLPLIG++H LVG SLPHRSL  L++KYGP+M LQLGE+ST+++
Sbjct  25    RSKANISTQKLPPGPWKLPLIGNVHQLVG-SLPHRSLTLLAKKYGPLMRLQLGEVSTLIV  83

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP++A+ + KTHD  FA RP ++A  I+ Y  + VAF+PYGDYWRQ+RKICV+ELL+ K
Sbjct  84    SSPEMAKQVMKTHDTNFAQRPILLATRILSYDCSGVAFAPYGDYWRQLRKICVVELLTAK  143

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              VKSF S R+EE+SNL++ +  +S +    N TEK+S  T S+IA+ AFG+  SEDQ  F
Sbjct  144   RVKSFQSVREEEISNLITMV--TSCSRLQINFTEKISSLTFSIIARAAFGKK-SEDQDAF  200

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             ++++K+++  A GF + D++PS KW+   SGM+ K+ K+    D+I   I+ +H+E    
Sbjct  201   LSVMKELVETASGFCVADMYPSVKWLDLISGMRYKIDKVFRMTDRILQNIVDEHREKLKT  260

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
              S    G + D+VDVLL++++  +LQFP+T++NIKAVI D+F    E+++T++ WAMSEM
Sbjct  261   QSGKLEG-EADLVDVLLKLQQNDDLQFPLTDNNIKAVILDIFGGAGESTSTSVEWAMSEM  319

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             +K P V+ KAQAEVR    G    D+  ++ L +LK V+ ETLRLHPP PL+ PRE  E 
Sbjct  320   LKAPIVIEKAQAEVRSVFDGKGHVDETAIDELKFLKAVVNETLRLHPPFPLLLPRECREM  379

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              KI  Y IP KTR+I+NAWA+  + + W + ERF PERF +SS+D+ G  + +IPFGAGR
Sbjct  380   CKINGYEIPEKTRIIVNAWAIGRDSDYWVEAERFYPERFLDSSIDYKGTDFGYIPFGAGR  439

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R+CPGI FA   I L LA LLYHF+W+LP+G+  +DLDMTEA G+   +K+DL LI  P+
Sbjct  440   RICPGILFAMPGIELPLANLLYHFDWKLPNGMKAEDLDMTEAFGLAVRRKQDLHLIPIPY  499



>ref|XP_008779150.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=502

 Score =   488 bits (1256),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 335/478 (70%), Gaps = 7/478 (1%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K+ A +KLPP PWKLP+IG LHHL+G  LPHR+LR LSR++GP+MHL+LG++  I++SSP
Sbjct  26    KSTATRKLPPSPWKLPIIGHLHHLLG-PLPHRALRELSRRHGPLMHLRLGQVDHIIVSSP  84

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             ++AR I KTHDL+FASR KI+A    FY   D+ F+PYG YWR++RKICV+ELLS K VK
Sbjct  85    KMAREILKTHDLIFASRDKILA-SKAFYDGADIVFAPYGSYWRELRKICVIELLSAKRVK  143

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF + RQE +SNLV  I  S+    P NL+E     ++++ + V FG  C     +FI+ 
Sbjct  144   SFSTIRQEVMSNLVGYI--STMNNSPVNLSEMFLLTSNTMTSMVTFGTKCKHGP-RFIST  200

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA-NS  875
             LK++L    GF + DLFPS  +I   SG    L K H E+D+I   II +H+E     NS
Sbjct  201   LKKLLEFLSGFSVADLFPSLGFIDTLSGASSSLKKCHREVDEILGEIIKEHEEKRATKNS  260

Query  876   TNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
             +N   +  ED+VDVLL +KE G L+FP+T  +IKAVI DMF+ GTETSATT+ W M+E++
Sbjct  261   SNEEQQQGEDLVDVLLELKENGGLEFPLTLTSIKAVIMDMFAGGTETSATTLEWTMAELM  320

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             + P +M K QAEVRQALKG    +++D+    Y+KLVIKE+LRLH P PL+ PR   E  
Sbjct  321   RHPEIMEKVQAEVRQALKGKARIEEEDINKFHYMKLVIKESLRLHQPGPLLLPRVCRETC  380

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
             ++G Y IP  +R+I+NAWA AT+P  WEDPE F PERF+ SSVD+ G ++E++PFGAGRR
Sbjct  381   QVGGYNIPAGSRIIVNAWAAATDPRYWEDPESFKPERFDGSSVDYKGGNFEYMPFGAGRR  440

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             +CP ++F    + ++LA LLYHF+W+LP+G++P DLDMTE+       K  L LIA P
Sbjct  441   ICPAMTFGLAQVEVALANLLYHFDWKLPNGMAPNDLDMTESFAAAVGLKSRLWLIATP  498



>ref|XP_007214747.1| hypothetical protein PRUPE_ppa025066mg [Prunus persica]
 gb|EMJ15946.1| hypothetical protein PRUPE_ppa025066mg [Prunus persica]
Length=514

 Score =   488 bits (1257),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 246/471 (52%), Positives = 335/471 (71%), Gaps = 5/471 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LPPGPWKLP+IG+LH L  GSLPH  LR+L++KYGP+MHL+LGE+S +V+SS + A+ + 
Sbjct  38    LPPGPWKLPVIGNLHRL-AGSLPHHRLRDLAKKYGPLMHLKLGEVSAVVVSSAEFAKEVM  96

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHDL+FASRP I+A +I+ Y STD+ F+PYG+YWRQ+RKIC LELLS K V+SF   R+
Sbjct  97    KTHDLIFASRPTILAANILSYGSTDIGFAPYGEYWRQLRKICTLELLSTKRVQSFRPIRE  156

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE+ NL+  I  +S  G P NLT+++   T ++ ++ AFG+  + DQ KFI ++K+ +  
Sbjct  157   EEVVNLIQWI--ASRAGSPINLTQEIYSSTYTITSRTAFGKK-TRDQEKFIYIVKEFVKA  213

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
             A GF L D+FPS   +H  S M+PKL +LH E DKI   II +H+ N +   +     DE
Sbjct  214   ASGFALADIFPSVSLLHLLSRMRPKLERLHKEADKIMGNIIKEHQRNVVNTKSGEGEADE  273

Query  900   DIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             D+VDVLL+  + G EL+F +T +NIKAVI D+F+ G+ETS+T + WA++EMIK P VM  
Sbjct  274   DLVDVLLKFHDHGNELEFSLTTENIKAVIFDIFAAGSETSSTAVDWAIAEMIKNPRVMNM  333

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQ EVR+        D+  +  + YL LVIKETLRLHPP PL+ PRE  E+ +I  Y IP
Sbjct  334   AQNEVRELFNRKGQVDETCIREMKYLNLVIKETLRLHPPGPLLLPRECGEKCEIDGYEIP  393

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              K++VI+NAWA+  +P  W +PE F P RF ++S+D+ G ++E+IPFGAGRRMCPG+SF 
Sbjct  394   VKSKVIVNAWAIGRDPNYWNEPESFNPNRFLDNSIDYKGTNFEYIPFGAGRRMCPGVSFG  453

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
               S+ L LA LLYHF+W+LP+G+  +DLDMTEA G    +K DL LI  P+
Sbjct  454   LASVELPLALLLYHFDWKLPNGMKHEDLDMTEAFGATVKRKHDLHLIPIPY  504



>ref|XP_009347232.1| PREDICTED: cytochrome P450 71D11-like [Pyrus x bretschneideri]
Length=512

 Score =   488 bits (1257),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 251/481 (52%), Positives = 338/481 (70%), Gaps = 6/481 (1%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             +K+K +A   LPPGPWKLP IG++H LVG S PH  LRNL++KYGPIMHLQLGE+ST+V+
Sbjct  28    SKTKESAVN-LPPGPWKLPFIGNIHQLVG-SQPHHGLRNLAKKYGPIMHLQLGEVSTVVV  85

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SS + A+ + KTHD+V +SRP ++A  I+ Y++T++AF+P GDYWRQ+RKIC LELLS K
Sbjct  86    SSAEYAKEVMKTHDVVLSSRPYLLASRIMSYEATNIAFAPCGDYWRQLRKICTLELLSTK  145

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+ F   R+EE+ NL++ I   S  G P NLTEK+   T +  ++ AFG+  SED  KF
Sbjct  146   RVQGFRPLREEEVGNLITWI--GSNAGLPINLTEKIYSSTYTFTSRAAFGKK-SEDHEKF  202

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I  +K+ +++A GFDL D+FPS K ++   G++P L +L    D+I + II +HK+    
Sbjct  203   IDAVKESITVAAGFDLADVFPSAKLLNLIGGIRPTLERLKKVTDRIMENIINEHKKKRST  262

Query  870   NSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               +      ED+VDVLL+  E G  L+F +T DNIKAVI D+F  G+ETSATT+ WAMSE
Sbjct  263   TKSGEGEAGEDLVDVLLKFHERGNGLEFSLTTDNIKAVILDIFGAGSETSATTVDWAMSE  322

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MIK P ++   Q EVR+    N   D+  +  + YL LVIKETLRLHPP PL+ PRES E
Sbjct  323   MIKNPRILKMTQDEVREVYNRNGKADETGIREMKYLSLVIKETLRLHPPAPLLLPRESSE  382

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
               KI  Y IP KT+VI+N WA+  +P  W +PE F PERF +SS+D+ G ++E+IPFGAG
Sbjct  383   CCKINGYDIPVKTKVIVNGWAIGRDPNYWTEPESFYPERFLDSSIDYKGTNFEYIPFGAG  442

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPGIS+   ++ L LA LLYHF+W+LP+G+S +DLDMTE  GV   +K+DL LI  P
Sbjct  443   RRICPGISYGLANVELPLALLLYHFDWKLPNGMSQEDLDMTELFGVTVRRKEDLRLIPIP  502

Query  1587  F  1589
             +
Sbjct  503   Y  503



>ref|XP_003530791.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
Length=510

 Score =   488 bits (1256),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 243/470 (52%), Positives = 342/470 (73%), Gaps = 5/470 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             +P GP KLP+IG++++L+  S PHR LR+L+ KYGP+MHLQLGE+STIVISSP  A+ + 
Sbjct  40    MPHGPRKLPIIGNIYNLIC-SQPHRKLRDLAIKYGPVMHLQLGEVSTIVISSPDCAKEVM  98

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
              THD+ FA+RP+I+A +I+ Y ST +AFSPYG+YWRQ+RKIC+LELLS+K V S+   R+
Sbjct  99    TTHDINFATRPQILATEIMSYNSTSIAFSPYGNYWRQLRKICILELLSLKRVNSYQPVRE  158

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EEL NLV  I  +SE G P NLT+ V     ++ ++  FG+ C +DQ KFI++L + + +
Sbjct  159   EELFNLVKWI--ASEKGSPINLTQAVLSSVYTISSRATFGKKC-KDQEKFISVLTKSIKV  215

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
             + GF++GDLFPS  W+ + +G++PKL +LH + D+I + II DHKE   + +     + +
Sbjct  216   SAGFNMGDLFPSSTWLQHLTGLRPKLERLHQQADQILENIINDHKEAK-SKAKGDDSEAQ  274

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+VDVL++ ++G +  F +T++NIKA+I D+F+ G ETSATTI WAM+EMIK P VM KA
Sbjct  275   DLVDVLIQYEDGSKQDFSLTKNNIKAIIQDIFAAGGETSATTIDWAMAEMIKDPRVMKKA  334

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             QAEVR+    N   D+  +  L YLKL++KETLRLHPP PL+ PRE  +  +I  Y IP 
Sbjct  335   QAEVREVFGMNGRVDENCINELQYLKLIVKETLRLHPPAPLLLPRECGQTCEIHGYHIPA  394

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
             KT+VI+NAWA+  +P+ W + ERF PERF +S++D+ GN +EFIPFGAGRR+CPG + A 
Sbjct  395   KTKVIVNAWAIGRDPKYWTESERFYPERFIDSTIDYKGNSFEFIPFGAGRRICPGSTSAL  454

Query  1440  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
              +I L+LA LLYHF+W LP+G+   +LDM+E  GV   +K DL L+  P+
Sbjct  455   RTIDLALAMLLYHFDWNLPNGMRSGELDMSEEFGVTVRRKDDLILVPFPY  504



>gb|KEH34013.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score =   488 bits (1255),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 244/472 (52%), Positives = 338/472 (72%), Gaps = 7/472 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LP GP KLP+IG++H+L+  S PHR L +L++KYGP+MHLQLGE+STIVISS + A+ + 
Sbjct  37    LPKGPRKLPIIGNIHNLLS-SQPHRKLSDLAKKYGPLMHLQLGEVSTIVISSAEFAKEVM  95

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD+ FA+RPK++A+DI+ Y ST ++FSPYGDYWRQ RKIC LELLS+K V S+   R+
Sbjct  96    KTHDIHFATRPKVLAIDIMSYNSTSISFSPYGDYWRQARKICTLELLSLKRVNSYQPIRE  155

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             E  SNL+ SI  +SE G P N TE V     +++++ AFG  C +DQ KFI+++K+ + +
Sbjct  156   EVFSNLIKSI--ASENGSPINFTEAVLSSIYTIVSRAAFGNKC-KDQEKFISVVKESVKI  212

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-D  896
             A GFDLGD FPS KW+ Y +G++PK+ K H + D+I + II +HK           G+  
Sbjct  213   AAGFDLGDSFPSSKWLQYVTGLRPKIEKFHQQTDEILENIIDEHKREKYTKVKGDQGEVA  272

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             ED+VD+LL+ ++G +  F +T+DNIKA+I D+F  G ETSA+T  WAM EMI+ P +M K
Sbjct  273   EDLVDILLKYEDGSDQDFSLTKDNIKAIILDIFGGGGETSASTTDWAMIEMIRNPRIMKK  332

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQ EVR  +K     D+K +  L+YLK V+KETLRLHP +PL+ PRE  +  +I  Y IP
Sbjct  333   AQDEVRDVIKMKGRVDEKCINELSYLKSVVKETLRLHPSVPLLLPRECGKACEIHGYHIP  392

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              KT+VIINAWA+A +P  W +PE+F PERF ++ +D+ G+++E+IPFG GRR+CPG +F 
Sbjct  393   VKTKVIINAWAIARDPNYWTEPEKFYPERFIDNGIDYKGSNFEYIPFGGGRRICPGSTFG  452

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
               ++ L+LA LLYHF+W+LP G+   +LDMTE  GV   +K DL L+  PFV
Sbjct  453   LRNVELALAMLLYHFDWKLPGGIKCDELDMTEQFGVTMRRKDDLLLL--PFV  502



>gb|AIZ01224.1| epi-aristolochene dihydroxylase, partial [Nicotiana benthamiana]
Length=438

 Score =   484 bits (1247),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 240/436 (55%), Positives = 326/436 (75%), Gaps = 2/436 (0%)
 Frame = +3

Query  225   HLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAITKTHDLVFASRPKIMA  404
             H++GG  PH  LR+L++KYGP+MHLQLGEIS +V++S  +A+ + KTHD+VFASRPKI+A
Sbjct  3     HMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVVVTSRDMAKEVLKTHDVVFASRPKIVA  61

Query  405   LDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSE  584
             +DI+ Y  +D+AFSP+GD+WRQMRKICV+ELL+ K V+SF S R++E+  L+ SIR  S 
Sbjct  62    MDIICYNQSDIAFSPHGDHWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDSIRSDSS  121

Query  585   TGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKW  764
             +G   N T+++ WF SS+  + AFG+V  + Q  F   +++V+ LA GFD+ D+FP+ K+
Sbjct  122   SGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDIFAKKIREVIGLAEGFDVVDIFPTYKF  180

Query  765   IHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGEL  944
             +H  SGMK KLL  H ++D I + +I +HK+N  A  +N +   ED++DVLLR+     L
Sbjct  181   LHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAGKSNGALGGEDLIDVLLRLMNDTSL  240

Query  945   QFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFD  1124
             QFPIT DNIKAVI DMF+ GTETS+TT +WAM+EM+K P V  KAQAEVR+A +   +FD
Sbjct  241   QFPITNDNIKAVIVDMFAAGTETSSTTTVWAMAEMMKNPRVFTKAQAEVREAFRDKVSFD  300

Query  1125  DKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNP  1304
             + D+E L YLKLVIKETLRLHPP PL+ PRE  E+  I  Y IP KT+V++N WAL  +P
Sbjct  301   ENDVEELKYLKLVIKETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDP  360

Query  1305  ESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFN  1484
             + W+D E F PERFE  S+DF GN++EF+PFG GRR+CPG+SF   ++ L LA LLYHF+
Sbjct  361   KYWDDAESFKPERFEQCSLDFYGNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFD  420

Query  1485  WELPDGVSPKDLDMTE  1532
             W+LP G+ P+DLD+TE
Sbjct  421   WKLPTGMKPRDLDLTE  436



>ref|XP_006363816.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363817.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=503

 Score =   487 bits (1254),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 245/482 (51%), Positives = 349/482 (72%), Gaps = 10/482 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W KSK   + KLPPGP KLPLIG+LH L   SLPH +L+NLS KYGP+MHLQLGE+S ++
Sbjct  27    WKKSKI--QYKLPPGPRKLPLIGNLHQL-SNSLPHHTLKNLSNKYGPMMHLQLGEVSAVI  83

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSPQ+A+ + KTHD++FA+RP+++++ I+   S  ++FSPYG  WRQ+RK+CVLELLS 
Sbjct  84    VSSPQVAKEVLKTHDIIFANRPQLLSVQILSNNSPTLSFSPYGANWRQLRKVCVLELLSA  143

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+SF S R+EE+ NL+ +I    +   P +++E +   T+++ A+ AFG+ C + + +
Sbjct  144   KRVQSFESIREEEVENLIEAISFI-QPQVPIDISEMLFSMTNNITARAAFGKKC-KHKDE  201

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI  +K +  L+GGFD+ DLFPS K  H  SG++  L K+H  +DKIF+ II +HK    
Sbjct  202   FIKAMKTITELSGGFDIPDLFPSLKIFHSLSGVRSALEKVHQNVDKIFEDIIQEHK----  257

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             AN  +   K ED+VDVLLRV+E G+L+ PI+ + +K+VI ++F  GT+TS+T + WA+SE
Sbjct  258   ANKRDMLYK-EDLVDVLLRVQESGDLEIPISRNTLKSVILEIFIGGTDTSSTVLEWAISE  316

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P VM KAQAEVR+  KG     + +++ L Y+KLVIKETLR+HPP PL+ PRE++E
Sbjct  317   MMKNPQVMEKAQAEVRRVFKGKSKITESEIQKLDYMKLVIKETLRMHPPAPLLLPREAIE  376

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             +  IG Y IP KT+VIINAWA+  +PE W++ E F PERF++S +DF+G + E+IPFG G
Sbjct  377   KCDIGGYEIPAKTKVIINAWAIGRHPEHWKNAECFEPERFQDSDLDFIGTNLEYIPFGGG  436

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RR+CPG  F   ++ L LA LL+HF+W+LPDG+   +LDMTE  G    +K DL L+A+P
Sbjct  437   RRICPGTLFGIANVELPLAKLLFHFDWKLPDGIEASNLDMTETFGATVGRKNDLYLVAKP  496

Query  1587  FV  1592
             ++
Sbjct  497   YI  498



>gb|AGB55871.1| flavonoid 6-hydroxylase 2 [Glycine max]
Length=498

 Score =   487 bits (1253),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 248/480 (52%), Positives = 343/480 (71%), Gaps = 14/480 (3%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K  +   LPPGPWK+P+IG++H++VG SLPH  LR+LS KYGP+MHL+LGE+STIV+SSP
Sbjct  28    KPTSTPNLPPGPWKIPIIGNIHNVVG-SLPHHRLRDLSAKYGPLMHLKLGEVSTIVVSSP  86

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             + A+ +  THDL+F+SRP I+A  I+ Y S  ++F+PYGDYWR++RKIC  ELLS K V+
Sbjct  87    EYAKEVLSTHDLIFSSRPPILASKIMSYDSMGMSFAPYGDYWRRLRKICASELLSSKRVQ  146

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R EEL+N +   R++S+ G P NLT++V    S+++++ A G  C  D  KFI+ 
Sbjct  147   SFQPIRGEELTNFIK--RIASKEGSPINLTKEVLLTVSTIVSRTALGNKC-RDHKKFISA  203

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +++    AGGFDLGDL+PS +W+ + SG+KPKL K H + D+I   I+ +H+E   A S+
Sbjct  204   VREATEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADRIMQNIVNEHRE---AKSS  260

Query  879   NSSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
              + G+ E++ D L+ V  KE    +F +++++IKAVI DMF  GT+TS+TTI WAM+EMI
Sbjct  261   ATHGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDMFGGGTQTSSTTITWAMAEMI  316

Query  1053  KRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             K P VM K  AEVR+   G     D+ D+ENL YLK V+KETLRLHPP PL+ PR+  + 
Sbjct  317   KNPRVMKKVHAEVREVFGGKVGHPDESDMENLKYLKSVVKETLRLHPPGPLLLPRQCGQA  376

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              +I  Y IP K++VIINAWA+  +P  W + ERF PERF  SSVD+ GN +E+IPFGAGR
Sbjct  377   CEINGYYIPIKSKVIINAWAIGRDPNHWSEAERFYPERFIGSSVDYQGNSFEYIPFGAGR  436

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R+CPG++F  T++   LA L+Y+F+W+LP+ +  +DLDMTEA GV A +K DLCLI   F
Sbjct  437   RICPGLTFGLTNVEFPLALLMYYFDWKLPNEMKNEDLDMTEAFGVSARRKDDLCLIPITF  496



>gb|KEH34016.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   486 bits (1251),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 236/468 (50%), Positives = 341/468 (73%), Gaps = 5/468 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             +PPGP KLP+IG++H+L+  S PHR LR+L++KYGP+MHLQLGE+S +VISSP+ A  + 
Sbjct  1     MPPGPIKLPIIGNIHNLLS-SQPHRKLRDLAKKYGPVMHLQLGEVSNMVISSPECASEVM  59

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD+ F+SRP+I+  +I+ Y ST +AF+PYG+YWRQ+RKIC LELLS+K V S+   R+
Sbjct  60    KTHDIHFSSRPQILVTEIISYNSTSIAFAPYGNYWRQIRKICTLELLSLKRVNSYQPIRE  119

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             E LSNLV  I  +S+ G P N++E V     +++++ AFG  C +DQ KFI+L++Q + +
Sbjct  120   EVLSNLVKWI--ASQKGTPINISEAVLSTMYTIVSRSAFGNEC-KDQEKFISLVRQTIKV  176

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-D  896
             AGGF+LGDLFPS KW+   +G++PKL ++H + D+I + II +HKE     + +  G+ +
Sbjct  177   AGGFNLGDLFPSAKWLQRITGLRPKLERIHRQTDQILENIINEHKEEKYTKAKDDQGRVE  236

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             ED+VDVLL  ++G      +T++NIKA+I D+F  G ETSA+TI WAM+EM++ P +M K
Sbjct  237   EDLVDVLLNYEDGRNQDLSLTKNNIKAIIMDIFGAGGETSASTIDWAMAEMVRNPRIMKK  296

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQAEVR+  K     ++  +  L YLK V+KETLRLHPP PL+ PRE ++   I  Y IP
Sbjct  297   AQAEVREVFKMKGRVEENCINELIYLKSVVKETLRLHPPTPLLLPRECVQACVINGYHIP  356

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              K++V INAWA+A +P  W +PERF PERF +S++D+ G+++E+IPFGAGRR+CPG +F 
Sbjct  357   IKSKVTINAWAIARDPNYWTEPERFYPERFIDSAIDYKGSNFEYIPFGAGRRICPGSTFG  416

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
               +I ++LA LLYHF+W+LP G+  ++LDMT+  G    +K +L L +
Sbjct  417   LRNIDMALAMLLYHFDWKLPSGIKSEELDMTDEFGATMRRKDELLLFS  464



>ref|XP_004247352.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=502

 Score =   487 bits (1253),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 240/484 (50%), Positives = 340/484 (70%), Gaps = 13/484 (3%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGS----LPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             +  +K+KLPPGPWKLPLIG+LHHL+       LPHR+L  L+ K+G +MH++LGE   IV
Sbjct  24    ECNSKKKLPPGPWKLPLIGNLHHLIDWQSSELLPHRTLAKLASKHGDLMHMKLGEREAIV  83

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSPQ+ R + + HDL+F++RP ++    +FY   D+ F  YGD+WRQMRKIC+ ELLS 
Sbjct  84    VSSPQMVREVMRKHDLIFSNRPTLLVGTEMFYDHADMGFCNYGDFWRQMRKICIQELLSH  143

Query  507   KMVKSFCSFRQEELSNLVSSIRLS-SETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
             K ++SF      E++NLVS I+ S SE G   N+TE +S +T+S+I K + GR C ++QG
Sbjct  144   KNIQSFYPNMMNEITNLVSCIKSSASEGGSSINMTETLSLYTNSIICKASVGRAC-KNQG  202

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
               I +++ V + AG FDL DLFPS K IH+ SG+K KL K+H E+D + + II +H+   
Sbjct  203   SLIEIMRTVAASAGVFDLADLFPSMKMIHFISGLKYKLRKMHDEVDVVLEEIINEHE---  259

Query  864   LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
                S NS   +EDIVDVLLR+++  +   PIT DNIKA+I D+F+ G+ TSA+T+ WA S
Sbjct  260   ---SQNSETSEEDIVDVLLRLQKSQDFSIPITRDNIKAIIIDLFAGGSTTSASTMEWAFS  316

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKT-FDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             E++K P +M KAQ EVRQ  KG +T  D  D++ L Y+K+++KET+R HP  PL+ PRES
Sbjct  317   ELMKNPEIMKKAQDEVRQVFKGKETTIDQADIQKLKYIKMIVKETVRFHPLAPLLAPRES  376

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              EE +I  Y+IP  T  ++N WA++ +P  W++PE F PERF +S +DF+G H+EF PFG
Sbjct  377   REECEINGYVIPKGTMALVNFWAISRDPNYWQNPEIFDPERFNDSHLDFIGAHFEFTPFG  436

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
              GRR+CPG+SF+  ++ LS+A LLYHF+W+LP+G++P +LDMTE  G    +K +L LI 
Sbjct  437   TGRRICPGLSFSMATVELSIALLLYHFDWKLPNGMNPHELDMTEKFGNALERKNNLFLIP  496

Query  1581  RPFV  1592
              P+V
Sbjct  497   LPYV  500



>ref|XP_008791005.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=506

 Score =   486 bits (1251),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 244/485 (50%), Positives = 353/485 (73%), Gaps = 10/485 (2%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             AKS+A   +KLPP P KLP+IG LHHL G ++ HR+LR+LSR++GP+M+L+LG++  +VI
Sbjct  30    AKSRA---RKLPPSPRKLPIIGHLHHLRG-NVHHRALRDLSRRHGPVMYLKLGQVDHVVI  85

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP+ AR I +THDL+FA+RP+++  +++ +  TD+AF+PYG+YWRQ+RKIC++ELLS K
Sbjct  86    SSPEAAREIMQTHDLIFATRPRLLIPEML-HHCTDIAFAPYGNYWRQLRKICIVELLSAK  144

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              VK+F + +QEE+SNLV +I + +++  P NL+EK+S  T+ +I++VA G+ C   Q + 
Sbjct  145   RVKAFATPQQEEISNLVGNISMLNKS--PVNLSEKLSLLTNGVISRVACGKTCKHGQ-RI  201

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I+  K++ +LA GF + DLFPS  +I   SG++        ELD+I + II +H+E   A
Sbjct  202   ISSCKKLTALASGFCVADLFPSFGFIDTLSGLRSASANARRELDEILEDIIKEHQEKRAA  261

Query  870   NSTNSSG--KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
              ++N     ++ED+VDVLL +KE G L+FP+T  NIKAVI DMF  GT+TS+ T++WAM+
Sbjct  262   TNSNKGDDQREEDLVDVLLGLKENGGLEFPLTHTNIKAVIMDMFFAGTDTSSETMVWAMA  321

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             E++K+P VM KAQAEVR+ LKG    ++ D+    Y+KLVIKETLRLHPP PL+ PR   
Sbjct  322   ELLKQPEVMEKAQAEVRRVLKGKAKIEEGDMSEFHYMKLVIKETLRLHPPAPLLLPRVCT  381

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             +  ++  Y IP  +RV+INAWA+  +P  WEDPE F PERFE SSVDF+G+ +E +PFG 
Sbjct  382   KSCQVDGYDIPVGSRVMINAWAIGRDPRYWEDPESFKPERFEGSSVDFVGSSFELVPFGG  441

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRR+CPG++F    + L L+ LLY+F+W+LP+G+ P D++MTE  G    +K  LCLIA 
Sbjct  442   GRRICPGMNFGLAEMELFLSHLLYYFDWKLPNGMGPDDVEMTETFGSTVGRKSPLCLIAT  501

Query  1584  PFVDL  1598
             P+V +
Sbjct  502   PYVPI  506



>ref|XP_003529194.2| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=517

 Score =   486 bits (1252),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 241/475 (51%), Positives = 340/475 (72%), Gaps = 6/475 (1%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K  +   +PPGPWKLP+IG++HHLV  + PHR LR+L++ YGP+MHLQLGE+ TI++SSP
Sbjct  31    KTESSPNIPPGPWKLPIIGNIHHLVTCT-PHRKLRDLAKTYGPLMHLQLGEVFTIIVSSP  89

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             + A+ I KTHD++FASRPKI+A DI+ Y+ST++ FSPYG+YWRQ+RKIC +ELL+ + V 
Sbjct  90    EYAKEIMKTHDVIFASRPKILASDILCYESTNIVFSPYGNYWRQLRKICTVELLTQRRVN  149

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R+EE +NLV  I   S  G P NLTE V     S+I++ AFG  C +DQ +FI++
Sbjct  150   SFKQIREEEFTNLVKMI--DSHKGSPINLTEAVFLSIYSIISRAAFGTKC-KDQEEFISV  206

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +K+ +++  GF++GDLFPS KW+   +G++PKL +LH + D+I   II +H+E       
Sbjct  207   VKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHGKTDRILKEIINEHREAKSKAKE  266

Query  879   NSSGKDEDIVDVLLRVKEGGELQ--FPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
             +    +ED+VDVLL+ ++G +      +T +NIKA+I D+F+ G ETSATTI WAM+E+I
Sbjct  267   DQGEAEEDLVDVLLKFQDGDDRNQDISLTINNIKAIILDVFAAGGETSATTINWAMAEII  326

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             K P VM KAQ EVR+        D+  +  L YLK V+KETLRLHPP PL+ PRE  +  
Sbjct  327   KDPRVMKKAQVEVREIFNMKGRVDEICINELKYLKSVVKETLRLHPPAPLLIPRECGQTC  386

