BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25867_g1_i2 len=884 path=[1:0-154 9472:155-172 9490:173-198
7031:199-221 9526:222-276 9562:277-283 9574:284-286 340:287-325
9589:326-336 9600:337-350 2259:351-393 9644:394-396 9647:397-405
9656:406-435 6528:436-462 9730:463-469 6561:470-546 6638:547-633
6724:634-693 969:694-874 9916:875-883]

Length=884
                                                                      Score     E

ref|XP_009623937.1|  PREDICTED: premnaspirodiene oxygenase-like i...    315   7e-103   
gb|ABC69397.1|  CYP71D48v1                                              321   1e-102   Nicotiana tabacum [American tobacco]
gb|ABC69396.1|  CYP71D48v2                                              319   8e-102   Nicotiana tabacum [American tobacco]
ref|XP_009612725.1|  PREDICTED: premnaspirodiene oxygenase-like         318   1e-101   
ref|XP_009623936.1|  PREDICTED: premnaspirodiene oxygenase-like i...    314   6e-100   
ref|XP_006365912.1|  PREDICTED: premnaspirodiene oxygenase-like         311   1e-98    
gb|AAF27282.1|AF122821_1  cytochrome P450                               308   1e-97    Capsicum annuum
emb|CDP08465.1|  unnamed protein product                                307   3e-97    
gb|ABC69395.1|  CYP71D47v2                                              307   3e-97    Nicotiana tabacum [American tobacco]
ref|XP_009766832.1|  PREDICTED: premnaspirodiene oxygenase-like         306   6e-97    
gb|ABC69394.1|  CYP71D47v1                                              306   1e-96    Nicotiana tabacum [American tobacco]
ref|XP_009770332.1|  PREDICTED: premnaspirodiene oxygenase-like         305   2e-96    
ref|XP_006350393.1|  PREDICTED: cytochrome P450 71D7-like               303   9e-96    
ref|XP_009623934.1|  PREDICTED: premnaspirodiene oxygenase-like         303   1e-95    
ref|XP_006361940.1|  PREDICTED: premnaspirodiene oxygenase-like         302   2e-95    
ref|XP_006339043.1|  PREDICTED: premnaspirodiene oxygenase-like         302   3e-95    
ref|XP_009609826.1|  PREDICTED: premnaspirodiene oxygenase-like         295   4e-95    
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7             301   4e-95    Solanum chacoense
ref|XP_006367966.1|  PREDICTED: premnaspirodiene oxygenase-like         301   8e-95    
ref|XP_006350394.1|  PREDICTED: cytochrome P450 71D6-like               300   1e-94    
ref|XP_006341699.1|  PREDICTED: premnaspirodiene oxygenase-like         299   3e-94    
ref|XP_004233564.1|  PREDICTED: premnaspirodiene oxygenase-like         298   7e-94    
ref|XP_009598320.1|  PREDICTED: premnaspirodiene oxygenase-like         298   9e-94    
ref|XP_009609720.1|  PREDICTED: premnaspirodiene oxygenase              293   2e-93    
sp|A6YIH8.1|C7D55_HYOMU  RecName: Full=Premnaspirodiene oxygenase...    297   2e-93    Hyoscyamus muticus
ref|XP_006350417.1|  PREDICTED: cytochrome P450 71D7-like               296   3e-93    
ref|XP_006339044.1|  PREDICTED: premnaspirodiene oxygenase-like         296   5e-93    
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like         295   1e-92    
dbj|BAN58140.1|  putative premaspirodiene oxygenase                     295   1e-92    
ref|XP_006350396.1|  PREDICTED: premnaspirodiene oxygenase-like         295   2e-92    
ref|XP_009622900.1|  PREDICTED: cytochrome P450 71D7-like               294   2e-92    
gb|ABC69399.1|  CYP71D49v1                                              294   3e-92    Nicotiana tabacum [American tobacco]
ref|XP_004237369.1|  PREDICTED: premnaspirodiene oxygenase              293   5e-92    
ref|XP_004245943.1|  PREDICTED: premnaspirodiene oxygenase-like         291   2e-91    
gb|ABC69400.1|  CYP71D49v3                                              291   3e-91    Nicotiana tabacum [American tobacco]
ref|XP_006355983.1|  PREDICTED: premnaspirodiene oxygenase-like         291   3e-91    
ref|XP_009758268.1|  PREDICTED: premnaspirodiene oxygenase              291   3e-91    
gb|ABC69405.1|  CYP71D51v3                                              291   3e-91    Nicotiana tabacum [American tobacco]
emb|CDP20259.1|  unnamed protein product                                291   3e-91    
ref|XP_006350395.1|  PREDICTED: premnaspirodiene oxygenase-like         291   4e-91    
emb|CAC24711.1|  cytochrome P450                                        291   5e-91    Solanum tuberosum [potatoes]
ref|XP_006355212.1|  PREDICTED: premnaspirodiene oxygenase-like         289   3e-90    
ref|XP_004242036.1|  PREDICTED: premnaspirodiene oxygenase-like         289   3e-90    
ref|XP_009608635.1|  PREDICTED: premnaspirodiene oxygenase-like         289   3e-90    
ref|XP_004242219.2|  PREDICTED: cytochrome P450 71D7-like               289   3e-90    
ref|XP_004228510.1|  PREDICTED: premnaspirodiene oxygenase-like         289   3e-90    
ref|XP_006341698.1|  PREDICTED: premnaspirodiene oxygenase-like         289   3e-90    
sp|P93530.1|C71D6_SOLCH  RecName: Full=Cytochrome P450 71D6             288   4e-90    Solanum chacoense
ref|XP_004249520.2|  PREDICTED: premnaspirodiene oxygenase-like         290   4e-90    
gb|ABC69403.1|  CYP71D51v1                                              288   5e-90    Nicotiana tabacum [American tobacco]
gb|KDP39283.1|  hypothetical protein JCGZ_01040                         282   9e-90    
ref|XP_007212458.1|  hypothetical protein PRUPE_ppa017406mg             281   2e-89    
ref|XP_006367730.1|  PREDICTED: premnaspirodiene oxygenase-like         280   4e-89    
ref|XP_009357363.1|  PREDICTED: premnaspirodiene oxygenase-like         286   4e-89    
ref|XP_006365979.1|  PREDICTED: premnaspirodiene oxygenase-like         286   5e-89    
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               285   9e-89    
ref|XP_004249519.1|  PREDICTED: premnaspirodiene oxygenase-like         285   1e-88    
ref|XP_006339045.1|  PREDICTED: premnaspirodiene oxygenase-like         285   1e-88    
ref|XP_004246079.1|  PREDICTED: cytochrome P450 71D7-like               284   2e-88    
ref|XP_009794456.1|  PREDICTED: premnaspirodiene oxygenase-like         284   2e-88    
ref|XP_009776870.1|  PREDICTED: premnaspirodiene oxygenase-like         279   2e-88    
ref|XP_006339046.1|  PREDICTED: premnaspirodiene oxygenase-like         283   4e-88    
ref|XP_004249812.1|  PREDICTED: premnaspirodiene oxygenase-like         283   4e-88    
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         283   5e-88    
dbj|BAC53923.1|  cytochrome P450                                        283   5e-88    Petunia x hybrida [garden petunia]
ref|XP_004228511.1|  PREDICTED: premnaspirodiene oxygenase-like         282   1e-87    
ref|XP_004243471.1|  PREDICTED: premnaspirodiene oxygenase-like         282   1e-87    
ref|XP_008385924.1|  PREDICTED: premnaspirodiene oxygenase-like         282   1e-87    
ref|XP_009765480.1|  PREDICTED: premnaspirodiene oxygenase-like         282   1e-87    
ref|XP_006365938.1|  PREDICTED: premnaspirodiene oxygenase-like         282   2e-87    
gb|ABC69398.1|  CYP71D5v3                                               281   2e-87    Nicotiana tabacum [American tobacco]
gb|ABC69402.1|  CYP71D5v2                                               281   2e-87    Nicotiana tabacum [American tobacco]
ref|XP_007146608.1|  hypothetical protein PHAVU_006G054500g             281   2e-87    
ref|XP_009764618.1|  PREDICTED: cytochrome P450 71D7-like isoform X1    281   4e-87    
ref|XP_006359503.1|  PREDICTED: premnaspirodiene oxygenase-like         280   1e-86    
emb|CDP10756.1|  unnamed protein product                                279   2e-86    
ref|XP_009619325.1|  PREDICTED: premnaspirodiene oxygenase-like         279   3e-86    
ref|XP_006367127.1|  PREDICTED: premnaspirodiene oxygenase-like i...    279   3e-86    
ref|XP_009617877.1|  PREDICTED: premnaspirodiene oxygenase-like         279   3e-86    
emb|CDP07879.1|  unnamed protein product                                278   4e-86    
ref|XP_003589693.1|  Cytochrome P450                                    278   4e-86    
gb|AES59944.2|  cytochrome P450 family 71 protein                       278   4e-86    
ref|XP_006352953.1|  PREDICTED: premnaspirodiene oxygenase-like         278   5e-86    
ref|XP_009794007.1|  PREDICTED: premnaspirodiene oxygenase-like         278   6e-86    
ref|XP_002522762.1|  cytochrome P450, putative                          278   6e-86    Ricinus communis
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...    278   7e-86    
gb|KHM99028.1|  Cytochrome P450 71D11                                   277   7e-86    
ref|XP_004511998.1|  PREDICTED: cytochrome P450 71D8-like               278   8e-86    
emb|CDP07872.1|  unnamed protein product                                277   9e-86    
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like         277   1e-85    
ref|XP_006605460.1|  PREDICTED: cytochrome P450 71D11-like              277   1e-85    
ref|XP_009788504.1|  PREDICTED: premnaspirodiene oxygenase-like         271   2e-85    
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like         276   2e-85    
ref|XP_009772938.1|  PREDICTED: premnaspirodiene oxygenase-like         276   2e-85    
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             276   2e-85    
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    276   3e-85    
ref|XP_006365962.1|  PREDICTED: cytochrome P450 71D7-like               276   3e-85    
emb|CDP10758.1|  unnamed protein product                                276   4e-85    
ref|XP_010655881.1|  PREDICTED: cytochrome P450 71D10-like              276   4e-85    
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like         275   5e-85    
ref|XP_009793271.1|  PREDICTED: premnaspirodiene oxygenase-like         275   6e-85    
ref|XP_008227171.1|  PREDICTED: cytochrome P450 71D9-like               272   1e-84    
ref|XP_011082249.1|  PREDICTED: premnaspirodiene oxygenase-like         275   1e-84    
emb|CDP18841.1|  unnamed protein product                                274   2e-84    
ref|XP_003537457.1|  PREDICTED: cytochrome P450 71D8-like               274   2e-84    
gb|KHN42275.1|  Cytochrome P450 71D8                                    274   2e-84    
ref|XP_010655870.1|  PREDICTED: cytochrome P450 71D10-like              274   2e-84    
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like              274   3e-84    
ref|XP_003550472.2|  PREDICTED: cytochrome P450 71D8-like               275   3e-84    
ref|XP_003529672.2|  PREDICTED: cytochrome P450 71D8-like               274   3e-84    
ref|XP_006345633.1|  PREDICTED: premnaspirodiene oxygenase-like         273   4e-84    
ref|XP_007147597.1|  hypothetical protein PHAVU_006G138100g             273   5e-84    
ref|XP_009794009.1|  PREDICTED: premnaspirodiene oxygenase-like         273   5e-84    
ref|XP_004250027.1|  PREDICTED: cytochrome P450 71D7                    273   5e-84    
ref|XP_008227173.1|  PREDICTED: cytochrome P450 71D9-like               271   6e-84    
gb|KDP39287.1|  hypothetical protein JCGZ_01044                         273   7e-84    
ref|XP_007146610.1|  hypothetical protein PHAVU_006G054700g             272   1e-83    
ref|XP_009765945.1|  PREDICTED: premnaspirodiene oxygenase-like         267   2e-83    
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               271   2e-83    
gb|KDP39256.1|  hypothetical protein JCGZ_01013                         271   2e-83    
ref|XP_010653207.1|  PREDICTED: cytochrome P450 71D9-like               271   2e-83    
ref|XP_010644548.1|  PREDICTED: premnaspirodiene oxygenase-like         271   3e-83    
gb|AAD47832.1|  cytochrome P450                                         271   3e-83    Nicotiana tabacum [American tobacco]
ref|XP_004241764.1|  PREDICTED: premnaspirodiene oxygenase-like         271   3e-83    
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               271   4e-83    
gb|AHH25653.1|  cytochrome P450 CYP71D                                  270   4e-83    
ref|XP_003636315.1|  Cytochrome P450                                    271   4e-83    
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like               271   5e-83    
gb|KDP33179.1|  hypothetical protein JCGZ_13444                         264   5e-83    
ref|XP_003610580.1|  Cytochrome P450                                    270   6e-83    
gb|KEH19671.1|  cytochrome P450 family 71 protein                       270   7e-83    
ref|XP_002522721.1|  cytochrome P450, putative                          270   7e-83    Ricinus communis
ref|XP_003617731.1|  Cytochrome P450                                    270   8e-83    
ref|XP_007020549.1|  Cytochrome P450                                    270   9e-83    
ref|XP_007146612.1|  hypothetical protein PHAVU_006G054900g             269   9e-83    
ref|XP_009612417.1|  PREDICTED: premnaspirodiene oxygenase-like         269   1e-82    
ref|XP_007146609.1|  hypothetical protein PHAVU_006G054600g             268   1e-82    
ref|XP_003516583.1|  PREDICTED: cytochrome P450 71D8-like               269   1e-82    
ref|XP_004231934.1|  PREDICTED: premnaspirodiene oxygenase-like         269   2e-82    
ref|XP_009611155.1|  PREDICTED: premnaspirodiene oxygenase-like         268   2e-82    
ref|XP_007146605.1|  hypothetical protein PHAVU_006G054200g             268   2e-82    
ref|XP_009765039.1|  PREDICTED: premnaspirodiene oxygenase-like         268   2e-82    
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...    269   3e-82    
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like         268   3e-82    
ref|XP_009625417.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxylase    268   3e-82    
ref|XP_009612418.1|  PREDICTED: premnaspirodiene oxygenase-like         268   3e-82    
ref|XP_003516584.1|  PREDICTED: cytochrome P450 71D8-like               268   3e-82    
ref|XP_009606204.1|  PREDICTED: premnaspirodiene oxygenase-like         268   4e-82    
ref|XP_004228509.1|  PREDICTED: premnaspirodiene oxygenase-like         268   4e-82    
ref|XP_004512032.1|  PREDICTED: cytochrome P450 71D8-like               268   4e-82    
ref|XP_003611886.1|  Cytochrome P450                                    268   6e-82    
ref|XP_003611883.1|  Cytochrome P450                                    267   6e-82    
ref|XP_009771988.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    267   8e-82    
ref|XP_004512033.1|  PREDICTED: cytochrome P450 71D8-like               267   1e-81    
ref|XP_003600339.1|  Cytochrome P450                                    266   2e-81    
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like         266   2e-81    
emb|CDP07887.1|  unnamed protein product                                265   3e-81    
ref|XP_009587552.1|  PREDICTED: premnaspirodiene oxygenase-like         266   3e-81    
ref|XP_009347232.1|  PREDICTED: cytochrome P450 71D11-like              266   3e-81    
gb|AFK35275.1|  unknown                                                 259   4e-81    
gb|EYU21978.1|  hypothetical protein MIMGU_mgv1a004623mg                265   5e-81    
ref|XP_007156881.1|  hypothetical protein PHAVU_002G025000g             265   5e-81    
ref|XP_003600330.1|  Cytochrome P450                                    265   5e-81    
ref|XP_003611884.1|  Cytochrome P450                                    265   5e-81    
ref|XP_011082374.1|  PREDICTED: premnaspirodiene oxygenase-like         265   6e-81    
sp|Q94FM7.2|C71DK_TOBAC  RecName: Full=5-epiaristolochene 1,3-dih...    265   6e-81    Nicotiana tabacum [American tobacco]
ref|XP_004511999.1|  PREDICTED: cytochrome P450 71D8-like               265   6e-81    
ref|XP_009801864.1|  PREDICTED: LOW QUALITY PROTEIN: 5-epiaristol...    265   7e-81    
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              265   7e-81    
ref|XP_009803037.1|  PREDICTED: premnaspirodiene oxygenase-like         265   7e-81    
ref|XP_003537455.1|  PREDICTED: cytochrome P450 71D8-like               264   1e-80    
sp|O81974.1|C71D8_SOYBN  RecName: Full=Cytochrome P450 71D8; AltN...    264   1e-80    Glycine max [soybeans]
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g             264   1e-80    
dbj|BAM68819.1|  putative cytochrome P450 monooxygenase CYP71AV1        263   1e-80    
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               264   2e-80    
gb|KEH26014.1|  cytochrome P450 family 71 protein                       256   2e-80    
gb|KEH34017.1|  cytochrome P450 family 71 protein                       264   2e-80    
ref|XP_007020557.1|  Cytochrome P450, putative                          264   2e-80    
ref|XP_004304108.1|  PREDICTED: cytochrome P450 71D11-like              264   2e-80    
ref|XP_011081934.1|  PREDICTED: cytochrome P450 71D95-like              263   2e-80    
gb|AIA09036.1|  germacrene A oxidase                                    263   2e-80    
gb|KHN08718.1|  Cytochrome P450 71D8                                    263   2e-80    
ref|XP_002523467.1|  cytochrome P450, putative                          263   2e-80    Ricinus communis
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             262   2e-80    
ref|XP_003600328.1|  Cytochrome P450                                    263   2e-80    
sp|D5JBW9.1|GAO_SAUCO  RecName: Full=Germacrene A oxidase; Short=...    263   3e-80    
ref|XP_003535170.1|  PREDICTED: cytochrome P450 71D8-like               263   3e-80    
ref|XP_006346274.1|  PREDICTED: premnaspirodiene oxygenase-like         263   3e-80    
gb|KEH34016.1|  cytochrome P450 family 71 protein                       262   4e-80    
ref|XP_007154033.1|  hypothetical protein PHAVU_003G085400g             263   4e-80    
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              263   5e-80    
ref|XP_003537212.1|  PREDICTED: cytochrome P450 71D8-like               262   5e-80    
ref|XP_011087047.1|  PREDICTED: premnaspirodiene oxygenase-like         262   5e-80    
ref|XP_006357930.1|  PREDICTED: cytochrome P450 71D7-like               262   6e-80    
gb|AIA09035.1|  germacrene A oxidase                                    262   6e-80    
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg                263   6e-80    
gb|KDP39257.1|  hypothetical protein JCGZ_01014                         261   6e-80    
ref|XP_003551489.1|  PREDICTED: cytochrome P450 71D9-like               262   8e-80    
gb|AGB55871.1|  flavonoid 6-hydroxylase 2                               261   9e-80    
gb|KEH34013.1|  cytochrome P450 family 71 protein                       262   1e-79    
gb|KHN43612.1|  Cytochrome P450 71D9                                    261   1e-79    
ref|XP_006475119.1|  PREDICTED: premnaspirodiene oxygenase-like         261   1e-79    
ref|XP_004491491.1|  PREDICTED: premnaspirodiene oxygenase-like         261   1e-79    
gb|ABC69421.1|  CYP71D20v2                                              261   2e-79    Nicotiana tabacum [American tobacco]
ref|XP_003535171.1|  PREDICTED: cytochrome P450 71D8-like               261   2e-79    
ref|XP_003535169.1|  PREDICTED: cytochrome P450 71D8-like               261   2e-79    
ref|XP_010061472.1|  PREDICTED: cytochrome P450 71D11-like              261   2e-79    
gb|KEH34024.1|  cytochrome P450 family 71 protein                       261   2e-79    
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like               261   3e-79    
gb|AAK62343.2|  elicitor-inducible cytochrome P450                      259   3e-79    Nicotiana tabacum [American tobacco]
ref|XP_003589691.1|  Cytochrome P450                                    260   3e-79    
dbj|BAM68810.1|  putative CYP71AV1 ortholog                             260   3e-79    
gb|AGC29947.1|  CYP71BE30                                               260   4e-79    
ref|XP_007153133.1|  hypothetical protein PHAVU_003G009500g             260   5e-79    
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              259   6e-79    
gb|KEH41118.1|  cytochrome P450 family 71 protein                       259   7e-79    
ref|XP_006363816.1|  PREDICTED: premnaspirodiene oxygenase-like i...    259   1e-78    
ref|XP_006452551.1|  hypothetical protein CICLE_v10010293mg             258   2e-78    
gb|KHM99472.1|  Cytochrome P450 71D11                                   259   2e-78    
ref|XP_008345750.1|  PREDICTED: cytochrome P450 71D8-like               259   2e-78    
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like               259   2e-78    
dbj|BAM68809.1|  putative CYP71AV1 ortholog                             258   2e-78    
gb|AEX07771.1|  cytochrome P450                                         258   2e-78    
gb|AGO03789.1|  germacrene A oxidase                                    258   2e-78    
ref|XP_010921587.1|  PREDICTED: premnaspirodiene oxygenase-like         258   2e-78    
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                    259   2e-78    
gb|AHN62855.1|  germacrene A oxidase                                    258   3e-78    
ref|XP_004242298.1|  PREDICTED: premnaspirodiene oxygenase-like         253   3e-78    
gb|ABG49366.1|  P450 monooxygenase                                      258   3e-78    Artemisia annua [sweet Annie]
ref|XP_002513339.1|  cytochrome P450, putative                          258   3e-78    Ricinus communis
ref|XP_003535173.1|  PREDICTED: cytochrome P450 71D8-like               258   3e-78    
dbj|BAM68815.1|  cytochrome P450 monooxygenase CYP71AV2                 257   5e-78    
gb|ABC41927.1|  amorpha-4,11-diene monooxygenase                        257   6e-78    Artemisia annua [sweet Annie]
ref|XP_011081964.1|  PREDICTED: premnaspirodiene oxygenase-like         257   6e-78    
ref|XP_003520242.1|  PREDICTED: cytochrome P450 71D8-like               257   7e-78    
gb|ABG91755.1|  amorpha-4,11-diene C-12 oxidase                         256   8e-78    Artemisia annua [sweet Annie]
gb|ABE57266.1|  amorpha-4,11-diene monooxygenase                        256   9e-78    Artemisia annua [sweet Annie]
gb|AFP19100.1|  amorphadiene oxidase                                    256   9e-78    
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              257   1e-77    
gb|AFO64615.1|  cytochrome P450 mono-oxygenase                          256   1e-77    
gb|KCW68417.1|  hypothetical protein EUGRSUZ_F02067                     256   1e-77    
ref|XP_007020553.1|  Cytochrome P450 71D10, putative                    257   1e-77    
sp|Q1PS23.1|AMO_ARTAN  RecName: Full=Amorpha-4,11-diene 12-monoox...    256   1e-77    Artemisia annua [sweet Annie]
gb|KHM99474.1|  Cytochrome P450 71D11                                   256   1e-77    
ref|XP_003532168.1|  PREDICTED: cytochrome P450 71D11                   256   1e-77    
gb|KDP29297.1|  hypothetical protein JCGZ_19400                         257   1e-77    
ref|XP_004232610.1|  PREDICTED: premnaspirodiene oxygenase-like         256   1e-77    
gb|ABG49365.1|  P450 monooxygenase                                      255   2e-77    Artemisia annua [sweet Annie]
dbj|BAM68821.1|  putative cytochrome P450 monooxygenase CYP71AV11v2     256   2e-77    
ref|XP_006364814.1|  PREDICTED: premnaspirodiene oxygenase-like         256   2e-77    
gb|AHB62239.1|  cytochrome P450                                         255   2e-77    
gb|ABI31728.1|  amorpha-4,11-diene C-12 oxidase                         255   2e-77    Artemisia annua [sweet Annie]
dbj|BAM68808.1|  cytochrome P450 monooxygenase CYP71AV1                 255   2e-77    
sp|D5JBX0.1|GAO_HELAN  RecName: Full=Germacrene A oxidase; Short=...    255   3e-77    
ref|XP_010064672.1|  PREDICTED: cytochrome P450 71D11-like              255   3e-77    
gb|KDO37182.1|  hypothetical protein CISIN_1g010699mg                   255   3e-77    
gb|KDO38617.1|  hypothetical protein CISIN_1g045050mg                   255   3e-77    
sp|O22307.1|C71DB_LOTJA  RecName: Full=Cytochrome P450 71D11            254   4e-77    Lotus japonicus
gb|KEH34014.1|  cytochrome P450 family 71 protein                       255   4e-77    
ref|XP_003517259.1|  PREDICTED: cytochrome P450 71D8-like               255   4e-77    
ref|XP_006452560.1|  hypothetical protein CICLE_v10008075mg             255   4e-77    
ref|XP_007161221.1|  hypothetical protein PHAVU_001G052100g             255   4e-77    
ref|XP_003517257.1|  PREDICTED: cytochrome P450 71D8-like               255   4e-77    
ref|XP_008777955.1|  PREDICTED: premnaspirodiene oxygenase-like         254   4e-77    
gb|KHN39921.1|  Cytochrome P450 71D8                                    255   5e-77    
ref|XP_003537216.1|  PREDICTED: cytochrome P450 71D8-like               255   5e-77    
ref|XP_004295868.1|  PREDICTED: cytochrome P450 71D11-like              255   5e-77    
ref|XP_006359946.1|  PREDICTED: premnaspirodiene oxygenase-like         254   5e-77    
gb|KEH26493.1|  cytochrome P450 family 71 protein                       254   6e-77    
dbj|BAM68814.1|  putative cytochrome P450 monooxygenase CYP71AV11       254   7e-77    
ref|XP_011082254.1|  PREDICTED: premnaspirodiene oxygenase              255   7e-77    
gb|AFK45297.1|  unknown                                                 254   7e-77    
dbj|BAM68818.1|  putative cytochrome P450 monooxygenase CYP71AV1        254   8e-77    
ref|XP_004304768.1|  PREDICTED: cytochrome P450 71D11-like              252   8e-77    
ref|XP_003520239.1|  PREDICTED: cytochrome P450 71D8-like               254   9e-77    
dbj|BAM68811.1|  putative CYP71AV1 ortholog                             253   1e-76    
gb|EYU31465.1|  hypothetical protein MIMGU_mgv1a004885mg                253   1e-76    
gb|KHG02344.1|  Cytochrome P450                                         254   1e-76    
dbj|BAM68812.1|  cytochrome P450 monooxygenase CYP71AV10                253   1e-76    
ref|XP_010061471.1|  PREDICTED: cytochrome P450 71D11-like              253   1e-76    
gb|KHN36164.1|  Cytochrome P450 71D8                                    253   2e-76    
ref|XP_003519623.2|  PREDICTED: cytochrome P450 71D10-like              253   2e-76    
sp|E1B2Z9.1|C7AV8_CICIN  RecName: Full=Cytochrome P450 71AV8; Alt...    253   2e-76    
gb|ADU25498.1|  cytochrome P450 monooxygenase                           253   2e-76    
ref|XP_003617705.1|  Cytochrome P450                                    253   2e-76    
dbj|BAM68820.1|  putative cytochrome P450 monooxygenase CYP71AV11v1     253   3e-76    
gb|AAO32822.1|  cytochrome P450 71D1                                    252   3e-76    
gb|KDP39254.1|  hypothetical protein JCGZ_01011                         253   3e-76    
gb|KDP39088.1|  hypothetical protein JCGZ_00845                         251   3e-76    
ref|XP_011097781.1|  PREDICTED: premnaspirodiene oxygenase-like         253   4e-76    
dbj|BAM68813.1|  cytochrome P450 monooxygenase CYP71AV11                252   4e-76    
dbj|BAM68816.1|  putative cytochrome P450 monooxygenase CYP71AV1        252   4e-76    
gb|ACD42776.1|  cytochrome P450 71D1                                    252   4e-76    
ref|XP_007099625.1|  Cytochrome P450 71D10, putative                    256   5e-76    
ref|XP_003555570.2|  PREDICTED: cytochrome P450 71D11-like              253   5e-76    
ref|XP_003615865.1|  Cytochrome P450                                    252   5e-76    
ref|XP_003617704.1|  Cytochrome P450                                    252   6e-76    
ref|XP_003636948.1|  Cytochrome P450                                    246   7e-76    
gb|KCW68416.1|  hypothetical protein EUGRSUZ_F02065                     252   8e-76    
ref|XP_003600322.1|  Cytochrome P450                                    251   8e-76    
ref|XP_003600327.1|  Cytochrome P450                                    251   8e-76    
gb|ACF74516.1|  amorpha-4,11-diene monooxygenase                        250   2e-75    
gb|KHN43883.1|  Cytochrome P450 71D10                                   250   2e-75    
ref|XP_006596106.1|  PREDICTED: cytochrome P450 71D11-like              251   2e-75    
ref|XP_008791005.1|  PREDICTED: premnaspirodiene oxygenase-like         251   2e-75    
ref|XP_004491658.1|  PREDICTED: uncharacterized protein LOC101503808    259   2e-75    
ref|XP_003617772.1|  Cytochrome P450                                    250   2e-75    
gb|AGB55874.1|  flavonoid 6-hydroxylase 3                               249   3e-75    
gb|KHG11859.1|  Cytochrome P450                                         250   3e-75    
gb|AES70585.2|  cytochrome P450 family 71 protein                       253   3e-75    
ref|XP_003600334.1|  Cytochrome P450                                    252   3e-75    
gb|AET00662.2|  cytochrome P450 family 71 protein                       249   4e-75    
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             249   4e-75    
ref|XP_009624011.1|  PREDICTED: premnaspirodiene oxygenase-like i...    248   4e-75    
ref|XP_006452555.1|  hypothetical protein CICLE_v10008411mg             247   5e-75    
ref|XP_008779150.1|  PREDICTED: premnaspirodiene oxygenase-like         249   6e-75    
gb|KEH15784.1|  cytochrome P450 family 71 protein                       249   7e-75    
gb|KDP39024.1|  hypothetical protein JCGZ_00781                         250   7e-75    
ref|XP_007156882.1|  hypothetical protein PHAVU_002G025100g             249   8e-75    
sp|D5J9U8.1|GAO_LACSA  RecName: Full=Germacrene A oxidase; Short=...    248   8e-75    
emb|CDP17903.1|  unnamed protein product                                248   1e-74    
gb|KHN37234.1|  Cytochrome P450 71D11                                   248   1e-74    
ref|XP_008778208.1|  PREDICTED: premnaspirodiene oxygenase-like         248   2e-74    
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like              248   2e-74    
ref|XP_007156884.1|  hypothetical protein PHAVU_002G025300g             248   2e-74    
gb|KDP26294.1|  hypothetical protein JCGZ_22279                         249   2e-74    
sp|D5JBX1.1|GAO_BARSP  RecName: Full=Germacrene A oxidase; Short=...    248   2e-74    
ref|XP_011097779.1|  PREDICTED: cytochrome P450 71D11-like              248   2e-74    
gb|KHM99475.1|  Cytochrome P450 71D9                                    247   2e-74    
ref|XP_003617706.1|  Cytochrome P450 71D10                              248   3e-74    
ref|XP_003549267.1|  PREDICTED: cytochrome P450 71D11-like              248   3e-74    
ref|XP_002522903.1|  cytochrome P450, putative                          248   3e-74    
ref|XP_010104087.1|  Premnaspirodiene oxygenase                         247   4e-74    
gb|KEH25843.1|  cytochrome P450 family 71 protein                       247   4e-74    
ref|XP_007153130.1|  hypothetical protein PHAVU_003G009200g             247   5e-74    
ref|XP_003530791.1|  PREDICTED: cytochrome P450 71D9-like               247   5e-74    
ref|XP_011081935.1|  PREDICTED: cytochrome P450 71D95-like              246   7e-74    
emb|CDP07881.1|  unnamed protein product                                253   7e-74    
gb|KDP25063.1|  hypothetical protein JCGZ_22598                         246   7e-74    
ref|XP_003551491.1|  PREDICTED: cytochrome P450 71D9-like               246   8e-74    
gb|KHN48844.1|  Cytochrome P450 71D8                                    246   9e-74    
gb|AGB55870.1|  flavonoid 6-hydroxylase 1                               246   1e-73    
gb|KCW68415.1|  hypothetical protein EUGRSUZ_F02064                     245   1e-73    
gb|AGB55868.1|  flavonoid 6-hydroxylase 1                               246   1e-73    
ref|XP_006421138.1|  hypothetical protein CICLE_v10004785mg             246   1e-73    
ref|XP_007020556.1|  Cytochrome P450 71D10, putative                    246   1e-73    
sp|O81971.1|C71D9_SOYBN  RecName: Full=Cytochrome P450 71D9; AltN...    246   1e-73    
ref|XP_004305992.1|  PREDICTED: cytochrome P450 71D11-like              246   2e-73    
ref|XP_006474923.1|  PREDICTED: cytochrome P450 71D11-like              246   2e-73    
gb|KHM99473.1|  Cytochrome P450 71D11                                   244   2e-73    
gb|KHN01537.1|  Cytochrome P450 71D11                                   245   2e-73    
gb|ABO32530.1|  cytochrome P450-dependent monooxygenase-like protein    245   2e-73    
gb|EYU22011.1|  hypothetical protein MIMGU_mgv1a022953mg                239   2e-73    
ref|XP_006380104.1|  hypothetical protein POPTR_0008s21950g             244   3e-73    
ref|XP_011077043.1|  PREDICTED: premnaspirodiene oxygenase-like         245   3e-73    
ref|XP_008778500.1|  PREDICTED: premnaspirodiene oxygenase-like         244   3e-73    
ref|XP_007153131.1|  hypothetical protein PHAVU_003G009300g             243   4e-73    
gb|KDP42339.1|  hypothetical protein JCGZ_02812                         244   4e-73    
ref|XP_003636936.1|  Cytochrome P450                                    244   4e-73    
dbj|BAM68817.1|  putative cytochrome P450 monooxygenase CYP71AV1        244   5e-73    
ref|XP_003600323.1|  Cytochrome P450                                    244   5e-73    
ref|XP_006469495.1|  PREDICTED: premnaspirodiene oxygenase-like         244   6e-73    
gb|KDO58402.1|  hypothetical protein CISIN_1g010334mg                   244   7e-73    
gb|KHN36162.1|  Cytochrome P450 71D8                                    243   7e-73    
ref|XP_004305998.1|  PREDICTED: cytochrome P450 71D11-like              244   8e-73    
ref|XP_003617703.1|  Cytochrome P450                                    249   8e-73    
sp|D5JBW8.1|GAO_CICIN  RecName: Full=Germacrene A oxidase; Short=...    243   9e-73    
gb|KDP42338.1|  hypothetical protein JCGZ_02811                         243   9e-73    
ref|XP_006435925.1|  hypothetical protein CICLE_v10031280mg             243   1e-72    
gb|ABO32531.1|  cytochrome P450-dependent monooxygenase-like protein    244   1e-72    
ref|XP_003600319.1|  Cytochrome P450                                    243   1e-72    
ref|XP_007033123.1|  Cytochrome P450 71D10, putative                    243   1e-72    
ref|XP_002513337.1|  cytochrome P450, putative                          243   2e-72    
ref|XP_011095806.1|  PREDICTED: cytochrome P450 71D10-like              243   2e-72    
gb|KHN42024.1|  Cytochrome P450 71D8                                    241   2e-72    
ref|XP_010104090.1|  Cytochrome P450 71D10                              243   2e-72    
ref|XP_004516744.1|  PREDICTED: cytochrome P450 71D10-like              242   3e-72    
ref|XP_007033124.1|  Cytochrome P450 71D10, putative                    243   3e-72    
ref|XP_008779112.1|  PREDICTED: premnaspirodiene oxygenase-like         242   3e-72    
ref|XP_003545101.1|  PREDICTED: cytochrome P450 71D10-like              242   3e-72    
gb|KEH16965.1|  cytochrome P450 family 71 protein                       242   3e-72    
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg             242   3e-72    
gb|KHN08732.1|  Cytochrome P450 71D9                                    241   4e-72    
ref|XP_003617769.1|  Cytochrome P450                                    242   4e-72    
ref|XP_008794219.1|  PREDICTED: premnaspirodiene oxygenase-like         241   5e-72    
ref|XP_006474922.1|  PREDICTED: cytochrome P450 71D11-like isofor...    241   5e-72    
gb|KEH25835.1|  cytochrome P450 family 71 protein                       241   6e-72    
ref|XP_008807779.1|  PREDICTED: premnaspirodiene oxygenase-like         241   6e-72    
ref|XP_004516745.1|  PREDICTED: cytochrome P450 71D10-like              241   6e-72    
ref|XP_006447773.1|  hypothetical protein CICLE_v10014947mg             241   7e-72    
ref|XP_010910607.1|  PREDICTED: premnaspirodiene oxygenase-like         241   8e-72    
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg             241   9e-72    
gb|EYU21982.1|  hypothetical protein MIMGU_mgv1a026917mg                240   9e-72    
ref|XP_003617701.1|  Cytochrome P450                                    241   1e-71    
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...    241   1e-71    
ref|XP_003617715.1|  Cytochrome P450                                    241   1e-71    
ref|XP_007216122.1|  hypothetical protein PRUPE_ppa018839mg             241   1e-71    
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             240   1e-71    
ref|XP_008807778.1|  PREDICTED: premnaspirodiene oxygenase-like         240   1e-71    
gb|AHK60843.1|  CYP71D2                                                 241   1e-71    
gb|KDP39288.1|  hypothetical protein JCGZ_01045                         239   2e-71    
ref|XP_006602150.1|  PREDICTED: cytochrome P450 71D10-like              233   2e-71    
gb|AED99878.1|  cytochrome P450                                         240   2e-71    
gb|EYU21980.1|  hypothetical protein MIMGU_mgv1a004765mg                240   2e-71    
gb|AED99871.1|  cytochrome P450                                         239   3e-71    
ref|XP_004247352.1|  PREDICTED: premnaspirodiene oxygenase-like         239   3e-71    
ref|XP_009344942.1|  PREDICTED: premnaspirodiene oxygenase-like         240   3e-71    
gb|KHN29541.1|  Cytochrome P450 71D11                                   239   3e-71    
ref|XP_007148447.1|  hypothetical protein PHAVU_006G209600g             239   5e-71    
gb|KEH25844.1|  cytochrome P450 family 71 protein                       239   5e-71    
ref|XP_008372133.1|  PREDICTED: premnaspirodiene oxygenase-like         234   5e-71    
ref|XP_009780363.1|  PREDICTED: premnaspirodiene oxygenase-like         239   6e-71    
ref|XP_006369963.1|  hypothetical protein POPTR_0001s364101g            233   6e-71    
ref|XP_003636932.1|  Cytochrome P450                                    236   8e-71    
ref|XP_009615716.1|  PREDICTED: premnaspirodiene oxygenase-like         238   1e-70    
ref|NP_001240107.1|  uncharacterized protein LOC100818520               238   1e-70    
ref|XP_007156883.1|  hypothetical protein PHAVU_002G025200g             238   1e-70    
gb|KDP39285.1|  hypothetical protein JCGZ_01042                         238   2e-70    
ref|XP_007020552.1|  Cytochrome P450 71D10, putative                    238   2e-70    
emb|CDP11812.1|  unnamed protein product                                237   2e-70    
ref|XP_006575708.1|  PREDICTED: cytochrome P450 71D10-like              237   2e-70    
ref|XP_010910161.1|  PREDICTED: premnaspirodiene oxygenase-like         237   2e-70    
ref|XP_004516743.1|  PREDICTED: cytochrome P450 71D10-like              237   3e-70    
ref|XP_008219722.1|  PREDICTED: premnaspirodiene oxygenase-like         237   3e-70    
ref|XP_011073878.1|  PREDICTED: premnaspirodiene oxygenase-like         237   3e-70    
ref|XP_007148446.1|  hypothetical protein PHAVU_006G209500g             237   3e-70    
sp|H2DH20.1|C7D13_PANGI  RecName: Full=Cytochrome P450 CYP71D313        237   4e-70    
ref|XP_010932987.1|  PREDICTED: premnaspirodiene oxygenase-like         237   4e-70    
gb|KDP36253.1|  hypothetical protein JCGZ_09818                         237   4e-70    
gb|KHN33492.1|  Cytochrome P450 71D10-like protein                      237   4e-70    
ref|XP_003615871.1|  Cytochrome P450                                    236   5e-70    
ref|XP_008231956.1|  PREDICTED: premnaspirodiene oxygenase-like         232   5e-70    
ref|XP_006349766.1|  PREDICTED: premnaspirodiene oxygenase-like         232   6e-70    
ref|NP_001236165.1|  cytochrome P450 71D10                              236   7e-70    
ref|XP_004288803.1|  PREDICTED: cytochrome P450 71D11-like              236   9e-70    
gb|KEH34025.1|  cytochrome P450 family 71 protein                       236   1e-69    
sp|G3GBK0.1|C7BL3_CICIN  RecName: Full=Costunolide synthase; Shor...    235   1e-69    
ref|XP_003593352.1|  Cytochrome P450                                    235   2e-69    
ref|XP_002513331.1|  cytochrome P450, putative                          235   2e-69    
ref|XP_010027348.1|  PREDICTED: cytochrome P450 CYP71D312-like          235   2e-69    
ref|XP_006351653.1|  PREDICTED: premnaspirodiene oxygenase-like         234   2e-69    
gb|AES70567.2|  cytochrome P450 family 71 protein                       234   2e-69    
gb|AIZ01224.1|  epi-aristolochene dihydroxylase                         233   3e-69    
ref|XP_010929721.1|  PREDICTED: premnaspirodiene oxygenase-like         231   3e-69    
ref|XP_007022417.1|  Cytochrome P450 71D10, putative                    234   3e-69    
gb|AJD25162.1|  cytochrome P450 CYP71D374                               234   3e-69    
ref|XP_006856371.1|  hypothetical protein AMTR_s00047p00189560          234   3e-69    
ref|XP_011038767.1|  PREDICTED: cytochrome P450 71D11-like              234   3e-69    
ref|XP_009775980.1|  PREDICTED: premnaspirodiene oxygenase-like         234   4e-69    
gb|AED99873.1|  cytochrome P450                                         234   4e-69    
emb|CDP07882.1|  unnamed protein product                                235   5e-69    
ref|XP_011002269.1|  PREDICTED: cytochrome P450 71D9-like               234   5e-69    
ref|XP_003532742.2|  PREDICTED: cytochrome P450 71D10                   234   5e-69    
ref|XP_006388372.1|  hypothetical protein POPTR_0206s00240g             234   6e-69    
gb|KHN12340.1|  Cytochrome P450 71D10                                   233   6e-69    
ref|XP_003518341.1|  PREDICTED: premnaspirodiene oxygenase-like         233   1e-68    
ref|XP_008362104.1|  PREDICTED: premnaspirodiene oxygenase-like         234   1e-68    
gb|KCW76838.1|  hypothetical protein EUGRSUZ_D01192                     233   1e-68    
gb|AIA09039.1|  costunolide synthase                                    232   2e-68    
ref|XP_009587294.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    224   3e-68    
gb|KDP25064.1|  hypothetical protein JCGZ_22599                         232   3e-68    
gb|KHG00772.1|  Cytochrome P450                                         232   3e-68    
gb|KEH29697.1|  cytochrome P450 family 71 protein                       232   3e-68    
ref|XP_002310060.1|  hypothetical protein POPTR_0007s07420g             232   3e-68    
gb|KDP30978.1|  hypothetical protein JCGZ_11354                         231   5e-68    
emb|CDP13734.1|  unnamed protein product                                238   5e-68    
ref|XP_010045514.1|  PREDICTED: cytochrome P450 71A1-like               231   5e-68    
gb|AIA09038.1|  costunolide synthase                                    231   6e-68    
ref|XP_009772400.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    223   7e-68    
ref|XP_004501854.1|  PREDICTED: cytochrome P450 71A1-like               231   8e-68    
gb|KDP39110.1|  hypothetical protein JCGZ_00867                         229   9e-68    
ref|XP_009371764.1|  PREDICTED: premnaspirodiene oxygenase-like         231   1e-67    
ref|XP_006377819.1|  hypothetical protein POPTR_0011s13430g             230   1e-67    
ref|XP_002532304.1|  cytochrome P450, putative                          230   1e-67    
gb|AJD25166.1|  cytochrome P450 CYP71D413                               230   1e-67    
gb|AGN04217.1|  cytochrome P450                                         230   1e-67    
ref|XP_009344944.1|  PREDICTED: premnaspirodiene oxygenase-like         231   1e-67    
ref|XP_006585455.1|  PREDICTED: cytochrome P450 71D10-like              230   2e-67    
gb|KDP27295.1|  hypothetical protein JCGZ_20283                         229   2e-67    
gb|ADD84654.1|  CYP71D175                                               230   2e-67    
gb|KHN36161.1|  Cytochrome P450 71D8                                    228   3e-67    
emb|CDP07886.1|  unnamed protein product                                228   3e-67    
ref|XP_010045519.1|  PREDICTED: cytochrome P450 71A1-like               229   3e-67    
ref|XP_009616520.1|  PREDICTED: premnaspirodiene oxygenase-like         229   4e-67    
ref|XP_002310636.2|  hypothetical protein POPTR_0007s07310g             229   4e-67    
emb|CDP17725.1|  unnamed protein product                                229   5e-67    
emb|CDP07893.1|  unnamed protein product                                228   5e-67    
ref|XP_009402815.1|  PREDICTED: premnaspirodiene oxygenase-like         229   6e-67    
ref|XP_010911520.1|  PREDICTED: cytochrome P450 71A9-like               225   7e-67    
ref|XP_009344943.1|  PREDICTED: premnaspirodiene oxygenase-like         229   9e-67    
gb|KHN25725.1|  Cytochrome P450 71D10                                   227   9e-67    
gb|AED99876.1|  cytochrome P450                                         228   9e-67    
ref|XP_008231957.1|  PREDICTED: cytochrome P450 CYP71D312-like          231   1e-66    
sp|F8S1I0.1|C7BL2_LACSA  RecName: Full=Costunolide synthase; Shor...    227   1e-66    
emb|CDP21437.1|  unnamed protein product                                227   1e-66    
gb|KCW76712.1|  hypothetical protein EUGRSUZ_D01067                     227   1e-66    
gb|ABC59080.1|  cytochrome P450 monooxygenase CYP71D64                  227   2e-66    
ref|XP_010907207.1|  PREDICTED: premnaspirodiene oxygenase-like         226   2e-66    
ref|XP_008353443.1|  PREDICTED: premnaspirodiene oxygenase-like         222   2e-66    
gb|AJD25161.1|  cytochrome P450 CYP71BE37                               226   3e-66    