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
             +I  Y IP K++V +NAWA+  +P+ W +PERF PERF +SS+D+ GN++EF PFG+GRR
Sbjct  387   EINGYHIPVKSKVFVNAWAIGRDPKYWTEPERFYPERFIDSSIDYKGNNFEFTPFGSGRR  446

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             +CPGI+    ++ L+LA LLYHF+W+LP+G+  ++LDMTE  G    +K+DL LI
Sbjct  447   ICPGITLGSVNVELALAFLLYHFHWKLPNGMKSEELDMTEKFGASVRRKEDLYLI  501



>gb|KHM99028.1| Cytochrome P450 71D11 [Glycine soja]
Length=496

 Score =   485 bits (1249),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 241/478 (50%), Positives = 343/478 (72%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K  +   +PPGPWKLP+IG++HHLV  S PHR LR+L++ YGP+MHLQLGE+ TI++SSP
Sbjct  19    KTESSPNIPPGPWKLPIIGNIHHLVT-SAPHRKLRDLAKMYGPLMHLQLGEVFTIIVSSP  77

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             + A+ I KTHD++FASRPKI+A DI+ Y+ST++ FSPYG+YWRQ+RKIC LEL + K V 
Sbjct  78    EYAKEIMKTHDVIFASRPKILASDILCYESTNIVFSPYGNYWRQLRKICTLELFTQKRVN  137

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R++EL+NLV  +   S  G P N TE V     ++I++ AFG  C +DQ +FI++
Sbjct  138   SFQPTREKELTNLVKMV--DSHKGSPMNFTEAVLLSIYNIISRAAFGMEC-KDQEEFISV  194

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +K+ +++  GF++GDLFPS KW+   +G++PKL +LH ++D+I + II +HK+   ANS 
Sbjct  195   VKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHRQIDRILEGIINEHKQ---ANSK  251

Query  879   NSSGKDEDIVDVLLRVKEGGE--LQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
               S   ED+VDVLL+ ++G +      ++ +NIKA+I D+FS G +T+A+TI WAM+EMI
Sbjct  252   GYSEAKEDLVDVLLKFQDGNDSNQDICLSINNIKAIILDIFSAGGDTAASTINWAMAEMI  311

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             +   VM K Q EVR+        D+  ++ L YLK V+KETLRLHPP PL+ PRE  +  
Sbjct  312   RDSRVMEKVQIEVREVFNMKGRVDEICIDELKYLKSVVKETLRLHPPAPLLLPRECGQAC  371

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
             +I  Y IP K++VI+NAWA+  +P+ W + ERF PERF +SS+D+ G ++E+IPFGAGRR
Sbjct  372   EINGYHIPVKSKVIVNAWAIGRDPKYWSEAERFYPERFIDSSIDYKGTNFEYIPFGAGRR  431

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             +CPG +F   ++ ++LA LLYHF+W+LP+G+  +DLDMTE  GV   +K DL LI  P
Sbjct  432   ICPGSTFGLINVEVALAFLLYHFDWKLPNGMKSEDLDMTEQFGVTVRRKNDLYLIPVP  489



>ref|XP_010644548.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   485 bits (1249),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 259/467 (55%), Positives = 340/467 (73%), Gaps = 4/467 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPWKLP+IG++H LVG SLPHRSLR+L++K+GP+MHLQLGE+S IV+SS ++A+ +
Sbjct  36    KLPPGPWKLPIIGNMHQLVG-SLPHRSLRSLAKKHGPLMHLQLGEVSAIVVSSREMAKEV  94

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHD++F+ RP I+A  IV Y  TD+AF+PYG YWRQ+RKI VLELLS K V+SF S R
Sbjct  95    MKTHDIIFSQRPCILAASIVSYDCTDIAFAPYGGYWRQIRKISVLELLSAKRVQSFRSVR  154

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             +EE+ NLV S+ L  + G   NLT+ +   T S+I++ AFG+ C +DQ  F   L +   
Sbjct  155   EEEVLNLVRSVSL--QEGVLINLTKSIFSLTFSIISRTAFGKKC-KDQEAFSVTLDKFAD  211

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  896
              AGGF + D+FPS K +H  SGM+ KL K+H +LD+I   II +HK    A  T  +  D
Sbjct  212   SAGGFTIADVFPSIKLLHVVSGMRRKLEKVHKKLDRILGNIINEHKARSAAKETCEAEVD  271

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             +D+VDVLL+V++ G+L+FP+T DNIKAV+ D+F  GTETS+T + WAM+EM+K P VMAK
Sbjct  272   DDLVDVLLKVQKQGDLEFPLTMDNIKAVLLDLFVAGTETSSTAVEWAMAEMLKNPRVMAK  331

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQAEVR         D+  +  L +LKLVIKETLRLHPP+PL+ PRES E   I  Y IP
Sbjct  332   AQAEVRDIFSRKGNADETVVRELKFLKLVIKETLRLHPPVPLLIPRESRERCAINGYEIP  391

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              KTRVIINAWA+A +P+ W D E F PERF +SS+D+ G ++E+IPFGAGRRMCPGI F 
Sbjct  392   VKTRVIINAWAIARDPKYWTDAESFNPERFLDSSIDYQGTNFEYIPFGAGRRMCPGILFG  451

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
               ++ L+LA LLYHF+W+LP+G   ++LDMTE       +K+DL LI
Sbjct  452   MANVELALAQLLYHFDWKLPNGARHEELDMTEGFRTSTKRKQDLYLI  498



>ref|XP_006605460.1| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=508

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 241/478 (50%), Positives = 343/478 (72%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K  +   +PPGPWKLP+IG++HHLV  S PHR LR+L++ YGP+MHLQLGE+ TI++SSP
Sbjct  31    KTESSPNIPPGPWKLPIIGNIHHLVT-SAPHRKLRDLAKMYGPLMHLQLGEVFTIIVSSP  89

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             + A+ I KTHD++FASRPKI+A DI+ Y+ST++ FSPYG+YWRQ+RKIC LEL + K V 
Sbjct  90    EYAKEIMKTHDVIFASRPKILASDILCYESTNIVFSPYGNYWRQLRKICTLELFTQKRVN  149

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R++EL+NLV  +   S  G P N TE V     ++I++ AFG  C +DQ +FI++
Sbjct  150   SFQPTREKELTNLVKMV--DSHKGSPMNFTEAVLLSIYNIISRAAFGMEC-KDQEEFISV  206

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +K+ +++  GF++GDLFPS KW+   +G++PKL +LH ++D+I + II +HK+   ANS 
Sbjct  207   VKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHRQIDRILEGIINEHKQ---ANSK  263

Query  879   NSSGKDEDIVDVLLRVKEGGE--LQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
               S   ED+VDVLL+ ++G +      ++ +NIKA+I D+FS G +T+A+TI WAM+EMI
Sbjct  264   GYSEAKEDLVDVLLKFQDGNDSNQDICLSINNIKAIILDIFSAGGDTAASTINWAMAEMI  323

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             +   VM K Q EVR+        D+  ++ L YLK V+KETLRLHPP PL+ PRE  +  
Sbjct  324   RDSRVMEKVQIEVREVFNMKGRVDEICIDELKYLKSVVKETLRLHPPAPLLLPRECGQAC  383

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
             +I  Y IP K++VI+NAWA+  +P+ W + ERF PERF +SS+D+ G ++E+IPFGAGRR
Sbjct  384   EINGYHIPVKSKVIVNAWAIGRDPKYWSEAERFYPERFIDSSIDYKGTNFEYIPFGAGRR  443

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             +CPG +F   ++ ++LA LLYHF+W+LP+G+  +DLDMTE  GV   +K DL LI  P
Sbjct  444   ICPGSTFGLINVEVALAFLLYHFDWKLPNGMKSEDLDMTEQFGVTVRRKNDLYLIPVP  501



>ref|XP_006475119.1| PREDICTED: premnaspirodiene oxygenase-like [Citrus sinensis]
Length=507

 Score =   484 bits (1247),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 251/483 (52%), Positives = 333/483 (69%), Gaps = 7/483 (1%)
 Frame = +3

Query  147   WAKSKA--AAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEIST  320
             W KSK   +    LPPGPW+LP+IG+LH LVG SLPH  L +L++KYGP+MHLQLG++S 
Sbjct  22    WKKSKNNHSTLLNLPPGPWRLPVIGNLHQLVG-SLPHHCLSDLAKKYGPLMHLQLGQVSH  80

Query  321   IVISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELL  500
             IVISSP+ A+ + +THD+ FASRP ++A     Y  T++AF+P+GDYWRQ+RKIC LEL 
Sbjct  81    IVISSPEAAKEVMRTHDMSFASRPFLLAASFFTYNFTNIAFAPHGDYWRQLRKICTLELF  140

Query  501   SMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQ  680
             S K V+SF S R+EE+SNL++SI  SS +G P NL++ V    + +  + AFG  C +DQ
Sbjct  141   SAKRVQSFRSIREEEVSNLITSI--SSNSGLPVNLSKMVFSLINGITTRAAFGVRC-QDQ  197

Query  681   GKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN  860
              + + +  + + L GGF+L D+FPS K +   +G++P+L +LH  LD+I   II +HKE 
Sbjct  198   EELMTVFHKAIELGGGFNLADVFPSIKLLGKLTGIEPELERLHQALDRILGNIINEHKEG  257

Query  861   HLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
                  T   G+ +D+V VLL  +E GEL F +T DNIKA I D+F  GT++S T I WAM
Sbjct  258   KALGKT-VEGEADDLVHVLLNCQENGELGFILTTDNIKAAITDIFIAGTDSSVTVIEWAM  316

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             SEM+K P VM KAQAEVRQA + N   D+  L  L YLKLV+KETLRLH PLPL+ PRE 
Sbjct  317   SEMMKNPRVMEKAQAEVRQAFEKNGNVDEIGLHELQYLKLVVKETLRLHTPLPLLLPREC  376

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              E  KI  Y IP  ++VI+NAWA+A +P  W D E F PERF +SS+D+ GN++E+IPFG
Sbjct  377   GERCKILGYDIPKGSKVIVNAWAIARDPWYWNDAESFYPERFLDSSIDYKGNYFEYIPFG  436

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             AGRR+CPG+ F   +I L LA LL+H NW+LP+G    DLDM E  G    +K DL L+ 
Sbjct  437   AGRRICPGMLFGMANIELPLAQLLFHLNWKLPNGEQNNDLDMAENFGGSVRRKNDLFLVP  496

Query  1581  RPF  1589
              P+
Sbjct  497   TPY  499



>ref|XP_003611884.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94842.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   484 bits (1247),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 253/470 (54%), Positives = 332/470 (71%), Gaps = 6/470 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLV-GGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             KLPP P KLPLIG+LH L   G LPH  L+ LS+KYGP+MHLQLGEI+ +V+SS  LA+ 
Sbjct  34    KLPPSPRKLPLIGNLHQLAFAGKLPHHGLQKLSQKYGPLMHLQLGEINAVVVSSSNLAKE  93

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             + KTHD+VFA+RPK+ +L I+ Y   D+ FSPYGDYWRQMRKICVLE+LS K V+SF   
Sbjct  94    VMKTHDVVFANRPKLPSLKILAYGFKDIVFSPYGDYWRQMRKICVLEILSAKRVQSFSYI  153

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             R++E    + SI+  S  G   NLT ++    +S+I + A G   SEDQ +F++L+++ +
Sbjct  154   REDETKKFIESIK--SFAGSKINLTTRIFSVINSIILRAALGD-KSEDQEEFVSLIRKAV  210

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-ANSTNSSG  890
             +++ G +L DLFPS K IH  +GMK  + K+H  +DKI D ++  H+E     N  N S 
Sbjct  211   AVSSGLELIDLFPSMKLIHVLTGMKKNVEKIHKRVDKILDNVVRKHQEKRARGNEGNKSE  270

Query  891   -KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
              + ED+VDVLLRV++ G L   +T +NIKAVI D+F  GT+TS+TTI WAMSEM+K P V
Sbjct  271   IEKEDLVDVLLRVQQSGSLDVQLTINNIKAVIWDVFVAGTDTSSTTIEWAMSEMMKNPRV  330

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
               KAQAE+RQA  G +   + D+E L+YLKLVIKETLRLHPP PL+ PR S E  KI  Y
Sbjct  331   REKAQAELRQAFNGKELIYETDVEKLSYLKLVIKETLRLHPPSPLLVPRLSTELTKIDGY  390

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP  T V INAWA+  +P+ W D ERF+PERF++S +DF GN++E+IPFGAGRRMCPG+
Sbjct  391   DIPKNTTVFINAWAIGRDPKYWNDAERFIPERFDDSLIDFKGNNFEYIPFGAGRRMCPGM  450

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             +F   S+   LA LLYHFNWELP+ +  +DLDM E  G+   +K +LCLI
Sbjct  451   TFGLASVIFPLALLLYHFNWELPNQMKSQDLDMIEDFGLTVGRKNELCLI  500



>gb|KHM99475.1| Cytochrome P450 71D9 [Glycine soja]
Length=474

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 249/482 (52%), Positives = 347/482 (72%), Gaps = 14/482 (3%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K K+A+   LPPGPWKLP+IG++ ++VG SLPH  LR+LS KYGP+MHL+LGE+STIV+S
Sbjct  2     KKKSASTPNLPPGPWKLPIIGNILNIVG-SLPHCRLRDLSAKYGPLMHLKLGEVSTIVVS  60

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP+ A+ +  T+DL+F+SRP I+A  I+ Y S  ++F+PYGDYWR +RKIC  ELLS K 
Sbjct  61    SPEYAKEVLNTNDLIFSSRPPILASKIMSYDSKGMSFAPYGDYWRWLRKICTSELLSSKC  120

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V+SF   R EEL+N +   R++S+ G   NLT++V    S+++++ A G  C + Q KFI
Sbjct  121   VQSFQPIRGEELTNFIK--RIASKEGSAINLTKEVLTTVSTIVSRTALGNKCRDHQ-KFI  177

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
             + +++    AGGFDLGDL+PS +W+ + SG+KPKL K H + D+I   II +H+E   A 
Sbjct  178   SSVREGTEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADRIMQSIINEHRE---AK  234

Query  873   STNSSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             S+ + G+ E++ D L+ V  KE    +F +++++IKAVI DMF  GT+TS+TTI WAM+E
Sbjct  235   SSATQGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDMFGGGTQTSSTTITWAMAE  290

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             MIK P VM K  AEVR    G     ++ D+ENL YLK V+KETLRL+PP PL+ PR+  
Sbjct  291   MIKNPRVMKKIHAEVRDVFGGKVGHPNESDVENLKYLKSVVKETLRLYPPGPLLLPRQCG  350

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             ++ +I  Y IP K++VI+NAWA+  +P  W + ERF PERF  SSVD+ GN +E+IPFGA
Sbjct  351   QDCEINGYHIPIKSKVIVNAWAIGRDPNHWSEAERFYPERFIGSSVDYKGNSFEYIPFGA  410

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRR+CPG++F  T++ L LA L+YHF+W+LP+G+  +DLDMTEA+GV A +K DLCLI  
Sbjct  411   GRRICPGLTFGLTNVELPLAFLMYHFDWKLPNGMKNEDLDMTEALGVSARRKDDLCLIPI  470

Query  1584  PF  1589
              F
Sbjct  471   TF  472



>ref|XP_003537455.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42025.1| Cytochrome P450 71D8 [Glycine soja]
Length=504

 Score =   484 bits (1246),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 336/476 (71%), Gaps = 7/476 (1%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             K  +  KLPPGPW+LP+IG+LH L +  SLP ++L+ L RKYGP+MHLQLGEIST+V+SS
Sbjct  26    KQKSSHKLPPGPWRLPIIGNLHQLALAASLPDQALQKLVRKYGPLMHLQLGEISTLVVSS  85

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P++A  + KTHD+ F  RP+++A   + Y +TD+AF+PYGDYWRQ+RKIC LELLS K V
Sbjct  86    PKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRV  145

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF   RQ+E   L+ SI   S  G P +L+ K+     + +++ AFG+  ++DQ +F++
Sbjct  146   QSFSHIRQDENKKLIQSIH--SSAGSPIDLSGKLFSLLGTTVSRAAFGKE-NDDQDEFMS  202

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDH--KENHLA  869
             L+++ +++ GGF++ D+FPS K +H  +  K K+  +H   DKI + I+  H  K   + 
Sbjct  203   LVRKAITMTGGFEVDDMFPSLKPLHLLTRQKAKVEHVHQRADKILEDILRKHMEKRTRVK  262

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                 S  + ED+VDVLLR+KE G L+ P+T +NIKAVI ++F+ GT+TSA+T+ WAMSEM
Sbjct  263   EGNGSEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVIWNIFAAGTDTSASTLEWAMSEM  322

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             +K P V  KAQAE+RQ  KG +   + DLE L+YLK VIKETLRLHPP  LI   E ++ 
Sbjct  323   MKNPKVKEKAQAELRQIFKGKEIIRETDLEELSYLKSVIKETLRLHPPSQLIPR-ECIKS  381

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
               I  Y IP KT+V+IN WA+  +P+ W D +RF+PERF +SS+DF GN +E+IPFGAGR
Sbjct  382   TNIDGYEIPIKTKVMINTWAIGRDPQYWSDADRFIPERFNDSSIDFKGNSFEYIPFGAGR  441

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             RMCPG++F   SI L LA LLYHFNWELP+ + P+DLDM E  G+  ++K  L LI
Sbjct  442   RMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDMDEHFGMTVARKNKLFLI  497



>gb|KEH26493.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score =   484 bits (1247),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 340/476 (71%), Gaps = 5/476 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K K+ +   +PPGP KLP+IG++H+L+  S P+R LR+L++KYGP+MHLQLGE+STIVI+
Sbjct  26    KKKSYSTYNIPPGPRKLPIIGNIHNLLS-SQPNRRLRDLAKKYGPVMHLQLGEVSTIVIT  84

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP+ A+ + KT+D+ F SRP +++ +I+ Y  T++A+SPYG+YW+Q+RKIC LELLS+K 
Sbjct  85    SPECAKEVMKTNDINFGSRPHLLSSEIMTYNGTNIAWSPYGNYWKQLRKICTLELLSLKR  144

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V S    R+E LSNLV  I   S+ G P NLT+ V+    +++++ AFG  C +DQ KFI
Sbjct  145   VNSHQPIREEVLSNLVRWI--VSQNGSPINLTQAVTSSVYTIVSRSAFGNKC-KDQEKFI  201

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
             +++KQ + ++ GF+LGDLFPS KWI + +G++PKL     + D+IF+ II DHKE     
Sbjct  202   SVIKQSIKVSAGFNLGDLFPSTKWIEHVTGLRPKLESFQRQTDQIFENIIKDHKEAKHTK  261

Query  873   STNSSGK-DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                  G+ +ED+VDVLL+ ++G  L F +T+DNIKA+I DMF  G ETSA+TI WAM EM
Sbjct  262   PKEDEGEVEEDLVDVLLKYEDGSNLDFSLTKDNIKAIIMDMFGAGGETSASTIDWAMVEM  321

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             ++ P +M KAQ EVR+  K     D+  +  L YLK V+KETLRLHPP PL+ PRE  + 
Sbjct  322   VRDPRIMKKAQDEVREVFKMKGRVDENCINELNYLKSVVKETLRLHPPAPLLLPRECSQA  381

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
               I  Y IP KT+VIINAWA+A +P  W +PE F PERF +S +DF G+++E+IPFGAGR
Sbjct  382   CDINGYHIPIKTKVIINAWAIARDPNYWTEPEMFYPERFIDSDIDFKGSNFEYIPFGAGR  441

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             R+CPG +F   +I  +LA LLYHF+W+LP G+  ++LDMTE  GV   +K DL ++
Sbjct  442   RICPGSTFGLRNIETTLAMLLYHFDWKLPSGIKSEELDMTEEFGVTMKRKNDLLVL  497



>gb|KDP39287.1| hypothetical protein JCGZ_01044 [Jatropha curcas]
Length=510

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 238/481 (49%), Positives = 325/481 (68%), Gaps = 5/481 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W  SK  +   LPPGPWKLP+IGS+HHL G  LPH  LRNL+ +YGP+MHL+LGE++ IV
Sbjct  25    WKNSKKNSAPNLPPGPWKLPVIGSMHHLSGSLLPHVRLRNLANEYGPLMHLKLGEVTNIV  84

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP+ A+AI KTHD +FA RP ++A +I+ Y STD+AF+PYGDYWRQMRKIC  E+LS 
Sbjct  85    VSSPETAKAIMKTHDHIFAQRPFLLAANIMAYNSTDLAFAPYGDYWRQMRKICTQEILSA  144

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V SF   R+EE+S  +    LSS  G   N +   +  T ++I +VA G++   ++  
Sbjct  145   KRVLSFGLIREEEVSKFIRD--LSSRAGSTVNFSRMFNSVTYNIIQRVAIGKLWKGEE-I  201

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
              I   K+++  AGGF L DL+PS K +H  S  K KLL+ H E DK+F  II +H+    
Sbjct  202   VIPAFKKLIEAAGGFSLSDLYPSIKLLHKISTTKFKLLRAHKETDKLFQNIIDEHRARKA  261

Query  867   ANS-TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
             + + + +  ++EDI+DVLL+ +   EL++PIT+DNIKAVI D+ S GT+TSATT++WAMS
Sbjct  262   SRAKSGAKNEEEDIIDVLLQAQSEEELEYPITDDNIKAVIMDVLSGGTDTSATTVVWAMS  321

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             E++K P VM + Q EVRQ        D++ +  L YLK V+KET     P   +  RE  
Sbjct  322   ELLKNPDVMKRVQTEVRQVFSKKGYVDEESIGELHYLKAVVKET-MRLHPTGAVLTRECR  380

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             E+  I  Y IP K+R+IINAWAL  +P+ W + ERF P+RF NSS+D+ G H+EF+PFGA
Sbjct  381   EDCVINGYDIPYKSRIIINAWALGRDPDYWPEAERFNPDRFLNSSIDYKGKHFEFLPFGA  440

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRR+CPGI F  +++   LA LLYHF+W+LP+G+ P+DLDM E  G+   +  DL LI  
Sbjct  441   GRRICPGILFGISNVQFPLARLLYHFDWKLPNGMRPEDLDMNEKYGIAVRRANDLQLIPI  500

Query  1584  P  1586
             P
Sbjct  501   P  501



>ref|XP_008777955.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=502

 Score =   483 bits (1244),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 247/481 (51%), Positives = 334/481 (69%), Gaps = 7/481 (1%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +K+ A +KLPP PWKLP+IG LHHL+G +LPHR LR LSR++GP+MHL+LG++  I+ISS
Sbjct  25    TKSTATRKLPPSPWKLPIIGHLHHLLG-ALPHRVLRELSRRHGPLMHLKLGQVDHIIISS  83

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P++AR I KT DL+FASR KI+A    FY   D+ F+PYG YWR++RKICV+ELLS K V
Sbjct  84    PEMAREILKTQDLIFASRDKILA-SKAFYDGADIVFAPYGCYWRELRKICVIELLSAKRV  142

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF + RQEE+SNLV  I  S+    P NL+E     T++  ++V FG  C     +FI+
Sbjct  143   KSFSTLRQEEMSNLVGYI--STMNNSPVNLSEMFLLITNTTTSRVVFGTKCKHGP-RFIS  199

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH-LAN  872
              +K+++    GF + DLFPS  +I   SG+  +L K H E+D+I   II +H+E     N
Sbjct  200   AMKKLVEFLSGFAVADLFPSLSFIDTLSGVSSRLKKCHSEMDEILGEIIKEHEEKRETKN  259

Query  873   STNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
             S+N   +  ED+VDVLL +KE G L+FP+T  +IKAVI DMF  G ETS+TT+ W M+E+
Sbjct  260   SSNEERQQGEDLVDVLLELKENGGLEFPLTLTSIKAVIMDMFGAGIETSSTTLDWTMAEL  319

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             ++ P  M K QAEVRQALKG     ++D     Y+KLVIKE+LRLHPP P+  PR   E 
Sbjct  320   MRHPKKMEKVQAEVRQALKGKAKIKEEDTNEFHYMKLVIKESLRLHPPAPVFLPRVCRER  379

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              ++  Y IP  +R+I+NAWA+AT+   WEDPE F PERF+ SSVD+ G +YE++PFGAG+
Sbjct  380   CQVDGYDIPAGSRIIVNAWAMATDSRYWEDPESFRPERFDGSSVDYKGGNYEYMPFGAGK  439

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             RMCPG++F    + ++LA LLY+F+W+LP+G+ P DLDM E+ G     K  L LIA P+
Sbjct  440   RMCPGMTFGMAQVEMALANLLYYFDWKLPNGMDPNDLDMNESFGAAVGLKSPLWLIATPY  499

Query  1590  V  1592
             V
Sbjct  500   V  500



>ref|XP_007020554.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12079.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=541

 Score =   484 bits (1247),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 247/491 (50%), Positives = 347/491 (71%), Gaps = 9/491 (2%)
 Frame = +3

Query  153   KSKAAAKQ--KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             K++ A K   +LPPGPWKLPLIG+LH LV  +LPH +L NL++KYGP+M L+LGE+ T+V
Sbjct  26    KAQKAKKSFTRLPPGPWKLPLIGNLHQLVS-TLPHHTLSNLAKKYGPLMWLKLGEVPTLV  84

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             +SSP++A+ + +THD+ F  RP ++A  I+ Y   D+ FSPYG+YWRQM+KIC+ ELLS 
Sbjct  85    VSSPEMAKEVMRTHDITFCQRPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELLST  144

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
               V+SF S R++E+S L+  I  SS    P NL+EK+   T  + A+ AFG+  S D+ +
Sbjct  145   NRVQSFQSIREQEVSALMEII--SSNARSPVNLSEKIYSLTYGITARAAFGKK-SGDEEE  201

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE--N  860
             FI +  +V  LAGGF L D++PS + +   SG++ KL KLH   D+I + II  HKE  N
Sbjct  202   FIRIAIEVSKLAGGFCLADMYPSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRN  261

Query  861   HLANSTNSSGKDE-DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
              +AN+   + KDE D+VD+LL++++ G+L FP+++DNIKAVI D+F  G+E S+ T+ WA
Sbjct  262   GMANTKTGNKKDEEDLVDILLKLQQQGDLDFPLSKDNIKAVIQDIFGAGSEASSNTVEWA  321

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             MSEM++ P +M +AQAEVR+   G    D+  LE L +LKL++KETLRL+P  PL+ PRE
Sbjct  322   MSEMVRNPKLMKEAQAEVRRVFHGKGKVDEVGLEELKFLKLIVKETLRLYPAGPLLIPRE  381

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               E+  IG Y IP KT+VI+NAWA+  +P  W++ E+F PERF +  +DF G ++E+IPF
Sbjct  382   CSEDCVIGGYEIPAKTKVIVNAWAIGRDPSYWKEAEKFQPERFIDKPIDFRGTNFEYIPF  441

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRRMCPGISFA  +I L LA LLYHF+W+LP+ +  +DLDMTE+ G+   +K DL LI
Sbjct  442   GAGRRMCPGISFALPNIELPLANLLYHFDWKLPNKMKCEDLDMTESFGLTIRRKNDLFLI  501

Query  1578  ARPFVDL*ALK  1610
               P+  L  +K
Sbjct  502   PIPYRSLLKMK  512



>gb|AGB55874.1| flavonoid 6-hydroxylase 3 [Glycine max]
 gb|AGB55875.1| flavonoid 6-hydroxylase 3 [Glycine max]
 gb|AGB55876.1| flavonoid 6-hydroxylase 3 [Glycine max]
Length=481

 Score =   482 bits (1241),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 248/482 (51%), Positives = 346/482 (72%), Gaps = 14/482 (3%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K K+A+   LPPGPWKLP+IG++ ++VG SLPH  LR+LS KYGP+MHL+LGE+STIV+S
Sbjct  9     KKKSASTPNLPPGPWKLPIIGNILNIVG-SLPHCRLRDLSAKYGPLMHLKLGEVSTIVVS  67

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP+ A+ +  THDL+F+SRP I+A  I+ Y S  ++F+PYGDYWR +RKIC  ELLS K 
Sbjct  68    SPEYAKEVLNTHDLIFSSRPPILASKIMSYDSKGMSFAPYGDYWRWLRKICTSELLSSKC  127

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V+SF   R EEL+N +   R++S+ G   NLT++V    S+++++ A G  C + Q KFI
Sbjct  128   VQSFQPIRGEELTNFIK--RIASKEGSAINLTKEVLTTVSTIVSRTALGNKCRDHQ-KFI  184

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
             + +++    AGGFDLGDL+PS +W+ + SG+KPKL K H + D+I   II +H+E   A 
Sbjct  185   SSVREGTEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADRIMQSIINEHRE---AK  241

Query  873   STNSSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             S+ + G+ E++ D L+ V  KE    +F +++++IKAVI DMF  GT+TS+TTI WAM+E
Sbjct  242   SSATQGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDMFGGGTQTSSTTITWAMAE  297

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             MIK P V  K  AE+R    G     ++ D+ENL YLK V+KETLRL+PP PL+ PR+  
Sbjct  298   MIKNPRVTKKIHAELRDVFGGKVGHPNESDMENLKYLKSVVKETLRLYPPGPLLLPRQCG  357

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             ++ +I  Y IP K++VI+NAWA+  +P  W + ERF PERF  SSVD+ GN +E+IPFGA
Sbjct  358   QDCEINGYHIPIKSKVIVNAWAIGRDPNHWSEAERFYPERFIGSSVDYKGNSFEYIPFGA  417

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRR+CPG++F  T++ L LA L+YHF+W+LP+G+  +DLDMTEA+GV A +K DLCLI  
Sbjct  418   GRRICPGLTFGLTNVELPLAFLMYHFDWKLPNGMKNEDLDMTEALGVSARRKDDLCLIPI  477

Query  1584  PF  1589
              F
Sbjct  478   TF  479



>ref|XP_008227138.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D9-like [Prunus 
mume]
Length=512

 Score =   483 bits (1244),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 244/481 (51%), Positives = 338/481 (70%), Gaps = 6/481 (1%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
              K+K +A   LPPGPWKLP+IG+LH L  GSLPH  LR+L++KYGP+MHL+LGE+S +V+
Sbjct  29    GKTKYSASN-LPPGPWKLPVIGNLHQL-AGSLPHHGLRDLAKKYGPLMHLKLGEVSAVVV  86

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SS + A+ + KTHDL+FASRP+++A  I+ Y ST++AF+PYG+YWRQ+RKIC +ELLS K
Sbjct  87    SSAEFAKEVMKTHDLIFASRPQVLAARILSYGSTNIAFAPYGEYWRQLRKICTIELLSAK  146

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+S+   R+EE+ NL+ SI  +S  G P NLT+++     ++ ++ AFG+  + DQ KF
Sbjct  147   RVRSYRPIREEEIRNLIKSI--ASRAGSPINLTQEICSSAFTITSRAAFGKK-TRDQEKF  203

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I ++K+    A GF L D+FPS   +H  SGM+PKL +LH E D+I   II +H+ + + 
Sbjct  204   IYIMKEAAKAASGFALADVFPSVSLLHLLSGMRPKLERLHKEADRIMGNIIKEHQRDMVT  263

Query  870   NSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                     +ED+VDVLL+  E G EL+  +T +NIKAVI D+F  G+ETS+T + WA+ E
Sbjct  264   TXCVEGEAEEDLVDVLLKFHEHGNELELSLTTENIKAVIFDIFGAGSETSSTAVDWAIVE  323

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MI+ P VM  AQ EVR+        D+  +  + YL LVIKETLRLHPP+PL+ PRE  E
Sbjct  324   MIRNPRVMNMAQNEVREVFNRKGQVDETCIREMKYLNLVIKETLRLHPPVPLLLPRECGE  383

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             + +I  Y IP K++VI+NAWA+  +P  W +PE F P RF +SS+D+ G ++E+IPFGAG
Sbjct  384   KCEIDGYEIPVKSKVIVNAWAIGRDPNYWNEPESFNPNRFLDSSIDYKGTNFEYIPFGAG  443

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RRMCPG+SF   +I L LA LLYHF+W+LP+G+  +DLDMTEA G    +K DL LI  P
Sbjct  444   RRMCPGVSFGLANIELPLALLLYHFDWKLPNGMKHEDLDMTEAFGAAVKRKDDLHLIPIP  503

Query  1587  F  1589
             +
Sbjct  504   Y  504



>ref|XP_008778500.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=502

 Score =   483 bits (1242),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 242/483 (50%), Positives = 339/483 (70%), Gaps = 7/483 (1%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +K+ A +KLPP PWKLP+IG LHHLVG ++PHR+ R LSR++GP+MHL+LG++  I++SS
Sbjct  25    TKSTATRKLPPSPWKLPIIGHLHHLVG-AVPHRAFRELSRRHGPLMHLRLGQVDHIIVSS  83

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P++AR I KTHDL+FASR  ++A   VFY   D+ F+PYG YWR++RKICV+ELLS K V
Sbjct  84    PEMAREILKTHDLIFASRDNVLA-SKVFYDGADLIFAPYGSYWRELRKICVIELLSAKRV  142

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF + RQE +SNLV  I  S+    P NL+E     ++++ ++V FG  C     +FI+
Sbjct  143   KSFSTLRQEVMSNLVGYI--STMNNSPVNLSEMFLLTSNTMTSRVTFGTKCKHGP-RFIS  199

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA-N  872
              +K+V  L  G+ + D+FPS  +I   SG+   L K H E+D+I   II +H+E     N
Sbjct  200   AMKRVNELLAGYTVADIFPSLSFIDTLSGVTSSLKKCHREMDEILGEIIKEHEEKRATKN  259

Query  873   STNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
             S+N   +  ED+VDVLL +KE G L+FP+T  +IKAVI DMF+ GTE+SATT+ W M+E+
Sbjct  260   SSNEEQQQGEDLVDVLLELKENGGLEFPLTLTSIKAVIMDMFAGGTESSATTLDWTMAEL  319

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             ++ P +M K QAEVRQA KG    +++D+    Y+KLVIKE+LRLH P PL+ PR   E 
Sbjct  320   MRHPKIMEKVQAEVRQAFKGKARIEEEDINKFHYMKLVIKESLRLHQPGPLLLPRVCRET  379

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              ++  Y IP  +R+IINAWA+A +P  WEDPE F PERF+ SSVD+ G ++E++PFGAGR
Sbjct  380   CQVDGYNIPAGSRIIINAWAVARDPRYWEDPESFRPERFDGSSVDYKGGNFEYLPFGAGR  439

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R+CP ++F    + ++LA LLY+F+W+LP+G+ P D+DMTE+ G     K  L LIA P+
Sbjct  440   RICPAMTFGLAQVEMALANLLYYFDWKLPNGMGPNDVDMTESFGAAVGLKSPLWLIATPY  499

Query  1590  VDL  1598
             V +
Sbjct  500   VPI  502



>sp|O81974.1|C71D8_SOYBN RecName: Full=Cytochrome P450 71D8; AltName: Full=Cytochrome 
P450 CP7 [Glycine max]
 emb|CAA71517.1| putative cytochrome P450 [Glycine max]
Length=504

 Score =   483 bits (1242),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 335/476 (70%), Gaps = 7/476 (1%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             K  +  KLPPGPW+LP+IG+LH L +  SLP ++L+ L RKYGP+MHLQLGEIST+V+SS
Sbjct  26    KQKSSHKLPPGPWRLPIIGNLHQLALAASLPDQALQKLVRKYGPLMHLQLGEISTLVVSS  85

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P++A  + KTHD+ F  RP+++A   + Y +TD+AF+PYGDYWRQ+RKIC LELLS K V
Sbjct  86    PKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRV  145

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF   RQ+E   L+ SI   S  G P +L+ K+     + +++ AFG+  ++DQ +F++
Sbjct  146   QSFSHIRQDENKKLIQSIH--SSAGSPIDLSGKLFSLLGTTVSRAAFGKE-NDDQDEFMS  202

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDH--KENHLA  869
             L+++ +++ GGF++ D+FPS K +H  +  K K+  +H   DKI + I+  H  K   + 
Sbjct  203   LVRKAITMTGGFEVDDMFPSLKPLHLLTRQKAKVEHVHQRADKILEDILRKHMEKRTRVK  262

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                 S  + ED+VDVLLR+KE G L+ P+T +NIKAVI ++F+ GT+TSA+T+ WAMSEM
Sbjct  263   EGNGSEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVIWNIFAAGTDTSASTLEWAMSEM  322

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             +K P V  KAQAE+RQ  KG +   + DLE L+YLK VIKETLRLHPP  LI   E +  
Sbjct  323   MKNPKVKEKAQAELRQIFKGKEIIRETDLEELSYLKSVIKETLRLHPPSQLIPR-ECIIS  381

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
               I  Y IP KT+V+IN WA+  +P+ W D +RF+PERF +SS+DF GN +E+IPFGAGR
Sbjct  382   TNIDGYEIPIKTKVMINTWAIGRDPQYWSDADRFIPERFNDSSIDFKGNSFEYIPFGAGR  441

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             RMCPG++F   SI L LA LLYHFNWELP+ + P+DLDM E  G+  ++K  L LI
Sbjct  442   RMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDMDEHFGMTVARKNKLFLI  497



>gb|KEH15784.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score =   482 bits (1241),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 245/465 (53%), Positives = 340/465 (73%), Gaps = 4/465 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LP GP KLP+IG++H+L+  S PHR L +L++KYGP+MHLQLGEISTIVISSP  AR + 
Sbjct  37    LPKGPRKLPIIGNIHNLLS-SQPHRKLSDLAKKYGPVMHLQLGEISTIVISSPDYAREVM  95

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD+ FA+RP+I+A++I+ Y ST++ F+PYG+YWRQ+RKIC  ELLS+K V S+   R+
Sbjct  96    KTHDINFATRPQILAVEIMTYNSTNIIFAPYGNYWRQVRKICTFELLSLKRVNSYQPIRE  155

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             + LS+LV  I  +SE G P NLT+ +     +++++ AFG  C +DQ KFI+++KQ + +
Sbjct  156   DVLSDLVKWI--ASENGSPINLTKALISSIYTIVSRAAFGNKC-KDQEKFISVVKQTIRI  212

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
             AGGFDLGDLFPS KW+   +G++PKL  LH + D+I + II +HKE          G++E
Sbjct  213   AGGFDLGDLFPSAKWLQQVTGLRPKLEMLHRQTDQILENIINEHKEARYGKLKEDEGEEE  272

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D++DVLL+ ++G   +F +T+DNIKA+I D+F  G +TSATTI WAM+EMI+ P +M KA
Sbjct  273   DLLDVLLKYEDGSNKEFSLTKDNIKAIIMDIFGAGGDTSATTIDWAMAEMIREPRIMMKA  332

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             QAEVR+    N   D+  +  L YLK V+KETLRLHPP PL+ PRE  +  +I  Y IP 
Sbjct  333   QAEVREVFTLNGKVDENYISKLNYLKSVVKETLRLHPPAPLLLPRECGKACEINGYNIPF  392

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
             +++VIINAWA+A +P  W +PERF PERF +S++D+ G ++E+IPFGAGRR+CPG  F  
Sbjct  393   RSKVIINAWAIARDPNFWTEPERFYPERFTDSTIDYKGGNFEYIPFGAGRRICPGSIFGL  452

Query  1440  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCL  1574
              ++ L+LA LLYHF+W+LP G+  ++LDMTE  GV   +K DL L
Sbjct  453   RNVELALAMLLYHFDWKLPCGIKSEELDMTEEFGVTMRRKDDLSL  497



>ref|XP_008385787.1| PREDICTED: cytochrome P450 71D11-like [Malus domestica]
Length=512

 Score =   483 bits (1242),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 247/471 (52%), Positives = 330/471 (70%), Gaps = 5/471 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LPPGPWKLP IG++H LVG S PH  LR L++KYGP+MHLQLGE+ST+V+SS + A+ + 
Sbjct  37    LPPGPWKLPFIGNIHQLVG-SQPHHGLRKLAKKYGPLMHLQLGEVSTVVVSSAEYAKEVM  95

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD+VFASRP ++A  I+ Y+ST++AF+  GDYWRQ+RKIC LELLS K V+ F   R+
Sbjct  96    KTHDVVFASRPHLLASRIMSYESTNIAFASCGDYWRQLRKICTLELLSTKRVQGFRPLRE  155

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE+ NL++ I   S    P NLTEK+   T +  ++ AFG+  SED  KFI  +K+ +++
Sbjct  156   EEVGNLITWI--GSNASSPINLTEKIYSSTYTFTSRAAFGKK-SEDHEKFIDAVKESITV  212

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
             A GFDL D+FPS K ++   G++P L +L    D+I + II +HK+      +      E
Sbjct  213   AAGFDLADVFPSAKLLNLIGGIRPTLERLKKVTDRIMENIINEHKKXRSTTKSGEGEAGE  272

Query  900   DIVDVLLRVKEGGE-LQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             D+VDVLL+  E G  L+F +T DNIKAVI D+F  G+ETSATT+ WAMSEMIK P ++  
Sbjct  273   DLVDVLLKFHEHGNGLEFSLTTDNIKAVILDIFGAGSETSATTVDWAMSEMIKNPRILKM  332

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
              Q EVR+    N   D+  +  + YL LVIKETLRLHPP PL+ PRES E  KI  Y IP
Sbjct  333   TQDEVREVYNRNGKVDEXSIGEMKYLSLVIKETLRLHPPAPLLLPRESSESCKINGYDIP  392

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              KT+VI+N WA+  +P  W +PE F PERF +SS+D+ G ++E+IPFGAGRR+CPGIS+ 
Sbjct  393   VKTKVIVNGWAIGRDPNYWTEPESFYPERFLDSSIDYKGTNFEYIPFGAGRRICPGISYG  452

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
               ++ L LA LLYHF+W+LP+G+S +DLDMTE  GV   +K+DL LI  P+
Sbjct  453   LANVELPLALLLYHFDWKLPNGMSHEDLDMTELFGVTVRRKEDLRLIPIPY  503



>gb|AAO32822.1| cytochrome P450 71D1, partial [Catharanthus roseus]
Length=495

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 247/477 (52%), Positives = 344/477 (72%), Gaps = 8/477 (2%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             KS       LPPGPWKLP++G+LH+++ GS+PHR LR+L++K+G +M L+LGE + IV+S
Sbjct  17    KSTRTKTINLPPGPWKLPILGNLHNMMMGSVPHRLLRDLAKKHGDLMLLKLGEFNAIVVS  76

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP++A+ + KTHDL F +RP I A  I+ Y ++D+ FS YGD WR+MRKI VLELLS K 
Sbjct  77    SPRMAKEVLKTHDLSFLNRPIIQAPKILCYDNSDLVFSQYGDSWREMRKIFVLELLSTKR  136

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG-KF  689
             V+SF   RQ+E S LVS I+ S   G   +L+EK++ +T+S++A+ AFG+V   D G  F
Sbjct  137   VRSFQPIRQDEGSRLVSLIKES--VGKSIDLSEKINSYTTSMVARAAFGKV--NDAGVTF  192

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH-L  866
             + L+K+   +AGGFD  D+FPS K+++     + KLLK+H + D I + +I +H +NH +
Sbjct  193   LKLVKEASEVAGGFDPADIFPSYKFLNVFFNSRSKLLKIHGKTDMILEEMIDEHIKNHEM  252

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 N     ED++D+LL +K+ GELQFP   +N+KA+I DMF+ GTETS++T+ WAMSE
Sbjct  253   GKKANGENGKEDVIDILLSIKDSGELQFPFQMNNVKALIFDMFAAGTETSSSTVEWAMSE  312

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             +I+ P VMAKAQ EVRQ LKG +  D+  L+ L YLKL++KE LRLHP  PL+ PRE  E
Sbjct  313   LIRNPDVMAKAQNEVRQVLKGKQIVDESVLQELEYLKLIVKEVLRLHPSSPLLIPRECGE  372

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             + +I  Y IP KTRV +N WA+A + + W+DPE F+PERFEN+  DF GN++E++PFG+G
Sbjct  373   DCQIDGYDIPVKTRVFVNIWAIARDDKYWKDPESFIPERFENTCFDFTGNNFEYLPFGSG  432

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             RRMCPG++F   ++ L LA LLYHFNW+LP GV+  D+DMTE VG+ A+KK  L LI
Sbjct  433   RRMCPGMTFGLANVDLVLALLLYHFNWKLPPGVN--DIDMTERVGLGATKKHSLVLI  487



>sp|E1B2Z9.1|C7AV8_CICIN RecName: Full=Cytochrome P450 71AV8; AltName: Full=(+)-Valencene 
oxidase [Cichorium intybus]
 gb|ADM86719.1| valencene oxidase [Cichorium intybus]
Length=496

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 242/481 (50%), Positives = 342/481 (71%), Gaps = 11/481 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             ++  +K+ L P PW+LP+IG +HHL+G ++PHR +  L+RK+G +MHLQLGE+STIV+SS
Sbjct  23    TRTTSKKNLLPEPWRLPIIGHMHHLIG-TMPHRGVMELARKHGSLMHLQLGEVSTIVVSS  81

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P+ A+ +  T+D+ FA+RP+ +  +IV Y +TD+  +PYG+YWRQ+RK+C LELLS K V
Sbjct  82    PRWAKEVLTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSNKKV  141

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF S R+EE  NLV  IR S+  G P NL+E +    ++++++ AFG+   +DQ KF  
Sbjct  142   KSFQSLREEECWNLVKDIR-STGQGSPINLSENIFKMIATILSRAAFGKGI-KDQMKFTE  199

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             L+K++L L GGFD+ D+FPSKK +H+ SG + KL  +H++LD + + II +H  N     
Sbjct  200   LVKEILRLTGGFDVADIFPSKKLLHHLSGKRAKLTNIHNKLDNLINNIIAEHPGNR----  255

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
               +S   E ++DVLLR+KE  E  FP+T DN+KAVI DMF  GT+TS+ TI WA+SE+I+
Sbjct  256   --TSSSQETLLDVLLRLKESAE--FPLTADNVKAVILDMFGAGTDTSSATIEWAISELIR  311

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P  M K Q E+RQAL G +   ++DL+ L YLKLVIKETLRLHPPLPL+ PRE  E   
Sbjct  312   CPRAMEKVQTELRQALNGKERIQEEDLQELNYLKLVIKETLRLHPPLPLVMPRECREPCV  371

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             +G Y IP KT++I+N +A+  +PE W+D E F+PERFENS +  MG+ YE++PFGAGRRM
Sbjct  372   LGGYDIPSKTKLIVNVFAINRDPEYWKDAETFMPERFENSPITVMGSEYEYLPFGAGRRM  431

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVD  1595
             CPG +    ++ L LA +LY+FNW+LP+G + +DLDMTE+ G    +K +L L+   F  
Sbjct  432   CPGAALGLANVELPLAHILYYFNWKLPNGKTFEDLDMTESFGATVQRKTELLLVPTDFQT  491

Query  1596  L  1598
             L
Sbjct  492   L  492



>ref|XP_008807779.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=513

 Score =   482 bits (1241),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 243/473 (51%), Positives = 340/473 (72%), Gaps = 6/473 (1%)
 Frame = +3

Query  177   KLPPGP-WKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             KLPP P  KLP+IG +HHL+G ++PHR+LR LS ++GP MHL+LG++  I+ SS + AR 
Sbjct  24    KLPPSPPEKLPVIGHIHHLLG-AMPHRALRELSSRHGPFMHLRLGQVDHIIASSTEAARD  82

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             I KTHDL FASRP+++A  ++FY   D+AFSP GDYWRQ+R+IC+ ELLS K VKSF + 
Sbjct  83    IMKTHDLAFASRPQLLAPFVMFYGGKDIAFSPMGDYWRQLRRICMQELLSPKRVKSFSTC  142

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             RQEE+SNLV +I  S ++G P NL E +   ++S I++VAFG+ C     +FI ++K+ L
Sbjct  143   RQEEMSNLVEAI--SKKSGSPVNLNEMLLLSSNSFISRVAFGKKCRHGL-RFITIMKKAL  199

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG-  890
              +A GF + DLFPS  ++   +G+  ++ K   E+D+I + I+ +H+E     S+     
Sbjct  200   EVASGFSIADLFPSWSFVDALTGITSRIKKARQEIDEILEEILKEHEEKREGISSKEDQL  259

Query  891   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
             ++ED+VDVLL V E GEL+ P+T  ++K VI DMF  GTET++TT+ W M E+++ P +M
Sbjct  260   EEEDLVDVLLDVAENGELEIPLTRTHLKCVILDMFVGGTETASTTLEWVMVELMRHPEMM  319

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
              KAQAEVRQALK      ++D+  L YLKLVIKET+RLHP LPL+ PR + E  ++G+Y 
Sbjct  320   QKAQAEVRQALKEKANIKEEDMSELHYLKLVIKETMRLHPALPLLLPRFNSENCQVGDYE  379

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP  TRVI+NAWA+A +P  WEDPE F PERF++S VD+MG+ +EF+PFGAGRR+CPG +
Sbjct  380   IPAGTRVIVNAWAIARDPRYWEDPESFRPERFDDSMVDYMGSSFEFMPFGAGRRICPGST  439

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             FA   + ++LA LL++F+WELP+G+ P+DLDMTE+ G     K  LCL+  PF
Sbjct  440   FAMAQMEIALAYLLFYFDWELPNGMEPQDLDMTESFGGTTGLKSPLCLVPVPF  492



>ref|XP_003600328.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70579.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 337/478 (71%), Gaps = 13/478 (3%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
              K   ++ Q LPPGP KLP+IG++H+L+G SLPH  LR+LS KYGP+MHL+LGE+STIV+
Sbjct  26    TKKSESSAQNLPPGPLKLPIIGNIHNLIG-SLPHHRLRDLSTKYGPLMHLKLGEVSTIVV  84

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SS + A+ + K HDLVFASRP I A  I+ Y S  +AF+PYGDYWR +RKIC LELLS K
Sbjct  85    SSAEYAKEVMKNHDLVFASRPPIQASKIMSYDSLGLAFAPYGDYWRNLRKICTLELLSSK  144

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+SF   R EE++NL+  I  SS+ G   N T++V    S++ ++ AFG+ C E+Q KF
Sbjct  145   RVQSFQPIRSEEVTNLIKWI--SSKEGSQINFTKEVFSTISTITSRTAFGKKCKENQ-KF  201

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I++++  + +AGGFDLGDL+PS + +   SG+KPKL KLH + D I   II +H+E + +
Sbjct  202   ISIVRDAIKIAGGFDLGDLYPSCRLLQNISGLKPKLEKLHKQADLIMQNIIDEHREVNKS  261

Query  870   NSTNSSGKD--EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
                 + G++  ED+VDVLL+       Q  + ++++KAVI DM+  G+ETSATTI WAM+
Sbjct  262   RVNENQGEEVEEDLVDVLLK-------QDGLNDNSVKAVILDMYGGGSETSATTITWAMA  314

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             EMIK P +M K QAEVR+     +  ++ D+E LTYLK V+KETLRLHPP   + PRE  
Sbjct  315   EMIKNPKIMEKVQAEVREVFDKERNPNESDMEKLTYLKYVVKETLRLHPPAAFLLPRECG  374

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             +  +I  Y IP K++VI+NAWA+  +P  W+DPERF PERF  S VD+ GN++EFIPFGA
Sbjct  375   QACEINGYDIPFKSKVIVNAWAIGRDPNHWDDPERFYPERFIESCVDYKGNNFEFIPFGA  434

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GRRMCPG++F   ++   LA L+YHF+W+LP+ +  +DLDM+E  G   ++K DL LI
Sbjct  435   GRRMCPGVTFGLVNVEYPLALLMYHFDWKLPNEMKNEDLDMSETFGSAVTRKDDLYLI  492



>ref|XP_008807778.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=500

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/473 (52%), Positives = 336/473 (71%), Gaps = 6/473 (1%)
 Frame = +3

Query  177   KLPPGP-WKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             KLPP P  KLP+IG +HHL+G ++PHR+LR LS ++GP MHL+LG+I  I+ SSP+ AR 
Sbjct  11    KLPPSPPEKLPVIGHIHHLLG-AMPHRALRELSSRHGPFMHLKLGQIDHIIASSPEAARD  69

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             I KTHDL FASRP+++A  ++FY   D+ FSP GDYWRQ+RKIC+ ELLS K VKSF + 
Sbjct  70    IMKTHDLAFASRPQLLAPFVLFYGGKDIVFSPVGDYWRQLRKICMQELLSPKRVKSFSTC  129

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             RQEE+SNLV +I  S ++G P NL+E +   ++S I++VAFG+ C     +FI  +K+ +
Sbjct  130   RQEEMSNLVEAI--SKKSGSPVNLSEMLLLSSNSFISRVAFGKKCKHGL-RFITGMKKAI  186

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG-  890
              LA GF L DLFPS  ++   +GM  +  K   E+D+I + I+ +H+E     S      
Sbjct  187   ELASGFSLADLFPSWSFVDALTGMTARTKKARQEIDEILEEILKEHEEKREGISGKEDQL  246

Query  891   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
             ++ED+VDVLL V E GEL+ P+T  ++K+V+ +MF  GTETS+TT+ W M E+++ P +M
Sbjct  247   EEEDLVDVLLDVAENGELEIPLTRTDLKSVVLEMFIGGTETSSTTLEWVMIELMRHPEMM  306

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
              KAQAEVRQALK      ++D+  L YLKLVIKET+RLHP LPL+ PR + E  ++G+Y 
Sbjct  307   QKAQAEVRQALKEKANIKEEDMSELHYLKLVIKETMRLHPALPLLVPRFNSENCQVGDYE  366

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP  TRVI+NAWA+A +P  WEDPE F PERFE S VD+ G  +EF+PFGAGRR+CPG++
Sbjct  367   IPAGTRVIVNAWAIARDPRYWEDPESFRPERFEGSMVDYKGTSFEFVPFGAGRRICPGVT  426

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             FA   + ++LA LL+HF+WELP+G+ P+DLDMTE+ G     K  L L+  PF
Sbjct  427   FAMAQMEMALAYLLFHFDWELPNGMEPQDLDMTESFGATTGLKSPLWLVPVPF  479



>ref|XP_007146612.1| hypothetical protein PHAVU_006G054900g [Phaseolus vulgaris]
 gb|ESW18606.1| hypothetical protein PHAVU_006G054900g [Phaseolus vulgaris]
Length=489

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/456 (53%), Positives = 336/456 (74%), Gaps = 5/456 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             K+P GP KLP+IG++H+L+  S PHR LR+L+ KYGP+MHLQLGE+STIVISSP+ A+ +
Sbjct  37    KIPHGPTKLPIIGNIHNLLS-SQPHRKLRDLALKYGPLMHLQLGEVSTIVISSPECAKEV  95

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              K HD+ FA+RPKI+A +I+ Y STD+AF+PYG+YWRQ+RKIC LELLS+K VKSF   R
Sbjct  96    MKIHDINFATRPKILASEIISYNSTDIAFAPYGNYWRQLRKICTLELLSLKRVKSFQPIR  155

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             +EELSNLV  I   SE G P NLT+ V     S+ ++ AFG+   +DQ  FIA +K+++ 
Sbjct  156   EEELSNLVKWI--DSEKGSPINLTQAVLSSIYSIASRSAFGKK-YKDQQNFIAAVKKLIK  212

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  896
             L GGFD+GDLFPS  W+ + +G++PKL +LH + D+I + II +HKE   + + +   + 
Sbjct  213   LEGGFDIGDLFPSATWLQHVNGIRPKLERLHQQADQIMEGIINEHKEAR-SEAKDYERET  271

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             ED+VDVL++ ++G    F +T +NIKA+I D+F+ G ETSATTI WAM+E+IK   +M K
Sbjct  272   EDLVDVLMQYEDGSNQDFTLTRNNIKAIILDIFAAGGETSATTIDWAMAEIIKDSRIMRK  331

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQAEVR+     +  D+  +  L YLKLV+KETLR HPPLPL+ PRE  +  +I  Y IP
Sbjct  332   AQAEVREVFNMKRRVDENCINELKYLKLVVKETLRFHPPLPLLLPRECGKTCEIHGYNIP  391

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              K++VI+NAWA+  +   W +PERF PERF +S+VD+ GN++EFIPFGAGRR+CPG +F+
Sbjct  392   AKSKVIVNAWAIGRDSNYWTEPERFYPERFIDSTVDYKGNNFEFIPFGAGRRICPGSTFS  451

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGV  1544
                + ++LA LLYHF+W+LP G+  ++LDM+E  G+
Sbjct  452   SRIVEVTLAMLLYHFDWKLPSGMISEELDMSEEFGI  487



>gb|ACD42776.1| cytochrome P450 71D1 [Catharanthus roseus]
Length=507

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 247/477 (52%), Positives = 342/477 (72%), Gaps = 8/477 (2%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             KS       LPPGPWKLP++G+LH+++ GS+PHR LR+L++K+G +M L+LGE + IV+S
Sbjct  29    KSTRTKTINLPPGPWKLPILGNLHNMMMGSVPHRLLRDLAKKHGDLMLLKLGEFNAIVVS  88

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP++A+ + KTHDL F +RP I A  I+ Y ++D+ FS YGD WRQMRKI VLELLS K 
Sbjct  89    SPRMAKEVLKTHDLSFLNRPIIQAPKILCYDNSDLVFSQYGDSWRQMRKIFVLELLSTKR  148

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG-KF  689
             V+SF   RQ+E S LV  I+ S   G   +L+EK++ +T+S++A+ AFG+V   D G  F
Sbjct  149   VRSFQPIRQDEGSRLVXLIKES--VGKSIDLSEKINSYTTSMVARAAFGKV--NDAGVTF  204

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH-L  866
             + L+K+   +AGGFD  D+FPS K+++     + KLLK+H + D I + +I +H +NH +
Sbjct  205   LKLVKEASEVAGGFDPADIFPSYKFLNVFFNSRSKLLKIHGKTDMILEEMIDEHIKNHEM  264

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 N     ED++D+LL +K+ GELQFP   +N+KA I DMF+ GTETS++T+ WAMSE
Sbjct  265   GKKANGENGKEDVIDILLSIKDSGELQFPFQMNNVKAFIFDMFAAGTETSSSTVEWAMSE  324

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             +I+ P VMAKAQ EVRQ LKG +  D+  L+ L YLKL++KE LRLHP  PL+ PRE  E
Sbjct  325   LIRNPDVMAKAQNEVRQVLKGKQIVDESVLQELEYLKLIVKEVLRLHPSSPLLIPRECRE  384

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             + +I  Y IP KTRV +N WA+A + + W+DPE F+PERFEN+  DF GN++E++PFG+G
Sbjct  385   DCQIDGYDIPVKTRVFVNIWAIARDDKYWKDPESFIPERFENTCFDFTGNNFEYLPFGSG  444

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             RRMCPG++F   ++ L LA LLYHFNW+LP GV+  D+DMTE VG+ A+KK  L LI
Sbjct  445   RRMCPGMTFGLANVDLVLALLLYHFNWKLPPGVN--DIDMTERVGLGATKKHSLVLI  499



>ref|XP_007146605.1| hypothetical protein PHAVU_006G054200g [Phaseolus vulgaris]
 gb|ESW18599.1| hypothetical protein PHAVU_006G054200g [Phaseolus vulgaris]
Length=494

 Score =   481 bits (1238),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 244/478 (51%), Positives = 339/478 (71%), Gaps = 11/478 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K A+   LPPGPWKLP+IG++H+LVG SLPHR LR+LS KYGP+MHL+LGE+STIV+SS 
Sbjct  25    KCASTSNLPPGPWKLPIIGNIHNLVG-SLPHRRLRDLSAKYGPLMHLKLGEVSTIVVSSA  83

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             + A+ + KTHDL+FASRP I+A  I+ Y S  ++FSPYGDYWRQ+RKIC LELLS+K V+
Sbjct  84    EYAKEVLKTHDLIFASRPPILASKILSYDSVGISFSPYGDYWRQLRKICALELLSLKRVQ  143

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R+EEL+  + +I  +S+ G P NLT+++    S+++++ A G     D  KFI+ 
Sbjct  144   SFQPIREEELTKFIKNI--ASKEGSPINLTKEILSTISTIVSRTALGSKY-RDHKKFISA  200

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE-NHLANS  875
             +++   +AGGFDLGDL+PS  W+ + SG+K KL + H + D+I   II DH+E    A  
Sbjct  201   VREATEVAGGFDLGDLYPSAGWLQHISGLKGKLEQSHQQTDRIMQRIIDDHREAKSRAAQ  260

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
                   ++D+VDVL++       +F +++++IKAVI D++  G+ETS+ TI WAM+EMIK
Sbjct  261   AQGEQVEDDLVDVLMKE------EFGLSDNSIKAVILDIYGGGSETSSITITWAMAEMIK  314

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P VM K Q+EVR+        ++ D+ENL YLK V+KETLRLHPP PL+ PRES +  +
Sbjct  315   NPRVMKKVQSEVREVFGKEGGPNESDMENLKYLKSVVKETLRLHPPGPLLLPRESGQACE  374