>ref|XP_009623937.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=320

 Score =   315 bits (808),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 208/285 (73%), Gaps = 5/285 (2%)
 Frame = +3

Query  36   EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
            E +H F F  +S+++FLSF+F    +R+ S    + +LPPGPW LPLIG+LH L+ G LP
Sbjct  2    ETQH-FPFIFISLLIFLSFIFRFVLIRKNSRIVTK-RLPPGPWSLPLIGNLHQLMNGRLP  59

Query  216  -HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYK  392
             H TLR+LS++YGPI HL LGEIS IV+SSP++AK I KT DL FA RP+ MS D+++Y 
Sbjct  60   IHHTLRSLSQRYGPIFHLCLGEISIIVVSSPEMAKEIMKTQDLRFATRPEFMSGDIIFYN  119

Query  393  CTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKAS-GSAPINLT  569
             TD+   PYG+YWR MRK+CVLELLS KMVKSFNS RQEE+S LISSI ++   + INL+
Sbjct  120  YTDIGTCPYGEYWRNMRKVCVLELLSAKMVKSFNSIRQEEMSSLISSINSTPDDSLINLS  179

Query  570  EKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTK  749
            +K+ WFTSS   ++AFG+V   DQ++ I+LVK+   LAGGF +ADLFPS+KW+H +SG K
Sbjct  180  DKMFWFTSSVTCRSAFGKV-IHDQDKLIMLVKDVTLLAGGFDLADLFPSRKWLHEISGLK  238

Query  750  PRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             ++LKVH ++D I E II EH++N         +   ED++DVLL
Sbjct  239  SKMLKVHTKIDVILENIINEHRNNRTIGKKGNGESGGEDLIDVLL  283



>gb|ABC69397.1| CYP71D48v1 [Nicotiana tabacum]
Length=504

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 212/283 (75%), Gaps = 7/283 (2%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
            ME +F  N V+ ++FLS +F ++    +    R+  LPPGPWKLP IGSLHHL V G LP
Sbjct  1    MEIQF-SNLVAFLLFLSSIFLVF----KKWKTRKLNLPPGPWKLPFIGSLHHLAVAGPLP  55

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  L+NL+++YGP+MHLQLG+I  +VISSPQ+AK + KTHDL FA RPK++  D+++Y  
Sbjct  56   HHGLKNLAKRYGPLMHLQLGQIPTLVISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDS  115

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
            TD+AFSPYG+YWRQ+RKIC+LELLS KMVK F+S RQ+ELS+++SSI+ + + P+NLT+K
Sbjct  116  TDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSSIRTTPNLPVNLTDK  175

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            I WFTSS I ++A G++   DQ++ I+ ++E +SLAGGF +AD FP+ K IH + G+K +
Sbjct  176  IFWFTSSVICRSALGKI-CGDQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSKSK  234

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            L+K HR++D+I E ++ EHK N A+      +   ED++DVLL
Sbjct  235  LVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGEDLIDVLL  277



>gb|ABC69396.1| CYP71D48v2 [Nicotiana tabacum]
Length=503

 Score =   319 bits (817),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 211/283 (75%), Gaps = 7/283 (2%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
            ME +F  N V+ ++FLS +F ++    +    R+  LPPGPWKLP IGSLHHL V G LP
Sbjct  1    MEIQF-SNLVAFLLFLSSIFLVF----KKWKTRKLNLPPGPWKLPFIGSLHHLAVAGPLP  55

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  L+NL+++YGP+MHLQLG+I  +VISSPQ+AK + KTHDL FA RPK++  D+++Y  
Sbjct  56   HHGLKNLAKRYGPLMHLQLGQIPTLVISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDS  115

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
            TD+A SPYG+YWRQ+RKIC+LELLS KMVK F+S RQ+ELS+++SSI+ + + P+NLT+K
Sbjct  116  TDIALSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSSIRTTPNLPVNLTDK  175

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            I WFTSS I ++A G++   DQ++ I+ ++E +SLAGGF +AD FP+ K IH + G+K +
Sbjct  176  IFWFTSSVICRSALGKI-CGDQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSKSK  234

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            L+K HR++D+I E ++ EHK N A+      +   ED++DVLL
Sbjct  235  LVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGEDLIDVLL  277



>ref|XP_009612725.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=503

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/283 (53%), Positives = 211/283 (75%), Gaps = 7/283 (2%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
            ME +F  N V+ ++FLS +F ++    +    R+  LPPGPWKLP IGSLHHL V G LP
Sbjct  1    MEIQF-SNLVAFLLFLSSIFLVF----KKWKTRKLNLPPGPWKLPFIGSLHHLAVAGPLP  55

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  L+NL+++YGP+MHLQLG+I  +VISSPQ+AK + KTHDL FA RPK++  D+++Y  
Sbjct  56   HHGLKNLAKRYGPLMHLQLGQIPTLVISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDS  115

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
            TD+AFSPYG+YWRQ+RKIC+LELLS KMVK F+S RQ+ELS+++S I+ + + P+NLT+K
Sbjct  116  TDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSYIRTTPNLPVNLTDK  175

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            I WFTSS I ++A G++   DQ++ I+ ++E +SLAGGF +AD FP+ K IH + G+K +
Sbjct  176  IFWFTSSVICRSALGKI-CGDQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSKSK  234

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            L+K HR++D+I E ++ EHK N A+      +   ED++DVLL
Sbjct  235  LVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGEDLIDVLL  277



>ref|XP_009623936.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   314 bits (805),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/285 (55%), Positives = 208/285 (73%), Gaps = 5/285 (2%)
 Frame = +3

Query  36   EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
            E +H F F  +S+++FLSF+F    +R+ S    + +LPPGPW LPLIG+LH L+ G LP
Sbjct  2    ETQH-FPFIFISLLIFLSFIFRFVLIRKNSRIVTK-RLPPGPWSLPLIGNLHQLMNGRLP  59

Query  216  -HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYK  392
             H TLR+LS++YGPI HL LGEIS IV+SSP++AK I KT DL FA RP+ MS D+++Y 
Sbjct  60   IHHTLRSLSQRYGPIFHLCLGEISIIVVSSPEMAKEIMKTQDLRFATRPEFMSGDIIFYN  119

Query  393  CTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKAS-GSAPINLT  569
             TD+   PYG+YWR MRK+CVLELLS KMVKSFNS RQEE+S LISSI ++   + INL+
Sbjct  120  YTDIGTCPYGEYWRNMRKVCVLELLSAKMVKSFNSIRQEEMSSLISSINSTPDDSLINLS  179

Query  570  EKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTK  749
            +K+ WFTSS   ++AFG+V   DQ++ I+LVK+   LAGGF +ADLFPS+KW+H +SG K
Sbjct  180  DKMFWFTSSVTCRSAFGKV-IHDQDKLIMLVKDVTLLAGGFDLADLFPSRKWLHEISGLK  238

Query  750  PRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             ++LKVH ++D I E II EH++N         +   ED++DVLL
Sbjct  239  SKMLKVHTKIDVILENIINEHRNNRTIGKKGNGESGGEDLIDVLL  283



>ref|XP_006365912.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=512

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 203/276 (74%), Gaps = 5/276 (2%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLSR  242
            +S+++FL F+F ++ + ++S     +KLPPGPWKLP+IG+LH L   G LPH TLR LS+
Sbjct  12   ISLLLFLYFIFYLFQIWKKSK-TLTKKLPPGPWKLPIIGNLHQLASHGGLPHHTLRTLSQ  70

Query  243  KYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYG  422
            KYGP+ HLQLGEISAIV+SSP++AK I KT D+ FA RP+ M+  +++Y  +D+A  PYG
Sbjct  71   KYGPLTHLQLGEISAIVVSSPEMAKEIMKTQDVRFATRPQSMTGSIIFYNYSDIALCPYG  130

Query  423  DYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKAS--GSAPINLTEKICWFTSS  596
            DYWR MRKICVLELLS KMVKSFNS RQEE+S L+SSI  S    + +NL+ KI WFT S
Sbjct  131  DYWRNMRKICVLELLSAKMVKSFNSIRQEEMSSLVSSIINSTPDESLVNLSNKIFWFTGS  190

Query  597  TIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHRE  776
               ++AFG+V   DQ++ I+LVKEA+SL+ GF + DLFPS KW+H +SG K RLLK H +
Sbjct  191  VTCRSAFGKVVH-DQDKLIMLVKEAVSLSSGFDLTDLFPSHKWLHGISGMKSRLLKAHEK  249

Query  777  VDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            VD I E +I EH +N AN N    +   ED++DVLL
Sbjct  250  VDVILEKLINEHCENRANGNKGNGESGAEDLIDVLL  285



>gb|AAF27282.1|AF122821_1 cytochrome P450 [Capsicum annuum]
Length=502

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/252 (56%), Positives = 191/252 (76%), Gaps = 2/252 (1%)
 Frame = +3

Query  132  ARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQ  308
             ++  LPPGPWKLP IGSLHHL V G LPH  L+NL++ YGP+MHL+LGEI  ++ISSP+
Sbjct  27   TQKLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKLYGPLMHLRLGEIPTVIISSPR  86

Query  309  LAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKS  488
            +AK + KTHDL FA RPK++  D+V+Y  TD+AFSPYG+YWRQ+RKIC+LELLS KMVK 
Sbjct  87   MAKEVLKTHDLAFATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKF  146

Query  489  FNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKE  668
            F+S RQ+ELS ++SSI+   + P+NLT+KI WFTSS   ++A G++ R DQ++ I+ ++E
Sbjct  147  FSSIRQDELSMMVSSIRTMPNFPVNLTDKIFWFTSSVTCRSALGKICR-DQDKLIIFMRE  205

Query  669  ALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKA  848
             +SL GGF +AD FP+ K +H V G+K RLLK HR++D+I E ++ EHK N A+      
Sbjct  206  IISLTGGFSIADFFPTWKMLHDVGGSKTRLLKAHRKIDEILEHVVNEHKQNRADGQKGNG  265

Query  849  KDHEEDIVDVLL  884
            +   ED++DVLL
Sbjct  266  EFGGEDLIDVLL  277



>emb|CDP08465.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   307 bits (787),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/261 (54%), Positives = 191/261 (73%), Gaps = 1/261 (0%)
 Frame = +3

Query  102  IYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEI  281
            I  L+R       QKLPPGPWKLP IG +HHL+G SLPHR L+NL++KYG +MHLQLGE+
Sbjct  24   IKELKRSQKTKTIQKLPPGPWKLPFIGCMHHLIG-SLPHRCLKNLAQKYGSLMHLQLGEV  82

Query  282  SAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLE  461
            S I+++SP LAK I KTHDL FA RP++++F ++ Y   D+AFSPYGDYWRQMRKI VLE
Sbjct  83   SLIIVTSPNLAKEIMKTHDLSFATRPELLAFKIICYDTKDIAFSPYGDYWRQMRKISVLE  142

Query  462  LLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQ  641
            LLS K V+SF + RQ+E+  L+ +I+      +NLTE++  + SS + +AAFG+V +EDQ
Sbjct  143  LLSAKSVRSFENIRQDEVLHLVEAIRPLAGKKVNLTEQVFSYASSMVCRAAFGQVSKEDQ  202

Query  642  ERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDN  821
              F+ L+K+  +LAGGF +ADLFPS K +H ++G KP+LLK+H ++D IFE +IEEH  N
Sbjct  203  YEFVQLMKQVAALAGGFDIADLFPSYKILHVLTGMKPKLLKIHHKMDSIFEKLIEEHIKN  262

Query  822  MANRNNNKAKDHEEDIVDVLL  884
                    A  ++ED++DVLL
Sbjct  263  QTRNKKLVADSNQEDLIDVLL  283



>gb|ABC69395.1| CYP71D47v2 [Nicotiana tabacum]
Length=503

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 194/252 (77%), Gaps = 2/252 (1%)
 Frame = +3

Query  132  ARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQ  308
             R+  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I  ++ISSPQ
Sbjct  27   TRKLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLIISSPQ  86

Query  309  LAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKS  488
            +AK + KTHDL FA RPK+++ D+++Y  TD+AFSPYG+YWRQ+RKIC+LELLS KMVK 
Sbjct  87   MAKEVLKTHDLAFATRPKLVAADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKF  146

Query  489  FNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKE  668
            F+S RQ+ELS+++SSI+ + +  +NLT+KI WFTSS   ++A G++   DQ++ I+ ++E
Sbjct  147  FSSIRQDELSKMLSSIRTTPNLTVNLTDKIFWFTSSVTCRSALGKICG-DQDKLIIFMRE  205

Query  669  ALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKA  848
             +SLAGGF +AD FP+ K IH + G+K +L+K HR++D+I   +++EHK N A+      
Sbjct  206  IISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNRADGKKGNG  265

Query  849  KDHEEDIVDVLL  884
            +   ED++DVLL
Sbjct  266  EFGGEDLIDVLL  277



>ref|XP_009766832.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=503

 Score =   306 bits (784),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 193/252 (77%), Gaps = 2/252 (1%)
 Frame = +3

Query  132  ARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQ  308
             R+  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I  ++ISSPQ
Sbjct  27   TRKLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLIISSPQ  86

Query  309  LAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKS  488
            +AK + KTHDL FA RPK++  D+++Y  TD+AFSPYG+YWRQ+RKIC+LELLS KMVK 
Sbjct  87   MAKEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKF  146

Query  489  FNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKE  668
            F+S RQ+ELS+++SSI+ + +  +NLT+KI WFTSS   ++A G++   DQ++ I+ ++E
Sbjct  147  FSSIRQDELSKMVSSIRTTPNLTVNLTDKIFWFTSSVTCRSALGKICG-DQDKLIIFMRE  205

Query  669  ALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKA  848
             +SLAGGF +AD FP+ K IH + G+K +L+K HR++D+I   +++EHK N A+      
Sbjct  206  IISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNRADGKKGNG  265

Query  849  KDHEEDIVDVLL  884
            +   ED++DVLL
Sbjct  266  EFGGEDLIDVLL  277



>gb|ABC69394.1| CYP71D47v1 [Nicotiana tabacum]
Length=503

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 193/252 (77%), Gaps = 2/252 (1%)
 Frame = +3

Query  132  ARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQ  308
             R+  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I  ++ISSPQ
Sbjct  27   TRKLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLIISSPQ  86

Query  309  LAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKS  488
            +AK + KTHDL FA RPK++  D+++Y  TD+AFSPYG+YWRQ+RKIC+LELLS KMVK 
Sbjct  87   MAKEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKF  146

Query  489  FNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKE  668
            F+S RQ+ELS+++SSI+ + +  +NLT+KI WFTSS   ++A G++   DQ++ I+ ++E
Sbjct  147  FSSIRQDELSKMLSSIRTTPNLTVNLTDKIFWFTSSVTCRSALGKICG-DQDKLIIFMRE  205

Query  669  ALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKA  848
             +SLAGGF +AD FP+ K IH + G+K +L+K HR++D+I   +++EHK N A+      
Sbjct  206  IISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNRADGKKGNG  265

Query  849  KDHEEDIVDVLL  884
            +   ED++DVLL
Sbjct  266  EFGGEDLIDVLL  277



>ref|XP_009770332.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=523

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/294 (51%), Positives = 214/294 (73%), Gaps = 5/294 (2%)
 Frame = +3

Query  12   LVGSSFVSEMEHKFLFNP-VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSL  188
            ++   F+SEME K L +  +SV++F+SF+F +  + + S     + LPPGPW  PLIG+L
Sbjct  6    IIYDPFLSEMEAKHLSSIFISVLIFVSFIFRLVQIWKASK-TFNKILPPGPWSPPLIGNL  64

Query  189  HHLVGGSLP-HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKM  365
            H  + G LP H TLR+LSR+YGPI HL+LGEIS IV+SSP++AK I KT DL FA RP+ 
Sbjct  65   HLFMNGRLPVHHTLRSLSRRYGPIFHLRLGEISIIVVSSPEMAKEIMKTQDLRFATRPEF  124

Query  366  MSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKA-  542
            M+ D+++Y  TD+   PYGD+WR MRK+C++ELLS KMVKSFNS RQ E+S LISS+ + 
Sbjct  125  MAGDIIFYNYTDIITCPYGDHWRNMRKVCIVELLSAKMVKSFNSIRQAEMSSLISSVNSM  184

Query  543  SGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKK  722
               + INL++K+ WFTSS   ++AFG+V   DQ++ I+LVK+  SLA GF +AD+FPS+K
Sbjct  185  PDDSLINLSDKMFWFTSSVTCRSAFGKV-IHDQDKLIMLVKDISSLAAGFDLADMFPSRK  243

Query  723  WIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            W+H ++G K ++LKVH++VD I E I+ EH+++ AN   +  +   ED++DVLL
Sbjct  244  WLHKITGLKSKMLKVHKKVDAILENILNEHQESRANGKKSNGETGGEDLIDVLL  297