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             I  Y IP K+++I+NAWA+  +P  W + ERF PERF  S  D+ GN++E+IPFGAGRRM
Sbjct  375   IKGYHIPIKSKIIVNAWAIGRDPNHWTEAERFYPERFIESDFDYKGNNFEYIPFGAGRRM  434

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             CPG++F  T++   LA L+YHF+W+LP+G+  +DLDMTE  GV  S+K DL LI   F
Sbjct  435   CPGLTFGLTNVEFPLALLMYHFDWKLPNGMRNEDLDMTEVFGVSVSRKHDLQLIPVTF  492



>ref|XP_006452551.1| hypothetical protein CICLE_v10010293mg [Citrus clementina]
 ref|XP_006474926.1| PREDICTED: cytochrome P450 71D10-like [Citrus sinensis]
 gb|ESR65791.1| hypothetical protein CICLE_v10010293mg [Citrus clementina]
Length=501

 Score =   481 bits (1238),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 237/474 (50%), Positives = 338/474 (71%), Gaps = 6/474 (1%)
 Frame = +3

Query  165   AAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQL  344
             +  QKLPPGPW+LPLIG+LH LV  SLPH SLR+L++K+GP+MHL+LGE+STIV+SS ++
Sbjct  33    STSQKLPPGPWRLPLIGNLHQLVA-SLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEI  91

Query  345   ARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSF  524
             A+ + KTHDLVFA RP +++     Y  T++  +PYG YWRQ+R+IC +ELLS K V+SF
Sbjct  92    AKEVLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSF  151

Query  525   CSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLK  704
              S R+EE+SNL+ ++R  S  G   NL EK+   T  + A+ AFG+ C +DQ  FI+++K
Sbjct  152   RSIREEEVSNLIKTVR--SNEGSVINLREKIFTMTFGITARAAFGKKC-KDQEVFISVVK  208

Query  705   QVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNS  884
             + + +  GF + DL+PS K +   SG++ KL KLH E D+IF  I+ +HKE      T  
Sbjct  209   EFIKIMSGFSISDLYPSIKLLQEISGVRRKLKKLHLESDRIFGEILDEHKEKR--TKTAQ  266

Query  885   SGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1064
             +  +ED +DV + +++ G+L+FP+T++NIKAVI D+F  G++TS+T++ WAM+EM+K P 
Sbjct  267   AEAEEDPIDVFMNLQQNGDLEFPLTDNNIKAVIWDIFVAGSDTSSTSVEWAMAEMLKNPR  326

Query  1065  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1244
             ++ +AQAEVR+  KG +  ++  +  L +LKLV+KETLRLHPP PL+ PRES E  +I  
Sbjct  327   ILKEAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEING  386

Query  1245  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1424
             Y IP  TR+I+NAWA+  +P  W + E   PERF NSS+D+ G  +E+IPFGAGRR+CPG
Sbjct  387   YAIPENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPG  446

Query  1425  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             I+FA  +I L LA LL+HF+W+LP+G+    LDM+E  G+   +K DL LI  P
Sbjct  447   ITFAIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVP  500



>ref|XP_006351653.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   481 bits (1238),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 340/488 (70%), Gaps = 14/488 (3%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGS----LPHRSLRNLSRKYGPIMHLQLGEI  314
             W K +  +K+KLPPGPWKLP IG+LHHLV       LPHR+L  L+ KYG +MH++LGE 
Sbjct  21    WYK-ECNSKKKLPPGPWKLPFIGNLHHLVDWQSSELLPHRTLAKLASKYGDLMHMKLGER  79

Query  315   STIVISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLE  494
               IV+SSPQ+ R + + HDL F++RP ++    +FY   D+ F  YGD+WRQMRKIC+ E
Sbjct  80    EAIVVSSPQMVREVMRKHDLNFSNRPTLLVGTEMFYDHADMGFCNYGDFWRQMRKICIQE  139

Query  495   LLSMKMVKSFCSFRQEELSNLVSSIRLS-SETGFPTNLTEKVSWFTSSLIAKVAFGRVCS  671
             LLS K ++SF      E++NLV+SI+ S SE G   N+T+ +S +T+S+I K + GR C 
Sbjct  140   LLSHKNIQSFYPNMLNEITNLVTSIKSSASEGGSSINMTDTLSLYTNSIICKASVGRAC-  198

Query  672   EDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDH  851
             + QG  I +++ V + AG FDL DLFPS K IH+ SG+K KL K+H E+D + + II +H
Sbjct  199   KSQGSLIEIMRTVAASAGVFDLADLFPSMKMIHFISGLKYKLRKMHDEVDVLLEEIINEH  258

Query  852   KENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  1031
             +        NS   +EDIVDVLLR+++  +   PIT DNIKA+I D+FS G+ TSA+T+ 
Sbjct  259   E------FQNSETSEEDIVDVLLRLQKSQDFSIPITRDNIKAIIIDLFSGGSTTSASTME  312

Query  1032  WAMSEMIKRPSVMAKAQAEVRQALKGNKT-FDDKDLENLTYLKLVIKETlrlhpplplih  1208
             WA SE++K+P +M KAQ EVR+  KG +T  D  D++ L Y+K+V+KET+R HP  PL+ 
Sbjct  313   WAFSELMKKPEIMKKAQDEVREVFKGKETTIDQADIQKLKYIKMVVKETVRFHPLAPLLA  372

Query  1209  prESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEF  1388
             PRES EE +I  Y+IP  T  ++N WA++ +P+ W++PE F PERF +S +DF+G H+EF
Sbjct  373   PRESREECEINGYVIPKGTMALVNFWAISRDPKYWQNPEVFDPERFNDSHLDFIGAHFEF  432

Query  1389  IPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDL  1568
              PFG GRR+CPG+SF+  ++ LS+A LLYHF+W+LP+G++P +LDMTE       +K +L
Sbjct  433   TPFGTGRRICPGLSFSMATVELSIALLLYHFDWKLPNGMNPHELDMTEKFSNALERKNNL  492

Query  1569  CLIARPFV  1592
              LI  P+V
Sbjct  493   FLIPSPYV  500



>ref|XP_011081935.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=506

 Score =   481 bits (1238),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 246/457 (54%), Positives = 332/457 (73%), Gaps = 10/457 (2%)
 Frame = +3

Query  207   LIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAITKTHDLVFAS  386
             +IG LHHLVGG LPH +LR +++KYGP+++L+LGE+S +VISS +  + + K  D   A 
Sbjct  52    VIGHLHHLVGG-LPHHALRRVAQKYGPVLYLKLGEVSAVVISSREATKEVVKLQDPACAD  110

Query  387   RPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSS  566
             RP+ +   I++Y  TD+AFS Y +YWRQMRKIC+LELLS K VKSF S RQ+E+S L+ S
Sbjct  111   RPESIGSKIMWYDYTDIAFSAYNEYWRQMRKICILELLSAKNVKSFGSIRQDEVSRLMKS  170

Query  567   IRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDL  746
               L S +G   NLTEKV  FTSS+  + AFG+V   D+   IA+LK+ +++AGGF+L DL
Sbjct  171   --LQSSSGQAINLTEKVFAFTSSITCRAAFGKVM-RDRDVLIAMLKKAVTMAGGFELADL  227

Query  747   FPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRV  926
             FPS K +H  S  K KLL++  +LD I D I+ +HK   L  S    G  EDIVDVLLR+
Sbjct  228   FPSSKLLHVLSWNKYKLLRMRRKLDTILDAILEEHK---LKQSGEFGG--EDIVDVLLRM  282

Query  927   KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALK  1106
             ++ GELQFPIT DNIKAVI DMFS GTETS+TTI WAM+E+++ P VMAK QAE ++A K
Sbjct  283   QKTGELQFPITNDNIKAVIFDMFSAGTETSSTTIDWAMAELMRNPRVMAKVQAEQKEAFK  342

Query  1107  GNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAW  1286
             G  T ++ D++ L YLKLVIKET RLHPP+PL+      +E K+  Y IP K++V+IN W
Sbjct  343   GKTTVEESDVQALKYLKLVIKETFRLHPPIPLLPRA-CRDECKVNGYTIPLKSKVMINIW  401

Query  1287  ALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAG  1466
              +  +PE W  PE F PERF+N+S+DF+GN++E+IPFGAGRR+CPG++F   ++ L LA 
Sbjct  402   GMGRDPEYWHQPETFQPERFDNNSIDFLGNNFEYIPFGAGRRICPGMNFGLANVELPLAK  461

Query  1467  LLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             LLYHF+W++P G++P D+DMTEA G+  S++  L L+
Sbjct  462   LLYHFDWKMPKGMTPDDIDMTEAEGIAVSRRNGLVLV  498



>ref|XP_008246006.1| PREDICTED: cytochrome P450 71D11-like [Prunus mume]
Length=514

 Score =   481 bits (1238),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 245/481 (51%), Positives = 338/481 (70%), Gaps = 6/481 (1%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
              K+K +A   LPPGPWKLP+IG+LH L  GSLPH  LR+L++KYGP+MHL+LGE+S +V+
Sbjct  29    GKTKYSASN-LPPGPWKLPVIGNLHQL-AGSLPHHRLRDLAKKYGPLMHLKLGEVSAVVV  86

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SS + A+ + KTHDL+FASRP I+A  I+ Y STD+ ++PYG+YWRQ+RKIC LELLS K
Sbjct  87    SSAEFAKEVMKTHDLIFASRPTILAAKILSYGSTDIGYAPYGEYWRQLRKICTLELLSTK  146

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+SF   R+EE+ NL+  I  +S  G P N+T +V   T ++ ++ AFG+  + DQ KF
Sbjct  147   RVQSFRPIREEEVVNLIQWI--ASRAGSPINITREVYSSTYTITSRTAFGKK-TRDQEKF  203

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I ++K+ +  A GF L D+FPS   +H  SGM+ KL +LH E D+I   II +H+ + + 
Sbjct  204   IYIVKEFVKAASGFALTDIFPSVSLLHLLSGMRLKLERLHKEADRILGNIIKEHQRDLVT  263

Query  870   NSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
               +     +ED+VDVLL+  + G EL+F +T +NIKAVI D+F+ G+ETS+T + WA++E
Sbjct  264   TKSGEGEAEEDLVDVLLKFHDHGNELEFSLTIENIKAVIFDIFAAGSETSSTAVDWAIAE  323

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             MIK P VM  AQ EVR+        D+  +  + YL LVIKETLRLHPP PL+ PRE  E
Sbjct  324   MIKNPRVMNMAQNEVREVFNRKGQVDETCIREMKYLNLVIKETLRLHPPGPLLLPRECRE  383

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
             + +I  Y IP K++VI+NAWA+  +P  W +PE F P+RF +SS+D+ G ++E+IPFGAG
Sbjct  384   KCEIDGYEIPVKSKVIVNAWAIGRDPNYWNEPESFNPDRFLDSSIDYKGTNFEYIPFGAG  443

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RRMCPG+SF   ++ L LA LLYHF+W+LP G+  +DLDMTEA G    +K DL LI  P
Sbjct  444   RRMCPGVSFGLANVELPLALLLYHFDWKLPSGMKHEDLDMTEAFGATVKRKDDLHLIPIP  503

Query  1587  F  1589
             +
Sbjct  504   Y  504



>ref|XP_009345818.1| PREDICTED: cytochrome P450 71D9-like [Pyrus x bretschneideri]
Length=508

 Score =   481 bits (1238),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 246/472 (52%), Positives = 339/472 (72%), Gaps = 7/472 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LPPGPWKLP IG+LH L+G  LPH  LR+L+ KYGP+MHL+LGE+STIV+SS + A+ + 
Sbjct  37    LPPGPWKLPFIGNLHQLIG-CLPHHGLRDLAEKYGPLMHLRLGEVSTIVVSSAEFAKEVM  95

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD++FASRP+I+A  I+ Y ST++AF+PYGDYWRQ+RKIC LELLS K V+S+   R+
Sbjct  96    KTHDVIFASRPQILATRILSYGSTNIAFAPYGDYWRQLRKICTLELLSTKRVQSYRPVRE  155

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE+  L+ SI L S  G   NLT+++   T S+ ++ A G+  + D  KFI + ++   +
Sbjct  156   EEVLKLIKSIALQS--GSAVNLTQEIYSLTYSITSRAASGKK-TRDHEKFIFVAEEAGKV  212

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD-  896
             AGGF L DL+PS   +H  SG++PKL +LH + D+I + II +H+++ L  + N  G+  
Sbjct  213   AGGFALADLYPSVSLLHLVSGIRPKLERLHKQADRIMENIINEHQKD-LETTKNVEGESV  271

Query  897   EDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
             ED+V VLL+  E GG L+F +T +NIKAVI D+FS G+E SATT+ WA+SEM+K P VM 
Sbjct  272   EDLVHVLLKFHEHGGALEFSLTTNNIKAVIFDVFSAGSERSATTVDWAISEMMKNPRVMK  331

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             KAQ EVR+        D+  +  + YL  VIKETLRLHP +PL+ PRE  E+ +IG Y I
Sbjct  332   KAQREVREVFNRKGKADETSIGEMKYLNTVIKETLRLHPSVPLLLPRECGEKCEIGGYGI  391

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P K++VI+NAWA+  +P+ W +PERF PERF +SS+D+ G ++E+IPFGAGRR+CPGI +
Sbjct  392   PGKSKVIVNAWAIGRDPKYWTEPERFKPERFLDSSIDYKGTNFEYIPFGAGRRICPGILY  451

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
                ++ L LA LLYHF+W+LPDG   +DLDMTE  G+   +K+DL LI  P+
Sbjct  452   GLANVELPLALLLYHFDWKLPDGTKHEDLDMTETFGIAVRRKQDLHLIPIPY  503



>ref|XP_007156881.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
 gb|ESW28875.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
Length=504

 Score =   481 bits (1237),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 249/478 (52%), Positives = 336/478 (70%), Gaps = 6/478 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             K K+    KLPPGP +LP+IG+LH L V GSLPHR+L+ LS +YGP+MHLQLGEIS +V 
Sbjct  26    KLKSHVSLKLPPGPKRLPIIGNLHQLAVAGSLPHRALQKLSHEYGPLMHLQLGEISAVVA  85

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP++ + ITKTHD+ F  RP+ ++  I+ Y   DV F+PYGDYWRQMRKI V ELLS K
Sbjct  86    SSPEMVKEITKTHDVAFLQRPQFISGQILSYGGIDVVFAPYGDYWRQMRKIFVSELLSTK  145

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+SF   R++E    + SIR S+  G P NL+ ++    S+ +++ AFG + S+D  +F
Sbjct  146   RVQSFSFIREDETEKFIDSIRTSA--GSPINLSSRIFSLVSTSVSRAAFGNI-SKDHIEF  202

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-  866
             + L+K+V+   GGFDL DLFPS K IH+ +G K KL KL +++D+  + I+ +H+E    
Sbjct  203   MLLIKKVMGSVGGFDLADLFPSMKSIHFITGKKAKLEKLLNQVDRFLESIVREHQEKQRR  262

Query  867   ANSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
             A       KDED+VDVLL  ++    L   +T  N+KA+I D+F+ G +TS +TI WAM+
Sbjct  263   AKEGRVQIKDEDLVDVLLTFQQTDAALDIKMTTRNVKALILDIFAGGIDTSGSTIEWAMT  322

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             EM++ P VM KAQAE+R+AL+  +   +KDLE L YLKLV+KETLRLHPP PL+ PRE  
Sbjct  323   EMMRSPRVMKKAQAELREALREKEIIHEKDLEQLPYLKLVVKETLRLHPPTPLLIPRECS  382

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             E   I  Y IP KT+V+IN WA+  +P+ W D E+F+PERFE SS+DF GN++E++PFGA
Sbjct  383   ERTIIDGYEIPVKTKVMINVWAICRDPKYWSDAEKFVPERFEGSSIDFKGNNFEYLPFGA  442

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GRR+CPGISF   SI L LA LLYHFNWELP+ ++P+ +D  E  G+   +K DLCLI
Sbjct  443   GRRICPGISFGLASIMLPLARLLYHFNWELPNSMTPESIDTIERFGMAIGRKNDLCLI  500



>ref|XP_008337945.1| PREDICTED: cytochrome P450 71D9-like [Malus domestica]
Length=516

 Score =   481 bits (1238),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 256/483 (53%), Positives = 337/483 (70%), Gaps = 12/483 (2%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K+K +A   LPPGPWKLP IG++H LVG S PH  LRNL++KYGP+MHLQLGE+ST+V+S
Sbjct  29    KTKESAVN-LPPGPWKLPFIGNIHQLVG-SQPHHGLRNLAKKYGPLMHLQLGEVSTVVVS  86

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             S + A+ + KTHD+VFASRP I+A  I+ Y+ST++AF+P GDYWRQ+RKIC LELLS   
Sbjct  87    SAEYAKEVMKTHDVVFASRPPILATRILSYESTNIAFAPCGDYWRQLRKICTLELLSANR  146

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V+     R+EEL NL++ I   S  G P NLTEKV   T ++ ++ AFG+  SED  KFI
Sbjct  147   VQGHRPLREEELGNLITWI--GSNAGSPINLTEKVYSSTYTITSRAAFGK-KSEDHEKFI  203

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
               +KQ +++A GFDL D+FPS K +H   G++P L +LH   D+I + II +HK+     
Sbjct  204   DAVKQSIAVAAGFDLADVFPSVKLLHLIGGIRPTLERLHKVTDRIMENIINEHKKK---R  260

Query  873   STNSSGKDE---DIVDVLLRVKEGGE-LQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
             ST  SG+ E   D+VDVLL+  E G  L+F +T DNIKAVI D+F  G+ETSATT+ WAM
Sbjct  261   STTKSGEGEAEVDLVDVLLKFHEHGNGLEFSLTTDNIKAVILDIFGAGSETSATTVDWAM  320

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             SEMIK   +M  AQ +VR+        D+  +  + YL LVIKETLRLHPP PL+ PRES
Sbjct  321   SEMIKNXRIMKMAQDDVREVYNRIGKVDETGIREMKYLSLVIKETLRLHPPAPLLLPRES  380

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              E  KI  Y IP KT+VI+N WA+  +P  W + E F PERF +SS+D+ G ++E+IPFG
Sbjct  381   SESCKINGYEIPVKTKVIVNGWAIGRDPNHWTETESFYPERFLDSSIDYKGTNFEYIPFG  440

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             AGRR+C GI +   ++ L LA LLYHF+W+LPDG++ +DLDMTE  G+   +K DL LI 
Sbjct  441   AGRRICXGILYGLANVELPLALLLYHFDWKLPDGMTHEDLDMTELFGITVXRKDDLRLIP  500

Query  1581  RPF  1589
              P+
Sbjct  501   IPY  503



>ref|XP_006341719.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   480 bits (1236),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 246/470 (52%), Positives = 344/470 (73%), Gaps = 5/470 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LPPGP KLPLIG+LH L+G SLPH +LR+++ +YGPIMHL+ GE+ T+++SS + A+ + 
Sbjct  36    LPPGPRKLPLIGNLHQLMG-SLPHHTLRDMANEYGPIMHLRFGEVPTVIVSSAEAAKEVM  94

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHDLVFA RPKI+  DI+ Y ST + FSPYGD+WRQ+RKICV ELL++K V+SF S RQ
Sbjct  95    KTHDLVFADRPKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLNVKRVQSFESLRQ  154

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE+ +L+ +I L+   G   NL++ +   T+++IA+ AFGR   E+Q +FIA L++++ L
Sbjct  155   EEVKDLIKTISLNP-AGTTINLSQMIFTLTNNIIARAAFGRKL-ENQDEFIATLRKIVDL  212

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
             AGGFDL D FPS K++H  +G K  + K+HH++DKI + ++ +HK      + N   K E
Sbjct  213   AGGFDLPDTFPSLKFLHPLTGAKAAMEKIHHQIDKILESVLQEHKAARKL-AINREDK-E  270

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+VDVLLRV+E G+L+ PIT D IKAVI + F  GT+TS+T + WAM+E++K P VM +A
Sbjct  271   DLVDVLLRVQESGDLEVPITTDTIKAVILETFIAGTDTSSTALEWAMAELMKNPQVMEQA  330

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             QAEVRQA KG     + +++ L YL+LVIKETLRLH P+PL+ PR + +  ++G Y I  
Sbjct  331   QAEVRQAFKGKSMITEFEVQQLDYLRLVIKETLRLHAPVPLLVPRVARQRCELGGYEIQA  390

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
              TR+++NAWA+  +P+ WE+ E F PER  NS++DF GN++EFIPFGAGRR CPGI F  
Sbjct  391   NTRLMVNAWAICRDPKYWENAECFEPERHRNSTLDFKGNNFEFIPFGAGRRACPGILFGI  450

Query  1440  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             +++ L LA LL HF+W+LP+G+ P +LDMTEA G    KK +L +I  P+
Sbjct  451   SNLELPLAQLLLHFDWKLPNGIEPNNLDMTEAFGETVRKKTNLHVIGIPY  500



>ref|XP_006346274.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   481 bits (1237),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 338/478 (71%), Gaps = 9/478 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             KA  + KLPPGPW+LP IGSLHHL+G    H +LRN +++YGP+M+LQLGEI  ++ISSP
Sbjct  46    KAKKQIKLPPGPWRLPFIGSLHHLIGRGPLHCTLRNFAQRYGPLMYLQLGEIPVVIISSP  105

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
              +A+ +  THDL F+ RP+ M+ +I FY + ++AF P+ +YW+QMRKIC ++LLS+KMVK
Sbjct  106   TIAKELLTTHDLAFSDRPQSMSTNITFYNNKNIAFCPHDNYWKQMRKICNVQLLSVKMVK  165

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF + R++E+S+ VSSIR  S  G P N+TEK+ WFT+S+     FG++  +++ +FI L
Sbjct  166   SFGAIRKDEISSPVSSIR--STKGSPINMTEKIFWFTNSVTCSAPFGKIF-KNRDEFIKL  222

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             LK ++ L  GFD+ D F    +    SG++ +L+ +H ++D+I + I+ +H EN  A   
Sbjct  223   LKDMVILVSGFDVADFFLLGSY--KLSGVESRLMNVHKKVDEIMEDILKEHLENK-ATRN  279

Query  879   NSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
                G+   ED+VDVLLRV E  EL+ P T D+IKAVI D+F  G+E S    IW + E++
Sbjct  280   KGIGEFGGEDLVDVLLRVTEDAELECPFTNDHIKAVILDIFVAGSEPSVAITIWVLLEIL  339

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDK-DLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             K P++MAK Q EVRQ  KG K +DD+ ++E LTYL LVIKETL LH P PL+ PR+  E+
Sbjct  340   KNPNIMAKTQKEVRQVFKGKKHYDDEENMEKLTYLNLVIKETLSLHTPTPLLPPRKCREQ  399

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
               I    IP KT++ +NAWAL ++ ESW DPE F+PERFENSS+DFMGNH+EFIPFG GR
Sbjct  400   IYIDGCTIPLKTKIFVNAWALVSDSESWHDPESFIPERFENSSIDFMGNHFEFIPFGYGR  459

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             R+CP I F   ++ L LA LLYHF WELP G++ K+LD  E  G+  +K+KDL L+AR
Sbjct  460   RICPRILFGLFNVKLHLAKLLYHFEWELPYGMNLKELDTAETHGLSGAKQKDLYLVAR  517



>gb|KEH34014.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   480 bits (1236),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 242/466 (52%), Positives = 335/466 (72%), Gaps = 4/466 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LP GP KLP+IG++H+L+  S PHR LR+L+R+YGP+MHLQLGEIS IVISSP  AR + 
Sbjct  36    LPNGPRKLPIIGNIHNLLS-SQPHRKLRDLAREYGPLMHLQLGEISFIVISSPDCAREVM  94

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD+ FA+RP+ ++ D++ Y ST +  SPYG+YWRQ+RKIC LELLS+K V S+   R+
Sbjct  95    KTHDINFATRPQGLSSDLIAYNSTGIVSSPYGNYWRQLRKICTLELLSLKRVNSYQPIRE  154

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE SNLV  I  +S+ G P NLT+ V     ++++K AFG+   +DQ KFI+  K++L +
Sbjct  155   EEFSNLVKWI--ASKEGSPINLTQAVLSSIYTIVSKSAFGKKF-KDQEKFISAEKEILKI  211

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
             A GFDL +LFPS  W+H+ +G++PKL ++H  +D+I + II +HKE       +    DE
Sbjct  212   AAGFDLAELFPSITWMHFFTGLRPKLERVHRVVDQIMENIINEHKEAKSKGEFDQVESDE  271

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+VDVLL+ ++G   +F +T DNIKA+I D+F  G ETSA+TI WAM+EM+K P +M KA
Sbjct  272   DLVDVLLKYQDGNNKEFFLTIDNIKAIIMDIFGAGGETSASTIDWAMAEMVKNPRIMKKA  331

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             QAEVR+        ++  +  L YLK ++KETLRLHPP PL+ PRE  +  KI  Y IP 
Sbjct  332   QAEVREIFNMKGRVEENCINELNYLKSIVKETLRLHPPAPLLIPRECAQSCKIDGYDIPT  391

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
             KT+VI+NAWA+A +P  W +PERF PERF +S +D+ G+++E+IPFGAGRR+CPG  F  
Sbjct  392   KTKVIVNAWAIARDPNYWTEPERFYPERFIDSDIDYKGSNFEYIPFGAGRRICPGSIFGL  451

Query  1440  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
              S+ L+LA LLYHF+W+LP+G+  ++LDMTE  G+   +K DL L+
Sbjct  452   RSVELALAKLLYHFDWKLPNGIKSEELDMTEKFGITVCRKDDLLLL  497



>gb|KDP39024.1| hypothetical protein JCGZ_00781 [Jatropha curcas]
Length=537

 Score =   481 bits (1239),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 332/470 (71%), Gaps = 6/470 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KL PGPWKLP+IG++H L+G S+PH  LR+LS +YGP+MHL+LG+IS IVISSP+ A+ +
Sbjct  33    KLAPGPWKLPIIGNMHQLLG-SIPHHRLRHLSNQYGPVMHLKLGQISNIVISSPEAAKKV  91

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHD++F+ RP ++A +I+FY   D+A +PYGD WRQMRKIC LELLS K V+SF + R
Sbjct  92    MKTHDIIFSQRPFLLAGEIIFYNFKDIALAPYGDSWRQMRKICTLELLSTKRVRSFRAIR  151

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             +EE SN + SI   SE     N+++ V   ++++  + AFG+V SE    F+ L+++++ 
Sbjct  152   EEETSNFIRSISSLSEV----NISKMVLSLSNAITLRSAFGKV-SERHEAFLPLVQKIVL  206

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  896
             +  GF + D+FPS K++H   GM+ K+ KLH E D + + II +H+EN     +N+ GK+
Sbjct  207   VLEGFSVADIFPSVKFLHGIIGMRSKIEKLHQEADIMLENIINEHRENKRLGRSNTQGKE  266

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             +D+VDVLL ++ G  L+FP+  +NIKAV+ DMF  GTETSAT I WAMSEM+K   VM K
Sbjct  267   DDLVDVLLNLQCGDSLEFPLRIENIKAVMLDMFLAGTETSATVIEWAMSEMVKDSRVMKK  326

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQ E+RQ     +  D+   + L YLKLVIKETLRLHPP PL+ PRE +E  +I  Y +P
Sbjct  327   AQEEIRQVFNEKENIDETRFDELKYLKLVIKETLRLHPPAPLLAPRECLEAVEIDGYEVP  386

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
               T+VIINAWA+  +   W + E+F PERF+N+S+DF GN +EFIPFGAGRRMCPG+++ 
Sbjct  387   INTKVIINAWAIGRDSRHWNEAEKFYPERFQNNSIDFKGNDFEFIPFGAGRRMCPGVTYG  446

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
                + L LA LLYHF+W+LP+G+    LDM+E  G  A +K +L LI  P
Sbjct  447   LAVVELVLANLLYHFDWKLPNGLEAHQLDMSETFGATARRKNELHLIPIP  496



>gb|KDP29297.1| hypothetical protein JCGZ_19400 [Jatropha curcas]
Length=546

 Score =   482 bits (1240),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 243/475 (51%), Positives = 340/475 (72%), Gaps = 6/475 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             ++LPPGP KLPLIG+LH+L G   PH +L  L+++YGP+MHLQLGEIS IV+S+P++A+ 
Sbjct  60    KRLPPGPIKLPLIGNLHNLAGAQ-PHHALTELAKEYGPLMHLQLGEISAIVVSNPRIAQV  118

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             I KTHDLVFA RP+I+A  I+ Y   D+AFS  G+YW+QM++I ++ELL  K V+SF S 
Sbjct  119   IMKTHDLVFADRPEILAAKIITYGGQDIAFSKLGEYWKQMKRISLMELLGPKTVQSFASL  178

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             R+ E+  L+ SI LS   G P N TEK+   T+ +  K AFG  C +DQ   IAL K+  
Sbjct  179   RENEVEKLIQSIHLSK--GKPINFTEKIFHLTNVITCKAAFGDEC-KDQDVVIALTKEAT  235

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA--NSTNSS  887
             ++AGGF + D+FPS +++   +G+K KL KL  EL  +F  II +HK+  +    S +  
Sbjct  236   TIAGGFGIADVFPSMEFLQAITGVKGKLEKLRDELGDVFGNIIDEHKQKLMNRDGSDDVE  295

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
              + ED+VDVLL+++  G  Q P+T +++KAV+ D+F+ GT+TS+TT+ WAMSEM+K P +
Sbjct  296   SEKEDLVDVLLKLQGSGRFQCPVTNNSLKAVVLDLFTAGTDTSSTTVEWAMSEMMKNPRI  355

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             + KAQ EVR+A KG K   ++D++ L YL LVIKETLRLHPP PL+ PRES E  +I  Y
Sbjct  356   LKKAQEEVREAFKGKKIICEEDVKQLKYLPLVIKETLRLHPPAPLLLPRESREACEIDGY  415

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP +++VI+NA+A+  +PE+W +P+ F PERF NSSVDF G ++EFIPFGAGRR+CPGI
Sbjct  416   EIPMRSKVIVNAYAIGRDPEAWPEPDNFKPERFINSSVDFKGMNFEFIPFGAGRRICPGI  475

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
             +F   +I L LA +LYHF+W+LP+G++ ++LDMTEA G    +K  L LI  P+ 
Sbjct  476   AFGLANIELPLARILYHFDWKLPEGITSENLDMTEAFGATVGRKNQLYLIPIPYT  530



>gb|AAK62343.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=473

 Score =   478 bits (1230),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 242/480 (50%), Positives = 332/480 (69%), Gaps = 33/480 (7%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
              K+  +  ++LPPGPWK+P++GS+ H++GG  PH  LR+L++KYGPIMHLQ GEIS +V+
Sbjct  22    CKNSNSQTKQLPPGPWKIPILGSMLHMLGGE-PHHILRDLAKKYGPIMHLQFGEISAVVV  80