>ref|XP_006350393.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   303 bits (776),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 195/255 (76%), Gaps = 5/255 (2%)
 Frame = +3

Query  126  NPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSP  305
            N ++ +KLPPGPWKLP IGS+HHL GG LPHR LR+L+ KYGP+MHLQLGE+SA+V++SP
Sbjct  24   NNSQTKKLPPGPWKLPFIGSMHHLAGG-LPHRVLRDLAEKYGPLMHLQLGEVSAVVVTSP  82

Query  306  QLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVK  485
            ++AK + KTHD+ FA+RPK+++ D++ Y   D+AFSPYG+YWRQMRKIC++E+LS K V+
Sbjct  83   EMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGEYWRQMRKICIMEVLSAKNVR  142

Query  486  SFNSFRQEELSELISSIKA--SGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            SF+S R +E+  LI SI+   +    +N TE+I WFTSS   ++AFG+V +E QE FI L
Sbjct  143  SFSSIRHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKE-QEVFIKL  201

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            ++E +SLA GF VAD+FPS K++H   G K +LL  HR+VD I E +I+EHK N+A R +
Sbjct  202  IREVISLAEGFDVADIFPSYKFLHGFGGAKKKLLNAHRKVDSIVEDVIKEHKKNIATRKS  261

Query  840  NKAKDHEEDIVDVLL  884
            + A    ED+VDVLL
Sbjct  262  DDAIGG-EDLVDVLL  275



>ref|XP_009623934.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/285 (53%), Positives = 205/285 (72%), Gaps = 5/285 (2%)
 Frame = +3

Query  39   MEHKFL-FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
            ME K L F  +SV++F+SF+  ++ + + S    +  LPPGPW LPLIG+LH L+ G LP
Sbjct  1    MEAKHLSFIFISVLIFVSFIIRLFQIWKASKTFNKL-LPPGPWSLPLIGNLHLLMNGRLP  59

Query  216  -HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYK  392
             H T R+LSR+YGPI HL+LGEIS IV+SSP++AK I KT DL FA RP+ MS D+++Y 
Sbjct  60   VHHTFRSLSRRYGPIFHLRLGEISIIVVSSPEMAKEIMKTQDLRFATRPEFMSGDIIFYN  119

Query  393  CTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKA-SGSAPINLT  569
             TD+   PYGD+WR MRK+C++ELLS KMVKSFNS RQ E+S LISSI +    + INL+
Sbjct  120  YTDIITCPYGDHWRNMRKVCIVELLSAKMVKSFNSIRQAEMSSLISSINSMPDDSLINLS  179

Query  570  EKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTK  749
            +K+ WFTSS   ++AFG+V   DQ + I+LVK+  SLA GF +AD+FPS+KW+H ++G K
Sbjct  180  DKMFWFTSSVTCRSAFGKV-IHDQHKLIMLVKDIASLAAGFDLADMFPSRKWLHKITGLK  238

Query  750  PRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             ++LKVH +VD I E II EH+++  N      +   ED++DVLL
Sbjct  239  SKMLKVHTKVDAILENIINEHRESRTNGKKGNGETGGEDLIDVLL  283



>ref|XP_006361940.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/248 (57%), Positives = 190/248 (77%), Gaps = 3/248 (1%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAI  323
            LPPGPWKLP IGSLHHL V G LPH  L+NL++ YG +MHLQLGEI  ++ISSP++AK +
Sbjct  32   LPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKCYGALMHLQLGEIPTVIISSPRMAKEV  91

Query  324  TKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFR  503
             KTHDLVFA RPK++  D+V+Y  TD+AFSPYG+YWRQ+RKIC+LELLS KMVK F+S R
Sbjct  92   LKTHDLVFATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIR  151

Query  504  QEELSELISSIKA-SGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            Q+ELS+++SSI+    + P+NLT+KI WFTSS   ++A G++   DQ++ I+ ++E +SL
Sbjct  152  QDELSKMVSSIRTMPNNLPVNLTDKIFWFTSSVTCRSALGKICC-DQDKLIIFMREIISL  210

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE  860
            AGGF VAD FP+ K +H V G+K RL+K HR++D+I E ++ EHK N A+      +   
Sbjct  211  AGGFSVADFFPTWKMLHDVGGSKTRLVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGG  270

Query  861  EDIVDVLL  884
            ED++DVLL
Sbjct  271  EDLIDVLL  278



>ref|XP_006339043.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=509

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 192/260 (74%), Gaps = 3/260 (1%)
 Frame = +3

Query  111  LRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRKYGPIMHLQLGEISA  287
            ++R+ +    +KLPPGPWKLP +GS+HHLV  G LPH  L NLS+KYGP+MHLQLGEIS 
Sbjct  24   VQRKKSRNLNKKLPPGPWKLPFLGSIHHLVLEGGLPHHALTNLSKKYGPLMHLQLGEIST  83

Query  288  IVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELL  467
            +++SS  +A+ + KTHDL FA+RPK+ S D + YK TD+AF+PYG+YWRQMRK+CV+ELL
Sbjct  84   VIVSSTDMAREVLKTHDLAFASRPKLASVDTICYKSTDIAFTPYGEYWRQMRKVCVMELL  143

Query  468  STKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKAAFGRVRREDQE  644
            + K V+SF+S R++E S L+  I++S    PIN+TE+I W+ SS   KAAFG + + DQE
Sbjct  144  TAKNVRSFSSIRKDEASGLVQFIQSSTCGEPINVTERILWYQSSITCKAAFGELLK-DQE  202

Query  645  RFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNM  824
            +FI +VKE + LAGGF +AD+FPS K +  +SG + R+LKVH+ VD I E +I EHK N+
Sbjct  203  KFIQMVKEVMELAGGFNLADIFPSIKILQVLSGVRSRILKVHKNVDAIVEDVINEHKKNI  262

Query  825  ANRNNNKAKDHEEDIVDVLL  884
            A+          ED+VDVLL
Sbjct  263  ASGKKGNGAFGGEDLVDVLL  282



>ref|XP_009609826.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Nicotiana 
tomentosiformis]
Length=304

 Score =   295 bits (755),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 142/273 (52%), Positives = 202/273 (74%), Gaps = 7/273 (3%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            VS ++F+SF+F +    R+S     +KLPPGPW+LP+IGS+HHL  G +PHR LRNLS+K
Sbjct  7    VSFLLFISFIFLLIQKWRKS-----KKLPPGPWRLPIIGSVHHLTSG-VPHRVLRNLSQK  60

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            +GPIM+LQLGE+  +V+SSP +AK I KTHDL FA+RP++M   ++ Y C D+AFSPYGD
Sbjct  61   FGPIMYLQLGEVPTVVVSSPHMAKQILKTHDLAFASRPEIMMGKIICYDCKDIAFSPYGD  120

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWR MRK+  LELLS KMVKSF+  RQ+ELS L+SSI++ G+ PINL EK+ WF ++   
Sbjct  121  YWRHMRKLSTLELLSAKMVKSFSPIRQDELSSLLSSIESMGNLPINLVEKLLWFMNAATC  180

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            ++AFG+V + DQ+  I L+++A SL+GGF +ADLFPSKK++H +SG + +L++   ++D 
Sbjct  181  RSAFGKVCK-DQKELITLIQQAESLSGGFELADLFPSKKFLHGISGMRSKLMEARNKIDV  239

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + + II  H++N AN N+   +    D +DV L
Sbjct  240  VLDNIINVHRENRANGNSCNGESGTVDFIDVFL  272



>sp|P93531.1|C71D7_SOLCH RecName: Full=Cytochrome P450 71D7 [Solanum chacoense]
 gb|AAB61965.1| putative cytochrome P450 [Solanum chacoense]
Length=500

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 193/255 (76%), Gaps = 5/255 (2%)
 Frame = +3

Query  126  NPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSP  305
            N ++ +KLPPGPWKLP IG +HHL GG LPHR LR+L+ KYGP+MHLQLGE+SA+V++SP
Sbjct  24   NNSQTKKLPPGPWKLPFIGGMHHLAGG-LPHRVLRDLAEKYGPLMHLQLGEVSAVVVTSP  82

Query  306  QLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVK  485
            ++AK + KTHD+ FA+RPK+++ D++ Y   D+AFSPYGDYWRQMRKIC++E+LS K V+
Sbjct  83   EMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGDYWRQMRKICIMEVLSAKSVR  142

Query  486  SFNSFRQEELSELISSIKA--SGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            SF+S R +E+  LI SI+   +    +N TE+I WFTSS   ++AFG+V +E QE FI L
Sbjct  143  SFSSIRHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKE-QEVFIKL  201

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            ++E +SLA GF VAD+FPS K++H   G K +LL  HR+VD I E +I+EHK N+A R +
Sbjct  202  IREVISLAEGFDVADIFPSYKFLHGFGGAKQKLLNAHRKVDSIVEDVIKEHKKNLATRKS  261

Query  840  NKAKDHEEDIVDVLL  884
            + A    ED+VD L+
Sbjct  262  DDAIGG-EDLVDALV  275



>ref|XP_006367966.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   301 bits (771),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 151/291 (52%), Positives = 206/291 (71%), Gaps = 10/291 (3%)
 Frame = +3

Query  27   FVSEMEHK----FLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHH  194
              S+ME++    F+F  +S+++FLS  F +    ++S  +  + LPPGPW+LP IG+LH 
Sbjct  6    LASKMEYQHFPYFIF--ISLVLFLSSFFLVSQKWKKSK-SPNKTLPPGPWRLPFIGNLHQ  62

Query  195  LVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSF  374
            L+   LPHR+LRNLS+KYGPIMHL+LG IS IVISS ++AK I KT DL F +RP++MS 
Sbjct  63   LMS-DLPHRSLRNLSKKYGPIMHLRLGNISTIVISSSEMAKEIMKTQDLHFVDRPQIMST  121

Query  375  DVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASG-S  551
             +++Y CTD+ FS YGDYWR MRK+CVLELLSTKMVKS  S RQEE+S LISS+++S   
Sbjct  122  SIIFYDCTDIGFSSYGDYWRNMRKVCVLELLSTKMVKSLASIRQEEISNLISSLRSSTPD  181

Query  552  APINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIH  731
            + INL+ KI WFT++   +A  G++   D+ +FI+LVK+  SL GGF + DLFPS+KW+H
Sbjct  182  SLINLSNKIFWFTNTVTCRAVSGKI-IHDRNKFIMLVKDIYSLIGGFDLTDLFPSQKWLH  240

Query  732  YVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             +SG K +L K H +VD+I E I+ +H+DN A       +   ED VD LL
Sbjct  241  NISGMKYKLSKAHSKVDEILEQIVNDHRDNRAKGTKYNGESGNEDFVDALL  291



>ref|XP_006350394.1| PREDICTED: cytochrome P450 71D6-like [Solanum tuberosum]
Length=501

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 198/259 (76%), Gaps = 4/259 (2%)
 Frame = +3

Query  114  RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIV  293
            ++ S  ++ +KLPPGPWKLP IGS+HHL GG LPHR LR+L++KYGP+MHLQLGE+SA+V
Sbjct  20   KKYSKYSQTKKLPPGPWKLPFIGSMHHLAGG-LPHRVLRDLAKKYGPLMHLQLGEVSAVV  78

Query  294  ISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLST  473
            ++SP +AK I KTHD+ FA+RPK+++ D++ Y   D+AFSPYG+YW+QMRKICV+E+LS 
Sbjct  79   VTSPDIAKQILKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVMEVLSA  138

Query  474  KMVKSFNSFRQEELSELISSIKASGSAP--INLTEKICWFTSSTIAKAAFGRVRREDQER  647
            K V+SF+S R +E+  LI SI++S S+   +NLTE++ WFTSS   ++AFG+V +E Q+ 
Sbjct  139  KSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNLTERVIWFTSSMTCRSAFGQVPKE-QDM  197

Query  648  FIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMA  827
            FI L++E +SLA GF VAD+FPS K++H     K +LL VHR+VD I E +I EHK N +
Sbjct  198  FIKLIREVISLAEGFDVADIFPSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNFS  257

Query  828  NRNNNKAKDHEEDIVDVLL  884
             R N+      ED+VDVLL
Sbjct  258  TRKNDDHALGGEDLVDVLL  276



>ref|XP_006341699.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=501

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/279 (51%), Positives = 194/279 (70%), Gaps = 5/279 (2%)
 Frame = +3

Query  48   KFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTL  227
            + LF   S+++FLSF+     L R+ +    +KLPPGPWKLP IG+LH L+ G LPH T 
Sbjct  2    ELLFIITSLVLFLSFIL----LLRKQSKIFNKKLPPGPWKLPFIGNLHQLMNGRLPHHTF  57

Query  228  RNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVA  407
            R+LSRKYGPI HL+LGE+S +V+SSP  AK I K  DL FA RP+++  +++ Y  +D+ 
Sbjct  58   RDLSRKYGPIFHLRLGEVSHVVVSSPDTAKEIMKIQDLHFATRPQLLFGEIIMYNHSDIG  117

Query  408  FSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWF  587
              PYGDYWR MRK+C LELLSTKMV+SF+S RQ E+S LISSI +   + INLT+KI WF
Sbjct  118  TCPYGDYWRNMRKVCTLELLSTKMVRSFDSIRQAEMSSLISSINSMPDSLINLTDKIFWF  177

Query  588  TSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKV  767
            T     ++AFG++    Q++ I+L+K+   LAGGF + D+FPS+KW+H + G K ++LKV
Sbjct  178  TGPVTCRSAFGKIIH-GQDKLIMLLKDITLLAGGFDLTDVFPSRKWLHGICGLKSKILKV  236

Query  768  HREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            H E+D I E II EH  N AN     ++   ED++DVLL
Sbjct  237  HNEMDAILENIINEHCRNRANGKKGNSESEGEDLIDVLL  275



>ref|XP_004233564.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   298 bits (764),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 191/248 (77%), Gaps = 3/248 (1%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAI  323
            LPPGPWKLP IGSLHHL + G LPH  L+NL+++YG +++LQLGEI  ++ISSP++AK +
Sbjct  32   LPPGPWKLPFIGSLHHLALAGPLPHHGLKNLAKRYGALIYLQLGEIPTVIISSPRMAKEV  91

Query  324  TKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFR  503
             KTHDLVFA RPK++  D+V+Y  +D+AFSPYG+YWRQ+RKIC+LELLS KMVK F+S R
Sbjct  92   LKTHDLVFATRPKLVVADIVHYDSSDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIR  151

Query  504  QEELSELISSIKA-SGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            Q+ELS+++SSI+    + P+NLT+KI WFTSS   ++A G++   DQ++ I+ ++E +SL
Sbjct  152  QDELSKMVSSIRTMPNNHPVNLTDKIFWFTSSVTCRSALGKICC-DQDKLIIFMREIISL  210

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE  860
            AGGF VAD FP+ K +H V G+K RLLK HR++D+I E ++ EHK N A+      +   
Sbjct  211  AGGFSVADFFPTWKMLHDVGGSKTRLLKAHRKIDEILENVVNEHKQNRADGKKGNGEFGG  270

Query  861  EDIVDVLL  884
            ED++DVLL
Sbjct  271  EDLIDVLL  278



>ref|XP_009598320.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=502

 Score =   298 bits (763),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/277 (51%), Positives = 202/277 (73%), Gaps = 5/277 (2%)
 Frame = +3

Query  54   LFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             FN VS+ +F+S +F     ++ +N  +R  LPPGPWK+P +GS+ H++GG LPH  L N
Sbjct  3    FFNLVSIFLFVSSLFLFMKWKKSNNQTKR--LPPGPWKVPFLGSMFHMLGG-LPHHVLTN  59

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L++KYGP+MHLQLGE+S +V++SP++AK + KTHDL FA+RPK+++ D+V Y  TD+AFS
Sbjct  60   LAKKYGPLMHLQLGEMSVVVVTSPEMAKEVLKTHDLAFASRPKLVAVDIVGYNGTDIAFS  119

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTS  593
            PYGDYWRQMRKICV+ELLS K V+SFNS R++E+  LI   ++S   P+N+T++I  F S
Sbjct  120  PYGDYWRQMRKICVMELLSAKNVRSFNSIRRDEVCSLIEFFRSSAGEPVNVTKRIYVFAS  179

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
            S I ++AFG+V +E Q+  I L+K+   L GGF VAD+FPS+K +H +SG K + + +H 
Sbjct  180  SMIFRSAFGKVIKE-QDECIRLIKDVSGLVGGFDVADIFPSQKVLHVLSGKKGKTMYLHH  238

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            ++D I E +I EHK N+A    N  +   ED++DVLL
Sbjct  239  KIDTIIENVINEHKQNLATGKFN-GQLGSEDLIDVLL  274



>ref|XP_009609720.1| PREDICTED: premnaspirodiene oxygenase [Nicotiana tomentosiformis]
Length=376

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 199/255 (78%), Gaps = 3/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++R+KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  23   KNSNSQRKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP +AK + KTHD+ FA+RP +++ ++V Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  82   SPDMAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V++++S R++E+  L++ I++S   P+N+TE+I  FTSS   ++AFG+V +E Q++FI L
Sbjct  142  VRTYSSIRRDEVLRLLNFIRSSSGEPVNITERIFLFTSSMTCRSAFGQVFKE-QDKFIQL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            +KE + LAGGF VAD+FPS K++H +SG K +++  H +VD I E +I +HK N+A    
Sbjct  201  IKEVILLAGGFDVADIFPSYKFLHVLSGMKGKIMNAHHKVDAIVENVINKHKKNLAIGKT  260

Query  840  NKAKDHEEDIVDVLL  884
            N A    ED++DVLL
Sbjct  261  NGALGG-EDLIDVLL  274



>sp|A6YIH8.1|C7D55_HYOMU RecName: Full=Premnaspirodiene oxygenase; Short=HPO; AltName: 
Full=Cytochrome P450 71D55 [Hyoscyamus muticus]
 gb|ABS00393.1| cytochrome P450 hydroxylase [Hyoscyamus muticus]
Length=502

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 199/255 (78%), Gaps = 3/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  23   KNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP +AK + KTHD+ FA+RPK+++ ++V Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  82   SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+SF+S R++E+  L++ +++S S P+N TE++  FTSS   ++AFG+V +E QE FI L
Sbjct  142  VRSFSSIRRDEVLRLVNFVRSSTSEPVNFTERLFLFTSSMTCRSAFGKVFKE-QETFIQL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            +KE + LAGGF VAD+FPS K++H ++G + +++K H +VD I E +I EHK N+A    
Sbjct  201  IKEVIGLAGGFDVADIFPSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNLAMGKT  260

Query  840  NKAKDHEEDIVDVLL  884
            N A    ED++DVLL
Sbjct  261  NGALGG-EDLIDVLL  274



>ref|XP_006350417.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 193/259 (75%), Gaps = 5/259 (2%)
 Frame = +3

Query  114  RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIV  293
            ++ SN  + +KLPPGPWKLP IGS+HHL GG L HR LR+L++KYGP+MHLQLGE+SA+V
Sbjct  20   KKYSNNTQTKKLPPGPWKLPFIGSMHHLAGG-LSHRVLRDLAKKYGPLMHLQLGEVSAVV  78

Query  294  ISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLST  473
             +SP +AK + K HD+ FA+RP +++ D++ Y   D+AF PYG+YWRQMRKICV+E+L  
Sbjct  79   ATSPDMAKQVLKIHDIAFASRPSLLATDIICYNRRDIAFIPYGEYWRQMRKICVMEVLGA  138

Query  474  KMVKSFNSFRQEELSELISSIKAS--GSAPINLTEKICWFTSSTIAKAAFGRVRREDQER  647
            K V+SF+S R++E+  LI SI++S     P+N TEKI WFTSS   ++AFG+V +E QE 
Sbjct  139  KNVRSFSSIRRDEVVRLIDSIQSSSFSGEPVNFTEKIIWFTSSMTCRSAFGQVLKE-QEV  197

Query  648  FIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMA  827
            FI L++E +SL  GF VAD+FPS K++H   G K +LL  HR+VD I E +I+EHK N+A
Sbjct  198  FIKLIREVISLTEGFDVADIFPSYKFLHGFGGAKKQLLNAHRKVDSIVEDVIKEHKKNLA  257

Query  828  NRNNNKAKDHEEDIVDVLL  884
             R ++ +    ED+VDVLL
Sbjct  258  TRKSDDSIGG-EDLVDVLL  275



>ref|XP_006339044.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 185/250 (74%), Gaps = 3/250 (1%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
            +KLPPGPW LP +GSLHHL + G LPH  L NL +KYGP MHLQLGE S +V+SS  +A+
Sbjct  34   KKLPPGPWNLPFLGSLHHLALEGGLPHHALTNLGKKYGPFMHLQLGETSMVVVSSLDMAR  93

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             + KTHDL FA+RPK++S D+++YK TD+AFS YG+YWRQMRKICVLEL + K V+SF+S
Sbjct  94   EVMKTHDLAFASRPKLVSLDIIFYKSTDIAFSSYGEYWRQMRKICVLELFTAKNVRSFSS  153

Query  498  FRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEAL  674
             R++E S L+  I++S    PIN+TE+I W+ SS  ++AAFG++ + DQE+FI LVKE +
Sbjct  154  IRRDEASSLVQFIRSSTRGEPINVTEQISWYESSNTSRAAFGKLLK-DQEKFIGLVKELV  212

Query  675  SLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKD  854
             LA GF VAD FPS K +H +SG + R+LKVH+ VD I E +I EHK N+A+        
Sbjct  213  ELASGFSVADFFPSIKILHVLSGVRSRILKVHKNVDAIVEDVINEHKKNIASGKKGNGAF  272

Query  855  HEEDIVDVLL  884
              ED+VDVLL
Sbjct  273  GGEDLVDVLL  282



>ref|XP_009796910.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 203/276 (74%), Gaps = 5/276 (2%)
 Frame = +3

Query  57   FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
            F+ VS+ +F SF+F +       N A+R  LPPGPWKLP++GS+ H+VGG LPHR LR+L
Sbjct  4    FDLVSIFIFASFLFLLKKWMNSKNQAKR--LPPGPWKLPILGSMLHMVGG-LPHRVLRDL  60

Query  237  SRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSP  416
            ++KYGP+MHLQLGE+S +V++SP++AK + KTHDL FA+RPK+++ ++V Y  +DVAF+P
Sbjct  61   AKKYGPLMHLQLGEVSVVVVTSPEIAKEVLKTHDLAFASRPKLLAAEIVLYDSSDVAFAP  120

Query  417  YGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSS  596
            YGDYWRQMRKICVLE+LSTK V+SF+S R++E+  LI   ++S   P+N T++I  F S 
Sbjct  121  YGDYWRQMRKICVLEVLSTKNVRSFSSIRRDEVVRLIEFFRSSSGKPVNFTKRISLFMSF  180

Query  597  TIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHRE  776
             I ++AFG V +E Q+ FI ++K+  +L  GF VAD+FPS K++H ++G + + + +H +
Sbjct  181  IICRSAFGTVFKE-QDEFIQVMKDVTALLEGFDVADIFPSLKFLHVLTGMRAKAMNLHHK  239

Query  777  VDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            VD I + II EHK N+A    N  +   ED++DVLL
Sbjct  240  VDDIVDNIINEHKKNLATGKFN-GQLGGEDLIDVLL  274



>dbj|BAN58140.1| putative premaspirodiene oxygenase [Hyoscyamus albus]
Length=502

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 198/255 (78%), Gaps = 3/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  23   KNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP +AK + KTHD+ FA+RPK+++ ++V Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  82   SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+SF+S R++E+  L++ +++  S P+N TE++  FTSS   ++AFG+V +E QE FI L
Sbjct  142  VRSFSSIRRDEVLRLVNFVRSCTSKPVNFTERLFLFTSSMTCRSAFGKVFKE-QETFIQL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            +KE + LAGGF VAD+FPS K++H ++G + +++K H +VD I E +I EHK N+A    
Sbjct  201  IKEVIGLAGGFDVADIFPSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNLAMGKT  260

Query  840  NKAKDHEEDIVDVLL  884
            N A    ED++DVLL
Sbjct  261  NGALGG-EDLIDVLL  274



>ref|XP_006350396.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/255 (53%), Positives = 196/255 (77%), Gaps = 3/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWKLPL+GS+ H+ GG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  23   KNSNSQSKKLPPGPWKLPLLGSMLHMAGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP +AK + KTHD+ FA+RPK+++ ++V Y  +D+AF PYGDYWRQMRKICVLELLS K 
Sbjct  82   SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+S+ S R++E+  L++ I++S   P+N TE++  FTSS   ++AFG+V +E Q++FI L
Sbjct  142  VRSYGSIRRDEVDRLVNFIRSSSGEPVNFTERLFLFTSSMTCRSAFGKVFKE-QDKFIQL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            +KE + LAGGF VAD+FPS K++H +SG K +++  H +VD I E +I EHK N+A    
Sbjct  201  IKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHDKVDAIVEDVINEHKKNIAMGKT  260

Query  840  NKAKDHEEDIVDVLL  884
            N A    ED++DVL+
Sbjct  261  NGALGG-EDLIDVLI  274



>ref|XP_009622900.1| PREDICTED: cytochrome P450 71D7-like [Nicotiana tomentosiformis]
 gb|ABC69401.1| CYP71D49v2 [Nicotiana tabacum]
Length=505

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 200/277 (72%), Gaps = 7/277 (3%)
 Frame = +3

Query  57   FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
            FN +++++F+SF+F +        P    KLPPGPW+LPLIGSLHHL  G LPH  LR+L
Sbjct  8    FNLIALLLFISFLFILLKKWNTKIP----KLPPGPWRLPLIGSLHHL-KGKLPHHHLRDL  62

Query  237  SRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSP  416
            +RKYGP+M+LQLGE+  +VISSP++AKA+ KTHDL FA RP+ MS D+V+YK  D++F+P
Sbjct  63   ARKYGPLMYLQLGEVPVVVISSPRIAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAP  122

Query  417  YGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIK-ASGSAPINLTEKICWFTS  593
            YGDYWRQMRKI   ELLS KM+KSF++ R++ELS+L+SSI+ A+ S+ +N+ EK+ WFTS
Sbjct  123  YGDYWRQMRKILTQELLSNKMLKSFSTIRKDELSKLLSSIRLATASSAVNINEKLLWFTS  182

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
                + AFG++   D++  I+L++E L+L+GGF V DLFPS K +H +S  K RL  VH 
Sbjct  183  CMTCRLAFGKICN-DRDELIMLIREILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVHH  241

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + + I E II EHK+N A       +   ED++D LL
Sbjct  242  KYNLIMENIINEHKENHAAGIKGNNEFGGEDMIDALL  278



>gb|ABC69399.1| CYP71D49v1 [Nicotiana tabacum]
Length=505

 Score =   294 bits (753),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 200/277 (72%), Gaps = 7/277 (3%)
 Frame = +3

Query  57   FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
            FN +++++F+SF+F +        P    KLPPGPW+LPLIGSLHHL  G LPH  LR+L
Sbjct  8    FNLIALLLFISFLFILLKKWNTKIP----KLPPGPWRLPLIGSLHHL-KGKLPHHHLRDL  62

Query  237  SRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSP  416
            +RKYGP+M+LQLGE+  +VISSP++AKA+ KTHDL FA RP+ MS D+V+YK  D++F+P
Sbjct  63   ARKYGPLMYLQLGEVPVVVISSPRIAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAP  122

Query  417  YGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIK-ASGSAPINLTEKICWFTS  593
            YGDYWRQMRKI   ELLS KM+KSF++ R++ELS+L+SSI+ A+ S+ +N+ EK+ WFTS
Sbjct  123  YGDYWRQMRKILTQELLSNKMLKSFSTIRKDELSKLLSSIRLATASSAVNINEKLLWFTS  182

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
                + AFG++   D++  I+L++E L+L+GGF V DLFPS K +H +S  K RL  VH 
Sbjct  183  CMTCRLAFGKICN-DRDELIMLIREILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVHH  241

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + + I E II EHK+N A       +   ED++D LL
Sbjct  242  KYNLIMENIINEHKENHAAGIKGNNEFGGEDMIDALL  278



>ref|XP_004237369.1| PREDICTED: premnaspirodiene oxygenase [Solanum lycopersicum]
Length=501

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 199/257 (77%), Gaps = 5/257 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  23   KNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP +AK + KTHD+ FA+RPK+++ ++V Y  +D+AF PYGDYWRQMRKICVLELLS K 
Sbjct  82   SPDMAKEVLKTHDIAFASRPKLLAPEIVCYSRSDIAFCPYGDYWRQMRKICVLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGS--APINLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            V+S++S R++E+  L++ I++S S   P+N TE++  FTSS   ++AFG+V +E Q++FI
Sbjct  142  VRSYSSIRRDEVDRLVNFIRSSSSFREPVNFTERLFLFTSSMTCRSAFGKVFKE-QDKFI  200

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANR  833
             L+KE + LAGGF VAD+FPS K++H +SG K +++  H +VD I E +I EHK N+A  
Sbjct  201  QLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIVNAHHKVDAIVEDVINEHKKNIAMG  260

Query  834  NNNKAKDHEEDIVDVLL  884
              N A    ED++DVLL
Sbjct  261  KTNGALGG-EDLIDVLL  276



>ref|XP_004245943.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=499

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 190/255 (75%), Gaps = 2/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            R +    QKLPPGPWKLP+IGS+HHL+G  LPH  LRNLS+KYGPIMHL+LGEI  +V+S
Sbjct  23   RKSKKSNQKLPPGPWKLPIIGSMHHLIG-VLPHHVLRNLSKKYGPIMHLKLGEIDTVVVS  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            S  +AK + K HDL FA RP++MS D+V+Y   D+ F+ YGDYW+QMRKIC+ ELLS KM
Sbjct  82   SAHMAKQVLKVHDLCFAARPELMSSDIVFYNQNDIVFAKYGDYWKQMRKICISELLSAKM  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSF+  RQ+E+ +L++SI+++ +  +N++EKI   TSS I ++AFG+V  +D++  ++L
Sbjct  142  VKSFSLIRQDEVHDLVASIRSTPNVVVNISEKILRLTSSVICRSAFGKV-WDDRDNLLML  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            ++E LSL+GGF VADLFPS   +H + G + RL  +H+++D I E II EHK+N AN   
Sbjct  201  MREVLSLSGGFDVADLFPSWTLLHGIGGMRNRLKSLHQKIDVILEKIIHEHKENRANGKK  260

Query  840  NKAKDHEEDIVDVLL  884
              ++   ED++DVLL
Sbjct  261  GNSEFGGEDLIDVLL  275



>gb|ABC69400.1| CYP71D49v3 [Nicotiana tabacum]
Length=505

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/277 (52%), Positives = 199/277 (72%), Gaps = 7/277 (3%)
 Frame = +3

Query  57   FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
            FN +++++F+SF+F +        P    KLPPGPW+LPLIGSLHHL  G LPH  LR+L
Sbjct  8    FNLIALLLFISFLFILLKKWNTKIP----KLPPGPWRLPLIGSLHHL-KGKLPHHHLRDL  62

Query  237  SRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSP  416
            +RKYGP+M+LQLGE+  +VISSP++AKA+ KTHDL FA RP+ MS D+V+YK  D++F+P
Sbjct  63   ARKYGPLMYLQLGEVPVVVISSPRIAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAP  122

Query  417  YGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIK-ASGSAPINLTEKICWFTS  593
            YGDYWRQMRKI   ELLS KM+KSF++ R++ LS+L+SSI+ A+ S+ +N+ EK+ WFTS
Sbjct  123  YGDYWRQMRKILTQELLSNKMLKSFSTIRKDGLSKLLSSIRLATASSAVNINEKLLWFTS  182

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
                + AFG++   D++  I+L++E L+L+GGF V DLFPS K +H +S  K RL  VH 
Sbjct  183  CMTCRLAFGKI-CNDRDELIMLIREILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVHH  241

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + + I E II EHK+N A       +   ED++D LL
Sbjct  242  KYNLIMENIINEHKENHAAGIKGNNEFGGEDMIDALL  278



>ref|XP_006355983.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Solanum 
tuberosum]
Length=514

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/290 (51%), Positives = 202/290 (70%), Gaps = 9/290 (3%)
 Frame = +3

Query  27   FVSEMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-G  203
            F  EM +  LFN VS+++FLS    +  L R+ +  ++Q+LPPGPW+LP IGSLHHL+ G
Sbjct  1    FSIEMYYS-LFNLVSLLIFLS---SLVILVRKWSKNKKQRLPPGPWRLPFIGSLHHLIIG  56

Query  204  GSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVV  383
            G LPHR  RNL+R+YGPIM+LQLGEI  ++ISSP +A+ I +THDL FA+RP+ +S +++
Sbjct  57   GQLPHRVFRNLARRYGPIMYLQLGEIPVVIISSPTIAQEILRTHDLAFADRPQFVSTNII  116

Query  384  YYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEE---LSELISSIKASGSA  554
            +Y   D+ FS YGDYWRQMRKIC++ELLS KMVKSF+  RQ+E   L   I S +   + 
Sbjct  117  FYNNKDIVFSQYGDYWRQMRKICMVELLSVKMVKSFSGIRQDELSSLISSICSTRGGATV  176

Query  555  PINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHY  734
             IN++EK+  F +S   ++AFG++ +   E FI L+KE L  AGGF VADLFPS K +H 
Sbjct  177  LINMSEKVFRFINSVTCRSAFGKICKGKDE-FITLMKEVLFFAGGFDVADLFPSWKLLHN  235

Query  735  VSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            +SG K RL+  H++VD I E II EH +N A       +  +ED+VDVLL
Sbjct  236  ISGVKSRLMNAHQKVDAIMENIINEHIENKAIGKKRNGEFGDEDLVDVLL  285



>ref|XP_009758268.1| PREDICTED: premnaspirodiene oxygenase [Nicotiana sylvestris]
 gb|ABC69404.1| CYP71D51v2 [Nicotiana tabacum]
 gb|AGK30193.1| cytochrome P450 CYP71D51 [Nicotiana tabacum]
Length=514

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 196/255 (77%), Gaps = 3/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  35   KNSNSQSKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  93

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP  AK + KTHD+ FA+RP +++ ++V Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  94   SPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKN  153

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V++F+S R+ E+  LI+ I++S   PIN+TE+I  FTSS   ++AFG+V +E Q++FI L
Sbjct  154  VRTFSSIRRNEVLRLINFIRSSSGEPINVTERIFLFTSSMTCRSAFGQVFKE-QDKFIQL  212

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            +KE + LAGGF VAD+FPS K++H +SG K +++  H +VD I E +I EHK N+A    
Sbjct  213  IKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIGKT  272

Query  840  NKAKDHEEDIVDVLL  884
            N A    ED++DVLL
Sbjct  273  NGALGG-EDLIDVLL  286



>gb|ABC69405.1| CYP71D51v3 [Nicotiana tabacum]
Length=514

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/255 (54%), Positives = 196/255 (77%), Gaps = 3/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  35   KNSNSQSKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  93

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP  AK + KTHD+ FA+RP +++ ++V Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  94   SPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKN  153

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V++F+S R+ E+  LI+ I++S   PIN+TE+I  FTSS   ++AFG+V +E Q++FI L
Sbjct  154  VRTFSSIRRNEVLRLINFIRSSSGEPINVTERIFLFTSSMTCRSAFGQVFKE-QDKFIQL  212

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            +KE + LAGGF VAD+FPS K++H +SG K +++  H +VD I E +I EHK N+A    
Sbjct  213  IKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIGKT  272

Query  840  NKAKDHEEDIVDVLL  884
            N A    ED++DVLL
Sbjct  273  NGALGG-EDLIDVLL  286



>emb|CDP20259.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/280 (53%), Positives = 198/280 (71%), Gaps = 7/280 (3%)
 Frame = +3

Query  63   PVSVIVFLSFVFCIYTLRRRSNPARR----QKLPPGPWKLPLIGSLHHLVGGSLPHRTLR  230
            P + I F  F+  I TL +R    R+    QKLPPGP KLP IG+LH+L+G SLPH+ L 
Sbjct  4    PFNFITFFIFLALILTLWKRWKKPRKVNATQKLPPGPRKLPFIGNLHNLLG-SLPHQALT  62

Query  231  NLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAF  410
            NL++K+G +MHLQLGE+SAIV+SSP+ AK I KTHDL FA+RP+++   ++ Y  + +AF
Sbjct  63   NLAKKHGDLMHLQLGEVSAIVVSSPRSAKEILKTHDLAFADRPEVLVGKIICYDYSSIAF  122

Query  411  SPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKAS--GSAPINLTEKICW  584
             PYG+YWRQMRKIC LELLS KMV+SF S RQ+E+  L+SSI+AS  G  PINLTE++  
Sbjct  123  CPYGEYWRQMRKICTLELLSAKMVRSFGSIRQDEVLHLLSSIRASTGGGKPINLTEEVSS  182

Query  585  FTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLK  764
            FTSS + ++AFG++  E     I LVKE LS   GF ++DLFPS+K +H++S  KP LLK
Sbjct  183  FTSSMVCRSAFGKMFGEKNTILIQLVKEVLSRTSGFDISDLFPSQKILHHLSWMKPTLLK  242

Query  765  VHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            VH ++D I + II EH  N+A       +  +ED++D+LL
Sbjct  243  VHHKIDVILDNIINEHIRNLARGKGGNGESGQEDLIDILL  282



>ref|XP_006350395.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 194/255 (76%), Gaps = 3/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  23   KNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP +AK + KTHD+ FA+RPK+++ ++V Y  +D+AF PYGDYWRQM KICVLELLS K 
Sbjct  82   SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMHKICVLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+S+ S R++E+  L++ I++S   P+N  E++  FTSS   ++AFG+V +E Q++FI L
Sbjct  142  VRSYGSIRRDEVDRLVNLIRSSSGEPVNFIERLFLFTSSMTCRSAFGKVFKE-QDKFIQL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            +KE + LAGGF VADLFPS K +H +SG K +++  H ++D I E +I EHK N+A    
Sbjct  201  IKEVIGLAGGFDVADLFPSLKLLHVLSGMKGKIMNAHHKIDAIVEDVINEHKKNIAMGKT  260

Query  840  NKAKDHEEDIVDVLL  884
            N A    ED++DVL+
Sbjct  261  NGALGG-EDLIDVLI  274



>emb|CAC24711.1| cytochrome P450 [Solanum tuberosum]
Length=502

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 134/255 (53%), Positives = 194/255 (76%), Gaps = 3/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWKLPL+GS+ H+ GG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  23   KNSNSQSKKLPPGPWKLPLLGSMLHMAGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP +AK + KTHD+ FA+RPK+++ ++V Y  +D+AF PYGDYWRQMRKICVLELLS K 
Sbjct  82   SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+S+ S R++E+  L++ I++S   P+N TE++  FTSS   ++AFG+V +E Q++FI L
Sbjct  142  VRSYGSIRRDEVDRLVNFIRSSSGEPVNFTERLFLFTSSMTCRSAFGKVFKE-QDKFIQL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            +KE + LAGGF VAD+FPS K++H +SG K +++  H +VD I E +I EHK   A    
Sbjct  201  IKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVEDVINEHKKKFAIGKT  260

Query  840  NKAKDHEEDIVDVLL  884
            N A    ED++DVL+
Sbjct  261  NGALGG-EDLIDVLI  274



>ref|XP_006355212.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=504

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/247 (55%), Positives = 184/247 (74%), Gaps = 2/247 (1%)
 Frame = +3

Query  144  KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAI  323
            KLPPGPW+LPLIGSLHHL  G LPH  LR+L+RK+GP+M+LQLGE+  +VISSP++AKA+
Sbjct  33   KLPPGPWRLPLIGSLHHL-KGKLPHHNLRDLARKHGPLMYLQLGEVPVVVISSPRIAKAV  91

Query  324  TKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFR  503
             KTHDL FA RP+ M+ D+V+YK  D++F+PYGDYWRQMRK+   ELLS KM+KS+N  R
Sbjct  92   LKTHDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLSNKMLKSYNMIR  151

Query  504  QEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLA  683
            ++ELS+L+SSI+ S  + +N+TEK+ WFTS    + AFG++   D++  I+L++E L+L+
Sbjct  152  KDELSKLLSSIRLSTGSAVNITEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILALS  210

Query  684  GGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEE  863
            GGF V DLFPS K +H +S  K RL  VH + D+I E II EHK+N A       +   E
Sbjct  211  GGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYDQIMENIINEHKENHAAGIKGNNEFGGE  270

Query  864  DIVDVLL  884
            D++D LL
Sbjct  271  DMIDALL  277



>ref|XP_004242036.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/250 (55%), Positives = 191/250 (76%), Gaps = 1/250 (0%)
 Frame = +3

Query  135  RRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLA  314
            ++Q+LPPGPW+LP IG+LHHL+GG LPHR LR+LS++YGPIM+LQLG++  +VI+SP +A
Sbjct  25   KKQRLPPGPWRLPFIGNLHHLIGGGLPHRVLRDLSQRYGPIMYLQLGQVPTVVITSPTIA  84

Query  315  KAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFN  494
            + I KTHDL FA+RP+++S ++++Y   DVAFS YGDYWRQMRKIC++ELLSTKMVKSF+
Sbjct  85   QEILKTHDLAFADRPQLVSTNIIFYNNKDVAFSQYGDYWRQMRKICIVELLSTKMVKSFS  144

Query  495  SFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEAL  674
              RQ+ELS LISSI+++    IN+TEK+  FT+    ++AFG++ + D+  F+ L+K+ L
Sbjct  145  GIRQDELSSLISSIRSTRGTTINMTEKVFQFTNCVTCRSAFGKICK-DRNEFVALLKKIL  203

Query  675  SLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKD  854
              AGGF +ADLFPS K +H +SG K RL+K H+++D I E II EH +N         + 
Sbjct  204  VFAGGFDLADLFPSWKLLHNISGVKSRLVKAHQKIDAIMENIINEHIENKVAGKKGNGEF  263

Query  855  HEEDIVDVLL  884
             +ED+VDV L
Sbjct  264  GDEDLVDVFL  273



>ref|XP_009608635.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=511

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 192/256 (75%), Gaps = 1/256 (0%)
 Frame = +3

Query  117  RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVI  296
            R+ +  R+Q+LPPGPW+ P+IGSLHHL+G  +PHRTLR+L++KYGP+M+LQLG+   ++I
Sbjct  28   RQWSRNRKQRLPPGPWRFPIIGSLHHLMGREVPHRTLRSLAQKYGPLMYLQLGQAPTVII  87

Query  297  SSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTK  476
            SSP +AK + KTHDL FANR ++ S ++++Y   D+ FS Y DYWRQMRKIC+LELLSTK
Sbjct  88   SSPSMAKQVLKTHDLAFANRAQLTSSNIIFYNNKDIVFSQYSDYWRQMRKICILELLSTK  147

Query  477  MVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIV  656
            MVKSF++ RQ+ELS LISSI++   +P+NLTEKI   T+S   +AAFG V + D+  F+ 
Sbjct  148  MVKSFSAIRQDELSSLISSIRSMRGSPVNLTEKIFQLTNSITGRAAFGNVFK-DRHEFMK  206

Query  657  LVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRN  836
            L+KE L LAGGF VADLFPS K +H +SG K RL+  HR+VD+I E I+ EH +N A  N
Sbjct  207  LMKEVLELAGGFDVADLFPSWKLLHKMSGVKSRLVNAHRKVDEIMEDILNEHIENKAAGN  266

Query  837  NNKAKDHEEDIVDVLL  884
                +   ED+VDV L
Sbjct  267  KGIGEFGGEDLVDVFL  282



>ref|XP_004242219.2| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 192/276 (70%), Gaps = 5/276 (2%)
 Frame = +3

Query  60   NPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLS  239
            N VS I+  SF+F I+   RRS   ++Q LPPGPW+LPLIGSLHHL+ G  PHR  R+L+
Sbjct  4    NLVSFILLFSFLFIIFRKLRRS---QKQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLA  60

Query  240  RKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPY  419
            RKYGP+M+L+LGE+  ++ISSP  +K + KTHDL FA+RP+  S D+V Y   D+AF+ Y
Sbjct  61   RKYGPVMYLELGEVPTVIISSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEY  120

Query  420  GDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKA-SGSAPINLTEKICWFTSS  596
            GDYW+QMRKIC++ELLS KMVKSF+S R++ELS ++SSI +  G   +N+TE I  FTSS
Sbjct  121  GDYWKQMRKICIMELLSAKMVKSFSSIRKDELSSVLSSIDSVRGCCEVNMTEIIVRFTSS  180

Query  597  TIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHRE  776
               +  FG++ R D++  I L+K+AL L GGF + D FPS K ++ +SG K +L+K+H++
Sbjct  181  VTCRLVFGKLCR-DRDELINLMKDALFLVGGFDIGDFFPSWKLLYKMSGAKSKLVKMHQK  239

Query  777  VDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            VD + E I+ EH  N             ED+VDV L
Sbjct  240  VDSVLERIVNEHIKNREAGIKGNGAHGGEDLVDVFL  275



>ref|XP_004228510.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/278 (51%), Positives = 202/278 (73%), Gaps = 5/278 (2%)
 Frame = +3

Query  54   LFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             FN +S+ +F+SF+F +  L+  SN    + LPPGPWKLP +GS+ H++GG LPHR LR+
Sbjct  3    FFNLISISLFVSFLFLLKKLKN-SNSQINKSLPPGPWKLPFVGSMFHMIGG-LPHRVLRD  60

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L++KYG I+HLQLGE+S +V++SP +AK + KTHDL FA+RP++++ ++V Y CTD+AF 
Sbjct  61   LAKKYGSILHLQLGEVSLVVVTSPIMAKQVLKTHDLAFASRPRLLAAEIVLYNCTDIAFC  120

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFT  590
            PYGDYWRQMRKICVLE+LS K V+SF S RQ+E   L+   ++S S+ P+N+T++I  FT
Sbjct  121  PYGDYWRQMRKICVLEVLSGKNVRSFGSIRQDETIRLVEFFRSSSSSEPVNVTKRISLFT  180

Query  591  SSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVH  770
            S  I ++AFG + +E Q+ FI ++K   SL  GF VAD+FPS K++H +SG K + + +H
Sbjct  181  SFIICRSAFGTIFKE-QDEFIQVMKGVTSLLEGFNVADIFPSLKFLHVLSGMKSKTMYLH  239

Query  771  REVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             +VD I E +I EHK N+ N   N  +   ED++DVLL
Sbjct  240  HKVDTIVENVINEHKKNLVNGKTN-GELGGEDLIDVLL  276



>ref|XP_006341698.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 180/248 (73%), Gaps = 1/248 (0%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKA  320
            +KLPPGPW+LP IG+LH L+ G LPH T R+LS+ YGPI HL+LGE+S +V+SSP +AK 
Sbjct  32   KKLPPGPWRLPFIGNLHQLMNGRLPHHTFRDLSQNYGPIFHLRLGEVSHVVVSSPDIAKE  91

Query  321  ITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSF  500
            I K  DL FA RP++M  +++ Y  +D+   PYGDYWR MRK+C+LELLSTKMVKSF+S 
Sbjct  92   IMKIQDLNFATRPQLMVGEIIMYNYSDIGTCPYGDYWRSMRKVCILELLSTKMVKSFDSI  151

Query  501  RQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            RQ E+S LISSI +   + INL++KI WFT S   ++AFG++    Q++ I+L+K+   L
Sbjct  152  RQAEMSSLISSINSMPDSLINLSDKIFWFTGSVTCRSAFGKIIN-GQDKLIMLIKDITLL  210

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE  860
            AG   +ADLFPS+KW+H + G K ++LKVH+E D I E II EH+ N AN     ++   
Sbjct  211  AGATELADLFPSRKWLHQIYGLKSKILKVHKEADVILENIINEHQKNRANGKKGNSEYGG  270

Query  861  EDIVDVLL  884
            ED+VDVLL
Sbjct  271  EDLVDVLL  278



>sp|P93530.1|C71D6_SOLCH RecName: Full=Cytochrome P450 71D6 [Solanum chacoense]
 gb|AAB61964.1| putative cytochrome P450 [Solanum chacoense]
Length=501

 Score =   288 bits (738),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/259 (53%), Positives = 193/259 (75%), Gaps = 4/259 (2%)
 Frame = +3

Query  114  RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIV  293
            ++ S  ++ +KLPPGPWKLP IGS+HHL GG  PHR LR+L++KYGP+MHLQLGE+SA+V
Sbjct  20   KKYSKNSQTKKLPPGPWKLPFIGSMHHLAGGR-PHRVLRDLAKKYGPLMHLQLGEVSAVV  78

Query  294  ISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLST  473
            ++SP +AK + KTHD+ FA+RPK+++ D++ Y   D+AFSPYG+YW+QMRKICV E+LS 
Sbjct  79   VTSPDMAKEVLKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVTEVLSA  138

Query  474  KMVKSFNSFRQEELSELISSIKASGSAP--INLTEKICWFTSSTIAKAAFGRVRREDQER  647
            K V+SF+S R +E+  LI SI++S S+   +N  E++ WFTSS   ++AFG++ +E Q+ 
Sbjct  139  KSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNFKERVIWFTSSMTCRSAFGQLPKE-QDM  197

Query  648  FIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMA  827
            FI L++E + LA GF VAD+FPS K++H     K +LL VHR+VD I E +I EHK N A
Sbjct  198  FIKLIREVIRLAEGFDVADIFPSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNFA  257

Query  828  NRNNNKAKDHEEDIVDVLL  884
             R N+      E+++DVLL
Sbjct  258  TRKNDDHALGGENLIDVLL  276



>ref|XP_004249520.2| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=536

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 146/288 (51%), Positives = 201/288 (70%), Gaps = 2/288 (1%)
 Frame = +3

Query  24   SFVSEMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVG  203
            SF   ME +F FN + + +FLSF++ +    ++S    + KLPPGPWKLP +GSLHHL  
Sbjct  23   SFSYLMEFQFPFNIIFLFLFLSFLYLLLVEWKKSRNLNK-KLPPGPWKLPFLGSLHHLAI  81

Query  204  GSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVV  383
            G LPH  L  L +KYGP+MHLQLGEIS +V+SS  +A+ + KTHDL FA+RPK+ S D++
Sbjct  82   GGLPHHALTKLGKKYGPLMHLQLGEISTVVVSSMDMAREVLKTHDLAFASRPKLASIDII  141

Query  384  YYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PI  560
             YK TD+ FSPYG+YWRQMRK+CV+ELL+ K V+SF+S   +E S L+  I++S    PI
Sbjct  142  CYKSTDIVFSPYGEYWRQMRKVCVMELLTAKNVRSFSSILHDEASRLVQFIQSSTHGEPI  201

Query  561  NLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVS  740
            N+TE+I W+TSS   K AFG    +DQE+FI +VK+ + LA GF +AD+FPS K +  ++
Sbjct  202  NITERILWYTSSITCKTAFGDQLLKDQEKFIQMVKKLVELASGFSLADIFPSIKILGVLT  261

Query  741  GTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            G + R+LKVH+ VD I E +I EHK N+A+          E++VDVL+
Sbjct  262  GARSRILKVHKNVDAIVEDVINEHKKNLASGKKGNGAFGGENLVDVLI  309



>gb|ABC69403.1| CYP71D51v1 [Nicotiana tabacum]
Length=514

 Score =   288 bits (738),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 136/255 (53%), Positives = 195/255 (76%), Gaps = 3/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SA+V++
Sbjct  35   KNSNSQSKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  93

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP  AK + KTHD+ FA+RP +++ ++V Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  94   SPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKN  153

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V++F+S R+ E+  LI+ I++S   PIN+TE+I  FTSS   ++AFG+V +E Q++FI L
Sbjct  154  VRTFSSIRRNEVLRLINFIRSSSGEPINVTERIFLFTSSMTCRSAFGQVFKE-QDKFIQL  212

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            +KE + LAGGF VAD+FPS K++H +SG K +++  H +VD I E +I EHK N+A    
Sbjct  213  IKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIGKT  272

Query  840  NKAKDHEEDIVDVLL  884
            N A    ED++DV L
Sbjct  273  NGALGG-EDLIDVPL  286



>gb|KDP39283.1| hypothetical protein JCGZ_01040 [Jatropha curcas]
Length=339

 Score =   282 bits (722),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 142/283 (50%), Positives = 196/283 (69%), Gaps = 3/283 (1%)
 Frame = +3

Query  36   EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
            E E++ L+ P      L   F +   ++         LPPGPWKLPLIGS+HHLVG SLP
Sbjct  2    EQENQILYFPALFTFLLFLFFLLRVWKKFKTNNSTPNLPPGPWKLPLIGSMHHLVG-SLP  60

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  LR+L++KYGP+MHLQLGE+S IV+SSP++AK I KT+D++FA RP +++  +V Y  
Sbjct  61   HHRLRDLAKKYGPLMHLQLGEVSNIVVSSPEIAKEIMKTNDVIFAQRPFLLAASIVAYDL  120

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
            +D+AF+PYGDYWRQ+RKIC LELL+ K VKSF   R++E+S+LI SI +S  +PIN +  
Sbjct  121  SDIAFAPYGDYWRQLRKICTLELLTAKRVKSFRPVREDEVSKLIRSIYSSAGSPINFSRM  180

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
                T S  + AAFG++ +  +E FI  VK  +  +GGF +ADL+PS K +H +S T+P+
Sbjct  181  FNSLTYSITSTAAFGKIWK-GEEIFIPNVKNLIKASGGFSLADLYPSIKLLHLISTTRPK  239

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            LL++H+EVDKIF+ II EH+   A    + A+  EED VDVLL
Sbjct  240  LLRLHQEVDKIFQNIINEHRARKA-AGKSGAESEEEDFVDVLL  281



>ref|XP_007212458.1| hypothetical protein PRUPE_ppa017406mg [Prunus persica]
 gb|EMJ13657.1| hypothetical protein PRUPE_ppa017406mg [Prunus persica]
Length=331

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/273 (49%), Positives = 195/273 (71%), Gaps = 4/273 (1%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            ++ ++F+  V  I  +R ++       LPPGPWKLP+IG+LH L  GSLPH+ LR+L++K
Sbjct  12   LAFLLFMIMVLKIGKIRGKTK-CSASNLPPGPWKLPVIGNLHQL-AGSLPHQRLRDLAKK  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGE+S +V+SS + AK + KTHDL+FA+RP +++  ++ Y  TD+ F+PYG+
Sbjct  70   YGPLMHLKLGEVSTVVVSSAEFAKEVMKTHDLIFASRPHVLAIRILSYDFTDIVFAPYGE  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC LELLS K V+S+   R+EE+  LI SI +   +PINLT++I   T +  +
Sbjct  130  YWRQLRKICTLELLSAKRVQSYQPIREEEVRNLIKSIASRAGSPINLTQEIYSSTYTITS  189

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            +AAFG+  R DQE+FI +VKE    A GF +AD+FPS   +H +SG +P+L K+H+E D+
Sbjct  190  RAAFGKKNR-DQEKFIYIVKEVAKAASGFTLADVFPSVSLLHLLSGMRPKLEKLHKEADR  248

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I   II+EH+ +M N  + +  + EED+VDVLL
Sbjct  249  IMGNIIKEHQRDMVNTKSGEG-EAEEDLVDVLL  280



>ref|XP_006367730.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=314

 Score =   280 bits (716),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 180/237 (76%), Gaps = 2/237 (1%)
 Frame = +3

Query  111  LRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAI  290
            ++ +++ ++ +KLPPGPWKLPLIGS+ HL+GG LPH  LR+L++KYGPIMHLQLGE+S +
Sbjct  20   IKWKNSNSKTKKLPPGPWKLPLIGSMFHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLV  78

Query  291  VISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLS  470
            V++SP +AK + KTHDL FA+RPK+++ ++++Y  TD+ FSPYGDYWRQMRKIC+LELLS
Sbjct  79   VVTSPDMAKQVLKTHDLAFASRPKLLAAEILFYNGTDIVFSPYGDYWRQMRKICLLELLS  138

Query  471  TKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERF  650
             K VKSFNS RQ+E+  +I   ++S    +N T+K   F+SS   +AAFG+V +E Q+  
Sbjct  139  AKNVKSFNSIRQDEVLRMIDFFRSSIGETVNATKKFYQFSSSMTCRAAFGKVLKE-QDEL  197

Query  651  IVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDN  821
            I+LVK+A  L  GF VAD+FPS K+ H + G K +++  H E+D I E II EHK+N
Sbjct  198  ILLVKKASHLMEGFDVADIFPSLKFFHLLCGMKGKIMDAHHELDAILENIINEHKNN  254



>ref|XP_009357363.1| PREDICTED: premnaspirodiene oxygenase-like [Pyrus x bretschneideri]
Length=506

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/271 (50%), Positives = 198/271 (73%), Gaps = 7/271 (3%)
 Frame = +3

Query  72   VIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
            V+ FL F+  I  + +R+    +  LPPGPWKLP IG+LH LVG S+PH  LR+L++ YG
Sbjct  11   VVTFLLFLIMILKIGKRA----KINLPPGPWKLPFIGNLHQLVG-SIPHHGLRDLAKNYG  65

Query  252  PIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYW  431
            P+MHL+LGE+S IV+SS + AK + KTHD++FA+RP +++  ++ Y  T++ F+PYGDYW
Sbjct  66   PLMHLKLGEVSTIVVSSAEFAKEVMKTHDVIFASRPHILANSILTYGDTNIGFAPYGDYW  125

Query  432  RQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKA  611
            RQ+RKIC LELLS K V+SF S R+EE+  LI+ I+     PIN+TE+I  FT    ++A
Sbjct  126  RQLRKICTLELLSMKRVQSFRSLREEEVLNLINLIRLRAETPINITEQIYSFTYGFTSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG ++ +DQ++FI +VK+A+ +AGGF VAD+FPS   +H +SG +P+L ++H+E D+I 
Sbjct  186  AFG-IKSKDQDKFIDIVKQAMKVAGGFDVADIFPSVSLLHLISGMRPKLERLHKEADRIM  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            E II+EHK +MA   ++   +  ED++DVLL
Sbjct  245  ENIIKEHKKDMATSESHDI-EAREDLIDVLL  274



>ref|XP_006365979.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=521

 Score =   286 bits (732),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/293 (49%), Positives = 207/293 (71%), Gaps = 11/293 (4%)
 Frame = +3

Query  36   EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSL------HHL  197
            E+ +   +N V++++  SF+F ++    R + A+++KLPPGPW+LP+IGSL      HHL
Sbjct  2    EIIYSSTYNFVALLILFSFLFTLFDKLLRKSLAKQEKLPPGPWRLPIIGSLPIIGSLHHL  61

Query  198  VGGSL-PHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSF  374
             G  L PHRTL+NL+ KYGPIM+LQLGEI A+++SSP + K I KTH+L FA +P++ S 
Sbjct  62   RGALLFPHRTLKNLATKYGPIMYLQLGEIRAVIVSSPNMVKEILKTHELAFATKPQLTSI  121

Query  375  DVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKAS-GS  551
            D+  Y   D+AF+PYGD WRQMR ICV ELLSTKMVKSF+S +++E+  L+SSI+++ GS
Sbjct  122  DITTYNYKDIAFAPYGDKWRQMRNICVTELLSTKMVKSFSSIQKDEIMRLLSSIRSTNGS  181

Query  552  APINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIH  731
              +NLTE I  +T+S   ++AFG+V   +Q++ I L+++ L   GGF VADLFPS K +H
Sbjct  182  HLVNLTELILRYTNSVTCRSAFGKV-YTNQDQLINLLRDVLDTLGGFDVADLFPSWKLLH  240

Query  732  YVSGTKPRLLKVHREVDKIFELIIEEHKDN--MANRNNNKAKDHEEDIVDVLL  884
             +SG K +LLK+H++VD+  E I+ EH  N  +  + N +     ED+VDVLL
Sbjct  241  KMSGVKSKLLKMHKKVDEALENIVNEHIKNRSLGCKGNGEKLVGGEDLVDVLL  293



>ref|XP_010061478.1| PREDICTED: cytochrome P450 71D9-like [Eucalyptus grandis]
 gb|KCW68420.1| hypothetical protein EUGRSUZ_F02072 [Eucalyptus grandis]
Length=507

 Score =   285 bits (729),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 134/271 (49%), Positives = 198/271 (73%), Gaps = 5/271 (2%)
 Frame = +3

Query  81   FLSFVFCIYTLRRR--SNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            FL F+F    + +R  ++     KLPPGPWKLP+IG++H L GG LPHRTL  L++KYGP
Sbjct  13   FLLFIFMALKIAKRKPNSEGSAPKLPPGPWKLPIIGNMHQL-GGPLPHRTLSELAKKYGP  71

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHL++GE+S +V SS + AK + KTHD++FA+RP +++  ++ Y CT + F+PYG+YWR
Sbjct  72   LMHLKMGEVSTVVFSSLETAKEVLKTHDVIFASRPPILASSIISYDCTSITFAPYGEYWR  131

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAA  614
            Q+RKIC+LELLS+K V S+ S R++E+  ++  I A     INLTEKI        ++AA
Sbjct  132  QLRKICILELLSSKRVLSYRSIREDEMLNMVRWIAARAGMTINLTEKIYSSQYGMTSRAA  191

Query  615  FGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFE  794
            FG+  +E Q+RFI +VKEA+  AGGFG+ADLFPS K +H +SG +P++ K+H+E D++ E
Sbjct  192  FGKKCKE-QDRFIGVVKEAIKFAGGFGIADLFPSVKLLHVMSGMRPKIEKLHQESDRMLE  250

Query  795  LIIEEHKDNMA-NRNNNKAKDHEEDIVDVLL  884
             II EH++N + N++ ++ +D +ED+VDVLL
Sbjct  251  DIIREHRNNRSENKSGDQREDGDEDLVDVLL  281



>ref|XP_004249519.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=510

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/250 (55%), Positives = 182/250 (73%), Gaps = 3/250 (1%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
            +KLPPGPWKLP+IGS+HHL +   LPH  L  L +K+GP+MHLQLGEIS IV+SS ++A+
Sbjct  34   KKLPPGPWKLPIIGSIHHLALEDGLPHHALTKLGKKHGPLMHLQLGEISTIVVSSMEMAR  93

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             + K HDL FA+RPK++S D++ YK TD+AF  YGDYWRQMRKICVLEL + K V+SF+S
Sbjct  94   EVMKIHDLAFASRPKLVSLDIILYKSTDIAFCSYGDYWRQMRKICVLELFTAKNVRSFSS  153

Query  498  FRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEAL  674
             R+EE S L+  I++S    PIN+T++I W+ SS   KAAFG + + DQE+FI +V+E  
Sbjct  154  IRREEGSNLVQFIRSSTRGEPINVTKQISWYESSITCKAAFGELLK-DQEKFIGIVRELA  212

Query  675  SLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKD  854
             L GGF VA++FPS K +H +SG + R+LKVH  VD I E II +HK N+A+        
Sbjct  213  ELTGGFSVANIFPSIKILHVLSGVRSRILKVHENVDAIVEDIISDHKRNIASGKRGNGAF  272