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             +S ++A+ + KTHD+VFASRPKI+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K
Sbjct  81    TSREMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAK  140

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  F
Sbjct  141   NVRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDVF  199

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
                +++V+ LA GFD+ D+FPS K++H  SGMK KLL  H ++D I + +I +HK+N   
Sbjct  200   AKKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAT  259

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
               TN +                               + DMF+ GTETS+TT +WAM+EM
Sbjct  260   GKTNGA-------------------------------LGDMFAAGTETSSTTTVWAMAEM  288

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             +K P+V  KAQAEVR+  K   TFD+ D E L YLKLVIKETLRLHPP PL+ PRE  E+
Sbjct  289   MKNPNVFNKAQAEVRETFKDKVTFDEIDAEELEYLKLVIKETLRLHPPSPLLVPRECRED  348

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
               I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG GR
Sbjct  349   TDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGGR  408

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R+CPG+SF   ++ L LA LLYHF+W+LP G+ P DLD+TE  G+  ++K DL L+A P+
Sbjct  409   RICPGMSFGLANLYLPLAQLLYHFDWKLPSGMMPGDLDLTELAGITIARKGDLYLMATPY  468



>ref|XP_007153133.1| hypothetical protein PHAVU_003G009500g [Phaseolus vulgaris]
 gb|ESW25127.1| hypothetical protein PHAVU_003G009500g [Phaseolus vulgaris]
Length=509

 Score =   479 bits (1234),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 249/476 (52%), Positives = 340/476 (71%), Gaps = 10/476 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K  + QK+ PGPWKLP+IG++H+L+  S PH  LR+L++ YGP MHLQLGE+ TI++SSP
Sbjct  31    KTESSQKILPGPWKLPIIGNIHNLLT-STPHTKLRDLAKIYGPFMHLQLGEVFTIIVSSP  89

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             + A+ I KTHDL FASRPKI+A DI+ Y+ST++ F+ YG+YWRQ+RKIC +EL + K V 
Sbjct  90    EYAKEIMKTHDLNFASRPKILASDILSYESTNIVFASYGNYWRQLRKICTVELFTHKRVS  149

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF   R+EEL++LV  I   S  G P NLT+ V     +L+A+ AFG+ C +DQ +FI++
Sbjct  150   SFQPVREEELAHLVRMI--DSHEGSPFNLTQAVLSSVYNLMARAAFGKKC-KDQEEFISV  206

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +K+ + +  GF++GDLFPS KW+   +G++PKL ++H ++D+I + II +HK    A S 
Sbjct  207   VKEGVKIGSGFNIGDLFPSAKWLQTVTGLRPKLERMHRKIDRILEDIISEHKG---AKSK  263

Query  879   NSSGK-DEDIVDVLLRVKEGGELQFPI--TEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                G+ +ED+VDVLL+ ++G +    I  T DNIKA+I D+F  G ETSATTI WAM+EM
Sbjct  264   GRGGEAEEDLVDVLLKFQDGNDSNQDICLTVDNIKAIILDIFGAGGETSATTINWAMAEM  323

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             I+ P VM KAQ EVR+        D   ++ L YLKLV+KETLRLHPP PL+ PRE  E 
Sbjct  324   IRDPRVMKKAQDEVREVFNMKGRVDKICMDELKYLKLVVKETLRLHPPAPLLLPRECREA  383

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              +I  Y IP K++VI+NAWA+  +P  W + ERF PERF +SSVD+ GN++E+IPFGAGR
Sbjct  384   CEIKGYHIPAKSKVIVNAWAIGRDPNCWSEAERFYPERFIDSSVDYKGNNFEYIPFGAGR  443

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             R+CPG +F   S+ L+LA LLYHF+W+LP G+  +DLDMTE  GV   +K DL LI
Sbjct  444   RICPGSTFGLISVELTLAFLLYHFDWKLPIGMKNEDLDMTEQFGVTVGRKDDLYLI  499



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   479 bits (1233),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 248/483 (51%), Positives = 346/483 (72%), Gaps = 10/483 (2%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             ++SK      LPPGP KLPLIG+LH L+G SLPH +LR+++ +YGPIMHL+ GE+ T+++
Sbjct  26    SESKRGKGSNLPPGPRKLPLIGNLHQLMG-SLPHHTLRDMANEYGPIMHLRFGEVPTVIV  84

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SS + A+ + KTHDLVFA RPKI+  DI+ Y ST + FSPYGD+WRQ+RKICV ELL++K
Sbjct  85    SSAEAAKEVMKTHDLVFADRPKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLNVK  144

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+SF S RQEE+ +L+ +I  S+ +G   NL++ +   T+++IA+ AFGR   E+Q +F
Sbjct  145   RVQSFESIRQEEVEDLIKTIS-SNPSGTTINLSQMIFTLTNNIIARAAFGRKL-ENQDEF  202

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I  L++++ LAGGFDL D FPS K++H  +G K  + K+HH++DKI + ++ +HK    A
Sbjct  203   IGTLRKIVDLAGGFDLPDTFPSLKFLHPLTGAKAAMEKIHHQIDKILESVLQEHKA---A  259

Query  870   NSTNSSGKD----EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
                  + KD    ED+VDVLLRV+E  +L  PIT D IKAVI + F  GT+TS+T + WA
Sbjct  260   RKVTINHKDKMHKEDLVDVLLRVQESSDLDVPITTDTIKAVILETFIAGTDTSSTALEWA  319

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             M+E++K P VM +AQAEVR+A KG     + +++ L YLKLVIKETLRLH P+PL+ PR 
Sbjct  320   MAELMKNPHVMEQAQAEVRKAFKGKSMMTESEVQQLDYLKLVIKETLRLHAPVPLLVPRV  379

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
             + E  ++G Y I   TR+++NAWA+  +P+ WE+ E F PER  NS++DF GN++EFIPF
Sbjct  380   ARERCELGGYEIQANTRLMVNAWAICRDPKYWENAECFEPERHRNSTLDFKGNNFEFIPF  439

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRR CPGI F  +++ L LA LL HF+W+LP+G+ P +LDMTEA G    KK +L +I
Sbjct  440   GAGRRACPGILFGISNLELPLAQLLLHFDWKLPNGIEPNNLDMTEAFGETVRKKTNLHVI  499

Query  1578  ARP  1586
               P
Sbjct  500   GIP  502



>gb|KDP39285.1| hypothetical protein JCGZ_01042 [Jatropha curcas]
Length=505

 Score =   479 bits (1232),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 241/483 (50%), Positives = 331/483 (69%), Gaps = 13/483 (3%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIV  326
             W K+K+  K  LPPGPWKLPLIGS+HHL G SL H  +  L+RKYGPIMHLQLG+++ I 
Sbjct  26    WRKTKS--KPNLPPGPWKLPLIGSMHHLAGPSLLHHRVTELARKYGPIMHLQLGQVTNIF  83

Query  327   ISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  506
             ISSP++AR + KTHDL+FA+RP ++A+ +V Y  TD+AF+PYGDYWRQ++KIC +ELL+ 
Sbjct  84    ISSPEIAREVMKTHDLIFATRPSLVAVQLVTYNFTDIAFAPYGDYWRQIKKICTMELLTA  143

Query  507   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  686
             K V+ F   RQEE+S +++ I  +S  G   N T  ++  T  ++++   G++   ++G 
Sbjct  144   KRVQLFAPIRQEEVSKVITDI--TSNVGSTINFTNVLTSLTYKILSRSTIGKILKGEEG-  200

Query  687   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
             FI  +  +     GF+L D +PS K       +K KL ++H ++DK+   +I D +    
Sbjct  201   FIRAVMDLTEEGAGFNLADFYPSIKLFRMFGSLKHKLKRIHQQVDKMMQNVIDDRR----  256

Query  867   ANSTNSSGKDE--DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
             A    S   DE  DIVDVLLR++E G+LQ P+T+DNIKAVI DMFS G+++SA T IW M
Sbjct  257   ATKRESGVDDEERDIVDVLLRIQEQGDLQLPLTDDNIKAVIFDMFSAGSDSSAATTIWTM  316

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             SE++K PSVM KAQAEVRQ  K     D++ +E L YLK  +KETLRLH P PL+ PRE 
Sbjct  317   SELLKNPSVMEKAQAEVRQVFKKKGQVDEEGMEELHYLKAAVKETLRLHAPGPLVVPREC  376

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              E   I  Y IP K+R+ +N+WAL  +PE W +PER+ PERF + S+D  GN++ ++PFG
Sbjct  377   TENCVIAGYDIPAKSRINVNSWALGRDPEYWTEPERYSPERFLDGSIDHKGNNFTYLPFG  436

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             +GRR+CPGI F  T+I   LA LLY+F+W+LP+G+ P+DLDMTE  G  A +K DL +I 
Sbjct  437   SGRRLCPGILFGLTNIEFILANLLYYFDWKLPNGLQPEDLDMTEVFGSAARRKNDLLVI-  495

Query  1581  RPF  1589
              PF
Sbjct  496   -PF  497



>ref|XP_007146606.1| hypothetical protein PHAVU_006G054300g [Phaseolus vulgaris]
 gb|ESW18600.1| hypothetical protein PHAVU_006G054300g [Phaseolus vulgaris]
Length=508

 Score =   479 bits (1232),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 244/474 (51%), Positives = 343/474 (72%), Gaps = 5/474 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             K+P GP KLP+IG++++L+  S PH  LR+L+ KYGP+MHLQLGEISTIVISSP+ A+ +
Sbjct  37    KIPHGPTKLPIIGNIYNLLF-SQPHIKLRDLALKYGPLMHLQLGEISTIVISSPECAKEV  95

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHD+ FA+RPK++A+DI+ Y STD+AF+PYG+YWRQ+RKIC LELLS+K V S+   R
Sbjct  96    MKTHDINFATRPKVLAVDIMSYNSTDIAFAPYGEYWRQLRKICTLELLSLKRVNSYQPIR  155

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             +EELSNLV  I   S+ G P NLT+ V     S+ ++ AFG+   +DQ  FI ++K+++ 
Sbjct  156   EEELSNLVKWI--DSKKGSPINLTQAVLSSIYSIASRSAFGKK-YKDQENFILVIKKLIK  212

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  896
              AGGFD+GDLFPS  W+ + +GM+PKL  LH + D+I + II +HKE   + + +   + 
Sbjct  213   AAGGFDIGDLFPSATWLQHVTGMRPKLENLHQQADQIMENIINEHKEAK-SEANDYEREA  271

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             ED+VDVL++ +EG +  F +T +NIKA+I D+F+ G ETSATTI WAM+E++K   VM  
Sbjct  272   EDLVDVLIQYEEGSKQDFSLTRNNIKAIILDIFAAGGETSATTIDWAMAEIMKNSRVMKH  331

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQAEVR+        D+  +  L YLKLV+KETLRLHPP+PL+ PRE  +  +I  Y IP
Sbjct  332   AQAEVREVFNMKGRVDENCINELKYLKLVVKETLRLHPPIPLLLPRECGQTCEIHGYNIP  391

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              K++VI+NAWA+  +   W +PERF PERF ++++D+ GN++E+IPFGAGRR+CPG  FA
Sbjct  392   AKSKVIVNAWAIGRDSNYWTEPERFYPERFIDNTIDYKGNNFEYIPFGAGRRICPGSIFA  451

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVDL  1598
                + L+LA LLYHF+W+LP G+  ++LDM+E  G+   +K DL L+  P + L
Sbjct  452   SRVVELTLAMLLYHFDWKLPSGMISEELDMSEEFGITVRRKHDLFLVPFPCLPL  505



>ref|XP_008779112.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=499

 Score =   478 bits (1231),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 242/483 (50%), Positives = 338/483 (70%), Gaps = 10/483 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +K+ A++ LPP PWKLP+IG LHHL+G +LPHR+LR LSR++GP+MHL+LG++  I++SS
Sbjct  25    TKSTARRNLPPSPWKLPIIGHLHHLLG-ALPHRALRELSRRHGPLMHLKLGQVDHIIVSS  83

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P++AR I KTHDL+FASR KI+A     Y   D+ F+PYG YWR++RKICV+ELLS K V
Sbjct  84    PEMAREILKTHDLIFASREKILA-SKALYDGADIIFAPYGSYWRELRKICVIELLSAKRV  142

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF + RQEE+SNLV  I  S+    P NL+E     +++  ++V FG  C     +FI+
Sbjct  143   KSFSTVRQEEMSNLVGYI--STMNNSPVNLSEMFLLISNTTTSRVVFGTKCKHGP-RFIS  199

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH-LAN  872
              +K+++    GF + DLFPS   + +   +  +L K H E+D+I   II +H+E     N
Sbjct  200   AMKKLVEFLSGFSVADLFPS---LSFVDTLNLRLKKCHREMDEILGEIIKEHEEKRETMN  256

Query  873   STNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
             S+N   +  ED+VDVLL +KE G L+FP+T  +IKAVI DMF  GTETS+TT+ W M+E+
Sbjct  257   SSNEERQQGEDLVDVLLELKENGGLEFPLTITSIKAVIMDMFGGGTETSSTTLDWTMAEL  316

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             ++ P +M K QAEVR+ALKG     ++D     Y+KLVIKE+LRLHPP+PL  PR   E 
Sbjct  317   MRHPEIMEKVQAEVREALKGKAKIKEEDTNEFHYMKLVIKESLRLHPPVPLFLPRVCRET  376

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              ++  + IP  +R++INAWA+AT+P  WEDPE F PERF+ SSVD+ G +YE++PFGAG+
Sbjct  377   CQMDGFKIPAGSRILINAWAMATDPRYWEDPESFRPERFDGSSVDYKGGNYEYMPFGAGK  436

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             RMCPG++F    + ++LA LLY+F+W+LP+G+ P DLDM E+ G     K  L LIA P+
Sbjct  437   RMCPGMTFGMAQVEMALANLLYYFDWKLPNGMGPNDLDMNESFGAAVGLKSPLWLIATPY  496

Query  1590  VDL  1598
             V +
Sbjct  497   VPI  499



>ref|XP_007020553.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12078.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=518

 Score =   479 bits (1233),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 243/474 (51%), Positives = 338/474 (71%), Gaps = 7/474 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPWKLPLIG+LH LV  +LPH +LR+L++KYGP+M L+LGE+ T+V+SS ++A+ +
Sbjct  42    KLPPGPWKLPLIGNLHQLVS-TLPHYTLRDLAKKYGPLMWLKLGEVPTLVVSSLEMAKEV  100

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              +THD+ F  RP ++A  I+ Y   D+ FSPYG+YWRQM+KIC+ ELLS   V+SF S R
Sbjct  101   MRTHDVTFCQRPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELLSTNRVQSFQSIR  160

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++E+S L+  I  SS    P NL+EK+   T  + A+ AFG+  S D+ +FI++  +V  
Sbjct  161   EQEVSALMEII--SSNARSPVNLSEKIYSMTYGITARAAFGKK-SGDEEEFISIAIEVSK  217

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE--NHLANSTNSSG  890
             LAGGF L D++PS + +   SG++ KL KLH   D+I + II  HKE  N +AN+   + 
Sbjct  218   LAGGFCLADMYPSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRNGMANTKTGNK  277

Query  891   KDE-DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
             KDE D+VDVLL++++ G+L FP+ +DNIKAVI D+F  G+E S+ T+ WAMSEM++ P +
Sbjct  278   KDEEDLVDVLLKLQQQGDLDFPLLKDNIKAVIQDIFGAGSEASSNTVEWAMSEMVRNPKL  337

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             M +AQAEVR+   G    D+  LE L +LKL++KETLRL+P  PL+ PRE  E+  IG Y
Sbjct  338   MKEAQAEVRRVFHGKGKVDEVGLEELKFLKLIVKETLRLYPAGPLLIPRECSEDCVIGGY  397

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP KT+VI+NAWA+  +P  W++ E+F PERF +  +DF G ++E+IPFGAGRRMCPGI
Sbjct  398   EIPAKTKVIVNAWAIGRDPSYWKEAEKFQPERFIDKRIDFRGTNFEYIPFGAGRRMCPGI  457

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             SFA  +I L LA LLYHF+W+LP+ +   DLDMTE+ G+   +K DL LI  P+
Sbjct  458   SFALPNIELPLAKLLYHFDWKLPNEMKCDDLDMTESFGLTVRRKNDLFLIPIPY  511



>ref|XP_008345750.1| PREDICTED: cytochrome P450 71D8-like [Malus domestica]
Length=519

 Score =   479 bits (1233),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 244/479 (51%), Positives = 322/479 (67%), Gaps = 13/479 (3%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             +LPPGPWK+PLIG+LH +   SLPH  + +L+ KYGPIMHL+LG++S +VISSP+  + +
Sbjct  41    RLPPGPWKVPLIGNLHQMAASSLPHXCMTDLANKYGPIMHLKLGQLSAVVISSPEFVQEM  100

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHD+ F+ RP  +A +I+ Y S  + FSPY D+WRQMRKIC+LELLS K V+SF S R
Sbjct  101   LKTHDVAFSQRPTFLAAEILSYNS-GIIFSPYNDFWRQMRKICMLELLSAKRVESFASIR  159

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             QEE SNLV SI LS   G P NL+E +    S +IA+ AFG+ C   Q +F++ L+  + 
Sbjct  160   QEEASNLVESISLSD--GHPFNLSEMIFSXQSVIIARAAFGKKCKYQQ-EFLSQLQDAVR  216

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  896
             LA  FD+ DLFPS K++ Y   +KP + K+H ++DKI D II DH+      S       
Sbjct  217   LAAEFDVPDLFPSLKFLRYVINLKPAVEKVHQKMDKILDEIISDHRVKRNEESAAGDDHQ  276

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             EDIVDVLLR++E GELQF +T   IKAV  DMFS G+ETSATT  WAM+E+++ P  M K
Sbjct  277   EDIVDVLLRLQESGELQFDLTTTQIKAVTLDMFSAGSETSATTTEWAMAELLRSPRAMKK  336

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQAEVRQ   G    ++ D++ L YL LVI+ET  L    P   PR++ E+  IG Y IP
Sbjct  337   AQAEVRQLXGGKGKIEESDIKKLDYLNLVIRET--LRLHPPPFIPRQASEKCTIGGYDIP  394

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              +  V INAW +  +P+ WE+ + FLPERF+ SSVDF G ++E +P G GRRMCPGISFA
Sbjct  395   TEATVFINAWGIGRDPKYWENADCFLPERFQGSSVDFRGTNFELVPXGGGRRMCPGISFA  454

Query  1437  YTSIALSLAGLLYHFNWELPDGVSP-------KDLDMTEAVGVIASKKKDLCLIARPFV  1592
               SI L+L+ LLYHF+W+LP+           ++LDMTE  G+   KK +L LIA PF+
Sbjct  455   TASIELALSHLLYHFDWKLPNANGSSXEXXLLEELDMTECKGLNVRKKNNLYLIAIPFI  513



>ref|XP_003610580.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92777.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=503

 Score =   478 bits (1230),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 244/477 (51%), Positives = 327/477 (69%), Gaps = 15/477 (3%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
              KLPPGPWKLPLIG+LH L +GGSLPH +LR+LS KYGP+M+LQLGEIS +V+SSP LA+
Sbjct  35    HKLPPGPWKLPLIGNLHQLALGGSLPHHTLRDLSNKYGPLMYLQLGEISAVVVSSPDLAK  94

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              I KTHDL F  RP+++A  I+ Y STD+ ++PYGDYWRQMRKIC  +LLS K V  F S
Sbjct  95    EIMKTHDLSFVQRPELLAPKILSYDSTDIVYAPYGDYWRQMRKICTSQLLSAKRVHYFSS  154

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R+EE+  L+ SI++S     P N+T+      S+ +++ AFG+  S+ + + ++LLKQ 
Sbjct  155   IREEEVQKLIQSIQVS--LSLPLNVTKTAFSLVSTFVSRAAFGKK-SKYEDELLSLLKQT  211

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
             + +A GFD  DLFPS K IH  +  K KL  +  +LDKI + II +H+ N +        
Sbjct  212   VEMASGFDPADLFPSFKPIHLITRTKAKLQNMQKKLDKILESIIKEHQSNSIHGK-----  266

Query  891   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
             + E++VDVLLRV++      PIT+DN+KAV+ DMF+ G++TSAT I WAMSE++K   VM
Sbjct  267   QGENLVDVLLRVQQSDNFDIPITDDNVKAVLWDMFAAGSDTSATVIEWAMSELMKNSRVM  326

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
              KAQ+E+R+A+KG K   + DL  L+YLK VIKET     P   + PRE  E   I  Y 
Sbjct  327   KKAQSEIREAVKGKKRIYESDLHELSYLKSVIKET-MRLHPPFTLLPRECREACNIDGYE  385

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSS-VDF----MGNHYEFIPFGAGRRM  1415
             IP KT VI+NAWA+  +P+ W D ++F+PERF +S+  DF      N ++++PFG GRRM
Sbjct  386   IPIKTSVIVNAWAIGRDPKHWYDAKKFIPERFNDSTGFDFNKLNNNNSFDYMPFGGGRRM  445

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             CPGIS    +I L LA LLYHFNWELP+G+ P+DLDMTEA G  A+++  L LI  P
Sbjct  446   CPGISLGLANIELPLAALLYHFNWELPNGMKPEDLDMTEAFGAAAARRNGLYLIPTP  502



>ref|XP_004232610.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   478 bits (1230),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 249/477 (52%), Positives = 344/477 (72%), Gaps = 8/477 (2%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K  +   LPPGPWKLP IGS+HHL+   LPH +LR+L++K+GP+MHLQLGEI TIVISSP
Sbjct  26    KRKSTLNLPPGPWKLPFIGSIHHLIASQLPHHTLRDLAKKHGPLMHLQLGEIPTIVISSP  85

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             ++A+ + KTHDL F +RP ++++ I+ Y  +D+AF+PYG+YWRQMRK+C LELLS K V 
Sbjct  86    RVAQEVLKTHDLAFTNRPGLLSVQILTYNYSDIAFAPYGNYWRQMRKLCTLELLSAKNVV  145

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF S R+EE  +L+  +   S++G   NLTEK+   T+++I + AFG+   E+   F++L
Sbjct  146   SFASIREEEAFDLLQDVE--SKSGSVINLTEKIYALTNAVICRAAFGKRRKEESTYFMSL  203

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             +K++  +  G D+ ++FPS K++   +G K KLLKLH + DK+ D+II +HK  +     
Sbjct  204   IKELSLMITGLDISEVFPSLKFLQVITGTKEKLLKLHKKFDKVLDMIIEEHKHEY---DD  260

Query  879   NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1058
               S +  D+V++LL ++E G L F  T DNIKAVI DMF  GTETSAT + WAM EM++ 
Sbjct  261   EESSRKTDLVNLLLMLQESGTLDFSFTRDNIKAVILDMFLAGTETSATVLDWAMVEMMRS  320

Query  1059  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1238
             P+VM KAQ E+R+ LKG     + DL+ ++YLKLVIKETLRLHPPLPL+ PRE  EE  I
Sbjct  321   PNVMEKAQTELRRILKGKNRVTENDLKEVSYLKLVIKETLRLHPPLPLLLPRECREECVI  380

Query  1239  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSS---VDFMGNHYEFIPFGAGR  1409
               Y IP KT+VI+NAWA+  + E WED E F PERF NS+   ++F+G +YE++PFG GR
Sbjct  381   DGYDIPIKTKVIVNAWAINRDAEFWEDSESFTPERFINSASNNLEFIGQNYEYLPFGGGR  440

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             RMCPGISF  +++ L LA L+YHFNW+LP+G+ P+D+D+TE  G   S+K +LC+IA
Sbjct  441   RMCPGISFGLSNVELPLAQLIYHFNWKLPNGMKPEDVDVTETPGSSCSRKYNLCVIA  497



>ref|XP_009615716.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=508

 Score =   478 bits (1230),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 245/488 (50%), Positives = 336/488 (69%), Gaps = 10/488 (2%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVGGS----LPHRSLRNLSRKYGPIMHLQLGEI  314
             W K +   ++KLPPGP KLP IG++H LV       LPHR+L  L+ K+GP+MH++LGE 
Sbjct  23    WFK-ECNNRRKLPPGPMKLPFIGNIHQLVDWKSSELLPHRTLAKLASKHGPLMHMKLGER  81

Query  315   STIVISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLE  494
             S IV+SSPQ+ R + + HDL F +RP ++    +FY   D+ F  YGD+WRQMRKIC+ E
Sbjct  82    SAIVVSSPQMVREVMRKHDLNFTNRPVLLVGKEMFYDHADMGFCNYGDFWRQMRKICIQE  141

Query  495   LLSMKMVKSFCSFRQEELSNLVSSIRLSSETG-FPTNLTEKVSWFTSSLIAKVAFGRVCS  671
             LLS K ++SF      E+SNLVSSI+  S TG  P NLTE +S +T+S+I K + GR C 
Sbjct  142   LLSHKNIQSFYPKMFNEISNLVSSIKADSATGGSPINLTETLSLYTNSVICKASVGRAC-  200

Query  672   EDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDH  851
             ++QG  I +++ V   AG FDL DLFPS K IH+ SG+K KL K+H E+D + + II +H
Sbjct  201   KNQGSLIDIMRTVAGSAGVFDLADLFPSVKIIHFLSGLKYKLRKMHDEVDVLLEEIINEH  260

Query  852   KENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  1031
             + ++   STN    +EDIVDVLLR+++  +   PIT DNIKA+I D+F+ G+ TSA+T+ 
Sbjct  261   ESHN--GSTNGDPTEEDIVDVLLRLQKSQDFSIPITRDNIKAIIIDLFAGGSTTSASTME  318

Query  1032  WAMSEMIKRPSVMAKAQAEVRQALKGN-KTFDDKDLENLTYLKLVIKETlrlhpplplih  1208
             WA SE++K P +M KAQ EVR+  KG  +  D  D++ L YLK+V+KET+R HP  PL+ 
Sbjct  319   WAFSELMKNPKIMKKAQDEVREVFKGKLEGIDQTDIQKLKYLKMVVKETVRFHPLAPLLA  378

Query  1209  prESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEF  1388
             PRES EE +I  Y+IP  T  ++N WA++ +P  W +PE F PERF  S +DF G H+EF
Sbjct  379   PRESREECEINGYVIPKGTMALVNFWAISRDPNYWPNPETFDPERFNESHLDFTGAHFEF  438

Query  1389  IPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDL  1568
              PFG GRR+CPGISF+  ++ LSLA LLYHF+W+LP+G++P +LDMTE  G    +K +L
Sbjct  439   TPFGTGRRICPGISFSMATVELSLALLLYHFDWKLPNGMNPHELDMTEKFGNALERKNNL  498

Query  1569  CLIARPFV  1592
              LI  P+V
Sbjct  499   YLIPLPYV  506



>gb|ADD84654.1| CYP71D175 [Scoparia dulcis]
Length=519

 Score =   478 bits (1231),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 251/482 (52%), Positives = 341/482 (71%), Gaps = 16/482 (3%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
              LPP PWKLPLIG LHHL  G LPHR  +  S KYGPIMH +LG ++TIV+SSP LA+ +
Sbjct  37    NLPPSPWKLPLIGHLHHL-AGRLPHRCFQEFSTKYGPIMHFKLGGVTTIVVSSPDLAKEV  95

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              K  D  F  +P+++A +I++Y S+ ++FS YGDYWRQMRKIC++ELLS+K V+SF   R
Sbjct  96    LKVQDPTFTDKPEMIAAEILWYNSS-LSFSQYGDYWRQMRKICMIELLSVKNVRSFGLIR  154

Query  537   QEELSNLVSSI-RLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
              +E+S L  SI   S   G   +LTE+V+  TSS+I + AFGRVC  D+ K I +LK  +
Sbjct  155   NDEVSRLAHSIVGDSGNRGTLVDLTEEVAKMTSSIICRAAFGRVC-RDKEKMIEMLKDGI  213

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK  893
             +L  G D+ DL+PS K +   S  + +LLK+  +LD I D II +H+ N  A   +SSG 
Sbjct  214   ALLSGLDVCDLYPSSKMLKAMSWNRVRLLKMRRKLDPILDGIIAEHRRNR-AEKLDSSGN  272

Query  894   -------DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
                    +ED++DVL+R  E GEL+FPIT+DNIKA+I D+F+ GTET++TTI W M+E++
Sbjct  273   IGNGEFGNEDLIDVLIRHMESGELEFPITDDNIKAMIYDIFAAGTETASTTINWIMAELM  332

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             + P+VMAKAQ+E+RQ LK N TF + +++ L YLKLVIKE LRLHPP+PLI       + 
Sbjct  333   RHPNVMAKAQSEIRQTLKENTTFGETEVQKLKYLKLVIKEGLRLHPPVPLIPRV-CRNDT  391

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFEN---SSVDFMGNHYEFIPFGA  1403
             +I  Y IP ++RV +N+WA+  +P  W DPE F+PERFE+   SS+DF GNH E+IPFGA
Sbjct  392   EIKGYFIPARSRVPVNSWAIGRDPRIWPDPESFIPERFEDMNHSSIDFNGNHAEYIPFGA  451

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRRMCPG++F   S+ L LA LLYHF W+LP G+SP+DLDM E + + A+++ +L LIA 
Sbjct  452   GRRMCPGMNFGLASVELPLAHLLYHFEWKLPHGMSPQDLDMVERLALAAARRTNLKLIAV  511

Query  1584  PF  1589
             P+
Sbjct  512   PY  513



>gb|KDO38617.1| hypothetical protein CISIN_1g045050mg [Citrus sinensis]
Length=507

 Score =   478 bits (1229),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 249/483 (52%), Positives = 329/483 (68%), Gaps = 7/483 (1%)
 Frame = +3

Query  147   WAKSKA--AAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEIST  320
             W KSK   +    LPPGPW+LP+IG+LH  VG  LPH    +L++KYGP+MHLQLG++S 
Sbjct  22    WKKSKNNHSTLLNLPPGPWRLPVIGNLHQFVG-PLPHHCFGDLAKKYGPLMHLQLGQVSH  80

Query  321   IVISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELL  500
             IVISSP+ A+ + +THD+ FASRP ++A     Y  T++AF+P+GDYWRQ+RKIC LEL 
Sbjct  81    IVISSPEAAKEVMRTHDMSFASRPFLLAASFFTYNFTNIAFAPHGDYWRQVRKICTLELF  140

Query  501   SMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQ  680
             S K V+SF S R+EE SNL++SI  SS  G P NL++ +    + +  + AFG V  +DQ
Sbjct  141   SAKRVQSFRSIREEEASNLITSI--SSNLGLPVNLSKMIFSLINGITTRAAFG-VRWQDQ  197

Query  681   GKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN  860
              + + +  + + L+GGF L D+FPS K +   +G+KP+  +LH ELDKI   II +HKE 
Sbjct  198   EELMTVFHKSIELSGGFSLADVFPSIKLLARLTGIKPESERLHQELDKILGNIINEHKEG  257

Query  861   HLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
                  T   G+ +D+V VLLR +E GEL F +T +NIKA I D+F  GT++S T I WAM
Sbjct  258   KALGKT-VEGEADDLVHVLLRCQENGELGFNLTTENIKAAITDIFIAGTDSSVTVIEWAM  316

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             SEM+K P VM KAQAEVRQA   N   D+  +  L YLKLV+KETLRLH PLPL+ PRE 
Sbjct  317   SEMMKNPRVMEKAQAEVRQAFDKNGNVDEIGVHELQYLKLVVKETLRLHTPLPLLLPREC  376

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              E  KI  Y IP  ++VI+NAWA+A +P  W D E F PERF +SS+D+ GN++E+IPFG
Sbjct  377   GERCKILGYDIPKGSKVIVNAWAIARDPRYWNDAESFYPERFLDSSIDYKGNYFEYIPFG  436

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             AGRR+CPG+ F   +I L LA LL+HFNW+LP+G    DLDM E  G    +K DL L+ 
Sbjct  437   AGRRICPGMLFGMANIELPLAQLLFHFNWKLPNGEQNNDLDMAETFGGSVRRKNDLFLVP  496

Query  1581  RPF  1589
              P+
Sbjct  497   TPY  499



>gb|KHN36162.1| Cytochrome P450 71D8 [Glycine soja]
Length=453

 Score =   475 bits (1223),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 239/459 (52%), Positives = 328/459 (71%), Gaps = 12/459 (3%)
 Frame = +3

Query  231   VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAITKTHDLVFASRPKIMALD  410
             + GSLPHR+LR+L+ KYGP+MHLQLGEIS++V+SSP +A+ I KTHDL F  RP+ +   
Sbjct  1     MAGSLPHRTLRDLALKYGPLMHLQLGEISSVVVSSPNMAKEIMKTHDLAFVQRPQFLPAQ  60

Query  411   IVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETG  590
             I+ Y  +D+AF+PYGDYWRQM+KICV ELLS K V+SF   R++E +  + S+R S   G
Sbjct  61    ILTYGQSDIAFAPYGDYWRQMKKICVSELLSAKRVQSFSDIREDETAKFIESVRTSE--G  118

Query  591   FPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIH  770
              P NLT K+    SS I++VAFG  C +DQ +F++L+K+++ +  GF+L DLFPS K +H
Sbjct  119   SPVNLTNKIYSLVSSAISRVAFGNKC-KDQEEFVSLVKELVVVGAGFELDDLFPSMK-LH  176

Query  771   YTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK----DEDIVDVLLRVKEGG  938
               +G K KL K+  ++DKI D I+ +H+E          G+    +ED+VDVLLR+++  
Sbjct  177   LINGRKAKLEKMQEQVDKIVDNILKEHQEKR--ERARREGRVDLEEEDLVDVLLRIQQSD  234

Query  939   ELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKT  1118
              L+  IT  NIKA+I D+F+ GT+TSA+T+ WAM+EM++ P V  KAQAEVRQA +  K 
Sbjct  235   NLEIKITTTNIKAIILDVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKI  294

Query  1119  FDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALAT  1298
              ++ D+E L YLKLVIKETLRLH P PL+ PRE  +   I  Y IP KT+V+INAWA+A 
Sbjct  295   INETDVEELIYLKLVIKETLRLHTPSPLLLPRECSKRTIIDGYEIPVKTKVMINAWAIAR  354

Query  1299  NPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYH  1478
             +P+ W D ERF+PERF+ SS+DF GN++E++PFGAGRRMCPG++    +I L LA LLYH
Sbjct  355   DPQYWTDAERFVPERFDGSSIDFKGNNFEYLPFGAGRRMCPGMTLGLANIMLPLALLLYH  414

Query  1479  FNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVD  1595
             FNWELP+ + P+ +DM E  G+   +K +LCLI  P V+
Sbjct  415   FNWELPNEMKPEYMDMVENFGLTVGRKNELCLI--PIVN  451



>ref|XP_007156884.1| hypothetical protein PHAVU_002G025300g [Phaseolus vulgaris]
 gb|ESW28878.1| hypothetical protein PHAVU_002G025300g [Phaseolus vulgaris]
Length=508

 Score =   477 bits (1228),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 244/470 (52%), Positives = 331/470 (70%), Gaps = 5/470 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
              KLPPGP KLP+IG+LH L V GSLPH ++R+L++KYGP+MHLQLG+IS ++ SSP++A+
Sbjct  32    HKLPPGPRKLPIIGNLHQLAVAGSLPHVAIRDLAKKYGPLMHLQLGQISAVIASSPEMAK  91

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              I KTHD+ FA RPKI+   I  Y   D+AFSPYGDYWRQM+KI  LELLS K V+SF  
Sbjct  92    EIMKTHDVAFAQRPKIVPAQIFTYGGLDIAFSPYGDYWRQMKKISKLELLSAKKVQSFSF  151

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R++  +  + +I   S  G   NLT ++S   S+ + K AFG + S DQ +F +L K +
Sbjct  152   IREQAAAKFIEAIE--SSAGSEINLTSRISNLISTSVFKAAFGNM-SGDQDEFESLQKHL  208

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN-HLANSTNSS  887
                 GG D+ DLFPS ++IH  +G + KL KL   LD+I+D I+  H+E           
Sbjct  209   AIHLGGLDITDLFPSMEFIHVLTGKRSKLEKLQKRLDRIYDNIVTQHEEKLPRVQERTLE  268

Query  888   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
              ++ED+VDVLLRV++ G L   IT  +IKA+++D+F  G +TS + + W+M+EM++ P+V
Sbjct  269   AEEEDLVDVLLRVQKSGSLGINITIKHIKAMVSDIFIAGIDTSESIMEWSMTEMMRNPTV  328

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
               KAQAE+RQA KG +   + DLE ++YLKLVIKETLRLHPP+PL+ PRE  E   I  Y
Sbjct  329   REKAQAELRQAFKGKRIIHESDLEEISYLKLVIKETLRLHPPVPLLLPRECSEATIIDGY  388

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP KT++++N WA+  +P+ W+D ERF+PERF+ SS DF GN++E++PFGAGRRMCPG+
Sbjct  389   EIPMKTKIMVNVWAMGRDPQYWDDAERFMPERFDGSSTDFKGNNFEYLPFGAGRRMCPGM  448

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             SF   SI L LA LLYHFNW+LP+G+ P+DLDMTE  G+   +K  LCLI
Sbjct  449   SFGLASIMLPLALLLYHFNWKLPNGIKPQDLDMTENFGLTIRRKGVLCLI  498



>ref|XP_010910607.1| PREDICTED: premnaspirodiene oxygenase-like [Elaeis guineensis]
Length=503

 Score =   477 bits (1227),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 248/477 (52%), Positives = 331/477 (69%), Gaps = 5/477 (1%)
 Frame = +3

Query  162   AAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQ  341
              A   KLPP PWKLP+IG LHH +G  LPHR+LR LS ++GP+MHL+LG++  I++SSP+
Sbjct  29    TATGIKLPPSPWKLPIIGHLHHFLGAQLPHRALRELSWRHGPVMHLRLGQVDHIIVSSPE  88

Query  342   LARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKS  521
             +AR I KTHDL+FA+R KI+ +  VFY  TD+ F+PYG YWR++RKICVLELLS K V+S
Sbjct  89    MAREILKTHDLIFATRDKIL-ISKVFYDGTDIVFAPYGSYWRELRKICVLELLSAKRVQS  147

Query  522   FCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALL  701
             F + RQEE+SNLV  I  S+    P NL+E     ++++ ++VAFG  C     +FI+  
Sbjct  148   FSTLRQEEMSNLVGYI--SNMRNSPVNLSEMFLLTSNTVTSRVAFGTQCKHGP-RFISAT  204

Query  702   KQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTN  881
             K+VL L  G ++ DLFPS   I   SG+  +L K   E+D+I   II +H E   A S  
Sbjct  205   KKVLELFIGSNVTDLFPSLSVIDTLSGLSSRLDKCGREMDEILGQIIEEH-EAKRATSNG  263

Query  882   SSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1061
                + ED+VDVLL +KE G L+FP T  NIKAVI DMF+ GTETSAT + W M+E+++ P
Sbjct  264   GPQEGEDLVDVLLGLKENGGLEFPFTLTNIKAVILDMFAGGTETSATKLQWTMAELMRHP  323

Query  1062  SVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1241
              +M KAQ EVRQA KG    +++D+  L Y+KLVIKE+LRLHPP+PL+ P+   E  K+ 
Sbjct  324   EIMVKAQVEVRQAFKGKTKIEEEDITKLHYIKLVIKESLRLHPPVPLLGPKVCREACKVD  383

Query  1242  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1421
              Y IP  +R+IINAWA+A +P  WEDPE F PERF+ SSVD+ G ++E++PFG GRR+CP
Sbjct  384   GYDIPFGSRIIINAWAVARDPRYWEDPESFKPERFDGSSVDYKGGNFEYLPFGGGRRICP  443

Query  1422  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
             GI+F    +   LA LLY+F+W++PDG+ PKDLD+TE  G   S K  L LIA P +
Sbjct  444   GITFGMAQVETVLAHLLYYFDWKIPDGMDPKDLDITELFGGTVSLKSPLWLIATPHI  500



>gb|AES59944.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=492

 Score =   476 bits (1226),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 243/479 (51%), Positives = 341/479 (71%), Gaps = 10/479 (2%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             +K K +A  KLPPGPWKLP+IGS+HHLV  S PHR LR+L++ YGP+MHLQLGEIS IV+
Sbjct  11    SKEKRSAP-KLPPGPWKLPIIGSIHHLVT-STPHRKLRDLAKIYGPLMHLQLGEISAIVV  68

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP+ AR + KTHD++FASRPK++ ++I+ Y  TD+AFSPYG+YWRQ+RKIC +EL + K
Sbjct  69    SSPEYAREVLKTHDVIFASRPKLLTIEILSYDYTDIAFSPYGNYWRQLRKICTMELFTQK  128

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V SF   R+EEL+NLV  I   S+ G P N+T+ V   T S+I K AFG   S+ +G+ 
Sbjct  129   RVSSFQPIREEELNNLVKKI--DSQQGSPVNITQLVVSSTFSIITKAAFG---SKGKGRE  183

Query  690   -IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
                 +    S+AGGFD+ +LFPS KW+   SG++PKL +LH ++D+I + I+ +HKE   
Sbjct  184   EFGSIGDGESIAGGFDIAELFPSAKWLQRVSGLRPKLERLHRQIDQILENIVTEHKEAKS  243

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPI--TEDNIKAVINDMFSTGTETSATTIIWAM  1040
               + +  G++ED+VDVLL+ + G +    I  T++NIK++I ++   G +TSA+TI+WAM
Sbjct  244   KANESQGGEEEDLVDVLLKFQGGNDSNQDICLTDNNIKSIILNIVGAGGDTSASTIVWAM  303

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             SE+++   VM KAQ EVR         ++  +  LTYLK V+KETLRLHPP PL+ PRE 
Sbjct  304   SELVRDKRVMKKAQDEVRDIFNMKGNVEENCINELTYLKSVVKETLRLHPPGPLLLPREC  363

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              +  +I  Y IP K++VI+NAWA+  +P+ W +PE+F PERF  SS+D+ GN++E+IPFG
Sbjct  364   GQACEIDGYRIPIKSKVIVNAWAIGRDPKYWTEPEKFYPERFIGSSIDYKGNNFEYIPFG  423

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             AGRR+CPG +F   ++ L+LA +LYHF+W+LP+G+  +DLDMTE  G    +K DL LI
Sbjct  424   AGRRICPGSTFGLINVELALALMLYHFDWKLPNGMKGEDLDMTEQFGATVKRKDDLYLI  482



>ref|XP_002523467.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38926.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   477 bits (1227),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 239/470 (51%), Positives = 337/470 (72%), Gaps = 5/470 (1%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
             K  LPPGPWKLP+IG++H+++G SLPH SL NL++K+GPIMHLQLGE++ I++SSP++A+
Sbjct  31    KLPLPPGPWKLPIIGNIHNVLG-SLPHHSLHNLAKKFGPIMHLQLGEVNAIIVSSPEIAK  89

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              I KTHD++FASRP ++AL I+F  +TDVAF+PYG++WRQMRKICV+E+LS K V+SF  
Sbjct  90    EIMKTHDVIFASRPFVVALKIIFGNTTDVAFAPYGEFWRQMRKICVVEILSAKRVQSFRP  149

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R+EE+ N +  I  S   G   N+++ +  +  ++I + AFG++ +E+Q   I L+K  
Sbjct  150   IREEEILNAIKEITCSE--GSMVNISKVLLSYAYNVILRAAFGKI-TEEQEALIPLIKDA  206

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
               ++ GF + DLFPS K IH   GM+ +  + + E DKI D +I  HK    A+S   S 
Sbjct  207   AEVSAGFSIADLFPSIKLIHNLDGMRSRTERAYQEADKIIDTVINYHKLRRKASSNKISD  266

Query  891   KD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
             ++  D++DVLL ++E   L F +T +N+K VI D+F  GTETS+T I WA+SEM+K P V
Sbjct  267   QESNDLIDVLLNIQEQENLDFTLTTENLKGVILDVFLGGTETSSTVIEWALSEMMKNPRV  326

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             M KAQ EVR+A    +  D++ L  L YLKLVIKETLRLHPPL L+ PRES EE +I  +
Sbjct  327   MEKAQVEVRRAFGKKEYVDEESLGELNYLKLVIKETLRLHPPLALLLPRESREECEINGF  386

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP K++VI+NAWA+  +P+ W + E F+PERF + +VD+ G ++EFIPFG+GRRMCPGI
Sbjct  387   PIPNKSKVIVNAWAIGRDPKYWSEAESFIPERFSDGTVDYRGANFEFIPFGSGRRMCPGI  446

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             +F   +I + LA LLY+F+W+LPDG+ P+D+DMTEA G    +K  L L+
Sbjct  447   TFGMVNIEVPLANLLYYFDWKLPDGMKPEDIDMTEAAGTSVRRKNSLNLV  496



>ref|XP_003589693.1| Cytochrome P450 [Medicago truncatula]
Length=500

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 243/479 (51%), Positives = 341/479 (71%), Gaps = 10/479 (2%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             +K K +A  KLPPGPWKLP+IGS+HHLV  S PHR LR+L++ YGP+MHLQLGEIS IV+
Sbjct  19    SKEKRSAP-KLPPGPWKLPIIGSIHHLVT-STPHRKLRDLAKIYGPLMHLQLGEISAIVV  76

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SSP+ AR + KTHD++FASRPK++ ++I+ Y  TD+AFSPYG+YWRQ+RKIC +EL + K
Sbjct  77    SSPEYAREVLKTHDVIFASRPKLLTIEILSYDYTDIAFSPYGNYWRQLRKICTMELFTQK  136

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V SF   R+EEL+NLV  I   S+ G P N+T+ V   T S+I K AFG   S+ +G+ 
Sbjct  137   RVSSFQPIREEELNNLVKKI--DSQQGSPVNITQLVVSSTFSIITKAAFG---SKGKGRE  191

Query  690   -IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  866
                 +    S+AGGFD+ +LFPS KW+   SG++PKL +LH ++D+I + I+ +HKE   
Sbjct  192   EFGSIGDGESIAGGFDIAELFPSAKWLQRVSGLRPKLERLHRQIDQILENIVTEHKEAKS  251

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPI--TEDNIKAVINDMFSTGTETSATTIIWAM  1040
               + +  G++ED+VDVLL+ + G +    I  T++NIK++I ++   G +TSA+TI+WAM
Sbjct  252   KANESQGGEEEDLVDVLLKFQGGNDSNQDICLTDNNIKSIILNIVGAGGDTSASTIVWAM  311

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             SE+++   VM KAQ EVR         ++  +  LTYLK V+KETLRLHPP PL+ PRE 
Sbjct  312   SELVRDKRVMKKAQDEVRDIFNMKGNVEENCINELTYLKSVVKETLRLHPPGPLLLPREC  371

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              +  +I  Y IP K++VI+NAWA+  +P+ W +PE+F PERF  SS+D+ GN++E+IPFG
Sbjct  372   GQACEIDGYRIPIKSKVIVNAWAIGRDPKYWTEPEKFYPERFIGSSIDYKGNNFEYIPFG  431

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             AGRR+CPG +F   ++ L+LA +LYHF+W+LP+G+  +DLDMTE  G    +K DL LI
Sbjct  432   AGRRICPGSTFGLINVELALALMLYHFDWKLPNGMKGEDLDMTEQFGATVKRKDDLYLI  490



>ref|XP_007146608.1| hypothetical protein PHAVU_006G054500g [Phaseolus vulgaris]
 gb|ESW18602.1| hypothetical protein PHAVU_006G054500g [Phaseolus vulgaris]
Length=508

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 241/482 (50%), Positives = 341/482 (71%), Gaps = 5/482 (1%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             + +     K+PPGP KLP+IG++H+L+  S PHR LR+L+ KYGP+MHLQLGE+STIVIS
Sbjct  29    RKRDETTSKIPPGPTKLPIIGNIHNLLS-SQPHRKLRDLALKYGPLMHLQLGEVSTIVIS  87

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             +P+ A+ + KTHD+ FA+RPK+  +D+  Y  TD+AFSPYG YWRQ+RKIC LELLS+K 
Sbjct  88    TPECAKEVMKTHDINFATRPKLPTVDVFSYNCTDIAFSPYGYYWRQLRKICTLELLSLKR  147

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V SF   R++ELSNLV  I   SE G P NLT+ +     ++I++ AFG+   +DQ  FI
Sbjct  148   VNSFQPIREDELSNLVKWI--DSEKGSPINLTQALLSSIYTIISRSAFGKK-YKDQENFI  204

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
              ++K+ + +AGGFD+GDLFPS  W+ + +GM+P+L +LH + D I + II +HKE   + 
Sbjct  205   TVVKKSMKVAGGFDIGDLFPSATWLQHVTGMRPELERLHQQTDHIMENIINEHKEAK-SK  263

Query  873   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
             + +   + ED+VDVL++ ++G +  F +T  NIKA+I D+F  G ETSATTI WAM+E++
Sbjct  264   AKDHEREPEDLVDVLIQYEDGSKQDFSLTRTNIKAIILDIFGAGGETSATTIDWAMAEIM  323

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
                 VM KAQAEVR+        D+  +  L YLKLV+KETLRLHPPLPL+ PRE  +  
Sbjct  324   NDSRVMKKAQAEVREVFNMKGRVDENCINELKYLKLVVKETLRLHPPLPLLLPRECGKTC  383

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
             +I  Y IP K++VI+N WA+  +   W +PERF PERF +S++D+ GN++E+IPFGAGRR
Sbjct  384   EIHGYNIPAKSKVIVNVWAIGRDSNYWTEPERFYPERFIDSTIDYKGNNFEYIPFGAGRR  443

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
             +CPG  FA   + ++LA LLYHF+W+LP G+  ++LDM+E  G+   +K DL L+  P++
Sbjct  444   ICPGSIFASRVVEVTLAMLLYHFDWKLPSGMISEELDMSEEFGITVRRKHDLFLVPFPYI  503

Query  1593  DL  1598
              L
Sbjct  504   PL  505



>ref|XP_010910161.1| PREDICTED: premnaspirodiene oxygenase-like [Elaeis guineensis]
Length=494

 Score =   476 bits (1225),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 246/473 (52%), Positives = 331/473 (70%), Gaps = 8/473 (2%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             K PPGPWKLP+IGS+HHL+G SLPH SLRNLS ++GP+M L+LGE++T+V+SSP+ AR I
Sbjct  29    KFPPGPWKLPIIGSIHHLLG-SLPHHSLRNLSFRHGPLMLLKLGEVNTLVVSSPEAAREI  87

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHD+ FA+RP  +   +  Y   D+ F+PYGDYWR +RK+CVLELLS K V+SF + R
Sbjct  88    MKTHDITFANRPMPIGSKMASYGGKDLIFAPYGDYWRDLRKMCVLELLSAKRVQSFQAIR  147

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             +EE+ NL+ SI     T    NL++K+    + +I +   G  C +DQ  FI  L +++ 
Sbjct  148   EEEVHNLIRSISSMKTTSSLVNLSQKLFMLNNDIIMRAVVGNRC-KDQNTFILALTEMIK  206

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  896
             LAGGF L DLFPS   I   + M  KL +   ++  I D II DH+E   A        +
Sbjct  207   LAGGFGLADLFPSSLLISRINMMASKLPRYQQKVGGILDDIIHDHQERKKAKLV-----E  261

Query  897   EDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1073
             ED++DVLLR++E GG    P+T D IKAVI DMF  GTETS+TT+ WAM+E++K P V+ 
Sbjct  262   EDLLDVLLRIREEGGLPSTPLTLDEIKAVILDMFGAGTETSSTTLDWAMAELMKNPKVLK  321

Query  1074  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1253
             +AQAEVR+ L       + ++ ++ YLKLVIKETLRLHPP+PL+ PRES E  ++  Y I
Sbjct  322   RAQAEVRELLCRKTMVTESEISDINYLKLVIKETLRLHPPVPLLVPRESRERVEVLGYEI  381

Query  1254  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1433
             P K RV++NAWAL  +P+ W+D E F PERF+ S++DF G ++EF+PFGAGRR+CPGISF
Sbjct  382   PEKVRVLVNAWALGRDPQIWDDAEEFKPERFDGSTIDFKGTNFEFVPFGAGRRICPGISF  441

Query  1434  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1592
             A  ++ L+LA LLY+FNWELPDG+ P DLDM E+ G+ + +K +LCL A P V
Sbjct  442   ALANVELTLACLLYYFNWELPDGMEPSDLDMAESFGMTSRRKLELCLRAIPVV  494



>ref|XP_008778208.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=515

 Score =   477 bits (1227),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 242/493 (49%), Positives = 349/493 (71%), Gaps = 18/493 (4%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K+  +   K+PP P KLP+IG LH+L+G ++PHR+  NLSR+YGP+MHL+LG++  ++IS
Sbjct  23    KAAKSTAMKMPPSPPKLPIIGHLHYLLG-NIPHRAFGNLSRRYGPVMHLKLGQVDHVIIS  81

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP+ AR I KTHDL+FA+RP+++  + VF+  TD+AF+PYG+YWRQ+RKIC++ELLS K 
Sbjct  82    SPEAAREIMKTHDLIFATRPRLLIAE-VFHNCTDIAFAPYGNYWRQLRKICIVELLSTKR  140

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             VKS+ + +QEE+SNL+  I + +++  P NL+EK+   T+ +IA++AFG  C   Q  FI
Sbjct  141   VKSYATLQQEEISNLMGDISMMNKS--PVNLSEKLFVLTNDVIARIAFGNTCKHGQS-FI  197

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  872
             +  K++++LA GF + DLFPS  +I   SG++  L  L  E+D+I + II +H+E   A 
Sbjct  198   SACKKMMALASGFCVADLFPSLSFIDTLSGLRSALENLRREMDEIIEEIIKEHQEKRAAT  257

Query  873   STNSSG--KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
              +N     ++ED+VDVLL +KE G L+FP+T+ NIKAVI DMF  GTET++TT++WAM+E
Sbjct  258   ISNKGDDQREEDLVDVLLGLKENGGLEFPLTDTNIKAVIMDMFIAGTETASTTMVWAMAE  317

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             +++ P +M KAQAEVR+ LKG    ++ D+    Y+KLVIKETLRLHPPLPL  PR   +
Sbjct  318   LMRHPEMMEKAQAEVRRVLKGRAKIEEGDMREFHYMKLVIKETLRLHPPLPLQLPRVCTK  377

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPER-----------FLPERFENSSVDFMG  1373
               ++  Y IP  +RV+INAWA+  +P+ WEDPER           F P++F+ SSVD  G
Sbjct  378   SCQVDGYDIPVGSRVMINAWAIGRDPKYWEDPERRDPRYWEDPEKFKPQKFDGSSVDHTG  437

Query  1374  NHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIAS  1553
             N +E +PFG GRR+CPG++F    + L L+ LLY+F+W+LP+G+ P D++MTE  G    
Sbjct  438   NSFELLPFGRGRRICPGMNFGLAEMELILSHLLYYFDWKLPNGMGPNDVEMTETFGAAVG  497

Query  1554  KKKDLCLIARPFV  1592
             +K  LCLIA P V
Sbjct  498   RKSPLCLIATPCV  510



>ref|XP_003530792.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
Length=512

 Score =   476 bits (1226),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 241/471 (51%), Positives = 339/471 (72%), Gaps = 5/471 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             K+P GP KLP+IG++++L+  S PHR LR+++ KYGP+M+LQLGE+STIVISSP+ A+ +
Sbjct  37    KIPDGPRKLPIIGNIYNLLS-SQPHRKLRDMALKYGPLMYLQLGEVSTIVISSPECAKEV  95

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHD+ FA+RPK++A+DI+ Y ST++AF+PYG+YWRQ+RKIC LELLS+K V S+   R
Sbjct  96    MKTHDINFATRPKVLAIDIMSYNSTNIAFAPYGNYWRQLRKICTLELLSLKRVNSYQPIR  155

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             +EELSNLV  I   S  G   NLT+ V     ++ ++ AFG+ C +DQ KFI+++K+   
Sbjct  156   EEELSNLVKWI--DSHKGSSINLTQAVLSSIYTIASRAAFGKKC-KDQEKFISVVKKTSK  212

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  896
             LA GF + DLFPS  W+ + +G++PK+ +LH + D+I + II +HKE       N S + 
Sbjct  213   LAAGFGIEDLFPSVTWLQHVTGVRPKIERLHQQADQIMENIINEHKEAKSKAKGNQS-EA  271

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             ED+VDVL++ ++G +  F +T +NIKA+I D+F  G ETSATTI WAM+EM+K   VM K
Sbjct  272   EDLVDVLIQYEDGSKPDFSLTRNNIKAIILDIFGAGGETSATTIDWAMAEMVKNSGVMKK  331

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQAEVR+        D+  +  L YLK V+KETLRLHPP+PL+ PRE     +I  Y IP
Sbjct  332   AQAEVREVFNMKGRVDENCINELKYLKQVVKETLRLHPPIPLLLPRECGHTCEIQGYKIP  391

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              K++V+INAWA+  +P  W +PERF PERF +S++++ GN +E+IPFGAGRR+CPG +FA
Sbjct  392   AKSKVVINAWAIGRDPNYWTEPERFYPERFIDSTIEYKGNDFEYIPFGAGRRICPGSTFA  451

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
                I L+LA LLYHF+W+LP G+  ++LDM+E  GV   +K DL L+  P+
Sbjct  452   SRIIELALAMLLYHFDWKLPSGIICEELDMSEEFGVAVRRKDDLFLVPFPY  502



>gb|KDO37182.1| hypothetical protein CISIN_1g010699mg [Citrus sinensis]
Length=503

 Score =   476 bits (1225),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 237/474 (50%), Positives = 329/474 (69%), Gaps = 4/474 (1%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
             K  LPPGPWKLP+IG+LH L    LPHR L +L+++YGP+MHL+LGE+ TIV+SSP  A+
Sbjct  27    KLNLPPGPWKLPIIGNLHQLARYELPHRGLADLAKQYGPLMHLRLGEVCTIVVSSPDYAK  86

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              IT THDLVFASRP + A  I+ Y  +D+AF+PYG YWR ++KICV ELL +K V+SF S
Sbjct  87    EITTTHDLVFASRPHVPAAQILSYDFSDIAFAPYGPYWRTLKKICVTELLGVKRVQSFRS  146

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R+EE++NLV  I   S+ G   NLTEKV     S+ ++ AFG+  +ED   F A++ + 
Sbjct  147   IREEEVTNLVDWI--GSKAGSVVNLTEKVFLLMCSITSRAAFGKK-NEDIEAFQAVVSEA  203

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
               +  G  + DL+PS K++   +G+K K+ ++H++ DKI   I+ DHK+     S +   
Sbjct  204   TEMFAGSSIADLYPSIKFLLALTGVKAKMQRMHNKTDKILSKIVEDHKKRRAMRSKSGKK  263

Query  891   KD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
             ++ ED+VDVLL+ +E G L+FP+T  N+KAV+ D+FS GTETSATT+ WAMS ++K P  
Sbjct  264   EEVEDLVDVLLKAQEDGNLEFPLTTKNVKAVVMDVFSAGTETSATTVDWAMSLLMKYPKT  323

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             M KAQ EVR+        D+  LE + YLKLVIKETLR+HP  P++ PRE  E   I  Y
Sbjct  324   MKKAQDEVREVFNRRGKVDEAALEEMKYLKLVIKETLRIHPSAPMLFPRECAETCNINGY  383

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP K +V++N WA+  + + W +PE F+PERF +S +DF G ++EF+PFGAGRRMCPG+
Sbjct  384   DIPAKAQVLVNVWAMTRDSKYWTEPESFIPERFLDSPIDFKGANFEFLPFGAGRRMCPGM  443

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             ++A  +I L LA  LYHF+W+LP+G+  +DLDMTE  GV   +K++LCLI  P+
Sbjct  444   TYANANIELPLAMFLYHFDWKLPNGMKNEDLDMTEGFGVTVKRKQNLCLIPTPY  497



>gb|KHM99472.1| Cytochrome P450 71D11 [Glycine soja]
Length=508

 Score =   476 bits (1225),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 241/471 (51%), Positives = 339/471 (72%), Gaps = 5/471 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             K+P GP KLP+IG++++L+  S PHR LR+++ KYGP+M+LQLGE+STIVISSP+ A+ +
Sbjct  37    KIPDGPRKLPIIGNIYNLLS-SQPHRKLRDMALKYGPLMYLQLGEVSTIVISSPECAKEV  95

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHD+ FA+RPK++A+DI+ Y ST++AF+PYG+YWRQ+RKIC LELLS+K V S+   R
Sbjct  96    MKTHDINFATRPKVLAIDIMSYNSTNIAFAPYGNYWRQLRKICTLELLSLKRVNSYQPIR  155

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             +EELSNLV  I   S  G   NLT+ V     ++ ++ AFG+ C +DQ KFI+++K+   
Sbjct  156   EEELSNLVKWI--DSHKGSSINLTQAVLSSIYTIASRAAFGKKC-KDQEKFISVVKKTSK  212