Query  855  HEEDIVDVLL  884
              ED+VDVLL
Sbjct  273  GGEDLVDVLL  282



>ref|XP_006339045.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 181/253 (72%), Gaps = 9/253 (4%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
            +KLPPGPWKLP +GS+HHL + G LPH  L  L +K+GP MHLQLGEIS IV+SS ++A+
Sbjct  34   KKLPPGPWKLPFLGSIHHLALEGGLPHHALTKLGKKHGPFMHLQLGEISTIVVSSLEMAR  93

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             + K HDL FA+RPK++S DV+ Y  TD+ FSPYGDYWRQMRKIC LEL S K V+SF+S
Sbjct  94   EVMKIHDLAFASRPKLVSLDVICYNSTDIVFSPYGDYWRQMRKICFLELFSAKNVRSFSS  153

Query  498  FRQEELSELISSIKASGSAP----INLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVK  665
             R+EE S L+  I   GS+P    IN+TE+I W+ SS   KAAFG + + DQE+FI +V+
Sbjct  154  IRREEASSLVQFI---GSSPRGETINVTERISWYESSNTCKAAFGELLK-DQEKFIGIVR  209

Query  666  EALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNK  845
            E   L GGF VA++FPS K +H +SG + R++KVH+ VD I E II EHK N+A+     
Sbjct  210  ELAELTGGFSVANIFPSIKILHVLSGLRSRIMKVHKNVDVIVEDIINEHKKNIASGKKGN  269

Query  846  AKDHEEDIVDVLL  884
                 ED+VDVLL
Sbjct  270  GAFGGEDLVDVLL  282



>ref|XP_004246079.1| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   284 bits (727),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 183/251 (73%), Gaps = 2/251 (1%)
 Frame = +3

Query  132  ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQL  311
             +  KLPPGPW+LPLIG+LHHL  G LPH  LR+L+RK+GP+M+LQLGE+  +VISSP++
Sbjct  29   TKNTKLPPGPWRLPLIGNLHHL-KGKLPHHNLRDLARKHGPLMYLQLGEVPVVVISSPRI  87

Query  312  AKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSF  491
            AKA+ KTHDL FA RP+ M+ D+V+YK  D++F+PYGDYWRQMRK+   ELL+ KMVKS+
Sbjct  88   AKAVLKTHDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLNNKMVKSY  147

Query  492  NSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEA  671
            N  R++ELS+L+SSI+ +  + +N+TEK+ WFTS    + AFG++   D++  I+L++E 
Sbjct  148  NMIRKDELSKLLSSIRLATGSAVNITEKLLWFTSCMTCRLAFGKI-CNDRDELIMLIREI  206

Query  672  LSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAK  851
            L+L+GGF V DLFPS K +  +S  K RL  VH + D+I E II EHK N A       +
Sbjct  207  LALSGGFDVCDLFPSWKLLQNMSNMKARLTNVHHKYDQIMENIINEHKQNHAAGIKGNNE  266

Query  852  DHEEDIVDVLL  884
               ED++D LL
Sbjct  267  FGGEDMIDALL  277



>ref|XP_009794456.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/272 (51%), Positives = 196/272 (72%), Gaps = 7/272 (3%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            VS ++F+SF+F +    R+S     ++LPPGPW+LP+IGS+HHL  G + HR LRNLS+K
Sbjct  7    VSFLLFISFIFLLIQKWRKS-----KRLPPGPWRLPIIGSVHHLTSG-VSHRVLRNLSQK  60

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            +GPIM+LQLGE+  +V+SSP +AK I KTHDL FA+RP++M   ++ Y C D+AFSPYGD
Sbjct  61   FGPIMYLQLGEVPTVVVSSPHMAKQILKTHDLAFASRPEIMMGKIICYDCKDIAFSPYGD  120

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWR MRK+  LELLS KMVKSF+  R++ELS L+SSI++ G  PINL EK+ WF ++   
Sbjct  121  YWRHMRKLSTLELLSAKMVKSFSPIRRDELSSLLSSIESMGDLPINLVEKLLWFMNAATC  180

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            ++AFG+V + DQ+  I L+  A SL+GGF +ADLFPSKK++H +SG + +L++   ++D 
Sbjct  181  RSAFGKVCK-DQKELITLIHRAQSLSGGFELADLFPSKKFLHGISGMRSKLMEARNKIDV  239

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVL  881
            + + II  H++N AN      +   ED +DV 
Sbjct  240  VLDNIINVHRENRANGKCCNGESGAEDFIDVF  271



>ref|XP_009776870.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=349

 Score =   279 bits (714),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 190/255 (75%), Gaps = 6/255 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLP+IGS+ HL+GG LPH  LR+L++KYGPIMHLQLGE+S +VIS
Sbjct  23   KNSNSQTKRLPPGPWKLPIIGSMLHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIS  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RP +++  +V+Y  TD+AFSPYG+YWRQMRKIC+LELLS K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSFNS RQ+E+  +I   ++S   P+N+T++   FTSS   ++AFG+  +E Q+ F  L
Sbjct  142  VKSFNSIRQDEVHRMIEFFRSSPGKPVNVTKRFALFTSSMTCRSAFGQEYKE-QDEFARL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK+  +L  GF VAD+FPS K++H ++G K +++  H E+D+I + II EHK  +A  N 
Sbjct  201  VKKVSNLMEGFDVADIFPSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHK-KVAKTN-  258

Query  840  NKAKDHEEDIVDVLL  884
               +   E I+DVLL
Sbjct  259  --CESGSEGIIDVLL  271



>ref|XP_006339046.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/250 (54%), Positives = 184/250 (74%), Gaps = 3/250 (1%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
            +KLPPGPWKLP IGS+HHL + G LPH  L NL +K+GP MHLQLGEIS IV+SS  +A+
Sbjct  34   KKLPPGPWKLPFIGSVHHLPLEGGLPHHALTNLGKKHGPFMHLQLGEISTIVVSSMDMAR  93

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             + KTHDL FA+R K+++ D++ YK TD+AFSPYGDYWRQM K+CVLELL+TK V+SF+S
Sbjct  94   EVLKTHDLAFASRSKLLALDIICYKSTDIAFSPYGDYWRQMCKVCVLELLTTKNVRSFSS  153

Query  498  FRQEELSELISSIKASG-SAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEAL  674
             R++E S L+  I++S    PIN+TE+I W+ SS   K AFG + + DQE+F+ +++E +
Sbjct  154  IRRDEASHLVQFIRSSTRDEPINVTERILWYQSSITCKTAFGELLK-DQEKFLGILRELM  212

Query  675  SLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKD  854
             +AGGF +AD+FPS K +  +SG K ++LKVH+  D I E +I EHK N+A+        
Sbjct  213  EVAGGFSLADIFPSIKILQVLSGLKSKILKVHKNADVIVEDVINEHKKNIASGKKGNGAF  272

Query  855  HEEDIVDVLL  884
              E++VDVLL
Sbjct  273  GGENLVDVLL  282



>ref|XP_004249812.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
 ref|XP_010312277.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=511

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 181/250 (72%), Gaps = 3/250 (1%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
            +KLPPGPWKLP IGS+HHL + G LPH  L NL +KYGP MHLQ+GEIS +V+SS  +A+
Sbjct  34   KKLPPGPWKLPFIGSVHHLALEGGLPHHALTNLGKKYGPFMHLQVGEISTVVVSSMDMAR  93

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             + KTHDL FA+R K+++FD++ YK TD+ F  YGDYWRQMRK+CVLELL+TK V+SF+S
Sbjct  94   EVLKTHDLAFASRHKILAFDIILYKSTDIGFCSYGDYWRQMRKVCVLELLTTKNVRSFSS  153

Query  498  FRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEAL  674
             R++E S L+  I++S    PIN+TE+I W+ SS   K AFG + + DQE+F+ +++E  
Sbjct  154  IRRDEASRLVQFIRSSTCGEPINVTERISWYQSSITCKTAFGELLK-DQEKFLGILREFT  212

Query  675  SLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKD  854
             +AGGF  AD+FPS K +  +SG K R+LK H+ VD I E +I EHK N+A+        
Sbjct  213  EVAGGFSTADIFPSIKILQVLSGLKSRILKFHKNVDVIVEDVINEHKKNLASGKKGNGAF  272

Query  855  HEEDIVDVLL  884
              E++VDVLL
Sbjct  273  GGENLVDVLL  282



>ref|XP_010644547.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 201/286 (70%), Gaps = 11/286 (4%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQ----KLPPGPWKLPLIGSLHHLVGG  206
            ME +F F P+      +F+  IY L+R   P+R       LPPGPWKLP+IG++H LVG 
Sbjct  1    MELQFSFFPI----LCTFLLFIYLLKRLGKPSRTTHPAPNLPPGPWKLPIIGNMHQLVG-  55

Query  207  SLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVY  386
            SLPH +LRNL++K+GP+MHLQLGE+SAIV+SS ++AK + KTHD++F+ RP +++  +V 
Sbjct  56   SLPHHSLRNLAKKHGPLMHLQLGEVSAIVVSSREMAKEVMKTHDIIFSQRPCILAASIVS  115

Query  387  YKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINL  566
            Y CTD+AF+PYGDYWRQ+RKI +LELLS K V+SF S R+EE+  L+ SI +     INL
Sbjct  116  YDCTDIAFAPYGDYWRQIRKISILELLSAKRVQSFRSVREEEVLNLVRSISSQEGVSINL  175

Query  567  TEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGT  746
            TE I   T S I++AAFG+ + +DQE F V +++     GGF +AD+FPS K +H VSG 
Sbjct  176  TESIFSLTFSIISRAAFGK-KCKDQEAFSVTLEKFAGSGGGFTIADVFPSIKLLHVVSGI  234

Query  747  KPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + +L K+H+++D I E II EHK        ++A + +ED+VDVLL
Sbjct  235  RHKLEKIHKKLDTILENIINEHKARSEASEISEA-EVDEDLVDVLL  279



>dbj|BAC53923.1| cytochrome P450 [Petunia x hybrida]
Length=502

 Score =   283 bits (724),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 179/247 (72%), Gaps = 2/247 (1%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAI  323
            LPPGPWKLP IGSLHHLV  G LPH  L NL+++YGP+M LQLGE   + ISSPQ+AK +
Sbjct  32   LPPGPWKLPFIGSLHHLVFAGPLPHHGLTNLAKRYGPLMLLQLGEQPTVFISSPQMAKEV  91

Query  324  TKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFR  503
             KTHDL FA RPK+   +++ Y  TD+AFSPYG+YWRQ+RKICV+ELLS KMV SF+S R
Sbjct  92   LKTHDLAFATRPKLTFAEIIKYGSTDIAFSPYGEYWRQIRKICVMELLSAKMVNSFSSIR  151

Query  504  QEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLA  683
            ++ELS +IS I+   + P+NLTEK+ WFTSS + ++A G++ + DQ + I+L++E LSLA
Sbjct  152  EDELSNMISWIRLRPNIPVNLTEKVKWFTSSVVCRSALGKICK-DQNKLIILMREILSLA  210

Query  684  GGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEE  863
                 AD FP  K++H + G+K RLLK H ++D+I + I+ EHK N  N      +   E
Sbjct  211  ISVNFADFFPRWKFLHDLGGSKTRLLKEHHKIDEILQDIVNEHKQNRVNGKMGNGEFGGE  270

Query  864  DIVDVLL  884
            D++DVLL
Sbjct  271  DLIDVLL  277



>ref|XP_004228511.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=493

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 185/256 (72%), Gaps = 2/256 (1%)
 Frame = +3

Query  54   LFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             FN  S+ +F+SF+F +    + SN   R+KLPPGPWKLPL+G++ HL+GG  PHR LR+
Sbjct  3    FFNIFSLFIFVSFLFLLIKYWKNSNDQIRKKLPPGPWKLPLLGNIFHLLGGP-PHRVLRD  61

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L++KYG IMHLQLGE+S +V++SP +AK + KTHD+ FA+RP +++ ++V Y  +D+ FS
Sbjct  62   LAKKYGSIMHLQLGEVSLVVVTSPDMAKQVLKTHDIAFASRPMLIAAEIVCYNGSDIVFS  121

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTS  593
            PYGDYWRQMRKIC++ELLS K VKSF+S RQ+E+  +I   ++S    +N T +I  F S
Sbjct  122  PYGDYWRQMRKICIMELLSAKNVKSFSSIRQDEVLRMIEFFRSSSGETVNATRRIFQFAS  181

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
            S   ++AFG+V +E Q+  I LVK+   L  GF VAD+FPS K++H + G K +++ VH 
Sbjct  182  SMTCRSAFGKVFKE-QDELIQLVKKVSRLTEGFDVADIFPSLKFLHVLCGMKSKIMDVHH  240

Query  774  EVDKIFELIIEEHKDN  821
            E+D I E II EHK+N
Sbjct  241  ELDAILENIINEHKNN  256



>ref|XP_004243471.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/250 (52%), Positives = 182/250 (73%), Gaps = 3/250 (1%)
 Frame = +3

Query  138  RQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
            + +LPPGPW+LP+IGS+HHL  G LPH+ L+ LS KYGPIM+LQLGE+  +V+SS  +AK
Sbjct  27   KNRLPPGPWRLPIIGSVHHLTSG-LPHQVLKKLSFKYGPIMYLQLGEVPTVVVSSSHMAK  85

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             I KTHDL FA+RP+ M   ++ Y C D+AFSPYGDYWR MRK+ VLELLS KMVKSF+ 
Sbjct  86   QILKTHDLAFASRPETMMGKIICYNCKDIAFSPYGDYWRHMRKLTVLELLSAKMVKSFSP  145

Query  498  FRQEELSELISSIKASG-SAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEAL  674
             RQ+ELS L+SSI++    +PINL EK+ WF ++   ++AFG V + DQ   I L+ +A 
Sbjct  146  IRQDELSNLLSSIRSMNLDSPINLVEKLLWFMNAATCRSAFGNVCK-DQRELITLIHQAQ  204

Query  675  SLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKD  854
            SL+GGF +ADLFPSKK++H +SG + +L+    ++D++ + II  H++N AN  +   + 
Sbjct  205  SLSGGFELADLFPSKKYLHGISGMESKLMNARYKIDQVLDNIINVHRENRANGKSCNGES  264

Query  855  HEEDIVDVLL  884
              ED++DV L
Sbjct  265  GAEDLIDVFL  274



>ref|XP_008385924.1| PREDICTED: premnaspirodiene oxygenase-like [Malus domestica]
Length=506

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/273 (51%), Positives = 198/273 (73%), Gaps = 11/273 (4%)
 Frame = +3

Query  72   VIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
            V  FL F+  I  + +R+    +  LPPGPWKLP IG+LH LVG S+PH  LR+L++KYG
Sbjct  11   VATFLLFLIMILKIGKRA----KINLPPGPWKLPFIGNLHQLVG-SIPHHGLRDLAKKYG  65

Query  252  PIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYW  431
             +MHL+LGE+S IV+SS + AK + KTHD+ FA+RP +++  ++ Y  T++ F+PYGDYW
Sbjct  66   XLMHLKLGEVSTIVVSSAEFAKEVMKTHDVXFASRPHILANSILTYGDTNIGFAPYGDYW  125

Query  432  RQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKA  611
            RQ+RKIC LELLS K V+SF S R+EE+  LI  I+     PIN+TE+I  FT    ++A
Sbjct  126  RQLRKICTLELLSMKRVQSFRSLREEEVFNLIKLIRLRAETPINITEQIYSFTYGFTSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG ++ +DQ++FI +VK+A+ +AGGF VAD+FPS   +H +SG +P+L ++H+E D+I 
Sbjct  186  AFG-IKSKDQDKFIDIVKQAMKVAGGFDVADVFPSVSLLHLISGMRPKLERLHKEADRIM  244

Query  792  ELIIEEHKDNMANRNNNKAKDHE--EDIVDVLL  884
            E II+EHK +MA    +K++D E  ED++DVLL
Sbjct  245  ENIIKEHKKDMA---TSKSQDVEAREDLIDVLL  274



>ref|XP_009765480.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=511

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/248 (55%), Positives = 183/248 (74%), Gaps = 4/248 (2%)
 Frame = +3

Query  150  PPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGP-IMHLQLGEISAIVISSPQLAKAI  323
            PPGPWKLP++GS+HHL + G  PH  L NL++KYGP +MHLQLGEIS +V+SS  +A+ +
Sbjct  37   PPGPWKLPILGSVHHLALEGGHPHHALANLAKKYGPDLMHLQLGEISTVVVSSLDMAREV  96

Query  324  TKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFR  503
             KTHDL FA+RPK+++ ++++YK TD+AFS YGDYWRQMRK+ VLELLS K V+SF S R
Sbjct  97   LKTHDLAFASRPKLLALEIIFYKSTDIAFSAYGDYWRQMRKVAVLELLSAKNVRSFTSIR  156

Query  504  QEELSELISSIKASGS-APINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            ++E S LI  I++S +  PIN+TE+I W+ SS   KAAFG + + DQ++FI++V+E   L
Sbjct  157  RDEASRLIQIIRSSPTDEPINVTERILWYESSMTCKAAFGELLK-DQKKFILIVRELTEL  215

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE  860
            +GGF VAD+FPS K +H +SG K R+L  H+ VD I E +I EH  N+AN          
Sbjct  216  SGGFSVADIFPSIKILHLLSGMKGRILNTHKRVDAIVEDVINEHIKNLANGKAGNGALGG  275

Query  861  EDIVDVLL  884
            ED+VDVLL
Sbjct  276  EDLVDVLL  283



>ref|XP_006365938.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=514

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 187/262 (71%), Gaps = 5/262 (2%)
 Frame = +3

Query  111  LRRRSNPARRQ----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGE  278
            +++ S P  R     +LPPGPW+LPLIG+LHHL+GG LPH   R LS++YGP+M+LQLGE
Sbjct  25   VKKWSKPKNRNEKQFRLPPGPWRLPLIGNLHHLIGGGLPHHIFRKLSQRYGPLMYLQLGE  84

Query  279  ISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVL  458
            +  +VISS  +AK I +THD  FA RP++ S ++++Y   D+AFSPYGDYWRQMRKIC L
Sbjct  85   VPTVVISSTTIAKEILRTHDHAFACRPQLTSTNIIFYNSIDIAFSPYGDYWRQMRKICTL  144

Query  459  ELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRRED  638
            EL S KM+K F++ R++EL+ LISSI++   +P+N+T+KI  FT+  I ++AFG+V + D
Sbjct  145  ELFSIKMIKLFSAIREDELTSLISSIRSMRGSPVNMTKKIFLFTNCIICRSAFGKVCK-D  203

Query  639  QERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKD  818
            +  F+  +KE L LA GF +ADL+PS K +H + G K R++  H++VD + E I+ EH +
Sbjct  204  RGEFLTTLKEVLLLAAGFFMADLYPSWKLLHNLRGEKTRMVNAHKKVDAVMEEILNEHIE  263

Query  819  NMANRNNNKAKDHEEDIVDVLL  884
            N A       +  +ED+VDVLL
Sbjct  264  NKAAGKKGNGEFGDEDLVDVLL  285



>gb|ABC69398.1| CYP71D5v3 [Nicotiana tabacum]
Length=504

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 182/251 (73%), Gaps = 2/251 (1%)
 Frame = +3

Query  132  ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQL  311
            A+  KLPPGPW+LP IGSLHHL  G LPH  LR+L+RKYGP+M+LQLGEI  +VISSP++
Sbjct  29   AKIPKLPPGPWRLPFIGSLHHL-KGKLPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRV  87

Query  312  AKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSF  491
            AKA+ KTHDL FA RP+ MS D+V+YK  D++F+P+GDYWRQMRKI   ELLS KM+KS+
Sbjct  88   AKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSY  147

Query  492  NSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEA  671
            +  R++ELS+L+SSI+    + +N+ EK+ WFTS    + AFG++   D++  I+L++E 
Sbjct  148  SLIRKDELSKLLSSIRLETGSAVNINEKLLWFTSCMTCRLAFGKI-CNDRDELIMLIREI  206

Query  672  LSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAK  851
            L+L+GGF V DLFPS K +H +S  K RL  VH + D + E II EH++N A       +
Sbjct  207  LTLSGGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNE  266

Query  852  DHEEDIVDVLL  884
               ED++D LL
Sbjct  267  FGGEDMIDALL  277



>gb|ABC69402.1| CYP71D5v2 [Nicotiana tabacum]
Length=504

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/251 (53%), Positives = 182/251 (73%), Gaps = 2/251 (1%)
 Frame = +3

Query  132  ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQL  311
            A+  KLPPGPW+LP IGSLHHL  G LPH  LR+L+RKYGP+M+LQLGEI  +VISSP++
Sbjct  29   AKIPKLPPGPWRLPFIGSLHHL-KGKLPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRV  87

Query  312  AKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSF  491
            AKA+ KTHDL FA RP+ MS D+V+YK  D++F+P+GDYWRQMRKI   ELLS KM+KS+
Sbjct  88   AKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSY  147

Query  492  NSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEA  671
            +  R++ELS+L+SSI+    + +N+ EK+ WFTS    + AFG++   D++  I+L++E 
Sbjct  148  SLIRKDELSKLLSSIRLETGSAVNINEKLLWFTSCMTCRLAFGKI-CNDRDELIMLIREI  206

Query  672  LSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAK  851
            L+L+GGF V DLFPS K +H +S  K RL  VH + D + E II EH++N A       +
Sbjct  207  LTLSGGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNE  266

Query  852  DHEEDIVDVLL  884
               ED++D LL
Sbjct  267  FGGEDMIDALL  277



>ref|XP_007146608.1| hypothetical protein PHAVU_006G054500g [Phaseolus vulgaris]
 gb|ESW18602.1| hypothetical protein PHAVU_006G054500g [Phaseolus vulgaris]
Length=508

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 194/276 (70%), Gaps = 15/276 (5%)
 Frame = +3

Query  81   FLSFVFCIYTLRRRSNPARRQ-----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             L F+F    +++  N  R++     K+PPGP KLP+IG++H+L+  S PHR LR+L+ K
Sbjct  11   LLFFIFLTLIVQKIGNKPRKRDETTSKIPPGPTKLPIIGNIHNLLS-SQPHRKLRDLALK  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGE+S IVIS+P+ AK + KTHD+ FA RPK+ + DV  Y CTD+AFSPYG 
Sbjct  70   YGPLMHLQLGEVSTIVISTPECAKEVMKTHDINFATRPKLPTVDVFSYNCTDIAFSPYGY  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC LELLS K V SF   R++ELS L+  I +   +PINLT+ +     + I+
Sbjct  130  YWRQLRKICTLELLSLKRVNSFQPIREDELSNLVKWIDSEKGSPINLTQALLSSIYTIIS  189

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            ++AFG+ + +DQE FI +VK+++ +AGGF + DLFPS  W+ +V+G +P L ++H++ D 
Sbjct  190  RSAFGK-KYKDQENFITVVKKSMKVAGGFDIGDLFPSATWLQHVTGMRPELERLHQQTDH  248

Query  786  IFELIIEEHKDNMANRNNNKAKDHE---EDIVDVLL  884
            I E II EHK+       +KAKDHE   ED+VDVL+
Sbjct  249  IMENIINEHKE-----AKSKAKDHEREPEDLVDVLI  279



>ref|XP_009764618.1| PREDICTED: cytochrome P450 71D7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009764619.1| PREDICTED: cytochrome P450 71D7-like isoform X2 [Nicotiana sylvestris]
Length=504

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 180/247 (73%), Gaps = 2/247 (1%)
 Frame = +3

Query  144  KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAI  323
            KLPPGPW+LP IGSLHHL  G LPH  LR+L+RKYGP+M+LQLGEI  +VISSP++AKA+
Sbjct  33   KLPPGPWRLPFIGSLHHL-KGKLPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRVAKAV  91

Query  324  TKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFR  503
             KTHDL FA RP+ MS D+V+YK  D++F+P+GDYWRQMRKI   ELLS KM+KS++  R
Sbjct  92   LKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIR  151

Query  504  QEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLA  683
            ++ELS+L+SSI+    + +N+ EK+ WFTS    + AFG++   D++  I+L++E L+L+
Sbjct  152  KDELSKLLSSIRLETGSAVNINEKLLWFTSCMTCRLAFGKI-CNDRDELIMLIREILTLS  210

Query  684  GGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEE  863
            GGF V DLFPS K +H +S  K RL  VH + D + E II EH++N A       +   E
Sbjct  211  GGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFGGE  270

Query  864  DIVDVLL  884
            D++D LL
Sbjct  271  DMIDALL  277



>ref|XP_006359503.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/255 (51%), Positives = 184/255 (72%), Gaps = 2/255 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            R++   ++KLPPGPW+LP+IGS+HHL  G+ PHR L NLS+KYGPIM+LQLGE+  +V+S
Sbjct  25   RNSKTLKKKLPPGPWRLPIIGSVHHLTRGT-PHRVLGNLSQKYGPIMYLQLGEVPTVVVS  83

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP +AK I KTHDL FA+R   M   ++ Y  TD+AFSPYGDYWR MRK+ VLELLS KM
Sbjct  84   SPHMAKQILKTHDLAFASRSVTMLGKILCYNSTDIAFSPYGDYWRHMRKLSVLELLSAKM  143

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSF+S R +ELS L+SSI +   +PINL+EK+ WF +++  ++ FG+  + +Q   + L
Sbjct  144  VKSFSSIRHDELSNLLSSIDSMVGSPINLSEKLFWFMNASTCRSTFGKTCK-NQNELVTL  202

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            ++ A+SL+ GF +ADLFPSK ++H +SG + +L+K   +VD + + II  H++N  N  N
Sbjct  203  IQRAMSLSSGFELADLFPSKTFLHGISGMESKLMKARNKVDILLDNIINVHRENHTNGKN  262

Query  840  NKAKDHEEDIVDVLL  884
               +   ED++DV L
Sbjct  263  YNGESGTEDLIDVFL  277



>emb|CDP10756.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/281 (49%), Positives = 195/281 (69%), Gaps = 11/281 (4%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSN----PARRQKLP---PGPWKLPLIGSLHHLVGGSLPHRT  224
            ++    L  V C + L + +      + R   P   PGPWKLPLIGS+HHL  GSLPH  
Sbjct  3    ITFPALLVSVLCFFVLWKLTGLFIKSSERTDSPRKLPGPWKLPLIGSMHHL-AGSLPHHA  61

Query  225  LRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDV  404
            LR+L+ K+GPIMHLQ+GEIS +VIS+PQ AK + K HD++FA+RP+ ++  ++ Y   D+
Sbjct  62   LRDLAEKFGPIMHLQMGEISTVVISAPQEAKEVLKVHDIIFADRPEFLASKILGYDNLDI  121

Query  405  AFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICW  584
            AFSPYGDYW+QMRKIC+LELLS K V+SF + R++E  ++I SIK+S S P+N+T+K   
Sbjct  122  AFSPYGDYWKQMRKICLLELLSPKSVRSFGTLREDEALKVIRSIKSSNS-PVNITDKAFT  180

Query  585  FTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLK  764
            FT+  + +AAFG+     Q+R I L+  A+S +GGF +ADLFPS K++H +SG KP+L+K
Sbjct  181  FTNDIVCRAAFGK-SFAHQDRLITLINGAISASGGFDIADLFPSLKFLHSLSGLKPKLIK  239

Query  765  VHREVDKIFELIIEEHKDNMANRNNNKAKDHE-EDIVDVLL  884
            +H E+D++ E II E K   AN++       E ED+VDVLL
Sbjct  240  LHNEIDQMLETIISERKQKRANQSTPVGSQSEVEDLVDVLL  280



>ref|XP_009619325.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 181/250 (72%), Gaps = 3/250 (1%)
 Frame = +3

Query  135  RRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLA  314
            + Q+LPPGPW+LP IGSLHHL+GG LPHR+L+ L++KYGP+M+LQLG++  I+ISSP++A
Sbjct  35   QNQRLPPGPWRLPFIGSLHHLIGGELPHRSLKKLAQKYGPLMYLQLGQVPTIIISSPRIA  94

Query  315  KAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFN  494
            K + KTHDL FANRP++ S  +++Y   D+ FS YGDYWRQMRKIC++ELLS+KMVKSF+
Sbjct  95   KEVLKTHDLAFANRPQLTSSTIIFYNNIDMVFSQYGDYWRQMRKICIVELLSSKMVKSFS  154

Query  495  SFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEAL  674
              R++ELS             +N+TEKI  FT+S   ++AFG++ + D+  F  L+KE L
Sbjct  155  GIREKELSS--LISSIRSMTEVNITEKIFMFTNSVTCRSAFGKICK-DRGEFRTLLKEVL  211

Query  675  SLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKD  854
             LAGGF VADLFP  K +H +SG + RL+  HR+VD+I E II EH  N A  N    + 
Sbjct  212  LLAGGFFVADLFPCWKLLHNLSGMESRLVNAHRKVDEIMENIINEHIANRAAGNKRNGEF  271

Query  855  HEEDIVDVLL  884
             +ED+VDV L
Sbjct  272  GDEDLVDVFL  281



>ref|XP_006367127.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
Length=505

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 188/262 (72%), Gaps = 3/262 (1%)
 Frame = +3

Query  105  YTLRRRSNPARRQK-LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEI  281
            + LR ++  +R +K LPPGPW+LP+IGS+HHL  G +PH  L+NLS+K+GPIM+LQLGE+
Sbjct  21   HKLRIKTKKSRNKKILPPGPWRLPIIGSVHHLTKG-IPHHVLKNLSQKFGPIMYLQLGEV  79

Query  282  SAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLE  461
              IV+SSP +A+ I KTHDL FA+R + M   +  Y CTD+AFSPYG+YWR MRK+C++E
Sbjct  80   PTIVVSSPHMAQKIMKTHDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRHMRKLCIME  139

Query  462  LLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQ  641
            LLS KMVKSF+  R +ELS L+SSIK+  + PIN++EK+ WF +S   +++FG+  ++  
Sbjct  140  LLSAKMVKSFSPIRLDELSSLVSSIKSMKNTPINVSEKLFWFMNSVTCRSSFGKACKDQN  199

Query  642  ERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDN  821
            E  I L+   LSLAGGF +ADL+PSKK++  +SG   +L++   +VD + + +I+ H++N
Sbjct  200  EAMISLIHGVLSLAGGFELADLYPSKKFLSGISGMGSKLIEARNKVDTVLDKVIDVHREN  259

Query  822  MAN-RNNNKAKDHEEDIVDVLL  884
             AN +  N      ED++DV  
Sbjct  260  HANGKKCNAECGSNEDLIDVFF  281



>ref|XP_009617877.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   279 bits (713),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 187/250 (75%), Gaps = 5/250 (2%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAIT  326
            LPPGPWKLPL+GS+HHL+   LPH TLR+L++K+GP+MHLQLGEIS IVIS+PQ AK + 
Sbjct  36   LPPGPWKLPLLGSIHHLIS-ILPHHTLRDLAKKHGPLMHLQLGEISTIVISTPQAAKEVL  94

Query  327  KTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQ  506
            K  D+ F NRP+++S  ++ Y  +D+AF+PYG+YWRQMRK+C LELLS K V+SF S R+
Sbjct  95   KVQDIAFTNRPELLSVKILCYNYSDIAFAPYGNYWRQMRKLCTLELLSAKNVQSFASIRE  154

Query  507  EELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAG  686
            EE  +L+  +K+   + INLTEK+   T++ I +AAFG+ R+E+   F+ L+KE   +  
Sbjct  155  EEAFDLVEYVKSKSGSTINLTEKLYALTNAVICRAAFGKRRKEESAYFMSLIKEVSLMVT  214