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  896
             LA GF + DLFPS  W+ + +G++PK+ +LH + D+I + II +HKE       N S + 
Sbjct  213   LAAGFGIEDLFPSVTWLQHVTGVRPKIERLHQQADQIMENIINEHKEAKSKAKGNQS-EA  271

Query  897   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1076
             ED+VDVL++ ++G +  F +T +NIKA+I D+F  G ETSATTI WAM+EM+K   VM K
Sbjct  272   EDLVDVLIQYEDGSKPDFSLTRNNIKAIILDIFGAGGETSATTIDWAMAEMVKNSGVMKK  331

Query  1077  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1256
             AQAEVR+        D+  +  L YLK V+KETLRLHPP+PL+ PRE     +I  Y IP
Sbjct  332   AQAEVREVFNMKGRVDENCINELKYLKQVVKETLRLHPPIPLLLPRECGHTCEIQGYKIP  391

Query  1257  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1436
              K++V+INAWA+  +P  W +PERF PERF +S++++ GN +E+IPFGAGRR+CPG +FA
Sbjct  392   AKSKVVINAWAIGRDPNYWTEPERFYPERFIDSTIEYKGNDFEYIPFGAGRRICPGSTFA  451

Query  1437  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
                I L+LA LLYHF+W+LP G+  ++LDM+E  GV   +K DL L+  P+
Sbjct  452   SRIIELALAMLLYHFDWKLPSGIICEELDMSEEFGVAVRRKDDLFLVPFPY  502



>ref|XP_004295869.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   476 bits (1224),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 240/481 (50%), Positives = 339/481 (70%), Gaps = 7/481 (1%)
 Frame = +3

Query  150   AKSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
              K+K+++   LPPGP +LP IG++H L  GSLPHRSLRNL+ KYGP+MHL+LGEIST+V+
Sbjct  28    GKTKSSSSN-LPPGPRELPFIGNIHQL-AGSLPHRSLRNLANKYGPLMHLRLGEISTVVV  85

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SS + AR + KTHD+ FA+RP ++A DIV Y  T++ F+ YGDYWRQ+RKIC LE+LS K
Sbjct  86    SSAEFAREVMKTHDVTFATRPYLLAADIVNYNCTNIVFAKYGDYWRQLRKICTLEVLSPK  145

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V+S+   R+EE+ NL+  I  +S+   P NLTEK+   T ++  + AFG+  S+   +F
Sbjct  146   RVQSYRPIREEEMLNLIKWI--ASKARSPINLTEKIYSSTYTITTRAAFGKK-SKYHEEF  202

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I  +K+ + L GGFDL D+FPS + +H  +G++PKL +LH + D+I + II + ++   +
Sbjct  203   IDCVKEGIQLGGGFDLADVFPSYRLLHMITGLRPKLERLHKKTDRILENIIKELRDKETS  262

Query  870   NSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
                 S  + E +++VLL+  E  G L+F +T DNIKAV+ D+F+ G+ETSAT + WAMSE
Sbjct  263   KGGESETQ-EHLIEVLLKFHEDNGSLEFTLTTDNIKAVMMDIFAAGSETSATAVDWAMSE  321

Query  1047  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1226
             M+K P +M +AQ EVR+         +  ++ + YL  +IKETLRLHP  PL+ PRE  E
Sbjct  322   MVKNPQIMKRAQDEVREVFNKLGHVSETGIKEMKYLNSIIKETLRLHPSAPLLIPRECRE  381

Query  1227  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1406
               +IG Y IP KT+V++N WA+  +P+ W +PERF P+RF +SSVDF G  +EFIPFGAG
Sbjct  382   TCEIGGYEIPVKTKVVVNGWAIGRDPKYWTEPERFYPDRFLDSSVDFRGTDFEFIPFGAG  441

Query  1407  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1586
             RRMCPGI++   ++ L LA LLYHF+W+LPDG   +DLDMTEA G+   +K++LCLI  P
Sbjct  442   RRMCPGITYGLANVDLPLAMLLYHFDWKLPDGKKHEDLDMTEAFGITVGRKENLCLIPIP  501

Query  1587  F  1589
             +
Sbjct  502   Y  502



>gb|AFP19100.1| amorphadiene oxidase [Artemisia annua]
Length=488

 Score =   475 bits (1222),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 339/474 (72%), Gaps = 11/474 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +++ + +K  P PW+LP+IG +HHL+G + PHR +R+L+RKYG +MHLQLGE+ TIV+SS
Sbjct  23    TRSKSTKKSLPEPWRLPIIGHMHHLIGTT-PHRGVRDLARKYGSLMHLQLGEVPTIVVSS  81

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P+ A+ I  T+D+ FA+RP+ +  +IV Y +TDV  +PYG+YWRQ+RKIC LELLS+K V
Sbjct  82    PKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKV  141

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF S R+EE  NLV  I+ +S +G P NL+E V    ++++++ AFG+   +DQ +   
Sbjct  142   KSFQSLREEECWNLVQEIK-ASGSGRPVNLSENVFKLIATILSRAAFGKGI-KDQKELTE  199

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D + D ++ +H  N     
Sbjct  200   IVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLIDNLVAEHTVN-----  254

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
               SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT+TS++TI WA+SE+IK
Sbjct  255   -TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGTDTSSSTIEWAISELIK  311

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLHPPLPL+ PRE  +   
Sbjct  312   CPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLHPPLPLVLPRECRQPVN  371

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   MG  YE++PFGAGRRM
Sbjct  372   LAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATVMGAEYEYLPFGAGRRM  431

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             CPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G    +K +L L+
Sbjct  432   CPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGATMQRKAELLLV  485



>gb|ABE57266.1| amorpha-4,11-diene monooxygenase [Artemisia annua]
Length=488

 Score =   475 bits (1222),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 339/474 (72%), Gaps = 11/474 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +++ + +K  P PW+LP+IG +HHL+G + PHR +R+L+RKYG +MHLQLGE+ TIV+SS
Sbjct  23    TRSKSTKKSLPEPWRLPIIGHMHHLIGTT-PHRGVRDLARKYGSLMHLQLGEVPTIVVSS  81

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P+ A+ I  T+D+ FA+RP+ +  +IV Y +TDV  +PYG+YWRQ+RKIC LELLS+K V
Sbjct  82    PKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKV  141

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF S R+EE  NLV  I+ +S +G P NL+E V    ++++++ AFG+   +DQ +   
Sbjct  142   KSFQSLREEECWNLVQEIK-ASGSGRPVNLSENVFKLIATILSRAAFGKGI-KDQKELTE  199

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D + D ++ +H  N     
Sbjct  200   IVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLIDNLVAEHTVN-----  254

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
               SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT+TS++TI WA+SE+IK
Sbjct  255   -TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGTDTSSSTIEWAISELIK  311

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLHPPLPL+ PRE  +   
Sbjct  312   CPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLHPPLPLVLPRECRQPVN  371

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   MG  YE++PFGAGRRM
Sbjct  372   LAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATVMGAEYEYLPFGAGRRM  431

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             CPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G    +K +L L+
Sbjct  432   CPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGATMQRKTELLLV  485



>gb|KHN36164.1| Cytochrome P450 71D8 [Glycine soja]
Length=503

 Score =   475 bits (1223),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 239/475 (50%), Positives = 333/475 (70%), Gaps = 6/475 (1%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             K  ++ KLPP PW+LP+IG+LH L +  SLP ++L+ L RKYGP+MHLQLGEIST+V+SS
Sbjct  26    KQKSRYKLPPSPWRLPIIGNLHQLALAASLPDQALQKLVRKYGPLMHLQLGEISTLVVSS  85

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P++A  + KTHD+ F  RP+++A   + Y +TD+ F+PYGDYWRQ+RKIC LELLS K V
Sbjct  86    PKMAMEVMKTHDVHFVQRPQLLAPQFMVYGATDIVFAPYGDYWRQIRKICTLELLSAKRV  145

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF   RQ+E   L+ SI   S  G   +L+ K+     + +++ AFG+  ++DQ + ++
Sbjct  146   QSFSHIRQDENRKLIQSIH--SSAGSSIDLSGKLFSLLGTTVSRAAFGKE-NDDQDELMS  202

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH-LAN  872
             L+++ +++ GGF+L D+FPS K +H  +  K K+  +H   DKI + I+  H E   +  
Sbjct  203   LVRKAITMTGGFELDDMFPSLKPLHLLTRQKAKVEHVHQRADKILEDILRKHMEKRTIGK  262

Query  873   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
               ++  + ED+VDVLLR+KE G L+ P+T +NIKAVI ++F++GT+T A+T+ WAMSEM+
Sbjct  263   EGSNEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVIWNIFASGTDTPASTLEWAMSEMM  322

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             K P V  KAQAE+RQ  KG +   + DLE L+YLK VIKETLRLHPP  LI   E ++  
Sbjct  323   KNPRVREKAQAELRQTFKGKEIIRETDLEELSYLKSVIKETLRLHPPSQLIPR-ECIKST  381

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
              I  Y IP KT+V+IN WA+  +P+ W D ERF+PERF++SS+DF GN +E+IPFGAGRR
Sbjct  382   NIDGYDIPIKTKVMINTWAIGRDPQYWSDAERFIPERFDDSSIDFKGNSFEYIPFGAGRR  441

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             MCPGI+F   SI L LA +LYHFNWELP+ + P DLDM E  G+   +K  L LI
Sbjct  442   MCPGITFGLASITLPLALILYHFNWELPNKMKPADLDMDELFGLTVVRKNKLFLI  496



>gb|AFO64615.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=488

 Score =   474 bits (1221),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 339/474 (72%), Gaps = 11/474 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +++ + +K  P PW+LP+IG +HHL+G + PHR +R+L+RKYG +MHLQLGE+ TIV+SS
Sbjct  23    TRSKSTKKSLPEPWRLPIIGHMHHLIGTT-PHRRVRDLARKYGSLMHLQLGEVPTIVVSS  81

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P+ A+ I  T+D+ FA+RP+ +  +IV Y +TDV  +PYG+YWRQ+RKIC LELLS+K V
Sbjct  82    PKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKV  141

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF S R+EE  NLV  I+ +S +G P NL+E V    ++++++ AFG+   +DQ +   
Sbjct  142   KSFQSLREEECWNLVQEIK-ASGSGRPVNLSENVFKLIATILSRAAFGKGI-KDQKELTE  199

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D + D ++ +H  N     
Sbjct  200   IVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLIDNLVAEHTVN-----  254

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
               SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT+TS++TI WA+SE+IK
Sbjct  255   -TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGTDTSSSTIEWAISELIK  311

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLHPPLPL+ PRE  +   
Sbjct  312   CPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLHPPLPLVLPRECRQPVN  371

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   MG  YE++PFGAGRRM
Sbjct  372   LAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATVMGAEYEYLPFGAGRRM  431

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             CPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G    +K +L L+
Sbjct  432   CPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGATMQRKTELLLV  485



>ref|XP_002522762.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39613.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   475 bits (1223),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 245/483 (51%), Positives = 332/483 (69%), Gaps = 6/483 (1%)
 Frame = +3

Query  147   WAKSKAA-AKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W KSK       LPPGPWKLPLIGS+HHLVG S PH  L++L++KYGP+MHLQLGE++ I
Sbjct  25    WKKSKTNHPAPHLPPGPWKLPLIGSMHHLVG-SQPHHRLKDLAKKYGPLMHLQLGELTNI  83

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             VISSP++A+ + KTHD+VFA RP ++A  +  Y  TD+AF+PYGDYWRQMRK+C LELL+
Sbjct  84    VISSPEIAKEVMKTHDVVFAQRPHLLAASVTSYNYTDIAFAPYGDYWRQMRKLCTLELLT  143

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF S R+EE+S L+ S+  S+  G P N +   +  T S+I++ +FG++   ++ 
Sbjct  144   AKRVQSFRSIREEEVSRLMRSLSSSA--GSPINFSRMFNSLTYSIISRASFGKIWKGEE-  200

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
              FI ++K+++  AGGF L D++PS K +H+ SGM P+L ++HH +D IF  II DH+   
Sbjct  201   IFIPIVKKLIVAAGGFTLADVYPSVKLLHWISGMAPRLKRIHHIVDNIFQNIIDDHRTKR  260

Query  864   LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
              A +++  G+  D+VDVLL  +   +L  PIT DNIK +I D F  G+ETS+TT  WAMS
Sbjct  261   AAANSSVEGEG-DLVDVLLNFQAQEDLAVPITNDNIKGIILDTFVAGSETSSTTAEWAMS  319

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             E++K P VM KAQ EVR+         +  L  L YLK VI ETLRLHPP+PL+ PRE  
Sbjct  320   ELLKNPRVMEKAQEEVRRVFGEEGNVHEGRLHELNYLKWVINETLRLHPPIPLLLPRECR  379

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             E   I  Y IP K++VI+N WA+  +P  W D E+F PERF++  +D+ G H+EF+PFGA
Sbjct  380   ESCVINGYDIPVKSKVIVNVWAIGRDPNCWMDAEKFYPERFQDCPIDYKGTHFEFLPFGA  439

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1583
             GRRMCPGI F   ++   LA LLYHF+W+LP GV P+  DMTE  G +  +K DL +I  
Sbjct  440   GRRMCPGILFGIINVEFPLAQLLYHFDWKLPTGVKPETFDMTEDFGAVVKRKSDLYVIPM  499

Query  1584  PFV  1592
             PF+
Sbjct  500   PFL  502



>gb|ABC41927.1| amorpha-4,11-diene monooxygenase [Artemisia annua]
Length=488

 Score =   474 bits (1221),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 233/474 (49%), Positives = 339/474 (72%), Gaps = 11/474 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +++ + +K  P PW+LP+IG +HHL+G + PHR +R+L+RKYG +MHLQLGE+ TIV+SS
Sbjct  23    TRSKSTKKSLPEPWRLPIIGHMHHLIGTT-PHRGVRDLARKYGSLMHLQLGEVPTIVVSS  81

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P+ A+ I  T+D+ FA+RP+ +  +IV Y +TDV  +PYG+YWRQ+RKIC LELLS+K V
Sbjct  82    PKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKV  141

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF S R+EE  NLV  I+ +S +G P NL+E +    ++++++ AFG+   +DQ +   
Sbjct  142   KSFQSLREEECWNLVQEIK-ASGSGRPVNLSENIFKLIATILSRAAFGKGI-KDQKELTE  199

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D + D ++ +H  N     
Sbjct  200   IVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLIDNLVAEHTVN-----  254

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
               SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT+TS++TI WA+SE+IK
Sbjct  255   -TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGTDTSSSTIEWAISELIK  311

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLHPPLPL+ PRE  +   
Sbjct  312   CPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLHPPLPLVLPRECRQPVN  371

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   MG  YE++PFGAGRRM
Sbjct  372   LAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATVMGAEYEYLPFGAGRRM  431

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             CPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G    +K +L L+
Sbjct  432   CPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGATMQRKTELLLV  485



>ref|XP_004512033.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=510

 Score =   475 bits (1223),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 245/480 (51%), Positives = 339/480 (71%), Gaps = 6/480 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVG-GSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             + K K    + LPPGP KLP IG+LH +   GSLPHR+ + L+ KYGPIMHL+LG+IS +
Sbjct  25    FYKLKTFGYKLLPPGPTKLPFIGNLHQIASLGSLPHRAFQQLAHKYGPIMHLKLGQISAV  84

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             VI+SP+LA+ I KTHD+ FA+RP + +  I+ Y S D+AFSPYGDY+RQMRKIC+LELLS
Sbjct  85    VITSPKLAKEILKTHDITFANRPNLESAHIMTYGSIDIAFSPYGDYYRQMRKICMLELLS  144

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K V+SF   R++E +  +  I+  S  G   NLT ++    SS +++ AFG   +EDQ 
Sbjct  145   AKRVQSFSYIREDETNKFIELIK--SSEGSEVNLTNRIFSLVSSTVSRSAFGDK-TEDQD  201

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWI-HYTSGMKPKLLKLHHELDKIFDIIIGDHKEN  860
             +F++++++ +   GG +  DLFPS K+I H  +G K KL K+H + DKI +II+  H+E 
Sbjct  202   EFVSVIRKAIESVGGLEPADLFPSFKYIIHVLTGNKSKLEKMHKQADKILEIIVSKHQEK  261

Query  861   HLANSTNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
                   + S ++ ED+VDVLLRV++ G L  PIT  NIKAVI D F+ GT+T+ +TI WA
Sbjct  262   QRRKKLDGSDEEQEDLVDVLLRVQQSGTLDIPITTSNIKAVIFDAFAAGTDTTTSTITWA  321

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             M+E++K P VM K Q+E+R A KG +   + D+++L YLKLVIKETLRLH P PL+ PRE
Sbjct  322   MAELMKNPRVMEKLQSELRDACKGKEIITEVDVQDLPYLKLVIKETLRLHSPTPLLLPRE  381

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
             S +   IG Y IP KT+V++N WA+A +P  W D E F+PERF+++S+D+ GNH+E++PF
Sbjct  382   STQLTNIGGYDIPKKTKVMVNVWAMARDPYYWNDAEMFIPERFDSNSIDYKGNHFEYLPF  441

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GAGRR+CPG+SF    I L LA L YHF+W+LP+ + P+DLDMTE  G+   +K DLCLI
Sbjct  442   GAGRRICPGMSFGIAGIMLPLALLFYHFDWKLPNQMKPQDLDMTEHYGLAIGRKIDLCLI  501



>ref|XP_010061478.1| PREDICTED: cytochrome P450 71D9-like [Eucalyptus grandis]
 gb|KCW68420.1| hypothetical protein EUGRSUZ_F02072 [Eucalyptus grandis]
Length=507

 Score =   475 bits (1222),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 239/474 (50%), Positives = 329/474 (69%), Gaps = 7/474 (1%)
 Frame = +3

Query  177   KLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAI  356
             KLPPGPWKLP+IG++H L GG LPHR+L  L++KYGP+MHL++GE+ST+V SS + A+ +
Sbjct  36    KLPPGPWKLPIIGNMHQL-GGPLPHRTLSELAKKYGPLMHLKMGEVSTVVFSSLETAKEV  94

Query  357   TKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  536
              KTHD++FASRP I+A  I+ Y  T + F+PYG+YWRQ+RKIC+LELLS K V S+ S R
Sbjct  95    LKTHDVIFASRPPILASSIISYDCTSITFAPYGEYWRQLRKICILELLSSKRVLSYRSIR  154

Query  537   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  716
             ++E+ N+V  I  ++  G   NLTEK+      + ++ AFG+ C E Q +FI ++K+ + 
Sbjct  155   EDEMLNMVRWI--AARAGMTINLTEKIYSSQYGMTSRAAFGKKCKE-QDRFIGVVKEAIK  211

Query  717   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  893
              AGGF + DLFPS K +H  SGM+PK+ KLH E D++ + II +H+ N   N +    + 
Sbjct  212   FAGGFGIADLFPSVKLLHVMSGMRPKIEKLHQESDRMLEDIIREHRNNRSENKSGDQRED  271

Query  894   -DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
              DED+VDVLL+ +  G+ +  +T +NIKAVI D+FS G+ET AT   W MSE++K P +M
Sbjct  272   GDEDLVDVLLKFQNQGDQELSLTTENIKAVILDIFSAGSETPATAADWIMSELVKNPKIM  331

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
             AKAQ EVRQ        D+  +  L YLK V+KE LRLHPP+PL+ PRE  +  ++  Y 
Sbjct  332   AKAQKEVRQVFGKRGKADEAGVAELKYLKSVVKEGLRLHPPVPLLLPRECSQVCEVNGYT  391

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERF-ENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
             IP KT+ IINAWAL  +P+ W DPE F P+RF ++SSVD+ GN  E+IPFGAGRR+CPG+
Sbjct  392   IPVKTKGIINAWALGRDPKYWRDPEVFDPDRFWDDSSVDYKGNCLEYIPFGAGRRICPGM  451

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             +F    + L +A LLYHF+W LP G+  +DLDMTE   V   ++ DL LI  P+
Sbjct  452   TFGLAQVELQIAVLLYHFDWTLPGGMRNEDLDMTEGFAVTVKRRDDLFLIPTPY  505



>sp|Q1PS23.1|AMO_ARTAN RecName: Full=Amorpha-4,11-diene 12-monooxygenase; AltName: Full=Amorpha-4,11-diene 
C-12 oxidase; AltName: Full=Cytochrome 
P450 71AV1 [Artemisia annua]
 gb|ABB82944.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
 gb|AEQ63684.1| amorpha-4,11-diene oxidase [synthetic construct]
Length=495

 Score =   474 bits (1220),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 339/474 (72%), Gaps = 11/474 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +++ + +K  P PW+LP+IG +HHL+G + PHR +R+L+RKYG +MHLQLGE+ TIV+SS
Sbjct  30    TRSKSTKKSLPEPWRLPIIGHMHHLIGTT-PHRGVRDLARKYGSLMHLQLGEVPTIVVSS  88

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P+ A+ I  T+D+ FA+RP+ +  +IV Y +TDV  +PYG+YWRQ+RKIC LELLS+K V
Sbjct  89    PKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKV  148

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF S R+EE  NLV  I+ +S +G P NL+E V    ++++++ AFG+   +DQ +   
Sbjct  149   KSFQSLREEECWNLVQEIK-ASGSGRPVNLSENVFKLIATILSRAAFGKGI-KDQKELTE  206

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D + D ++ +H  N     
Sbjct  207   IVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLIDNLVAEHTVN-----  261

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
               SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT+TS++TI WA+SE+IK
Sbjct  262   -TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGTDTSSSTIEWAISELIK  318

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLHPPLPL+ PRE  +   
Sbjct  319   CPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLHPPLPLVLPRECRQPVN  378

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   MG  YE++PFGAGRRM
Sbjct  379   LAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATVMGAEYEYLPFGAGRRM  438

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             CPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G    +K +L L+
Sbjct  439   CPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGATMQRKTELLLV  492



>ref|XP_006364814.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=526

 Score =   475 bits (1223),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 245/470 (52%), Positives = 342/470 (73%), Gaps = 8/470 (2%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             LPPGPWKLP IGS+HHL+   LPH +LR+L++K+GP+MHLQLGEI TIVISSP++A+ + 
Sbjct  55    LPPGPWKLPFIGSIHHLIASQLPHHTLRDLAKKHGPLMHLQLGEIPTIVISSPRVAQEVL  114

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD+ F +RP+++++ ++ Y  +D+AF+PYG+YWRQMRK+C LELLS K V SF S R+
Sbjct  115   KTHDIAFTNRPELLSVKVLTYNCSDIAFAPYGNYWRQMRKLCTLELLSAKNVVSFASIRE  174

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EE  NLV  +   S++G   NLTEK+   T+++I + AFG+   E+   F++L+K++  +
Sbjct  175   EEALNLVQYVE--SKSGSIINLTEKIYALTNAVICRAAFGKRRKEESVYFMSLIKELSLM  232

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
               G D+ ++FPS K++   +G K KLLKLH + DK+ D+II +HK  +       S +  
Sbjct  233   VSGLDISEVFPSLKFLQVITGTKEKLLKLHKKFDKVLDMIIEEHKHKY---DEEESSRKN  289

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+V++LL+++E G L F  T DNIKAVI DMF  GTETSAT + WAM EM++ P VM KA
Sbjct  290   DLVNLLLKLQESGTLDFSFTADNIKAVILDMFLAGTETSATVLDWAMVEMMRNPKVMEKA  349

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             Q E+R+ LKG     + DL+ ++YLKLVIKETLRLHPPLPL+ PRE  E   I  Y IP 
Sbjct  350   QTELRRILKGKNRVTEIDLKEVSYLKLVIKETLRLHPPLPLLLPRECREHCVINGYDIPI  409

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFEN---SSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             KT+VI+NAWA+  + E WE+ E F PERF N   +S++F+G ++E++PFG GRRMCPGIS
Sbjct  410   KTKVIVNAWAINRDAEFWENAESFSPERFINCASNSLEFIGQNFEYLPFGGGRRMCPGIS  469

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             F  +++ L LA L+YHFNW+LP+G+ P+D+D+TE  G   S+K +LC+IA
Sbjct  470   FGLSNVELPLAQLIYHFNWKLPNGMKPEDVDVTETPGSSCSRKYNLCVIA  519



>ref|XP_003517259.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=503

 Score =   474 bits (1221),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 239/475 (50%), Positives = 332/475 (70%), Gaps = 6/475 (1%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHL-VGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             K  ++ KLPP PW+LP+IG+LH L +  SLP ++L+ L RKYGP+MHLQLGEIS +V+SS
Sbjct  26    KQKSRYKLPPSPWRLPIIGNLHQLALAASLPDQALQKLVRKYGPLMHLQLGEISALVVSS  85

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P++A  + KTHD+ F  RP+++A   + Y +TD+ F+PYGDYWRQ+RKIC LELLS K V
Sbjct  86    PKMAMEVMKTHDVHFVQRPQLLAPQFMVYGATDIVFAPYGDYWRQIRKICTLELLSAKRV  145

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             +SF   RQ+E   L+ SI   S  G   +L+ K+     + +++ AFG+  ++DQ + ++
Sbjct  146   QSFSHIRQDENRKLIQSIH--SSAGSSIDLSGKLFSLLGTTVSRAAFGKE-NDDQDELMS  202

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH-LAN  872
             L+++ +++ GGF+L D+FPS K +H  +  K K+  +H   DKI + I+  H E   +  
Sbjct  203   LVRKAITMTGGFELDDMFPSLKPLHLLTRQKAKVEHVHQRADKILEDILRKHMEKRTIGK  262

Query  873   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1052
               ++  + ED+VDVLLR+KE G L+ P+T +NIKAVI ++F++GT+T A+T+ WAMSEM+
Sbjct  263   EGSNEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVIWNIFASGTDTPASTLEWAMSEMM  322

Query  1053  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1232
             K P V  KAQAE+RQ  KG +   + DLE L+YLK VIKETLRLHPP  LI   E ++  
Sbjct  323   KNPRVREKAQAELRQTFKGKEIIRETDLEELSYLKSVIKETLRLHPPSQLIPR-ECIKST  381

Query  1233  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1412
              I  Y IP KT+V+IN WA+  +P+ W D ERF+PERF++SS+DF GN +E+IPFGAGRR
Sbjct  382   NIDGYDIPIKTKVMINTWAIGRDPQYWSDAERFIPERFDDSSIDFKGNSFEYIPFGAGRR  441

Query  1413  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             MCPGI+F   SI L LA LLYHFNWELP+ + P DLDM E  G+   +K  L LI
Sbjct  442   MCPGITFGLASITLPLALLLYHFNWELPNKMKPADLDMDELFGLTVVRKNKLFLI  496



>gb|AJD25162.1| cytochrome P450 CYP71D374 [Salvia miltiorrhiza]
Length=502

 Score =   474 bits (1220),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 251/478 (53%), Positives = 340/478 (71%), Gaps = 11/478 (2%)
 Frame = +3

Query  147   WAKSKAA-AKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             W K K+  A Q LPP P KLP+IG +H LVG  LPH++L+  ++K+GP+MHLQLGE+  +
Sbjct  27    WTKPKSPKAHQNLPPSPPKLPVIGHIHLLVG-DLPHKALQRQAQKHGPVMHLQLGEVPAV  85

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             VISS +  R + K  D   A RP+ +A  I++Y  TD+AFS Y +YWRQMRKIC++ELLS
Sbjct  86    VISSREATREVLKVQDPACADRPESIASKILWYDYTDIAFSAYNEYWRQMRKICIVELLS  145

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
              K VKSF   R++E S L+ S+  SS  G   +LT+K+  FTS++  + AFG+V ++  G
Sbjct  146   SKNVKSFGHIRRDESSRLMKSLECSS--GNAIDLTDKIFTFTSTITCRAAFGKVMTDRDG  203

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
               IAL K+ +++AGGF+L DLFPS K ++  S  K +L ++  +LD I D II +HK   
Sbjct  204   -LIALFKEAVAMAGGFELADLFPSWKLLNVLSWSKYRLWRMRGKLDAILDGIIDEHK---  259

Query  864   LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1043
             L  S    G  EDIVDVL+R+++ GEL+FPIT DNIKAVI DMF  GTETS+TT +WAMS
Sbjct  260   LKQSGEFGG--EDIVDVLIRMQQTGELKFPITTDNIKAVIFDMFVAGTETSSTTTVWAMS  317

Query  1044  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1223
             EM++ P VM KAQAEVR ALKG    ++ D++ L YLKLVIKET RLHPP+PL+   ++ 
Sbjct  318   EMMRNPRVMEKAQAEVRAALKGKAAVEESDVQELKYLKLVIKETFRLHPPIPLLPR-QTR  376

Query  1224  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1403
             EE K+  Y IP KT+V++N W++  +P+ WE PE+F PERFENS  DF+GN +E+IPFGA
Sbjct  377   EECKVDGYSIPIKTKVMLNIWSMGRDPQYWEQPEKFQPERFENSPKDFIGNDFEYIPFGA  436

Query  1404  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             GRR+CPG++F   +I L LA +LYHF+W+LP G+S + LDM+E  G+  S+KK L +I
Sbjct  437   GRRICPGLNFGLANIELPLAKILYHFDWKLPKGMSYERLDMSEGEGLTVSRKKPLIII  494



>dbj|BAM68808.1| cytochrome P450 monooxygenase CYP71AV1 [Artemisia annua]
Length=495

 Score =   474 bits (1219),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 339/474 (72%), Gaps = 11/474 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +++ + +K  P PW+LP+IG +HHL+G + PHR +R+L+RKYG +MHLQLGE+ TIV+SS
Sbjct  30    TRSKSTKKSLPEPWRLPIIGHMHHLIGTT-PHRGVRDLARKYGSLMHLQLGEVPTIVVSS  88

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P+ A+ I  T+D+ FA+RP+ +  +IV Y +TDV  +PYG+YWRQ+RKIC LELLS+K V
Sbjct  89    PKWAKEILTTYDISFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKV  148

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF S R+EE  NLV  I+ +S +G P NL+E V    ++++++ AFG+   +DQ +   
Sbjct  149   KSFQSLREEECWNLVQEIK-ASGSGRPVNLSENVFKLIATILSRAAFGKGI-KDQKELTE  206

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D + D ++ +H  N     
Sbjct  207   IVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLIDNLVAEHTVN-----  261

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
               SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT+TS++TI WA+SE+IK
Sbjct  262   -TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGTDTSSSTIEWAISELIK  318

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLHPPLPL+ PRE  +   
Sbjct  319   CPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLHPPLPLVLPRECRQPVN  378

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   MG  YE++PFGAGRRM
Sbjct  379   LAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATVMGAEYEYLPFGAGRRM  438

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             CPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G    +K +L L+
Sbjct  439   CPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGATMQRKTELLLV  492