Query  687  GFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMA----NRNNNKAKD  854
            G  ++++FPS K++H ++GTK +L+K+H+++DK+ ++IIEEHK+N+      +N  +   
Sbjct  215  GLDISEVFPSLKFLHAITGTKAKLVKLHKKLDKVLDMIIEEHKENLQLVSLKKNGEEESI  274

Query  855  HEEDIVDVLL  884
             +ED+V++LL
Sbjct  275  RKEDLVNLLL  284



>emb|CDP07879.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   278 bits (712),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/258 (53%), Positives = 188/258 (73%), Gaps = 5/258 (2%)
 Frame = +3

Query  117  RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVI  296
            +RS  A  QKLPP PWKLP+IG +HHL+G S PH  LR L++KYGP+M++QLG+++AIV+
Sbjct  25   KRSKTA--QKLPPSPWKLPIIGHMHHLLG-SPPHHALRKLAQKYGPLMNIQLGQMTAIVV  81

Query  297  SSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTK  476
            +SP+LAK I KTHDL FA+R + +S  ++ Y C+D+A   YGDYWRQMRKIC LELLS K
Sbjct  82   TSPRLAKEIMKTHDLAFADRAEFLSGKIMCYDCSDIACCRYGDYWRQMRKICTLELLSAK  141

Query  477  MVKSFNSFRQEELSELISSIK--ASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERF  650
             V+SF S RQ+E   LISSIK  A    PI+LTEK+  +TSS + +AAFG+V ++D   F
Sbjct  142  SVRSFVSVRQDEALHLISSIKVLAGAREPIDLTEKVSSYTSSVVCRAAFGKVSKDDHAAF  201

Query  651  IVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMAN  830
            + L+KEAL +A  F ++DL PS K +H +   + +LLK+H + D+I E II++H DN A 
Sbjct  202  LQLMKEALPIASAFDISDLLPSFKILHPLLSVESKLLKMHDKEDEILEKIIDQHIDNQAR  261

Query  831  RNNNKAKDHEEDIVDVLL  884
            RN +  +  +ED++DVLL
Sbjct  262  RNISTGEYGQEDLIDVLL  279



>ref|XP_003589693.1| Cytochrome P450 [Medicago truncatula]
Length=500

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 189/256 (74%), Gaps = 8/256 (3%)
 Frame = +3

Query  117  RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVI  296
            +RS P    KLPPGPWKLP+IGS+HHLV  S PHR LR+L++ YGP+MHLQLGEISAIV+
Sbjct  22   KRSAP----KLPPGPWKLPIIGSIHHLVT-STPHRKLRDLAKIYGPLMHLQLGEISAIVV  76

Query  297  SSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTK  476
            SSP+ A+ + KTHD++FA+RPK+++ +++ Y  TD+AFSPYG+YWRQ+RKIC +EL + K
Sbjct  77   SSPEYAREVLKTHDVIFASRPKLLTIEILSYDYTDIAFSPYGNYWRQLRKICTMELFTQK  136

Query  477  MVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIV  656
             V SF   R+EEL+ L+  I +   +P+N+T+ +   T S I KAAFG  + + +E F  
Sbjct  137  RVSSFQPIREEELNNLVKKIDSQQGSPVNITQLVVSSTFSIITKAAFGS-KGKGREEFGS  195

Query  657  LVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRN  836
             + +  S+AGGF +A+LFPS KW+  VSG +P+L ++HR++D+I E I+ EHK+  +  N
Sbjct  196  -IGDGESIAGGFDIAELFPSAKWLQRVSGLRPKLERLHRQIDQILENIVTEHKEAKSKAN  254

Query  837  NNKAKDHEEDIVDVLL  884
             ++  + EED+VDVLL
Sbjct  255  ESQGGE-EEDLVDVLL  269



>gb|AES59944.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=492

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/256 (52%), Positives = 189/256 (74%), Gaps = 8/256 (3%)
 Frame = +3

Query  117  RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVI  296
            +RS P    KLPPGPWKLP+IGS+HHLV  S PHR LR+L++ YGP+MHLQLGEISAIV+
Sbjct  14   KRSAP----KLPPGPWKLPIIGSIHHLVT-STPHRKLRDLAKIYGPLMHLQLGEISAIVV  68

Query  297  SSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTK  476
            SSP+ A+ + KTHD++FA+RPK+++ +++ Y  TD+AFSPYG+YWRQ+RKIC +EL + K
Sbjct  69   SSPEYAREVLKTHDVIFASRPKLLTIEILSYDYTDIAFSPYGNYWRQLRKICTMELFTQK  128

Query  477  MVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIV  656
             V SF   R+EEL+ L+  I +   +P+N+T+ +   T S I KAAFG  + + +E F  
Sbjct  129  RVSSFQPIREEELNNLVKKIDSQQGSPVNITQLVVSSTFSIITKAAFGS-KGKGREEFGS  187

Query  657  LVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRN  836
             + +  S+AGGF +A+LFPS KW+  VSG +P+L ++HR++D+I E I+ EHK+  +  N
Sbjct  188  -IGDGESIAGGFDIAELFPSAKWLQRVSGLRPKLERLHRQIDQILENIVTEHKEAKSKAN  246

Query  837  NNKAKDHEEDIVDVLL  884
             ++  + EED+VDVLL
Sbjct  247  ESQGGE-EEDLVDVLL  261



>ref|XP_006352953.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   278 bits (711),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/256 (51%), Positives = 189/256 (74%), Gaps = 2/256 (1%)
 Frame = +3

Query  117  RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVI  296
            R+     ++ LPPGPWKLPLIGSLHHL+G +LPH  LRNLS+KYGP+MHL+LGEI A+++
Sbjct  25   RKWKEMNQRLLPPGPWKLPLIGSLHHLIG-ALPHHVLRNLSKKYGPLMHLKLGEIDAVIV  83

Query  297  SSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTK  476
            SSP LAK + K HDL FA RPK+++ D+V+Y+  D+AF+ YGDYW+QMRKIC  ELLS+K
Sbjct  84   SSPHLAKQVLKVHDLSFAARPKLVASDIVFYRQNDIAFAEYGDYWKQMRKICTSELLSSK  143

Query  477  MVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIV  656
            +VKSF+  RQ+E+  L++SI +  +  +N++EK+   TSS I ++AFG+V  +D++  ++
Sbjct  144  IVKSFSLIRQDEVHNLVASICSMPNVVVNMSEKVLQLTSSVICRSAFGKV-WDDRDNLLM  202

Query  657  LVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRN  836
            +++E L+L  GF V DLFPS K +H +SG + RL+ +H ++D I E II +HK + AN  
Sbjct  203  IMRELLALLAGFDVVDLFPSWKLLHKISGKRNRLMNMHYKLDVILENIINDHKQSKANGG  262

Query  837  NNKAKDHEEDIVDVLL  884
                +   E+++DVLL
Sbjct  263  KGNNEFEGENLIDVLL  278



>ref|XP_009794007.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 128/255 (50%), Positives = 187/255 (73%), Gaps = 8/255 (3%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLPLIGS+ H++GG  PH  L NL++KYGP+MHLQLGE+  +V++
Sbjct  23   KNSNSQIKRLPPGPWKLPLIGSMFHMLGGH-PHHVLTNLAKKYGPLMHLQLGEMPVVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RPK ++ ++V+Y C+D+AF PYGDYWRQMRKICV+ELL+ K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPKFLATEIVFYNCSDIAFCPYGDYWRQMRKICVIELLTAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+SF++ RQ+E+  +I   ++S    IN+T++IC FTSS   ++AFG+V +E Q+ FI+L
Sbjct  142  VRSFSAIRQDEVHRMIEFFRSSTDQQINVTKRICQFTSSMTCRSAFGKVIKE-QDEFILL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK   +L  GF VAD+FPS K++H +SG K R++ VH ++D I E II E K+       
Sbjct  201  VKRNTALVEGFDVADIFPSLKFLHVLSGKKARVMDVHHKIDAILENIINERKEIATGELG  260

Query  840  NKAKDHEEDIVDVLL  884
             K       ++DVLL
Sbjct  261  GKG------LIDVLL  269



>ref|XP_002522762.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39613.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   278 bits (711),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 143/285 (50%), Positives = 207/285 (73%), Gaps = 10/285 (4%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRS---NPARRQKLPPGPWKLPLIGSLHHLVGGS  209
            ME++F F P+ +  FL F+F ++ + ++S   +PA    LPPGPWKLPLIGS+HHLVG S
Sbjct  1    MEYQFPFFPI-LFTFLLFIFMVFRIWKKSKTNHPA--PHLPPGPWKLPLIGSMHHLVG-S  56

Query  210  LPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYY  389
             PH  L++L++KYGP+MHLQLGE++ IVISSP++AK + KTHD+VFA RP +++  V  Y
Sbjct  57   QPHHRLKDLAKKYGPLMHLQLGELTNIVISSPEIAKEVMKTHDVVFAQRPHLLAASVTSY  116

Query  390  KCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLT  569
              TD+AF+PYGDYWRQMRK+C LELL+ K V+SF S R+EE+S L+ S+ +S  +PIN +
Sbjct  117  NYTDIAFAPYGDYWRQMRKLCTLELLTAKRVQSFRSIREEEVSRLMRSLSSSAGSPINFS  176

Query  570  EKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTK  749
                  T S I++A+FG++ +  +E FI +VK+ +  AGGF +AD++PS K +H++SG  
Sbjct  177  RMFNSLTYSIISRASFGKIWK-GEEIFIPIVKKLIVAAGGFTLADVYPSVKLLHWISGMA  235

Query  750  PRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            PRL ++H  VD IF+ II++H+   A  N+  + + E D+VDVLL
Sbjct  236  PRLKRIHHIVDNIFQNIIDDHRTKRAAANS--SVEGEGDLVDVLL  278



>ref|XP_009624010.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=502

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 191/253 (75%), Gaps = 5/253 (2%)
 Frame = +3

Query  126  NPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSP  305
            N A+R  LPPGPWKLP++GS+ H+VGG LPHR LR+L++KYGP+MHL+LGE+S +V++SP
Sbjct  27   NQAKR--LPPGPWKLPILGSMLHMVGG-LPHRILRDLAKKYGPLMHLKLGEVSVVVVTSP  83

Query  306  QLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVK  485
            ++AK + KTHDL FA+RPK+++ ++V Y  +D+AF+PYGDYWRQMRKICVLE+L+TK V+
Sbjct  84   EIAKEVLKTHDLAFASRPKLLAAEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVR  143

Query  486  SFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVK  665
            SF+S R++E+  LI   ++S   P+N T++I  FTS  I ++AFG V +E Q+ FI ++K
Sbjct  144  SFSSIRRDEVFRLIEFFRSSSGKPVNFTKRISLFTSFIICRSAFGTVFKE-QDEFIQVMK  202

Query  666  EALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNK  845
               +L  G  VAD+FPS K++H ++G + +++ +H +VD I + +I EHK N+A    N 
Sbjct  203  NVTALLEGLDVADIFPSLKFLHVLTGKRAKVMNLHHKVDSIVDNVINEHKKNLATGKFN-  261

Query  846  AKDHEEDIVDVLL  884
             +   ED++DVLL
Sbjct  262  GQLGGEDLIDVLL  274



>gb|KHM99028.1| Cytochrome P450 71D11 [Glycine soja]
Length=496

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 191/268 (71%), Gaps = 9/268 (3%)
 Frame = +3

Query  90   FVFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIM  260
            F+F I  L+  SN  + +    +PPGPWKLP+IG++HHLV  S PHR LR+L++ YGP+M
Sbjct  4    FLFMIVALKIGSNLKKTESSPNIPPGPWKLPIIGNIHHLVT-SAPHRKLRDLAKMYGPLM  62

Query  261  HLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQM  440
            HLQLGE+  I++SSP+ AK I KTHD++FA+RPK+++ D++ Y+ T++ FSPYG+YWRQ+
Sbjct  63   HLQLGEVFTIIVSSPEYAKEIMKTHDVIFASRPKILASDILCYESTNIVFSPYGNYWRQL  122

Query  441  RKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFG  620
            RKIC LEL + K V SF   R++EL+ L+  + +   +P+N TE +     + I++AAFG
Sbjct  123  RKICTLELFTQKRVNSFQPTREKELTNLVKMVDSHKGSPMNFTEAVLLSIYNIISRAAFG  182

Query  621  RVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELI  800
             +  +DQE FI +VKEA+++  GF + DLFPS KW+  V+G +P+L ++HR++D+I E I
Sbjct  183  -MECKDQEEFISVVKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHRQIDRILEGI  241

Query  801  IEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I EHK      N+    + +ED+VDVLL
Sbjct  242  INEHK----QANSKGYSEAKEDLVDVLL  265



>ref|XP_004511998.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   278 bits (710),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 141/285 (49%), Positives = 197/285 (69%), Gaps = 8/285 (3%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARR-QKLPPGPWKLPLIGSLHHL-VGGSL  212
            ME  F F    VI F+  +F ++ L +   P     KLPPGP KLPLIG+LH L +   L
Sbjct  1    MEAPFSF---YVIPFI-LLFLLHRLAKYYKPKTSLNKLPPGPRKLPLIGNLHQLAMSKKL  56

Query  213  PHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYK  392
            PH  L+ LS KYGP+MHLQLGEIS +++SSP+LAK + KTHD+ FANRPK++S +++ Y 
Sbjct  57   PHYALKELSHKYGPLMHLQLGEISTVIVSSPKLAKEVMKTHDVAFANRPKLLSPEIMAYG  116

Query  393  CTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTE  572
              D+ FSPYGDYWRQMRKICVLELL+ K V+SF+  R++E ++ I SI++S    INLT 
Sbjct  117  SKDIVFSPYGDYWRQMRKICVLELLNAKRVQSFSYIREDETNKFIKSIQSSIDTTINLTS  176

Query  573  KICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKP  752
            +I    SSTI++AAFG  + +DQ+ F+ LV++ + L+GGF V DLFPS K++H ++G +P
Sbjct  177  RILSMVSSTISRAAFGD-KSKDQDEFVDLVRKVVELSGGFDVDDLFPSMKFLHVITGMRP  235

Query  753  RLLKVHREVDKIFELIIEEHKDNMAN-RNNNKAKDHEEDIVDVLL  884
            +L K+H+  D I   I+ +H++N    + +N      ED+VDVLL
Sbjct  236  KLEKIHKRADTIMGNIVRQHEENRGRPKEDNNIDVQNEDLVDVLL  280



>emb|CDP07872.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   277 bits (709),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 190/278 (68%), Gaps = 5/278 (2%)
 Frame = +3

Query  57   FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
             N  +  +F++FV  +  + +RS  A  QKLPP PWKLP+IG +HHL  GS PH  LR L
Sbjct  5    LNFTAFFLFIAFVLTLIKVLKRSKTA--QKLPPSPWKLPIIGHMHHL-SGSPPHHALRKL  61

Query  237  SRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSP  416
            ++KYGP+MH+QLGEIS+IV++SP+LAK I KTHDL FANR + ++  ++ Y C+D+A  P
Sbjct  62   AQKYGPLMHIQLGEISSIVVTSPRLAKEIMKTHDLAFANRGETLAGKIMLYNCSDIACCP  121

Query  417  YGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA--PINLTEKICWFT  590
            YGDYWRQMRKIC LELLS+K V+S  S RQEE   L+SSIKA  +A   I++TEK+  + 
Sbjct  122  YGDYWRQMRKICTLELLSSKSVRSCGSIRQEEALHLVSSIKALANAGKSIDVTEKMSSYA  181

Query  591  SSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVH  770
            S+ + +AAFG+V  +D   F  L+KE+ S+A  F V+DL PS K +H     K ++L + 
Sbjct  182  SAVLYRAAFGKVSNDDHFAFFQLIKESSSIASAFDVSDLLPSFKILHPFLSVKNKMLNIR  241

Query  771  REVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             ++DK+ + II++H DN+A           EDI+DVLL
Sbjct  242  YKLDKVLDKIIDQHMDNLARTKIATGASDNEDIIDVLL  279



>ref|XP_009776868.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/255 (52%), Positives = 190/255 (75%), Gaps = 6/255 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLP+IGS+ HL+GG LPH  LR+L++KYGPIMHLQLGE+S +VIS
Sbjct  23   KNSNSQTKRLPPGPWKLPIIGSMLHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIS  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RP +++  +V+Y  TD+AFSPYG+YWRQMRKIC+LELLS K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSFNS RQ+E+  +I   ++S   P+N+T++   FTSS   ++AFG+  +E Q+ F  L
Sbjct  142  VKSFNSIRQDEVHRMIEFFRSSPGKPVNVTKRFALFTSSMTCRSAFGQEYKE-QDEFARL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK+  +L  GF VAD+FPS K++H ++G K +++  H E+D+I + II EHK  +A  N 
Sbjct  201  VKKVSNLMEGFDVADIFPSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHK-KVAKTN-  258

Query  840  NKAKDHEEDIVDVLL  884
               +   E I+DVLL
Sbjct  259  --CESGSEGIIDVLL  271



>ref|XP_006605460.1| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=508

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 191/268 (71%), Gaps = 9/268 (3%)
 Frame = +3

Query  90   FVFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIM  260
            F+F I  L+  SN  + +    +PPGPWKLP+IG++HHLV  S PHR LR+L++ YGP+M
Sbjct  16   FLFMIVALKIGSNLKKTESSPNIPPGPWKLPIIGNIHHLVT-SAPHRKLRDLAKMYGPLM  74

Query  261  HLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQM  440
            HLQLGE+  I++SSP+ AK I KTHD++FA+RPK+++ D++ Y+ T++ FSPYG+YWRQ+
Sbjct  75   HLQLGEVFTIIVSSPEYAKEIMKTHDVIFASRPKILASDILCYESTNIVFSPYGNYWRQL  134

Query  441  RKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFG  620
            RKIC LEL + K V SF   R++EL+ L+  + +   +P+N TE +     + I++AAFG
Sbjct  135  RKICTLELFTQKRVNSFQPTREKELTNLVKMVDSHKGSPMNFTEAVLLSIYNIISRAAFG  194

Query  621  RVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELI  800
             +  +DQE FI +VKEA+++  GF + DLFPS KW+  V+G +P+L ++HR++D+I E I
Sbjct  195  -MECKDQEEFISVVKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHRQIDRILEGI  253

Query  801  IEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I EHK      N+    + +ED+VDVLL
Sbjct  254  INEHK----QANSKGYSEAKEDLVDVLL  277



>ref|XP_009788504.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=321

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/276 (50%), Positives = 189/276 (68%), Gaps = 6/276 (2%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            V++++F  F+F +  +  +   +++QKLPPGPW+LPLIGS+HHL+ G LPH+TL  L++K
Sbjct  11   VTLLMFFPFLFIV--VFNKWKKSKQQKLPPGPWRLPLIGSIHHLIRGRLPHQTLTKLAKK  68

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGPI++L+LGEI  IVISSP + K I +THDL FA RP   S ++  Y C D+AF+PYGD
Sbjct  69   YGPILYLKLGEIPTIVISSPSMTKQILRTHDLAFATRPVFTSINISSYNCKDIAFAPYGD  128

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKA-SGSAPINLTEKICWFTSSTI  602
             WRQMRKICV+ELL+ KMVKSF S R++ELS L+SSI++ +G + +NLT+ +  FT+S I
Sbjct  129  NWRQMRKICVMELLTVKMVKSFCSIRKDELSRLLSSIRSVNGRSAVNLTQIVLRFTNSVI  188

Query  603  AKAAFGRVRREDQERFIVLVKEALSLAGGF-GVADLFPS-KKWIHYVSGTKPRLLKVHRE  776
             ++AFG   + +Q+  I L+ E L   GG   V D  PS K  IH +SG K R +K+H+ 
Sbjct  189  CRSAFGNACK-NQDELIKLLSEVLESVGGLVDVGDFIPSWKLLIHKMSGAKSRFIKLHKR  247

Query  777  VDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             D   E II EH  N A  +    +   ED+VDVLL
Sbjct  248  ADAALEDIINEHIKNRAAGSKGNGEFGGEDLVDVLL  283



>ref|XP_009769208.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/255 (52%), Positives = 190/255 (75%), Gaps = 6/255 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLP+IGS+ HL+GG LPH  LR+L++KYGPIMHLQLGE+S +VI+
Sbjct  23   KNSNSQTKRLPPGPWKLPIIGSMLHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RP +++  +V+Y  TD+AFSPYG+YWRQMRKIC+LELLS K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSFNS RQ+E+  +I   ++S   P+N+T++   FTSS   ++AFG+  +E Q+ F  L
Sbjct  142  VKSFNSIRQDEVHRMIEFFRSSPGKPVNVTKRFALFTSSMTCRSAFGQEYKE-QDEFARL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK+  +L  GF VAD+FPS K++H ++G K +++  H E+D+I + II EHK  +A  N 
Sbjct  201  VKKVSNLMEGFDVADIFPSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHK-KVAKTN-  258

Query  840  NKAKDHEEDIVDVLL  884
               +   E I+DVLL
Sbjct  259  --CESGSEGIIDVLL  271



>ref|XP_009772938.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 186/248 (75%), Gaps = 3/248 (1%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKA  320
            ++LPPGPWKLP+ GS  H+VGG LPHR LR+L++KYGP+MHLQLGE+S +V++SP++AK 
Sbjct  30   KRLPPGPWKLPIRGSTLHMVGG-LPHRVLRDLAKKYGPLMHLQLGEVSVVVVTSPEIAKE  88

Query  321  ITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSF  500
            + KTHDL FA+RPK+++ ++V Y  +DVAF+PYGDYWRQMRKICVLE+LSTK V+SF+S 
Sbjct  89   VLKTHDLAFASRPKLLAAEIVLYDSSDVAFAPYGDYWRQMRKICVLEVLSTKNVRSFSSI  148

Query  501  RQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            R++E+  L+   ++S   P+N T++I  F S  I ++AFG V +E Q+ FI ++K   +L
Sbjct  149  RRDEVFRLVEFFRSSSGKPVNYTKRISLFMSFIICRSAFGTVFKE-QDEFIQVMKNVTAL  207

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE  860
              GF VAD+FPS K++H V+G + + + +H +VD I + +I EHK+N+A       +   
Sbjct  208  LEGFDVADIFPSLKFLHVVTGMRAKAMNLHHKVDAIVDNVINEHKENLAT-GKFSGQLGG  266

Query  861  EDIVDVLL  884
            ED++DVLL
Sbjct  267  EDLIDVLL  274



>ref|XP_007214747.1| hypothetical protein PRUPE_ppa025066mg [Prunus persica]
 gb|EMJ15946.1| hypothetical protein PRUPE_ppa025066mg [Prunus persica]
Length=514

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/273 (49%), Positives = 197/273 (72%), Gaps = 4/273 (1%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            ++ ++F+  V  I  +R ++N +    LPPGPWKLP+IG+LH L  GSLPH  LR+L++K
Sbjct  12   LAFLLFMIMVLKIGKIRGKTNYSA-SNLPPGPWKLPVIGNLHRL-AGSLPHHRLRDLAKK  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGE+SA+V+SS + AK + KTHDL+FA+RP +++ +++ Y  TD+ F+PYG+
Sbjct  70   YGPLMHLKLGEVSAVVVSSAEFAKEVMKTHDLIFASRPTILAANILSYGSTDIGFAPYGE  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC LELLSTK V+SF   R+EE+  LI  I +   +PINLT++I   T +  +
Sbjct  130  YWRQLRKICTLELLSTKRVQSFRPIREEEVVNLIQWIASRAGSPINLTQEIYSSTYTITS  189

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + AFG+  R DQE+FI +VKE +  A GF +AD+FPS   +H +S  +P+L ++H+E DK
Sbjct  190  RTAFGKKTR-DQEKFIYIVKEFVKAASGFALADIFPSVSLLHLLSRMRPKLERLHKEADK  248

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I   II+EH+ N+ N  + +  + +ED+VDVLL
Sbjct  249  IMGNIIKEHQRNVVNTKSGEG-EADEDLVDVLL  280



>ref|XP_008227138.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D9-like [Prunus 
mume]
Length=512

 Score =   276 bits (706),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/273 (48%), Positives = 197/273 (72%), Gaps = 4/273 (1%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            ++ ++F+  V  I  +R ++  +    LPPGPWKLP+IG+LH L  GSLPH  LR+L++K
Sbjct  12   LAFLLFMIMVLKIGKIRGKTKYSA-SNLPPGPWKLPVIGNLHQL-AGSLPHHGLRDLAKK  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGE+SA+V+SS + AK + KTHDL+FA+RP++++  ++ Y  T++AF+PYG+
Sbjct  70   YGPLMHLKLGEVSAVVVSSAEFAKEVMKTHDLIFASRPQVLAARILSYGSTNIAFAPYGE  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC +ELLS K V+S+   R+EE+  LI SI +   +PINLT++IC    +  +
Sbjct  130  YWRQLRKICTIELLSAKRVRSYRPIREEEIRNLIKSIASRAGSPINLTQEICSSAFTITS  189

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            +AAFG+  R DQE+FI ++KEA   A GF +AD+FPS   +H +SG +P+L ++H+E D+
Sbjct  190  RAAFGKKTR-DQEKFIYIMKEAAKAASGFALADVFPSVSLLHLLSGMRPKLERLHKEADR  248

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I   II+EH+ +M      +  + EED+VDVLL
Sbjct  249  IMGNIIKEHQRDMVTTXCVEG-EAEEDLVDVLL  280



>ref|XP_006365962.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=504

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 186/258 (72%), Gaps = 4/258 (2%)
 Frame = +3

Query  117  RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVI  296
            R+   +++Q LPPGPW+LPLIGSLHHL+ G  PHR  R+L+RKYGP+ +L+LGE+  ++I
Sbjct  20   RKWRRSQKQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLARKYGPVTYLELGEVPTVII  79

Query  297  SSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTK  476
            SSP  +K + KTHDL FA+RP+  S D+V Y   D+AF+ YGDYW+QMRKIC++ELLS K
Sbjct  80   SSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSAK  139

Query  477  MVKSFNSFRQEELSELISSIKA-SGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            MVKSF+S R++ELS ++SS+ +  GS  +N+TEKI  FTSS   +  FG++ R D++  I
Sbjct  140  MVKSFSSIRKDELSSVLSSMDSVGGSCEVNMTEKIVRFTSSVTCRLVFGKLCR-DRDELI  198

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEH-KDNMAN  830
             L+K+AL L GGF V D FPS K ++ +SG K +L+K+H+ +D + E I+ EH K+ +A 
Sbjct  199  NLMKDALFLVGGFDVGDFFPSWKLLYKMSGAKSKLVKMHQNIDLVLERIVNEHIKNRVAG  258

Query  831  RNNNKAKDHEEDIVDVLL  884
               N A    ED+VD+ L
Sbjct  259  IKGNGAYGG-EDLVDIFL  275



>emb|CDP10758.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 181/245 (74%), Gaps = 4/245 (2%)
 Frame = +3

Query  153  PGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKT  332
            PGPWKLPLIGS+HHL  GSLPH  LR+L+ K+GPIMHLQ+GEIS +VIS+PQ AK + K 
Sbjct  39   PGPWKLPLIGSMHHL-AGSLPHHALRDLAEKFGPIMHLQMGEISTVVISAPQEAKEVLKV  97

Query  333  HDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEE  512
            HD+ FA+RP+ +S  ++ Y   D+AFSPYGDYW+QMRKIC+LELLS K V+SF + R++E
Sbjct  98   HDISFADRPEFLSSKILGYDNLDIAFSPYGDYWKQMRKICLLELLSPKSVRSFGTLREDE  157

Query  513  LSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGF  692
             S++I SIK+S S P+N+T+K   FT+  + +AAFG+     Q+R I L+  A+  +GGF
Sbjct  158  ASKVIRSIKSSNS-PVNITDKAFTFTNDIVCRAAFGK-SFAHQDRLITLINGAILASGGF  215

Query  693  GVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE-EDI  869
             +ADLFPS K++H +SG KP LLK+H E+D++ E II E K   AN++       E ED+
Sbjct  216  DIADLFPSLKFLHSLSGLKPTLLKLHHEIDQMLENIISERKQKRANQSIPVGSQSEVEDL  275

Query  870  VDVLL  884
            VDVLL
Sbjct  276  VDVLL  280



>ref|XP_010655881.1| PREDICTED: cytochrome P450 71D10-like [Vitis vinifera]
Length=505

 Score =   276 bits (705),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 190/264 (72%), Gaps = 5/264 (2%)
 Frame = +3

Query  96   FCIYTLRRRSNP-ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQL  272
            + +Y + +RS      QKLPPGPWKLPLIG++H LVG SLPHR+L  L++KYGP+M LQL
Sbjct  17   YMLYKIGKRSKANISTQKLPPGPWKLPLIGNVHQLVG-SLPHRSLTLLAKKYGPLMRLQL  75

Query  273  GEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKIC  452
            GE+S +++SSP++AK + KTHD  FA RP +++  ++ Y C+ VAF+PYGDYWRQ+RKIC
Sbjct  76   GEVSTLIVSSPEMAKQVMKTHDTNFAQRPILLATRILSYDCSGVAFAPYGDYWRQLRKIC  135

Query  453  VLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRR  632
            V+ELL+ K VKSF S R+EE+S LI+ + +     IN TEKI   T S IA+AAFG+ + 
Sbjct  136  VVELLTAKRVKSFQSVREEEISNLITMVTSCSRLQINFTEKISSLTFSIIARAAFGK-KS  194

Query  633  EDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEH  812
            EDQ+ F+ ++KE +  A GF VAD++PS KW+  +SG + ++ KV R  D+I + I++EH
Sbjct  195  EDQDAFLSVMKELVETASGFCVADMYPSVKWLDLISGMRYKIDKVFRMTDRILQNIVDEH  254

Query  813  KDNMANRNNNKAKDHEEDIVDVLL  884
            ++ +  ++     + E D+VDVLL
Sbjct  255  REKLKTQSGK--LEGEADLVDVLL  276



>ref|XP_009780029.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/235 (53%), Positives = 181/235 (77%), Gaps = 2/235 (1%)
 Frame = +3

Query  111  LRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAI  290
            ++ +++ ++ ++LPPGPWKLP++GS+ H++GG LPH  LR+L++KYGPIMHLQLGE+S +
Sbjct  20   MKWKNSNSQTKRLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLV  78

Query  291  VISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLS  470
            VISSP++AK + KTHDL FANRP +++  +V Y  TD+AFSPYG+YWRQMRKIC+LELLS
Sbjct  79   VISSPEMAKEVLKTHDLAFANRPLLVAAKIVCYNGTDIAFSPYGNYWRQMRKICLLELLS  138

Query  471  TKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERF  650
             K VKSFNS RQ+E+  +I   ++S   P+N+T++I  FT+S   ++AFG+  ++ Q+ F
Sbjct  139  AKTVKSFNSIRQDEVHRMIEFFRSSSGKPVNVTKRIALFTNSMTCRSAFGQEYKK-QDEF  197

Query  651  IVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHK  815
            + LVK+   L  GF VAD+FPS K++H ++G K +++ +H E+D I E II EHK
Sbjct  198  VELVKKVSHLIEGFDVADIFPSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHK  252



>ref|XP_009793271.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   275 bits (703),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/232 (53%), Positives = 179/232 (77%), Gaps = 2/232 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLP++GS+ H++GG LPH  LR+L++KYGPIMHLQLGE+S +VIS
Sbjct  23   KNSNSQTKRLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIS  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FANRP +++  +V Y C D+AFSPYG+YWRQMRKIC+LELLS K 
Sbjct  82   SPEMAKEVLKTHDLAFANRPLLVAAKIVSYNCMDIAFSPYGNYWRQMRKICLLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSFNS RQ+E+  +I   ++S   P+N+T++I  FT+S   ++AFG+  ++ Q+ F+ L
Sbjct  142  VKSFNSIRQDEVHRMIEFFRSSPGKPVNVTKRISLFTNSMTCRSAFGQEYKK-QDEFVEL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHK  815
            VK+   L  GF VAD+FPS K++H ++G K +++ +H E+D I E II EHK
Sbjct  201  VKKVSHLIEGFDVADIFPSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHK  252