>ref|XP_002522903.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39503.1| cytochrome P450, putative [Ricinus communis]
Length=532

 Score =   475 bits (1222),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 234/469 (50%), Positives = 338/469 (72%), Gaps = 5/469 (1%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             +KLPPGP KLP+IG+LH+L  G LPH +L+ L+++YGPI+HLQLGE+ST+V+S  ++A+ 
Sbjct  48    KKLPPGPMKLPIIGNLHNL-AGKLPHHALQELAKEYGPILHLQLGEVSTMVVSDGKMAKE  106

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             + KTHDL FA RP+++A DIV Y   D+AFSPYG+Y++QM+K+   ELL  K V+S+ S 
Sbjct  107   VLKTHDLNFAQRPRLLAADIVLYDGKDIAFSPYGEYYKQMKKVGAEELLGPKRVQSYSSL  166

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             R+EE+  LV S+RLS   G P N  +++   T+ ++ K AFG  C E Q   IA+     
Sbjct  167   REEEVQKLVESVRLS--LGKPINFGDRICRLTNVIVFKAAFGEECKE-QDTAIAVCVTAT  223

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK  893
             +LAGGF + D+FPS  ++H  +G K K+ ++  E+D++   I+ +H +   +   N+ G 
Sbjct  224   TLAGGFQIADVFPSLTFLHDINGFKTKVKEVAKEIDRMLSDIVEEHSKKLTSREINNDGT  283

Query  894   D-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
             + ED+VDVLL+++  G  Q  +T D+IKAVI D F  GTETS+ TI WAMSE+++ P V+
Sbjct  284   EREDLVDVLLKLQRSGRFQCEVTTDHIKAVIFDFFIAGTETSSNTIEWAMSELMRNPRVL  343

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
              KAQAEVR+A KG KT  D D+++L YL+LVIKETLRLHPPLPL+ PRE+ +   IG Y 
Sbjct  344   KKAQAEVREAFKGKKTIRDADVKDLKYLELVIKETLRLHPPLPLLLPRENKQSCAIGGYQ  403

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             IP KTR+I+NA+A+  +P++W D ++F+PERF +++VDF+G  +E+IPFG GRR+CPG++
Sbjct  404   IPAKTRMIVNAYAIGRDPKTWRDADKFIPERFLDAAVDFIGMDFEYIPFGGGRRICPGMN  463

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
                 ++ L LA LLYHF+W+LPDG++P+DLDMTE  G   ++K  L +I
Sbjct  464   LGMANMQLPLAQLLYHFDWKLPDGIAPEDLDMTETFGATITRKNKLHVI  512



>gb|KHG02344.1| Cytochrome P450 [Gossypium arboreum]
Length=512

 Score =   474 bits (1220),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 248/480 (52%), Positives = 331/480 (69%), Gaps = 11/480 (2%)
 Frame = +3

Query  153   KSKAAA-KQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVI  329
             KSKA +   +L PGP KLPLIG+LH L G +LPHR+LR+L+ KYG +MHLQLG++ST+VI
Sbjct  27    KSKARSLTHRLIPGPRKLPLIGNLHQLAGSTLPHRTLRDLATKYGAVMHLQLGQVSTVVI  86

Query  330   SSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  509
             SS ++A  I KTHD+VFASRP ++A  I+ Y+ TD+ FSPYG YWR +RKIC  ELLS  
Sbjct  87    SSAEMAEEIMKTHDIVFASRPLLLAAKIITYECTDIVFSPYGKYWRNLRKICTSELLSAS  146

Query  510   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  689
              V SF S R+EE+ NLV +I+  S  G   NL++KV   T  + A+ AFG+ C + Q  F
Sbjct  147   RVASFRSIREEEVLNLVKTIK--SNDGLAVNLSQKVFSMTYGITARAAFGKKC-KYQDSF  203

Query  690   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  869
             I++      L  GF + + FPS +++   SG+K ++ K H E D+I   I+ DHKE+   
Sbjct  204   ISVAADQTKLVSGFFVSEFFPSLQFLDVASGVKYRVEKTHAEADRILQSIVNDHKESRAR  263

Query  870   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1049
                 S    ED+VD+LLR++E  E  FP+T++N+KA+I D+F+ G+ETSA+T+ WA+SEM
Sbjct  264   G--RSKDDREDLVDLLLRLQEDDE--FPLTDNNVKAIILDIFTAGSETSASTVEWALSEM  319

Query  1050  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1229
             IK P VM KAQAEVRQ  +G    D+  +  L YLK VIKETLRLHP LPL+ PRE  + 
Sbjct  320   IKNPRVMTKAQAEVRQVFQGKGNVDETGIHQLQYLKCVIKETLRLHPILPLLLPRECGKN  379

Query  1230  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1409
              +I  + IP KTRVIINAWA+  +P  W  PE+F PERF NSSVDF+G ++EFIPFGAGR
Sbjct  380   CEINGFEIPSKTRVIINAWAIGRDPNHWAQPEKFEPERFINSSVDFLGTNFEFIPFGAGR  439

Query  1410  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             R+CPGI FA  ++ L LA LL+HF+W+LP     +D+DMTE   +   +K DL L+  P+
Sbjct  440   RICPGILFAVPNLELPLAQLLFHFDWKLP---KQEDIDMTEEFALSVRRKTDLVLVPTPY  496



>ref|XP_004304108.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=516

 Score =   474 bits (1221),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 236/476 (50%), Positives = 336/476 (71%), Gaps = 8/476 (2%)
 Frame = +3

Query  165   AAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQL  344
             ++   LPPGPWKLP+IG++H L+G +LPHR LR+L++KYGP+MHL+LGE+STIV+SS +L
Sbjct  34    SSASNLPPGPWKLPIIGNIHQLIG-TLPHRGLRDLAKKYGPVMHLRLGEVSTIVVSSAEL  92

Query  345   ARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSF  524
             A+ + KTHD++FASRP+++   I++Y S D+AF+PYGDYWR++RKIC  ELLS K V+S+
Sbjct  93    AKEVMKTHDIIFASRPQVLVTRILYYDSKDIAFAPYGDYWRELRKICTQELLSAKRVQSY  152

Query  525   CSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLK  704
                R++E+ NL+  I   S  G P NLT+KV   T S+ ++ AFG  C +DQ +FI  +K
Sbjct  153   RPIREKEVLNLIKWI--GSRAGLPINLTQKVLSATYSITSQAAFGIQC-KDQEEFIYAVK  209

Query  705   QVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNS  884
              ++    GF++ D+FPS K +H  SG+ PKL +L  + D+I + II +H +   A +T  
Sbjct  210   DIIKAVSGFNVADVFPSFKLLHRISGVHPKLQRLQKQADRILENIIKEHIQ---ATTTAK  266

Query  885   SGKDEDIVDVLLRVKEG-GELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1061
             S + +D+VDVLL+  E  G  +  +T DNIKAVI D+F+ G+ETSATT+ W MSEMIK P
Sbjct  267   SDEAQDLVDVLLKFHETCGGSELSLTTDNIKAVILDIFTAGSETSATTVDWTMSEMIKNP  326

Query  1062  SVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1241
              +M KAQ EVR+     +  ++  +  + YLKLVI+E LRLHPP PL+ PRE  E  +I 
Sbjct  327   RIMKKAQDEVREVFNRTQQVNETSIREMKYLKLVIQEALRLHPPAPLLLPRECGERCEID  386

Query  1242  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1421
              Y IP KT+VI+NAWA+  +P  W +PE F PERF +SS ++ G ++++IPFGAGRRMCP
Sbjct  387   GYEIPVKTKVIVNAWAIGRDPNYWSEPETFNPERFIDSSGEYQGTNFDYIPFGAGRRMCP  446

Query  1422  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             GI +   ++ L LA LLYHF+W LP+G++ +DL+MTE    +  +K+DL  I  P+
Sbjct  447   GILYGLANVELPLAMLLYHFDWSLPNGMNNEDLEMTEEFAAVVQRKQDLLSIPTPY  502



>gb|KHN39921.1| Cytochrome P450 71D8 [Glycine soja]
Length=508

 Score =   474 bits (1219),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 236/480 (49%), Positives = 338/480 (70%), Gaps = 5/480 (1%)
 Frame = +3

Query  147   WAKSKAAAKQKLPPGPWKLPLIGSLHHLVG-GSLPHRSLRNLSRKYGPIMHLQLGEISTI  323
             + K K      LPPGP KLP+IG+LH L   GSLPH +L+ LS+KYGP+MHLQLGEIS +
Sbjct  22    YYKLKTNVSHTLPPGPKKLPIIGNLHQLAAAGSLPHHALKKLSKKYGPLMHLQLGEISAV  81

Query  324   VISSPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  503
             V SSP++A+ I KTHD+ F  RP  +A +I+ Y    +AF+ YGD+WRQMRKICV E+LS
Sbjct  82    VASSPKMAKEIVKTHDVSFLQRPYFVAGEIMTYGGLGIAFAQYGDHWRQMRKICVTEVLS  141

Query  504   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  683
             +K V+SF S R++E +  ++SIR S+  G   NLT ++     + I++VAFG +  E   
Sbjct  142   VKRVQSFASIREDEAAKFINSIRESA--GSTINLTSRIFSLICASISRVAFGGIYKEQDE  199

Query  684   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  863
               ++L+++++ + GGFDL DLFPS  ++++ +G   KL KLH ++DK+ + I+ +H+E H
Sbjct  200   FVVSLIRRIVEIGGGFDLADLFPSIPFLYFITGKMAKLKKLHKQVDKLLETIVKEHQEKH  259

Query  864   -LANSTNSSGKDEDIVDVLLRVKEGGE-LQFPITEDNIKAVINDMFSTGTETSATTIIWA  1037
               A    +  +DED +DVLLR+++  + L   +T +NIKA+I D+F+ GT+TSA+T+ WA
Sbjct  260   KRAKEDGAEIEDEDYIDVLLRIQQQSDTLNINMTTNNIKALILDIFAAGTDTSASTLEWA  319

Query  1038  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1217
             M+EM++ P V  KAQAE+RQA +G +   + DLE LTYLKLVIKET R+HPP PL+ PRE
Sbjct  320   MAEMMRNPRVREKAQAELRQAFRGKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRE  379

Query  1218  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1397
               +   I  Y IP KT+V++N +A+  +P+ W D E F+PERFE SS+DF GN++E++PF
Sbjct  380   CSQLTIIDGYEIPAKTKVMVNVYAVCKDPKYWVDAEMFVPERFEASSIDFKGNNFEYLPF  439

Query  1398  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             G GRR+CPG++F   +I L LA LLYHFNWELP+ + P+++DM E  GV   +K +L LI
Sbjct  440   GGGRRICPGMTFGLATIMLPLALLLYHFNWELPNKIKPENMDMAEQFGVAIGRKNELHLI  499



>ref|XP_007153130.1| hypothetical protein PHAVU_003G009200g [Phaseolus vulgaris]
 gb|ESW25124.1| hypothetical protein PHAVU_003G009200g [Phaseolus vulgaris]
Length=508

 Score =   474 bits (1219),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 244/479 (51%), Positives = 342/479 (71%), Gaps = 12/479 (3%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +K      +PPGPWKLP+IGS+ HL+  + PH  LR+L++K+GP+MHLQLGE+ T+V+SS
Sbjct  29    TKTKPSPNMPPGPWKLPIIGSIPHLLTPT-PHIKLRDLAKKHGPLMHLQLGEVFTVVVSS  87

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
              + A+ + KTHDLVFASRP I+A  I+ Y +T+++FSPYG+YWRQ+RKIC  EL + K +
Sbjct  88    AECAKEVMKTHDLVFASRPLILASRIIGYDATNISFSPYGNYWRQLRKICTAELFTPKRL  147

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
              SF   R+EELS+L+  I  +S+ G   NL+E +     ++I++ AFG+ C E Q ++I+
Sbjct  148   SSFKPIREEELSSLIKMI--ASQNGSSFNLSEALLTSNYAIISRAAFGKTCKE-QEEYIS  204

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             + K+VL  AGGFD+GDLFPS  W+   +G++P L +LH + D+I + II +HK+   A S
Sbjct  205   VQKEVLKAAGGFDIGDLFPSATWLQNFTGLRPTLERLHRKSDQILENIIREHKD---AKS  261

Query  876   TNSSG--KDEDIVDVLLRVKE--GGELQ-FPITEDNIKAVINDMFSTGTETSATTIIWAM  1040
                 G  + ED+VDVLL  ++  GGE Q   +T+DNIKA+I+++F+ G ETSATTI W M
Sbjct  262   KAKEGIVEAEDLVDVLLTFQDDRGGENQDICLTDDNIKAIIDNIFAAGGETSATTIDWTM  321

Query  1041  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             +EM++ P VM KAQ EVR+    N   D+  +  + YLKLVIKETLR+HPP PL+ PRE 
Sbjct  322   AEMMRNPRVMKKAQGEVREVFSMNGRVDESCINEMKYLKLVIKETLRMHPPAPLLLPREC  381

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              E  +I  Y IP K++VI+NAWA+  +P+SW DPERF PERF +S VDF GN++E IPFG
Sbjct  382   GEACEIDGYHIPVKSKVIVNAWAIGRDPKSWNDPERFYPERFIDSGVDFRGNNFELIPFG  441

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             AGRR+CPGI+F   ++ L+LA LLYHF+W+LP+G+  ++LDMTE   +   +K  LCLI
Sbjct  442   AGRRICPGITFGLMNVELTLALLLYHFDWKLPNGMKGEELDMTEQFALTVRRKDGLCLI  500



>ref|XP_006452560.1| hypothetical protein CICLE_v10008075mg [Citrus clementina]
 ref|XP_006474919.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
 gb|ESR65800.1| hypothetical protein CICLE_v10008075mg [Citrus clementina]
Length=503

 Score =   473 bits (1218),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 235/474 (50%), Positives = 328/474 (69%), Gaps = 4/474 (1%)
 Frame = +3

Query  171   KQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLAR  350
             K  LPPGPWKLP+IG+LH L    LPHR L +L+++YGP+MHL+LGE+ TIV+SSP  A+
Sbjct  27    KLNLPPGPWKLPIIGNLHQLARYELPHRGLADLAKQYGPLMHLRLGEVCTIVVSSPDYAK  86

Query  351   AITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  530
              IT THDLVFASRP + A  I+ Y  +D+AF+PYG YWR ++KICV ELL +K V+SF S
Sbjct  87    EITTTHDLVFASRPHVPAAQILSYDFSDIAFAPYGPYWRTLKKICVTELLGVKRVQSFRS  146

Query  531   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  710
              R+EE++NLV  I   S+ G   NLTEKV     S+ ++ AFG+  +ED   F A++ + 
Sbjct  147   IREEEVTNLVDWI--GSKAGSVVNLTEKVFLLMCSITSRAAFGKK-NEDIEAFQAVVSEA  203

Query  711   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  890
               +  G  + DL+PS K++   +G+K K+ ++H++ DKI   I+ DHK+     S +   
Sbjct  204   TEMFAGSSIADLYPSIKFLLALTGVKAKMQRMHNKTDKILSKIVEDHKKRRAMRSKSGKK  263

Query  891   KD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1067
             ++ ED+VDVLL+ +E G L+FP+   N+KAV+ D+FS GTETSATT+ WAMS ++K P +
Sbjct  264   EEVEDLVDVLLKAQEDGNLEFPLNTKNVKAVVMDVFSAGTETSATTVDWAMSLLMKYPKI  323

Query  1068  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1247
             M KAQ EVR+        D+  LE + YLKL IKETLR+HP  P++ PRE  E   I  Y
Sbjct  324   MKKAQDEVREVFNRRGKVDEAGLEEMKYLKLAIKETLRIHPSAPMLFPRECAETCNINGY  383

Query  1248  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1427
              IP K +V++N WA+  + + W +PE F+PERF +S +DF G ++EF+PFGAGRRMCPG+
Sbjct  384   DIPAKAQVLVNVWAMTRDSKYWTEPESFIPERFLDSPIDFKGANFEFLPFGAGRRMCPGM  443

Query  1428  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             ++A  +I L LA  LYHF+W+LP+G+  +DLDMTE  GV   +K++LCLI  P+
Sbjct  444   TYANANIELPLAMFLYHFDWKLPNGMKNEDLDMTEGFGVTVKRKQNLCLIPTPY  497



>ref|XP_004491491.1| PREDICTED: premnaspirodiene oxygenase-like [Cicer arietinum]
Length=515

 Score =   474 bits (1219),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 240/469 (51%), Positives = 335/469 (71%), Gaps = 9/469 (2%)
 Frame = +3

Query  174   QKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARA  353
             +K PPGPWKLP+IGS+HHL+G SLPH SLR LS+ YGP+MHL+LGE+STIV+SSP+ A+ 
Sbjct  42    KKFPPGPWKLPIIGSIHHLIG-SLPHHSLRQLSKIYGPLMHLKLGEVSTIVVSSPEFAKE  100

Query  354   ITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  533
             I KT+D  FA RP  +  DI+ Y S+D+A +PYG YW+Q+RK+C  ELL  K V+SF S 
Sbjct  101   ILKTYDSNFAQRPHQIGADIMCYGSSDIATAPYGSYWKQLRKLCSQELLCTKRVRSFQSI  160

Query  534   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  713
             R++E+ NL++ I  S+  G   NL+EKV+  TS++ ++ AFG++C +DQ +FI+L+K+++
Sbjct  161   REQEVHNLITYI--SNNIGSCINLSEKVACMTSTITSRSAFGKIC-KDQQEFISLIKKLV  217

Query  714   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK  893
             +LA GF + DLFPS+KW+H  SGMKPKL +LH + D I + II +     +    N    
Sbjct  218   TLAEGFVVIDLFPSQKWLHLISGMKPKLEELHRKFDNIIENIIKEA----VTKKGNDGET  273

Query  894   DEDIVDVLLRVKEGGE-LQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1070
              E  + VLLR+K+  E L++P+T DNIKAVI DMF  G++T++  I W++SEM+K P+ M
Sbjct  274   IESFLSVLLRIKDHDEALEYPLTIDNIKAVILDMFVAGSDTTSAIIEWSISEMLKNPTTM  333

Query  1071  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1250
              KAQ EVR+        D+  L+ L YLK +IKETLRLHPP PL+ PRE  E  ++  Y 
Sbjct  334   IKAQKEVREHFGNKGYIDETSLQELKYLKAIIKETLRLHPPFPLLLPRECRETCEVKGYT  393

Query  1251  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1430
             I    +VI+NAWA+  +PE W + ERFLPERF +  +D+ G++ E+IPFGAGRR+CPGI 
Sbjct  394   IQAGNKVIVNAWAIGRDPEYWNEAERFLPERFLDCKIDYKGSNIEYIPFGAGRRICPGIL  453

Query  1431  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             F  +SI L LA LLYH+NWELP G++ ++L+MTEA+   + +K DL L+
Sbjct  454   FGVSSIELCLAKLLYHYNWELPSGLTEENLEMTEALSSSSRRKTDLILV  502



>gb|AGC29947.1| CYP71BE30 [Sinopodophyllum hexandrum]
Length=498

 Score =   473 bits (1217),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 236/477 (49%), Positives = 341/477 (71%), Gaps = 6/477 (1%)
 Frame = +3

Query  159   KAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSP  338
             K   + +LPPGPWKLPLIGSLHHL+ G LPH +LR+L++K+G +MHLQLG++ST+V++SP
Sbjct  21    KKGKRSQLPPGPWKLPLIGSLHHLLVG-LPHHTLRDLAKKHGSLMHLQLGQVSTVVVTSP  79

Query  339   QLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  518
             ++A+ + KTHD++F  RP + A  IV Y + D+  +PYG++WRQMRKI  LE+ S K V+
Sbjct  80    RIAKEMFKTHDIMFLDRPFMFAPSIVTYGAKDIVLAPYGEFWRQMRKISTLEVFSAKRVQ  139

Query  519   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  698
             SF S R++E+S L+ SI  SS  G   NLT+++  F + L A+VAFG  C +DQ  F+++
Sbjct  140   SFQSVREDEVSMLIESI--SSMNGSVFNLTKRIFSFMNDLTARVAFGNKC-KDQEAFVSM  196

Query  699   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  878
             + QV+ ++GGF + DL+PS + I+  SG+K ++  +H + D+I + II +H + +  N+ 
Sbjct  197   MDQVIKVSGGFGVADLYPSLEIINVISGLKSEMEGIHQKTDEILENIIKEHMQRN--NNP  254

Query  879   NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1058
             N    +EDIVDVLLR+++   L F +T DNIKAV+ D+FS G+ETS+T + WA+ E++K 
Sbjct  255   NKDVNEEDIVDVLLRLQKDANLGFQLTSDNIKAVLFDIFSGGSETSSTVMDWAICELMKS  314

Query  1059  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1238
             P+ M K Q EVRQ L G     + D+  L YLK VIKETLRLHPP PL+ PRE  E  ++
Sbjct  315   PTSMEKVQREVRQVLNGKTNIIETDIHELKYLKSVIKETLRLHPPFPLLIPRECRERCEV  374

Query  1239  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1418
               Y IP  T++I+NAWA+  +P+ W+D E+F+PERF+  SVD+ G H+++IPFGAGRR+C
Sbjct  375   DGYEIPVGTKIIVNAWAIGRDPQHWKDAEKFVPERFDEGSVDYKGAHFQYIPFGAGRRIC  434

Query  1419  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
             PGIS    +I L+LA LLYHF+W+LP+GV   +LDM EA G+   ++KDL + A P+
Sbjct  435   PGISLGVANIELALAQLLYHFDWKLPNGVGTDELDMAEAFGLAVRRRKDLYVNATPY  491



>ref|XP_011082254.1| PREDICTED: premnaspirodiene oxygenase [Sesamum indicum]
Length=524

 Score =   474 bits (1220),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 241/483 (50%), Positives = 336/483 (70%), Gaps = 18/483 (4%)
 Frame = +3

Query  153   KSKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVIS  332
             K+   +  KLPPGP +LP+IG LH +   S+P RS R+L++KYGPIMHL+ GE+  I+IS
Sbjct  28    KNSKPSSAKLPPGPQELPIIGHLHLI--SSVPFRSFRDLAKKYGPIMHLKFGEVPGIIIS  85

Query  333   SPQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  512
             SP++A+ + K  D VFA+RP  +A+ I+ Y   D+ FSPYGDYWRQMRKIC++ELLS K 
Sbjct  86    SPEIAKKVLKEQDPVFANRPPAIAMQIMGYNYKDIGFSPYGDYWRQMRKICIMELLSSKS  145

Query  513   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  692
             V+SF S R +E+S+LV  I+ S+  G P NLT+K+ W  +S+  + +FG VC +D    I
Sbjct  146   VRSFGSIRNDEVSSLVKFIQASA--GKPVNLTDKIFWMMNSITCRASFGTVC-KDNDALI  202

Query  693   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN--HL  866
              LL+  + +AGGF++ D+FPS K +   S  K +L+ +  +LD I D II +HK N   L
Sbjct  203   KLLRDGMQMAGGFEIADVFPSSKIVSALSWTKWRLVMMGRKLDMILDDIINEHKVNLDKL  262

Query  867   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1046
             A         E++VDV LR+KE G+L+FPI  DNIKA++ D+FS  TETSAT I W M+E
Sbjct  263   AR--------ENLVDVFLRLKESGDLEFPIGNDNIKAILFDVFSAATETSATAIDWIMTE  314

Query  1047  MIKRPSVMAKAQAEVRQALKGNKT--FDDKDLENLTYLKLVIKETlrlhpplplihprES  1220
             +++ P VMAKAQAEVRQ   G++T   ++ ++  L YLKLVI+ETLRLHP +P +    S
Sbjct  315   LMRNPGVMAKAQAEVRQVFNGSRTTSINEDNVRKLNYLKLVIRETLRLHPSVPFLPRA-S  373

Query  1221  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1400
              EE  I  Y IP   +V++N+W +  +P+ W +PE F PERFEN+S+DF+G  +E++PFG
Sbjct  374   REECTINGYTIPANVKVLVNSWGMQRDPKYWTNPESFEPERFENNSMDFVGGDFEYLPFG  433

Query  1401  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1580
             +GRRMCPGI+FA  SI L LA LLY+FNW+LP+GV P++LDM E  G+ AS+K  L ++ 
Sbjct  434   SGRRMCPGITFALASIELPLAQLLYNFNWKLPEGVKPENLDMIENPGLTASRKSKLYVVP  493

Query  1581  RPF  1589
              P+
Sbjct  494   TPY  496



>gb|ABG91755.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
Length=495

 Score =   473 bits (1216),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 232/474 (49%), Positives = 339/474 (72%), Gaps = 11/474 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +++ + +K  P PW+LP+IG +HHL+G + PHR +R+L+RKYG +MHLQLGE+ TIV+SS
Sbjct  30    TRSKSTKKSLPEPWRLPIIGHMHHLIGTT-PHRGVRDLARKYGSLMHLQLGEVPTIVVSS  88

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P+ A+ I  T+D+ FA+RP+ +  +IV Y +TDV  +PYG+YWRQ+RKIC LELLS+K V
Sbjct  89    PKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKV  148

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF S R+EE  NLV  I+ +S +G P NL+E +    ++++++ AFG+   +DQ +   
Sbjct  149   KSFQSLREEECWNLVQEIK-ASGSGRPVNLSENIFKLIATILSRAAFGKGI-KDQKELTE  206

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D + D ++ +H  N     
Sbjct  207   IVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLIDNLVAEHTVN-----  261

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
               SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT+TS++TI WA+SE+IK
Sbjct  262   -TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGTDTSSSTIEWAISELIK  318

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P  + K QAE+R+AL G +   ++D++ L+YL +VIKETLRLHPPLPL+ PRE  +   
Sbjct  319   CPKALEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLHPPLPLVLPRECRQPVN  378

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   MG  YE++PFGAGRRM
Sbjct  379   LAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATVMGAEYEYLPFGAGRRM  438

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             CPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G    +K +L L+
Sbjct  439   CPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGATMQRKTELLLV  492



>ref|XP_007146291.1| hypothetical protein PHAVU_006G028100g [Phaseolus vulgaris]
 gb|ESW18285.1| hypothetical protein PHAVU_006G028100g [Phaseolus vulgaris]
Length=507

 Score =   473 bits (1216),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 236/470 (50%), Positives = 334/470 (71%), Gaps = 5/470 (1%)
 Frame = +3

Query  180   LPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISSPQLARAIT  359
             +P GP KLP+IG++H+L+  S PHR LR+L+ K+GP+MHLQLGE+STIVISSP+  + + 
Sbjct  37    MPHGPRKLPVIGNIHNLLF-SQPHRKLRDLALKHGPLMHLQLGEVSTIVISSPECVKEVM  95

Query  360   KTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  539
             KTHD+ FA+RPK++A +I+ Y ST +AF+PYG+YWRQ+RKIC LELLS+K V S+   R+
Sbjct  96    KTHDINFATRPKVLASEIISYNSTSIAFAPYGNYWRQLRKICTLELLSLKRVNSYQPIRE  155

Query  540   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  719
             EELSNLV  I   SE G P NLT  +      + ++ AFG+ C +DQ  FI+ +K+   L
Sbjct  156   EELSNLVKWI--DSEKGSPINLTLALLSSIYKIASRSAFGKKC-KDQENFISEMKKATEL  212

Query  720   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  899
               GF++GD FPS  W+   SG++ KL K H ++D+I + II +HKE   + + +   + E
Sbjct  213   FAGFNIGDFFPSSTWLQLVSGLRHKLEKSHQQVDQILENIINEHKEAK-SKAKDDQSEAE  271

Query  900   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1079
             D+VDVL++ ++G +  F +T +NIKA+I D+F+ G +TSAT I WAM+EM+K P +M KA
Sbjct  272   DLVDVLIQYEDGRKKDFSLTRNNIKAIILDIFAAGGDTSATVIDWAMAEMVKDPRIMKKA  331

Query  1080  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1259
             Q+EVR+A  G    D+  +  L YLKLV+KET+RLHPP  L+ PRE  +  +I  Y IP 
Sbjct  332   QSEVREAFSGKGRVDENSINELKYLKLVVKETMRLHPPASLLLPRECGQACEIHGYHIPA  391

Query  1260  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1439
             K++VIINAW +  +P  W +PERF PERF  S++D+ G ++EFIPFGAGRR+CPG +FA 
Sbjct  392   KSKVIINAWTIGRDPNYWTEPERFYPERFTASTIDYKGTNFEFIPFGAGRRICPGSTFAL  451

Query  1440  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1589
              +I L+LA LLYHF+W+LP G+  ++L+M+E  GV   +K DL L+  P+
Sbjct  452   RTIELALAMLLYHFDWKLPSGMRSEELNMSEVFGVTMKRKYDLFLVPFPY  501



>gb|ABI31728.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
Length=495

 Score =   472 bits (1214),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 232/474 (49%), Positives = 338/474 (71%), Gaps = 11/474 (2%)
 Frame = +3

Query  156   SKAAAKQKLPPGPWKLPLIGSLHHLVGGSLPHRSLRNLSRKYGPIMHLQLGEISTIVISS  335
             +++ + +K  P PW+LP+IG +HHL+G + PHR +R+L+RKYG +MHLQLGE+ TIV+SS
Sbjct  30    TRSKSTKKSLPEPWRLPIIGHMHHLIGTT-PHRGVRDLARKYGSLMHLQLGEVPTIVVSS  88

Query  336   PQLARAITKTHDLVFASRPKIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMV  515
             P+ A+ +  T+D+ FA+RP+ +  +IV Y +TDV  +PYG+YWRQ+RKIC LELLS+K V
Sbjct  89    PKWAKEVLTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWRQLRKICTLELLSVKKV  148

Query  516   KSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  695
             KSF S R+EE  NLV  I+ +S +G P NL+E V    ++++++ AFG+   +DQ +   
Sbjct  149   KSFQSLREEECWNLVQEIK-ASGSGRPVNLSENVFKLIATILSRAAFGKGI-KDQKELTE  206

Query  696   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  875
             ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D + D ++ +H  N     
Sbjct  207   IVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLIDNLVAEHTVN-----  261

Query  876   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1055
               SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT+TS++TI WA+ E+IK
Sbjct  262   -TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGTDTSSSTIEWAIPELIK  318

Query  1056  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1235
              P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLHPPLPL+ PRE  +   
Sbjct  319   CPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLHPPLPLVLPRECRQPVN  378

Query  1236  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1415
             +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   MG  YE++PFGAGRRM
Sbjct  379   LAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATVMGAEYEYLPFGAGRRM  438

Query  1416  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1577
             CPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G    +K +L L+
Sbjct  439   CPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGATMQRKAELLLV  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4661392638896