>ref|XP_008227171.1| PREDICTED: cytochrome P450 71D9-like [Prunus mume]
Length=417

 Score =   272 bits (695),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/274 (48%), Positives = 191/274 (70%), Gaps = 8/274 (3%)
 Frame = +3

Query  78   VFLSFV-FCIYTLR----RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSR  242
            V L+F+ F I  L+    R         LPPGPWKLP+IG+LH L  GSLPH+ LR+L++
Sbjct  10   VLLAFLLFMIMVLKTGKIRGKTKCSASNLPPGPWKLPVIGNLHQL-AGSLPHQRLRDLAK  68

Query  243  KYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYG  422
            KYGP+MHL+LGE+S +V+SS + AK + KTHDL+FA+RP  ++  +++Y  TD+ F+PYG
Sbjct  69   KYGPLMHLKLGEVSTVVVSSAEFAKEVMKTHDLIFASRPHALAPRILFYDFTDIVFAPYG  128

Query  423  DYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTI  602
            +YWR++RKIC LELLS K V+S+   R+EE+  LI SI +   +PINLT++I   T +  
Sbjct  129  EYWRKLRKICTLELLSAKRVQSYQPTREEEVRNLIKSIASRAGSPINLTQEIYSSTYTIT  188

Query  603  AKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVD  782
            ++AAFG+  R DQE+FI +VKE      GF +AD+FPS   +H +SG +P+L ++H+E D
Sbjct  189  SRAAFGKKNR-DQEKFIYIVKEVAKAISGFALADVFPSVSLLHLLSGMRPKLERLHKEAD  247

Query  783  KIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            +I   II+EH+ +M    + +  + EED+VDVLL
Sbjct  248  RILGNIIKEHQRDMVTTKSGEG-EAEEDLVDVLL  280



>ref|XP_011082249.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=530

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 183/246 (74%), Gaps = 2/246 (1%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAIT  326
            LPPGPWKLPLIG L H+VG SLPH +LR+LS KYGP+MHL+ GE+S IV+SSP++AK + 
Sbjct  61   LPPGPWKLPLIGHLLHVVG-SLPHHSLRDLSNKYGPLMHLKFGEVSTIVVSSPKVAKEVL  119

Query  327  KTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQ  506
            KT D   A+RP+ ++  +++Y   D+AFSPYG+YWRQMRKIC+LELLS K V+SF+  R+
Sbjct  120  KTVDPACADRPQSLASQIMWYNYIDIAFSPYGEYWRQMRKICILELLSVKNVRSFDYIRK  179

Query  507  EELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAG  686
            +E S L+ SI+AS   PINLT+K   FTS+   +AAFG+V + D+E  I L+KEA+ LAG
Sbjct  180  DEASRLVESIRASSGRPINLTDKTFLFTSAITCRAAFGKVLK-DRETLISLLKEAVVLAG  238

Query  687  GFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEED  866
            GF +ADLFPS K ++ ++  K +LLK+  ++D I + +I+EHKDN+A       +   ED
Sbjct  239  GFDMADLFPSLKILNIINWNKYKLLKMRSKMDAILDRLIDEHKDNLATSKKGNGEMGSED  298

Query  867  IVDVLL  884
            +VDVLL
Sbjct  299  LVDVLL  304



>emb|CDP18841.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   274 bits (701),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/279 (51%), Positives = 193/279 (69%), Gaps = 5/279 (2%)
 Frame = +3

Query  57   FNPVSVIVFLSFVFCIYTLRRRSNPAR-RQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
            FN ++  +FL+F+  +     +S      QKLPPGP K+P IG+LH+L+G SLPH  L  
Sbjct  5    FNWIASFIFLAFILTLGKKWMKSKTVNATQKLPPGPKKIPFIGNLHNLLG-SLPHHALAK  63

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L++K+G +MHLQLGE+SA+V+SSP  AK I KTHD VF +RP+++   ++ Y  + +AFS
Sbjct  64   LAKKHGDLMHLQLGEVSAVVVSSPHSAKEILKTHDHVFVDRPEILVGKIICYDSSSIAFS  123

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKAS--GSAPINLTEKICWF  587
             YGDYWRQMRKIC +E+LS K V+SF S RQ+E+  LISSI+ S  G  PINLTE+I  F
Sbjct  124  QYGDYWRQMRKICAMEVLSAKSVRSFGSIRQDEVLHLISSIRGSTIGGQPINLTEEISSF  183

Query  588  TSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKV  767
            TSS I +AA G+V RE +   I L+KE LS   GF ++DLFPSKK +H++S  KP L K+
Sbjct  184  TSSMICRAACGKVFRE-RITLIELMKEVLSRTSGFDISDLFPSKKILHHLSSMKPTLQKL  242

Query  768  HREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            H ++D I E +I EH +N+A       +  +ED++DVLL
Sbjct  243  HHKIDVILESVINEHIENLARSKTVNGEFGQEDLIDVLL  281



>ref|XP_003537457.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42026.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/285 (46%), Positives = 195/285 (68%), Gaps = 8/285 (3%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
            MEH  L    S+++       +  L +   P    KLPPGPWKLP+IG+LH + +  SLP
Sbjct  1    MEHSQL----SIVITFFVFLLLLRLVKNHKPKSSHKLPPGPWKLPIIGNLHQVALAASLP  56

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  L+ L+RKYGP+MHLQLGEIS +V+SSP++A  I KTHDL F  RP++++   + Y  
Sbjct  57   HHALQKLARKYGPLMHLQLGEISTLVVSSPKMAMEIMKTHDLAFVQRPQLLAPQYMAYGA  116

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
            TD+AF+PYG+YWRQMRKIC LELLS K V+SF+  RQ+E  +LI SI++S  +PI+L+ K
Sbjct  117  TDIAFAPYGEYWRQMRKICTLELLSAKRVQSFSHIRQDENRKLIQSIQSSAGSPIDLSSK  176

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            +     +T+++AAFG  + +DQ+ F+ LV++A+++ GGF + D+FPS K +H ++G K +
Sbjct  177  LFSLLGTTVSRAAFGN-KNDDQDEFMSLVRKAVAMTGGFELDDMFPSLKPLHLLTGQKAK  235

Query  756  LLKVHREVDKIFELIIEEH--KDNMANRNNNKAKDHEEDIVDVLL  884
            + ++H+  D+I E I+ +H  K   A    N ++  +ED+VDVLL
Sbjct  236  VEEIHKRADRILEDILRKHVEKRTRAKEEGNNSEAQQEDLVDVLL  280



>gb|KHN42275.1| Cytochrome P450 71D8 [Glycine soja]
Length=511

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 187/251 (75%), Gaps = 10/251 (4%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
             KLPPGPWKLPLIG+LH L G G+LPH TL+NLSRKYGP+MHLQLGEISA+V+SS  +AK
Sbjct  35   HKLPPGPWKLPLIGNLHQLAGAGTLPHHTLQNLSRKYGPLMHLQLGEISAVVVSSSDMAK  94

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             I KTHDL F  RP+++   ++ Y  TD+AF+PYGDYWRQMRKIC LELLS K V+SF+ 
Sbjct  95   EIMKTHDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSF  154

Query  498  FRQEELSELISSIK--ASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEA  671
             R+EE+++LI SI+  A   +P+N+++ + +  S+ I++AAFG+ + E +++ + L+K+A
Sbjct  155  IREEEVAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGK-KSEYEDKLLALLKKA  213

Query  672  LSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAK  851
            + L GGF +ADLFPS K IH ++  K +L  + +E+DKI E II +H+      +N+   
Sbjct  214  VELTGGFDLADLFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQ------SNHGKG  267

Query  852  DHEEDIVDVLL  884
            + EE++VDVLL
Sbjct  268  EAEENLVDVLL  278



>ref|XP_010655870.1| PREDICTED: cytochrome P450 71D10-like [Vitis vinifera]
 emb|CBI39021.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 192/275 (70%), Gaps = 6/275 (2%)
 Frame = +3

Query  69   SVIVFLS--FVFCIYTLRRR-SNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLS  239
            S I+F S  F++ +Y + +R       QKLPPGPWKLPLIG++H L+ GSLPH +L  L+
Sbjct  6    SSILFASLLFLYMLYKIGKRWRGNISSQKLPPGPWKLPLIGNMHQLIDGSLPHHSLSRLA  65

Query  240  RKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPY  419
            ++YGP+M LQLGEIS ++ISSP++AK I KTHD+ FA R   ++ + V Y  TD+ FSPY
Sbjct  66   KQYGPLMSLQLGEISTLIISSPEMAKQILKTHDINFAQRASFLATNTVSYHSTDIVFSPY  125

Query  420  GDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSST  599
            GDYWRQ+RKICV+ELL++K VKSF   R+EELS LI+++ +    PINLT+K+   T + 
Sbjct  126  GDYWRQLRKICVVELLTSKRVKSFQLIREEELSNLITTLASCSRLPINLTDKLSSCTFAI  185

Query  600  IAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREV  779
            IA+AAFG   +E Q+ FI ++KE L L  G  VAD++PS KW+  +SG + ++ KV +  
Sbjct  186  IARAAFGEKCKE-QDAFISVLKETLELVSGPCVADMYPSVKWLDLISGMRHKIEKVFKRT  244

Query  780  DKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            D+I + I++EH++ M  +        EED+VDVLL
Sbjct  245  DRILQNIVDEHREKM--KTEAGKLQGEEDLVDVLL  277



>ref|XP_003529194.2| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=517

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 194/273 (71%), Gaps = 7/273 (3%)
 Frame = +3

Query  78   VFLSF-VFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            V +SF +F I  L+   N  + +    +PPGPWKLP+IG++HHLV  + PHR LR+L++ 
Sbjct  11   VIMSFSLFIIVALKIGRNLKKTESSPNIPPGPWKLPIIGNIHHLVTCT-PHRKLRDLAKT  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGE+  I++SSP+ AK I KTHD++FA+RPK+++ D++ Y+ T++ FSPYG+
Sbjct  70   YGPLMHLQLGEVFTIIVSSPEYAKEIMKTHDVIFASRPKILASDILCYESTNIVFSPYGN  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC +ELL+ + V SF   R+EE + L+  I +   +PINLTE +     S I+
Sbjct  130  YWRQLRKICTVELLTQRRVNSFKQIREEEFTNLVKMIDSHKGSPINLTEAVFLSIYSIIS  189

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            +AAFG  + +DQE FI +VKEA+++  GF + DLFPS KW+  V+G +P+L ++H + D+
Sbjct  190  RAAFG-TKCKDQEEFISVVKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHGKTDR  248

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I + II EH++  +    ++  + EED+VDVLL
Sbjct  249  ILKEIINEHREAKSKAKEDQG-EAEEDLVDVLL  280



>ref|XP_003550472.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=559

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/249 (52%), Positives = 185/249 (74%), Gaps = 7/249 (3%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHLVGGS-LPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
             KLPPGPWKLP+IG+L  L   S LPH  +R L++KYGP+MHLQLGEISA+++SSP +AK
Sbjct  84   HKLPPGPWKLPIIGNLLQLAAASSLPHHAIRELAKKYGPLMHLQLGEISAVIVSSPNMAK  143

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             I KTHDL FA RPK ++ D++ Y   D+AF+PYGDYWRQMRKIC LELLS K V+SF++
Sbjct  144  EIMKTHDLAFAQRPKFLASDIMGYGSVDIAFAPYGDYWRQMRKICTLELLSAKKVQSFSN  203

Query  498  FRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALS  677
             R++E+++LI  I++S  APINLT  I  F S+ +++  FG +  +D E F+++ +EA+ 
Sbjct  204  IREQEIAKLIEKIQSSAGAPINLTSMINSFISTFVSRTTFGNI-TDDHEEFLLITREAIE  262

Query  678  LAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDH  857
            +A GF +AD+FPS K +H ++G K ++ K+H++VDKI + II   K+N AN+   + K+ 
Sbjct  263  VADGFDLADMFPSFKPMHLITGLKAKMDKMHKKVDKILDKII---KENQANKGMGEEKN-  318

Query  858  EEDIVDVLL  884
             E++V+VLL
Sbjct  319  -ENLVEVLL  326



>ref|XP_003529672.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=522

 Score =   274 bits (700),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 187/251 (75%), Gaps = 10/251 (4%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
             KLPPGPWKLPLIG+LH L G G+LPH TL+NLSRKYGP+MHLQLGEISA+V+SS  +AK
Sbjct  46   HKLPPGPWKLPLIGNLHQLAGAGTLPHHTLQNLSRKYGPLMHLQLGEISAVVVSSSDMAK  105

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             I KTHDL F  RP+++   ++ Y  TD+AF+PYGDYWRQMRKIC LELLS K V+SF+ 
Sbjct  106  EIMKTHDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSF  165

Query  498  FRQEELSELISSIK--ASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEA  671
             R+EE+++LI SI+  A   +P+N+++ + +  S+ I++AAFG+ + E +++ + L+K+A
Sbjct  166  IREEEVAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGK-KSEYEDKLLALLKKA  224

Query  672  LSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAK  851
            + L GGF +ADLFPS K IH ++  K +L  + +E+DKI E II +H+      +N+   
Sbjct  225  VELTGGFDLADLFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQ------SNHGKG  278

Query  852  DHEEDIVDVLL  884
            + EE++VDVLL
Sbjct  279  EAEENLVDVLL  289



>ref|XP_006345633.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/266 (53%), Positives = 186/266 (70%), Gaps = 12/266 (5%)
 Frame = +3

Query  90   FVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQ  269
             V  I    + SNP   QKL PGPWKLP+IG+L  +  GSLPH +L NL+ K+GP+MHL+
Sbjct  20   LVILIIKYYKISNP--YQKLAPGPWKLPIIGNLLQM--GSLPHISLANLATKHGPLMHLK  75

Query  270  LGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKI  449
            LG++SAIVISSPQLAK + KTHDL FANRP++    +++Y C D+AFSPYGDYW+Q+RKI
Sbjct  76   LGQLSAIVISSPQLAKEMMKTHDLTFANRPQLSVAKIMFYDCQDIAFSPYGDYWKQIRKI  135

Query  450  CVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVR  629
            CV+ELLSTK + SF     +E   L++SIKA    PIN++EK+   TS+ I +A+ GR  
Sbjct  136  CVMELLSTKNITSFFPMMVDETYLLVNSIKAMSERPINISEKMYLLTSAIICRASIGRTC  195

Query  630  REDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEE  809
            + DQE  I+L+K+  S AG F V DLFPS K +H++SGT  +LL++HR+VD + E II E
Sbjct  196  K-DQESVIMLMKQVASFAGVFNVVDLFPSLKILHFISGTNRKLLQLHRKVDPVLERIINE  254

Query  810  HKDNMANRNNNKAKDH-EEDIVDVLL  884
            H+          A +H  ED+VDVLL
Sbjct  255  HE------TEQLATEHVGEDLVDVLL  274



>ref|XP_007147597.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
 gb|ESW19591.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
Length=506

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 184/251 (73%), Gaps = 11/251 (4%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
            ++LPPGPWKLP+IG+LH L V  +LPHR L  L++KYGP+MHLQLG+ISA+++SSP +AK
Sbjct  30   RRLPPGPWKLPIIGNLHQLAVASTLPHRALGELAQKYGPLMHLQLGQISAVIVSSPSIAK  89

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             I KTHDL FA RPK ++ D++ Y   D+AF+PYGDYWRQMRK+C LELLS K V+SF  
Sbjct  90   EIMKTHDLAFAQRPKFLASDIMGYGSGDIAFAPYGDYWRQMRKLCTLELLSAKKVQSFFH  149

Query  498  FRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALS  677
             R+EE+++LI +I++S   PI+L+ +   F S+ +++A FG++  ED E F++ VKEA+ 
Sbjct  150  IREEEVAKLIKTIQSSAGEPIDLSSRFGSFISTFVSRATFGKI-NEDHEEFVLTVKEAIE  208

Query  678  LAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDN--MANRNNNKAK  851
            +A GF +AD FPS K IH ++G K +L K+H++ DKI E II E++ N  M   NN    
Sbjct  209  VADGFDLADAFPSFKPIHLITGLKAKLDKMHKKSDKILEKIIRENQANEGMGEENN----  264

Query  852  DHEEDIVDVLL  884
               E++V+VLL
Sbjct  265  ---ENLVEVLL  272



>ref|XP_009794009.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 191/259 (74%), Gaps = 16/259 (6%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLPLIGS+ H++GG LPH  LRNL++K+GP+MHLQLGE+S +V++
Sbjct  23   KNSNSQTKRLPPGPWKLPLIGSMFHILGG-LPHHVLRNLAKKFGPLMHLQLGEMSVVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RPK+++ ++V Y C+D+AFSPYGDYWRQMRKIC++ELLS K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPKLLAAEIVIYNCSDIAFSPYGDYWRQMRKICMIELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+SF+S R++E+  +I   ++S    +N+T++I  F SS   ++AFG+V +E Q+  I+L
Sbjct  142  VRSFSSIRRDEVHRMIEFFRSSTGKQVNVTKRIYQFASSMTCRSAFGKVFKE-QDELILL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHK----DNMA  827
            VK   +L  GF VAD+FPS K++H +SG K +++ VH ++D I E II E K    D +A
Sbjct  201  VKRNTALVEGFDVADIFPSLKFLHVLSGMKTKVMDVHHKLDAILENIINERKKIATDELA  260

Query  828  NRNNNKAKDHEEDIVDVLL  884
                      +E ++DVLL
Sbjct  261  ----------DEGLIDVLL  269



>ref|XP_004250027.1| PREDICTED: cytochrome P450 71D7 [Solanum lycopersicum]
Length=508

 Score =   273 bits (698),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 188/263 (71%), Gaps = 9/263 (3%)
 Frame = +3

Query  117  RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVI  296
            + S     +KLPPGPWK+P IGS+HH+VGG  PH  LR+L++KYGP+MHLQLGE+  +V+
Sbjct  23   KNSKSQTTKKLPPGPWKIPFIGSIHHIVGG-YPHHVLRDLAKKYGPLMHLQLGEVCVVVV  81

Query  297  SSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTK  476
            +S ++AK I KTHDL FA+RPK++  D++ Y   D+AFSPYGDYW+QMRKI V+ELL+ K
Sbjct  82   TSSEMAKQIFKTHDLAFASRPKLLVMDIITYNSRDIAFSPYGDYWKQMRKISVMELLNAK  141

Query  477  MVKSFNSFRQEELSELISSIK--ASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERF  650
             V+SF+S R +E+  LI SI+  +S   P+N +E++ WF SS + ++AFG++ + DQ+ F
Sbjct  142  NVRSFSSIRHDEVVHLIDSIRSSSSSGEPVNFSERVLWFASSMLCRSAFGKLPK-DQDIF  200

Query  651  IVLVKEALSLAG-GFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMA  827
            I LV++ L L+  GF +AD+FPS K++H + G K ++L VH ++D I E +I EHK + A
Sbjct  201  IKLVRQVLRLSNQGFDMADIFPSYKFLHGLGGLKKKILDVHYKIDSIVEDVINEHKKSFA  260

Query  828  NRNNNKAKD----HEEDIVDVLL  884
            N       D     +ED++DVLL
Sbjct  261  NHKRTSDDDALGGGDEDLIDVLL  283



>ref|XP_008227173.1| PREDICTED: cytochrome P450 71D9-like [Prunus mume]
Length=465

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 193/273 (71%), Gaps = 4/273 (1%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            ++ ++F+  V  I  +R ++  +    LPPGPWKLP+IG+LH L  GSLPH  LR+L++K
Sbjct  12   LAFLLFMIMVLKIGKIRGKTKYSA-SNLPPGPWKLPVIGNLHQL-AGSLPHHRLRDLAKK  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGE+S +V+SS +LAK + KTHDL+FA+RP  ++  +++Y  TD+ F+PYG+
Sbjct  70   YGPLMHLKLGEVSTVVVSSAELAKEVMKTHDLIFASRPHALAPRILFYDFTDIVFAPYGE  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC LELLS K V+S+   R+EE+  LI  I +   +PINLT++I   T +  +
Sbjct  130  YWRQLRKICTLELLSAKRVRSYRPIREEEVRNLIKLIASRAGSPINLTQEIFSSTFTITS  189

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            +AAFG+  R DQE+FI +VKE    A GF + D+FPS   +H +SG +P+L ++H+E D+
Sbjct  190  RAAFGKKNR-DQEKFIYIVKEVAKAASGFALVDVFPSVSLLHLLSGMRPKLERLHKEADR  248

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I   II+EH+ +M    + +  + EED+VDVLL
Sbjct  249  ILGNIIKEHQRDMVTTKSGEG-EAEEDLVDVLL  280



>gb|KDP39287.1| hypothetical protein JCGZ_01044 [Jatropha curcas]
Length=510

 Score =   273 bits (697),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 191/282 (68%), Gaps = 2/282 (1%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
            ME++F   P  +  FL F+F +  L + S       LPPGPWKLP+IGS+HHL G  LPH
Sbjct  1    MENQFPSFPF-IFTFLVFLFMVLRLWKNSKKNSAPNLPPGPWKLPVIGSMHHLSGSLLPH  59

Query  219  RTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCT  398
              LRNL+ +YGP+MHL+LGE++ IV+SSP+ AKAI KTHD +FA RP +++ +++ Y  T
Sbjct  60   VRLRNLANEYGPLMHLKLGEVTNIVVSSPETAKAIMKTHDHIFAQRPFLLAANIMAYNST  119

Query  399  DVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKI  578
            D+AF+PYGDYWRQMRKIC  E+LS K V SF   R+EE+S+ I  + +   + +N +   
Sbjct  120  DLAFAPYGDYWRQMRKICTQEILSAKRVLSFGLIREEEVSKFIRDLSSRAGSTVNFSRMF  179

Query  579  CWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRL  758
               T + I + A G++ +  +E  I   K+ +  AGGF ++DL+PS K +H +S TK +L
Sbjct  180  NSVTYNIIQRVAIGKLWK-GEEIVIPAFKKLIEAAGGFSLSDLYPSIKLLHKISTTKFKL  238

Query  759  LKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            L+ H+E DK+F+ II+EH+   A+R  + AK+ EEDI+DVLL
Sbjct  239  LRAHKETDKLFQNIIDEHRARKASRAKSGAKNEEEDIIDVLL  280



>ref|XP_007146610.1| hypothetical protein PHAVU_006G054700g [Phaseolus vulgaris]
 gb|ESW18604.1| hypothetical protein PHAVU_006G054700g [Phaseolus vulgaris]
Length=508

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/280 (48%), Positives = 198/280 (71%), Gaps = 17/280 (6%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQ-----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
            S ++F  F+F    +++  N  R++     K+P GP KLP+IG++H+L+  S PHR LR+
Sbjct  9    SALIF--FIFLALIVQKIGNKPRKRDETTSKIPHGPTKLPIIGNIHNLLS-SQPHRKLRD  65

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L+ KYGP+MHLQLGE+S IVISSP+ AK + KTHD+ FA+RPK+ + D++ Y CTD+AF+
Sbjct  66   LALKYGPLMHLQLGEVSTIVISSPECAKEVMKTHDINFASRPKVPAMDLMTYNCTDIAFA  125

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTS  593
            PYG+YWRQ+RKIC LELLS K V S+   R+EELS L+  I +   +PINLT+ +     
Sbjct  126  PYGNYWRQLRKICTLELLSLKRVNSYQPIREEELSNLVKWIYSEKGSPINLTQALLSSIY  185

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
            +  +++AFG+ + +DQE FI +VK+ + L GGF + DLFPS  W+ +V+GT+P+L + ++
Sbjct  186  TIASRSAFGK-KCKDQENFISVVKKTIKLVGGFHIGDLFPSATWLQHVTGTRPKLERFYQ  244

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHE---EDIVDVLL  884
            + D+I E II EHK+       +KAKD+E   ED+VDVL+
Sbjct  245  QTDQIIENIINEHKE-----AKSKAKDYEREAEDLVDVLI  279



>ref|XP_009765945.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=359

 Score =   267 bits (682),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/275 (49%), Positives = 189/275 (69%), Gaps = 6/275 (2%)
 Frame = +3

Query  60   NPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLS  239
            N V++++F SF+F ++   R+S     QKLPPGPW+LPLIGS+HHL  G+ PHRTLR L+
Sbjct  9    NFVALLMFFSFLFILFGKWRKS----EQKLPPGPWRLPLIGSIHHL-RGAFPHRTLRKLA  63

Query  240  RKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPY  419
            RKYGPIM+LQLG+I A+VISSP +AK +   H+  FA +P++ S +++ Y   D+ F+PY
Sbjct  64   RKYGPIMYLQLGKIPAVVISSPIVAKEVFNIHEHAFAVKPQLTSINIITYNGKDIEFAPY  123

Query  420  GDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSST  599
            GD WRQMR +CV ELLS KMVKSF+S R +E+  L+SS+ +   +  N+TEKI  FT+S 
Sbjct  124  GDNWRQMRNLCVTELLSAKMVKSFSSIRNDEILSLVSSVHSMNGSVANITEKILRFTNSV  183

Query  600  IAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREV  779
              ++AFG+V +  Q++ I L++E L    G  VADLFPS + ++ +SG K RLLK+H++V
Sbjct  184  SCRSAFGKVDKY-QDKLINLLREVLDSLEGLDVADLFPSWRLLYKMSGVKSRLLKLHQKV  242

Query  780  DKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            D   E II EH    A       +   ED+VDVLL
Sbjct  243  DAALENIINEHIMKRALGCKGNGEFGGEDLVDVLL  277



>ref|XP_004506686.1| PREDICTED: cytochrome P450 71D9-like [Cicer arietinum]
Length=495

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 198/285 (69%), Gaps = 11/285 (4%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFC---IYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGS  209
            M+ +FL+   S++    FVF    I T + +S P     LPPGPWKLP+IG++H+LVG S
Sbjct  1    MDSQFLYF-ASILTLFIFVFMSHKILTKKSKSTP----NLPPGPWKLPIIGNIHNLVG-S  54

Query  210  LPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYY  389
            LPH  LR LS KYGP+MHL+LGEIS I++SS + AK + KTHDL+F++RP + +  ++ Y
Sbjct  55   LPHHRLRELSTKYGPLMHLKLGEISTIIVSSAECAKQVMKTHDLIFSSRPPIQASTIMSY  114

Query  390  KCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLT  569
                +AF+PYGDYWRQ+RKIC LELLS+K V+SF   R EE++ LI  I +   + INLT
Sbjct  115  NNVGIAFAPYGDYWRQLRKICTLELLSSKSVQSFQPIRDEEVTNLIKWITSKEGSSINLT  174

Query  570  EKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTK  749
            +++    S+  ++ AFG+ + E+  +FI LV+EA+ +AGGF + DL+PS KW+  +SG K
Sbjct  175  KEVFSTISTITSRTAFGK-KCEENTKFISLVREAVKVAGGFNLGDLYPSYKWLQNISGLK  233

Query  750  PRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            P+L K+H++ D I + II EH++ +     N+ ++ EED+VDVLL
Sbjct  234  PKLEKLHQQADIIMQKIINEHRE-VNKLRANEDQEVEEDLVDVLL  277



>gb|KDP39256.1| hypothetical protein JCGZ_01013 [Jatropha curcas]
Length=488

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/258 (50%), Positives = 189/258 (73%), Gaps = 3/258 (1%)
 Frame = +3

Query  111  LRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAI  290
            +R+ S   +   LPPGP KLP+IG++H+LVG SLPH  L+NL++KYGP+MHLQLGE++ I
Sbjct  5    IRKISESKKLLNLPPGPLKLPIIGNIHNLVG-SLPHHRLQNLAKKYGPLMHLQLGEVTTI  63

Query  291  VISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLS  470
            V++S ++AK + + HD+VF+NRP +++ +++ Y  T + FSPYG+YWRQ+RKICVLELLS
Sbjct  64   VVTSAEIAKEVMRAHDIVFSNRPSILAANIISYNATSIVFSPYGEYWRQLRKICVLELLS  123

Query  471  TKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERF  650
             K V+SF S R+EE+S ++  I +S  + INL+  +   T S  ++AAFG++R+E QE F
Sbjct  124  AKRVQSFKSIREEEVSNIVRRISSSSDSLINLSRMLFSLTYSITSRAAFGKIRKE-QEAF  182

Query  651  IVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMAN  830
            I LV+E + + GGF +ADLFPS K ++ ++G K R+ ++H+E DKI E II EH+ + A 
Sbjct  183  IPLVEEIIEVGGGFSIADLFPSIKLLNRINGMKSRVERLHQEADKILENIINEHRASKA-  241

Query  831  RNNNKAKDHEEDIVDVLL  884
            R    +K   +D+VDVLL
Sbjct  242  RAKPGSKGEADDLVDVLL  259



>ref|XP_010653207.1| PREDICTED: cytochrome P450 71D9-like [Vitis vinifera]
Length=504

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 131/247 (53%), Positives = 180/247 (73%), Gaps = 4/247 (2%)
 Frame = +3

Query  144  KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAI  323
            K PPGPWKLPLIG+LH LVG SLPH +LR+L++KYGP+MHLQLG++S +V+SSP++AK +
Sbjct  33   KRPPGPWKLPLIGNLHQLVG-SLPHHSLRDLAKKYGPLMHLQLGQVSMLVVSSPEIAKEV  91

Query  324  TKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFR  503
             KTHD+ FA RP +++  +V Y  TDVAFSPYGDYWRQ+RKICV+ELLS K VKSF   R
Sbjct  92   MKTHDINFAQRPHLLATRIVSYDSTDVAFSPYGDYWRQLRKICVVELLSAKRVKSFQVIR  151

Query  504  QEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLA  683
            +EE+S+LI  I +S   PINL ++I  FT S I++AA G+   +D +       E+  LA
Sbjct  152  KEEVSKLIRIINSSSRFPINLRDRISAFTYSAISRAALGK-ECKDHDPLTAAFGESTKLA  210

Query  684  GGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEE  863
             GF +ADL+PS KWI  VSG + +L KV + +D I +++++EH++ M  +      + E+
Sbjct  211  SGFCLADLYPSVKWIPLVSGVRHKLEKVQQRIDGILQIVVDEHRERM--KTTTGKLEEEK  268

Query  864  DIVDVLL  884
            D+VDVLL
Sbjct  269  DLVDVLL  275



>ref|XP_010644548.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/275 (50%), Positives = 192/275 (70%), Gaps = 10/275 (4%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQ----KLPPGPWKLPLIGSLHHLVGG  206
            ME +F F P+      +F+  IY L+R   P+R      KLPPGPWKLP+IG++H LVG 
Sbjct  1    MELQFSFFPI----LCTFLLFIYLLKRLGKPSRTNHPAPKLPPGPWKLPIIGNMHQLVG-  55

Query  207  SLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVY  386
            SLPHR+LR+L++K+GP+MHLQLGE+SAIV+SS ++AK + KTHD++F+ RP +++  +V 
Sbjct  56   SLPHRSLRSLAKKHGPLMHLQLGEVSAIVVSSREMAKEVMKTHDIIFSQRPCILAASIVS  115

Query  387  YKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINL  566
            Y CTD+AF+PYG YWRQ+RKI VLELLS K V+SF S R+EE+  L+ S+       INL
Sbjct  116  YDCTDIAFAPYGGYWRQIRKISVLELLSAKRVQSFRSVREEEVLNLVRSVSLQEGVLINL  175

Query  567  TEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGT  746
            T+ I   T S I++ AFG+ + +DQE F V + +    AGGF +AD+FPS K +H VSG 
Sbjct  176  TKSIFSLTFSIISRTAFGK-KCKDQEAFSVTLDKFADSAGGFTIADVFPSIKLLHVVSGM  234

Query  747  KPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAK  851
            + +L KVH+++D+I   II EHK   A +   +A+
Sbjct  235  RRKLEKVHKKLDRILGNIINEHKARSAAKETCEAE  269



>gb|AAD47832.1| cytochrome P450 [Nicotiana tabacum]
Length=499

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 176/232 (76%), Gaps = 2/232 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLP++GS+ H++GG LPH  LR+L++KYGPIMHLQLGE+S +VIS
Sbjct  23   KNSNSQTKRLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIS  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP +AK + KTHDL FANRP +++  +  Y C D+A SPYG+YWRQMRKIC+LELLS K 
Sbjct  82   SPGMAKEVLKTHDLAFANRPLLVAAKIFSYNCMDIALSPYGNYWRQMRKICLLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSFNS RQ+E+  +I   ++S   P+N+T++I  FT+S   ++AFG+  +E Q+ F+ L
Sbjct  142  VKSFNSIRQDEVHRMIKFFRSSPGKPVNVTKRISLFTNSMTCRSAFGQEYKE-QDEFVQL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHK  815
            VK+  +L  GF VAD+FPS K++H ++G K +++  H E+D I E II EHK
Sbjct  201  VKKVSNLIEGFDVADIFPSLKFLHVLTGMKAKVMNTHNELDAILENIINEHK  252



>ref|XP_004241764.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=513

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/262 (52%), Positives = 188/262 (72%), Gaps = 6/262 (2%)
 Frame = +3

Query  111  LRRRSNPARRQKLPPGPWKLPLIGSLHHLVGG-SLPHRTLRNLSRKYGPIMHLQLGEISA  287
            L R+S+ A+ +KLPPGPW+LP+IGSLHHL G  S PHRTL+NL+ KYGPIM+LQLGEI A
Sbjct  26   LLRKSSTAK-EKLPPGPWRLPIIGSLHHLRGALSFPHRTLKNLATKYGPIMYLQLGEIPA  84

Query  288  IVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELL  467
            +++SSP + K I KTH+L FA +P++ S D+  Y   D+AF+PYGD WRQMR ICV ELL
Sbjct  85   VIVSSPIMVKEILKTHELAFATKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTELL  144

Query  468  STKMVKSFNSFRQEELSELISSIKAS-GSAPINLTEKICWFTSSTIAKAAFGRVRREDQE  644
             TK VKSF+S R++E++ L+SSI+++ G+  +NLTE I  +T+S   ++AFG+V   +Q 
Sbjct  145  GTKTVKSFSSIRKDEITRLLSSIRSTNGTRLVNLTELILRYTNSVTCRSAFGKV-CTNQH  203

Query  645  RFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDN-  821
              I L+++ L   GGF V+DLFPS K +H +SG K  LL++H++VD+  E I+ EH  N 
Sbjct  204  HLINLLRDVLDTLGGFDVSDLFPSWKLLHKMSGVKSELLRMHKKVDEALENIVNEHIKNR  263

Query  822  -MANRNNNKAKDHEEDIVDVLL  884
             +  + N       ED+VDVLL
Sbjct  264  ALGCKGNGDKLIGGEDLVDVLL  285



>ref|XP_009345818.1| PREDICTED: cytochrome P450 71D9-like [Pyrus x bretschneideri]
Length=508

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/283 (47%), Positives = 195/283 (69%), Gaps = 5/283 (2%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPAR-RQKLPPGPWKLPLIGSLHHLVGGSLP  215
            MEH++   P+ +  FL F+  +  + R  N       LPPGPWKLP IG+LH L+G  LP
Sbjct  1    MEHQWPSFPI-MFAFLLFIIMVLKIGRSGNTNNYASNLPPGPWKLPFIGNLHQLIG-CLP  58

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  LR+L+ KYGP+MHL+LGE+S IV+SS + AK + KTHD++FA+RP++++  ++ Y  
Sbjct  59   HHGLRDLAEKYGPLMHLRLGEVSTIVVSSAEFAKEVMKTHDVIFASRPQILATRILSYGS  118

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
            T++AF+PYGDYWRQ+RKIC LELLSTK V+S+   R+EE+ +LI SI     + +NLT++
Sbjct  119  TNIAFAPYGDYWRQLRKICTLELLSTKRVQSYRPVREEEVLKLIKSIALQSGSAVNLTQE  178

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            I   T S  ++AA G+  R D E+FI + +EA  +AGGF +ADL+PS   +H VSG +P+
Sbjct  179  IYSLTYSITSRAASGKKTR-DHEKFIFVAEEAGKVAGGFALADLYPSVSLLHLVSGIRPK  237

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            L ++H++ D+I E II EH+ ++    N + +   ED+V VLL
Sbjct  238  LERLHKQADRIMENIINEHQKDLETTKNVEGES-VEDLVHVLL  279



>gb|AHH25653.1| cytochrome P450 CYP71D [Nicotiana tabacum]
Length=497

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 187/255 (73%), Gaps = 8/255 (3%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLPL+GS+ H++GG  PH  L NL++KYGP++HLQLGE+S +V++
Sbjct  23   KNSNSKIKRLPPGPWKLPLLGSMFHMLGGH-PHHVLTNLAKKYGPLVHLQLGEMSVVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RPK ++ ++V+Y C+D+AF PYGDYWRQMRKIC++ELL+ K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+SF+S R++E+  +I   ++S    +N+T++I  FTSS   ++AFG+V +E Q+ FI+L
Sbjct  142  VRSFSSIRRDEVHRMIEFFRSSIDQQVNVTKRIYQFTSSMTCRSAFGKVFKE-QDEFILL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK   +L  GF VAD+FPSKK++H +SG K R++ VH ++D I E II E K        
Sbjct  201  VKRNTALMEGFDVADIFPSKKFLHVLSGKKARVMDVHHKIDAILENIINERKKIATGEVG  260

Query  840  NKAKDHEEDIVDVLL  884
             K       ++DVLL
Sbjct  261  GKG------LIDVLL  269



>ref|XP_003636315.1| Cytochrome P450 [Medicago truncatula]
Length=507

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/271 (48%), Positives = 192/271 (71%), Gaps = 5/271 (2%)
 Frame = +3

Query  81   FLSFVFCIYTLRRRSNPARR---QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
            F  F+F I  L+ R++  +    + +PPGPWKLP++G++ HLV  + P R LR+L++KYG
Sbjct  9    FTIFMFMIIALKIRNHYKKYDFGKNIPPGPWKLPILGNILHLVATN-PPRRLRDLAKKYG  67

Query  252  PIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYW  431
            P+MHLQLGEI  IVISSP++AK + KTHD++FA+RP +++ D+  Y   D+AFSPYGDYW
Sbjct  68   PLMHLQLGEIFFIVISSPEVAKEVLKTHDIIFASRPHLLATDIASYNSMDIAFSPYGDYW  127

Query  432  RQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKA  611
            RQ+RKIC +ELLST+ VKS    RQ+E++ L+  I ++  +  NLTE++     +  +KA
Sbjct  128  RQLRKICAIELLSTRRVKSLWPVRQKEINSLLKKIASNEGSEFNLTEEVMSTMYTFTSKA  187

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+ +  +QE FI +VK+ + LAGGF + DLFPS +WI  +SG KP+L K+ ++VD+I 
Sbjct  188  AFGK-KYLEQEEFISVVKQLIKLAGGFYIGDLFPSAQWIQNISGLKPKLEKLSQQVDRIL  246

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              II +HK+ ++ R N    + EED++D LL
Sbjct  247  GHIITDHKEKISRRENEGLPEAEEDLIDCLL  277



>ref|XP_008337945.1| PREDICTED: cytochrome P450 71D9-like [Malus domestica]
Length=516

 Score =   271 bits (692),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/277 (48%), Positives = 190/277 (69%), Gaps = 6/277 (2%)
 Frame = +3

Query  63   PVSVIVFLSFVFCIYTLR---RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
            P   ++F  F+F I  L+   RR        LPPGPWKLP IG++H LVG S PH  LRN
Sbjct  6    PSFQVLFTFFLFVITVLKIANRRKTKESAVNLPPGPWKLPFIGNIHQLVG-SQPHHGLRN  64

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L++KYGP+MHLQLGE+S +V+SS + AK + KTHD+VFA+RP +++  ++ Y+ T++AF+
Sbjct  65   LAKKYGPLMHLQLGEVSTVVVSSAEYAKEVMKTHDVVFASRPPILATRILSYESTNIAFA  124

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTS  593
            P GDYWRQ+RKIC LELLS   V+     R+EEL  LI+ I ++  +PINLTEK+   T 
Sbjct  125  PCGDYWRQLRKICTLELLSANRVQGHRPLREEELGNLITWIGSNAGSPINLTEKVYSSTY  184

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
            +  ++AAFG+ + ED E+FI  VK+++++A GF +AD+FPS K +H + G +P L ++H+
Sbjct  185  TITSRAAFGK-KSEDHEKFIDAVKQSIAVAAGFDLADVFPSVKLLHLIGGIRPTLERLHK  243

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              D+I E II EHK   +   + +  + E D+VDVLL
Sbjct  244  VTDRIMENIINEHKKKRSTTKSGEG-EAEVDLVDVLL  279



>gb|KDP33179.1| hypothetical protein JCGZ_13444 [Jatropha curcas]
Length=316

 Score =   264 bits (675),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 180/246 (73%), Gaps = 1/246 (0%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAIT  326
            LPPGPWKLP++GS+HHL G SLPH  LR+L++++GPIMHLQLGE++ IV+SSP+ AKA+ 
Sbjct  36   LPPGPWKLPIMGSMHHLSGSSLPHVRLRDLAKEHGPIMHLQLGEVTNIVVSSPETAKAVM  95

Query  327  KTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQ  506
            KTHD +FA RP +++ +++ Y  TD+AF+PYGDYWRQMRKIC  E+LS K V+SF   R+
Sbjct  96   KTHDHIFAQRPFLLAANIMAYNSTDLAFAPYGDYWRQMRKICTQEMLSNKRVQSFGLIRE  155

Query  507  EELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAG  686
            EE+S+LI+ + +   + +N ++     T + I + A G++    +E  I  +K+ +  AG
Sbjct  156  EEVSKLIAELSSRAGSTVNFSKMFNSVTYNIIQRVAIGKL-WNGEEVVIPAIKKLIEAAG  214

Query  687  GFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEED  866
            GF ++D++PS K +H +S T+ +L + H+E D++F+ II+EH+   A+R  + AK+ EED
Sbjct  215  GFSLSDVYPSIKLLHKISTTRFKLQRAHKEADRVFQNIIDEHRARRASRAKSGAKNEEED  274

Query  867  IVDVLL  884
            ++DVLL
Sbjct  275  LIDVLL  280



>ref|XP_003610580.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92777.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=503

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 196/285 (69%), Gaps = 12/285 (4%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQ--KLPPGPWKLPLIGSLHHL-VGGS  209
            ME KF F  +S  +FL  + C+  + ++    + +  KLPPGPWKLPLIG+LH L +GGS
Sbjct  1    MEFKFSFLIISSFIFL--ILCLTKIYKQKIKVKNEVHKLPPGPWKLPLIGNLHQLALGGS  58

Query  210  LPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYY  389
            LPH TLR+LS KYGP+M+LQLGEISA+V+SSP LAK I KTHDL F  RP++++  ++ Y
Sbjct  59   LPHHTLRDLSNKYGPLMYLQLGEISAVVVSSPDLAKEIMKTHDLSFVQRPELLAPKILSY  118

Query  390  KCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLT  569
              TD+ ++PYGDYWRQMRKIC  +LLS K V  F+S R+EE+ +LI SI+ S S P+N+T
Sbjct  119  DSTDIVYAPYGDYWRQMRKICTSQLLSAKRVHYFSSIREEEVQKLIQSIQVSLSLPLNVT  178

Query  570  EKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTK  749
            +      S+ +++AAFG+  + + E  + L+K+ + +A GF  ADLFPS K IH ++ TK
Sbjct  179  KTAFSLVSTFVSRAAFGKKSKYEDE-LLSLLKQTVEMASGFDPADLFPSFKPIHLITRTK  237

Query  750  PRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             +L  + +++DKI E II+EH+ N  +          E++VDVLL
Sbjct  238  AKLQNMQKKLDKILESIIKEHQSNSIHGKQG------ENLVDVLL  276



>gb|KEH19671.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   270 bits (690),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/271 (48%), Positives = 193/271 (71%), Gaps = 5/271 (2%)
 Frame = +3

Query  81   FLSFVFCIYTLRRRSNPAR---RQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
            F  F+F I  L+ R++  +    + +PPGPWKLP++G++ HLV  + P R LR+L++KYG
Sbjct  9    FTIFMFMIIALKIRNHYKKYDFSKNIPPGPWKLPILGNILHLVA-TKPPRRLRDLAKKYG  67

Query  252  PIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYW  431
            P+MHLQLGEI  IVISSP++AK + KTHD++FA+RP +++ D+  Y   D+AFSPYGDYW
Sbjct  68   PLMHLQLGEIFFIVISSPEVAKEVLKTHDIIFASRPHLLATDIASYNSMDIAFSPYGDYW  127

Query  432  RQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKA  611
            RQ+RKIC +ELLST+ VKS  + RQ+E++ L+  I ++  +  N+TE+I     +  +KA
Sbjct  128  RQLRKICAIELLSTRRVKSLWTVRQKEINYLLKKIASNEGSEFNITEEIISKMYTFTSKA  187

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+ +  +QE FI +VK+ + LAGGF + DLFPS +WI  +SG KP+L K+ ++VD+I 
Sbjct  188  AFGK-KYLEQEEFISVVKQLIKLAGGFYIGDLFPSAQWIQNISGLKPKLEKLSQQVDRIL  246

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              II +HK+ ++ R N    + EED++D L+
Sbjct  247  GRIITDHKETISRRENEGLPEAEEDLIDCLI  277



>ref|XP_002522721.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39572.1| cytochrome P450, putative [Ricinus communis]
Length=499

 Score =   270 bits (689),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 134/274 (49%), Positives = 194/274 (71%), Gaps = 7/274 (3%)
 Frame = +3

Query  72   VIVFLSFVFCIYTLRRRSNP--ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            +I+ L F++ +  L +RSN   +  + LPPGP KLPLIG++H L+G SLPH  LR+L++K
Sbjct  6    LILSLIFIYMVLKLWKRSNSKHSTLKNLPPGPTKLPLIGNMHQLLG-SLPHHRLRDLAKK  64

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YG IMHLQLGE+  +V+SSP+ AK + KTHD+VFA RP +++  V+ Y  TD+AFSPY D
Sbjct  65   YGSIMHLQLGEVPHVVVSSPEAAKEVMKTHDIVFAQRPFLLAASVITYNFTDIAFSPYSD  124

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKICVLELLS K V+SF S R+EE+S LI+++ +    P N + K+   T    A
Sbjct  125  YWRQLRKICVLELLSAKRVQSFRSIREEEVSNLINTLTSFSGKPFNFSRKLFSSTYGIAA  184

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            +A+FG+ + +DQE FI + ++   +AGGF +ADLFPS  ++H +SG K RLL++  + D 
Sbjct  185  RASFGK-KYKDQEEFIKVAQQMTEVAGGFSLADLFPSIAFLHVISGMKSRLLRLRDDGDN  243

Query  786  IFELIIEEHKD-NMANRNNNKAKDHEEDIVDVLL  884
            I E II++H+  NM  + + + +D  +D+VDVLL
Sbjct  244  ILENIIDDHRARNMTGKTSGEGED--DDLVDVLL  275



>ref|XP_003617731.1| Cytochrome P450 [Medicago truncatula]
 gb|AET00690.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=513

 Score =   270 bits (690),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 186/264 (70%), Gaps = 9/264 (3%)
 Frame = +3

Query  39   MEHK------FLFNPVSVIVFLSFVF-CIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL  197
            MEH       FL    S I+FL+ +   +  + R +   ++  LPPGPW LP+IGS+HHL
Sbjct  1    MEHPSLSFLPFLLFSTSFILFLTQILKLVKRILRVTTKVQKNVLPPGPWTLPIIGSIHHL  60

Query  198  VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFD  377
            +G SLPH +LR LS+ YGPIMHL+LGE+S IVISSP+LAK I KT+D +FA RP  +  D
Sbjct  61   IG-SLPHHSLRTLSKIYGPIMHLKLGEVSTIVISSPELAKEILKTYDTIFAQRPHQIGAD  119

Query  378  VVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAP  557
            ++ Y  TD+A +PYG YW+Q+R++C  ELL TK V+SF S R+EE+S LI  I  +  + 
Sbjct  120  IMCYGSTDIATAPYGTYWKQLRRLCSQELLCTKRVRSFQSIREEEVSNLIKCISNNIGSC  179

Query  558  INLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYV  737
            INL+EK+   TSS  ++AAFG++ + DQ+ FI+L+K+ + +A GF + DLFPS+KW+H +
Sbjct  180  INLSEKVACMTSSITSRAAFGKICK-DQQEFILLIKKLVKIAEGFIIIDLFPSQKWLHVI  238

Query  738  SGTKPRLLKVHREVDKIFELIIEE  809
            SG KP+L ++HR+ D I E II+E
Sbjct  239  SGMKPKLEELHRKFDNIIENIIKE  262



>ref|XP_007020549.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY12074.1| Cytochrome P450 [Theobroma cacao]
Length=504

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 129/283 (46%), Positives = 198/283 (70%), Gaps = 9/283 (3%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
            M+H F   P   ++F S +F    L+          LPPGPWKLP+IG++H L  GSLPH
Sbjct  1    MDHPFFSFP---MLFTSIIFLFMLLKLGKRFRTNNLLPPGPWKLPVIGNMHQL-AGSLPH  56

Query  219  RTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCT  398
             +L +L++KYGP+MHLQLGE+S I++SSP+ A  + KTHD++FANRP ++  ++V Y  T
Sbjct  57   HSLSDLAKKYGPLMHLQLGEVSNIIVSSPETAAEVMKTHDILFANRPYLLCANIVSYNAT  116

Query  399  DVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKI  578
            D+AFSPYG YWRQ+RKIC LE+L++K V+SF+  R+EE+S+L+ +I +   +P+NL++ +
Sbjct  117  DIAFSPYGAYWRQLRKICTLEMLTSKRVQSFSPIREEEVSKLVRAISSKAGSPVNLSKML  176

Query  579  CWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRL  758
               T   +++ AFG  + +D+  F +L +EA+ L  GF V+DLFPS K + +++G +P+L
Sbjct  177  YSLTYEIVSRTAFGG-KCKDKGEFTLLFREAIKLGAGFTVSDLFPSVKLLQFLNGLRPKL  235

Query  759  LKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE-EDIVDVLL  884
             ++H++VDKI E +I EHK   A++   K+ + E +D+VDVLL
Sbjct  236  ERLHQKVDKILENVINEHK---ASKGMAKSGEGESDDLVDVLL  275



>ref|XP_007146612.1| hypothetical protein PHAVU_006G054900g [Phaseolus vulgaris]
 gb|ESW18606.1| hypothetical protein PHAVU_006G054900g [Phaseolus vulgaris]
Length=489

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 133/280 (48%), Positives = 195/280 (70%), Gaps = 17/280 (6%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARR-----QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
            S ++F  F+F    +++  N  R+      K+P GP KLP+IG++H+L+  S PHR LR+
Sbjct  9    SALIF--FIFLALIVQKIGNKPRKTYETASKIPHGPTKLPIIGNIHNLLS-SQPHRKLRD  65

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L+ KYGP+MHLQLGE+S IVISSP+ AK + K HD+ FA RPK+++ +++ Y  TD+AF+
Sbjct  66   LALKYGPLMHLQLGEVSTIVISSPECAKEVMKIHDINFATRPKILASEIISYNSTDIAFA  125

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTS  593
            PYG+YWRQ+RKIC LELLS K VKSF   R+EELS L+  I +   +PINLT+ +     
Sbjct  126  PYGNYWRQLRKICTLELLSLKRVKSFQPIREEELSNLVKWIDSEKGSPINLTQAVLSSIY  185

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
            S  +++AFG+ + +DQ+ FI  VK+ + L GGF + DLFPS  W+ +V+G +P+L ++H+
Sbjct  186  SIASRSAFGK-KYKDQQNFIAAVKKLIKLEGGFDIGDLFPSATWLQHVNGIRPKLERLHQ  244

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHE---EDIVDVLL  884
            + D+I E II EHK+       ++AKD+E   ED+VDVL+
Sbjct  245  QADQIMEGIINEHKE-----ARSEAKDYERETEDLVDVLM  279



>ref|XP_009612417.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 180/246 (73%), Gaps = 8/246 (3%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAIT  326
            LPPGPWKLPL+GS+ H++GG  PH  L NL++KYGP++HLQLGE+S +V++SP++AK + 
Sbjct  32   LPPGPWKLPLLGSMFHMLGGH-PHHVLTNLAKKYGPLVHLQLGEMSVVVVTSPEMAKEVL  90

Query  327  KTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQ  506
            KTHDL FA+RPK ++ ++V+Y C+D+AF PYGDYWRQMRKIC++ELL+ K V+SF+S R+
Sbjct  91   KTHDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTAKNVRSFSSIRR  150

Query  507  EELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAG  686
            +E+  +I   ++S    +N+T++I  FTSS   ++AFG+V +E Q+ FI+LVK   +L  
Sbjct  151  DEVHRMIEFFRSSIDQQVNVTKRIYQFTSSMTCRSAFGKVFKE-QDEFILLVKRNTALME  209

Query  687  GFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEED  866
            GF VAD+FPSKK++H +SG K R++ VH ++D I E II E K         K       
Sbjct  210  GFDVADIFPSKKFLHVLSGKKARVMDVHHKIDAILENIINERKKIATGEVGGKG------  263

Query  867  IVDVLL  884
            ++DVLL
Sbjct  264  LIDVLL  269



>ref|XP_007146609.1| hypothetical protein PHAVU_006G054600g [Phaseolus vulgaris]
 gb|ESW18603.1| hypothetical protein PHAVU_006G054600g [Phaseolus vulgaris]
Length=453

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 190/275 (69%), Gaps = 10/275 (4%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKY  248
            S ++FL+ +      + R       K+P GP KLP+IG++H+L+  S PHR LR+L+ KY
Sbjct  9    SALIFLALIVQKIGNKPRKTYETASKIPHGPTKLPIIGNIHNLLS-SQPHRKLRDLALKY  67

Query  249  GPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDY  428
            GP+MHLQLGE+S IVISSP+ AK + KTHD+ FA RPK+++ +++ Y  TD+ F+PYG+Y
Sbjct  68   GPLMHLQLGEVSTIVISSPECAKEVMKTHDINFATRPKILASEIISYNSTDIVFAPYGNY  127

Query  429  WRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAK  608
            WRQ+RKIC LELLS K V SF   R++ELS L+  I +   +PINLT+ +     S  ++
Sbjct  128  WRQLRKICTLELLSLKRVNSFQPIREDELSNLVKWIDSEKGSPINLTQAVLSSIYSIASR  187

Query  609  AAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKI  788
            +AFG+ + +DQ+ FI  VK+ + L GGF + DLFPS  W+ +V+G +P+L ++H++VD+I
Sbjct  188  SAFGK-KYKDQQNFIAEVKKLIKLVGGFDIGDLFPSATWLQHVTGIRPKLERLHQQVDQI  246

Query  789  FELIIEEHKDNMANRNNNKAKDHE---EDIVDVLL  884
             E II EHK+  +     +AKD E   ED+VDVL+
Sbjct  247  LEGIINEHKEARS-----EAKDFERETEDLVDVLI  276



>ref|XP_003516583.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/249 (53%), Positives = 180/249 (72%), Gaps = 4/249 (2%)
 Frame = +3

Query  144  KLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKA  320
            KLPPGP KLPLIG+LH L + GSLPHRTLR+L+ KYGP+MHLQLGEIS++V+SSP +AK 
Sbjct  35   KLPPGPKKLPLIGNLHQLAMAGSLPHRTLRDLALKYGPLMHLQLGEISSVVVSSPNMAKE  94

Query  321  ITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSF  500
            I KTHDL F  RP+ +   ++ Y  +D+AF+PYGDYWRQM+KICV ELLS K V+SF+  
Sbjct  95   IMKTHDLAFVQRPQFLPAQILTYGQSDIAFAPYGDYWRQMKKICVSELLSAKRVQSFSDI  154

Query  501  RQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            R++E ++ I S++ S  +P+NLT KI    SS I++ AFG  + +DQE F+ LVKE + +
Sbjct  155  REDETAKFIESVRTSEGSPVNLTNKIYSLVSSAISRVAFGN-KCKDQEEFVSLVKELVVV  213

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMAN-RNNNKAKDH  857
              GF + DLFPS K +H ++G K +L K+  +VDKI + I++EH++     R   +    
Sbjct  214  GAGFELDDLFPSMK-LHLINGRKAKLEKMQEQVDKIVDNILKEHQEKRERARREGRVDLE  272

Query  858  EEDIVDVLL  884
            EED+VDVLL
Sbjct  273  EEDLVDVLL  281



>ref|XP_004231934.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/284 (50%), Positives = 196/284 (69%), Gaps = 10/284 (4%)
 Frame = +3

Query  36   EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
            E++H    N   +I FL FV     L ++S    + KLPPGP KLP IG+LH L   SLP
Sbjct  2    EIQHS---NFAMLIAFLLFVAIALKLWKKSK--IQYKLPPGPRKLPFIGNLHQL-SSSLP  55

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H T +NLS KYGP+MHLQLGE+SA+++SSPQ+AK + KTHDL+FANRP+++S  ++    
Sbjct  56   HHTFKNLSNKYGPMMHLQLGEVSAVIVSSPQVAKEVLKTHDLIFANRPQLLSVQILSNNS  115

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIK-ASGSAPINLTE  572
              ++FSPYG  WRQ+RK+CVLELLS K V+SF S R+EE+  LI +I       PI+++E
Sbjct  116  PTLSFSPYGANWRQLRKVCVLELLSAKRVQSFESIREEEVDNLIEAISLIQPQVPIDISE  175

Query  573  KICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKP  752
             I   T++  A+AAFG+ + + ++ FI  +K    L+GGF + DLFPS K  H +SG KP
Sbjct  176  MIFSMTNNITARAAFGK-KCKHKDEFIKAMKTITELSGGFDIPDLFPSLKIFHSLSGVKP  234

Query  753  RLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             L KVH++VDKIFE II+EHK+N  + ++N    ++ED+VDVLL
Sbjct  235  ALEKVHQKVDKIFEDIIQEHKENKRDMSSNML--YKEDLVDVLL  276



>ref|XP_009611155.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 186/255 (73%), Gaps = 6/255 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLP++GS+ HL+GG  PH  LR+L++KYGP+MHLQLGE+S +V++
Sbjct  23   KNSSSQTKRLPPGPWKLPILGSMLHLLGGH-PHHVLRDLAKKYGPLMHLQLGEVSLVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RP +++  +V Y  TD+ FSPYG+YWRQMRKIC+LELLS K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSFNS RQ+E+  +I   ++S   P+N+T++   FTSS   ++AFG+  +E  E F+ L
Sbjct  142  VKSFNSIRQDEVHRMIEFFRSSPGKPVNVTKRFALFTSSMTCRSAFGQEHKEKDE-FVRL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK+  +   GF VAD+FPS K++H V+G K +++  H E+D+IFE II E K  +A  N 
Sbjct  201  VKKVSNYMEGFDVADIFPSLKFLHVVTGLKAKVMDAHHELDEIFENIISERK-KVAKTN-  258

Query  840  NKAKDHEEDIVDVLL  884
               +   E IVDVLL
Sbjct  259  --CESRGEGIVDVLL  271



>ref|XP_007146605.1| hypothetical protein PHAVU_006G054200g [Phaseolus vulgaris]
 gb|ESW18599.1| hypothetical protein PHAVU_006G054200g [Phaseolus vulgaris]
Length=494

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 191/273 (70%), Gaps = 6/273 (2%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            +S+++F+     I T +     A    LPPGPWKLP+IG++H+LVG SLPHR LR+LS K
Sbjct  9    LSIVIFMFIAHKIITKK----CASTSNLPPGPWKLPIIGNIHNLVG-SLPHRRLRDLSAK  63

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGE+S IV+SS + AK + KTHDL+FA+RP +++  ++ Y    ++FSPYGD
Sbjct  64   YGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLIFASRPPILASKILSYDSVGISFSPYGD  123

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC LELLS K V+SF   R+EEL++ I +I +   +PINLT++I    S+ ++
Sbjct  124  YWRQLRKICALELLSLKRVQSFQPIREEELTKFIKNIASKEGSPINLTKEILSTISTIVS  183

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + A G   R D ++FI  V+EA  +AGGF + DL+PS  W+ ++SG K +L + H++ D+
Sbjct  184  RTALGSKYR-DHKKFISAVREATEVAGGFDLGDLYPSAGWLQHISGLKGKLEQSHQQTDR  242

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I + II++H++  +     + +  E+D+VDVL+
Sbjct  243  IMQRIIDDHREAKSRAAQAQGEQVEDDLVDVLM  275



>ref|XP_009765039.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=501

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 185/255 (73%), Gaps = 4/255 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ +  ++LPPGPWKLPL+G++ HL+GG  PH  L +L++KYGP+MHLQLGE+S + ++
Sbjct  23   KNSNSHTKRLPPGPWKLPLLGNMFHLLGGP-PHHVLGDLAKKYGPLMHLQLGEVSVVAVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RP +++  +V Y  TD+ FSPYGDYWRQMRKIC+LELLS K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+SF+S R++E+  +I   ++S   P+N+T++I  FTSS   ++AFG+  +E Q+ F  L
Sbjct  142  VRSFSSVRRDEVFRMIEFFRSSSGKPVNVTKRISVFTSSMTCRSAFGQEYKE-QDEFARL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK+  SL  GF +AD+FPS K++H +SG K +++  H E+D I E II EHK     +NN
Sbjct  201  VKKVSSLMEGFDIADIFPSLKFLHVLSGMKAKVMDAHHELDAILEKIINEHKKIATGKNN  260

Query  840  NKAKDHEEDIVDVLL  884
            ++     E ++DVLL
Sbjct  261  DELGG--EGLIDVLL  273



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 186/259 (72%), Gaps = 3/259 (1%)
 Frame = +3

Query  111  LRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAI  290
            L   S   +   LPPGP KLPLIG+LH L+G SLPH TLR+++ +YGPIMHL+ GE+  +
Sbjct  24   LMSESKRGKGSNLPPGPRKLPLIGNLHQLMG-SLPHHTLRDMANEYGPIMHLRFGEVPTV  82

Query  291  VISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLS  470
            ++SS + AK + KTHDLVFA+RPK++  D++ Y  T + FSPYGD+WRQ+RKICV ELL+
Sbjct  83   IVSSAEAAKEVMKTHDLVFADRPKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLN  142

Query  471  TKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKAAFGRVRREDQER  647
             K V+SF S RQEE+ +LI +I ++ S   INL++ I   T++ IA+AAFGR + E+Q+ 
Sbjct  143  VKRVQSFESIRQEEVEDLIKTISSNPSGTTINLSQMIFTLTNNIIARAAFGR-KLENQDE  201

Query  648  FIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMA  827
            FI  +++ + LAGGF + D FPS K++H ++G K  + K+H ++DKI E +++EHK    
Sbjct  202  FIGTLRKIVDLAGGFDLPDTFPSLKFLHPLTGAKAAMEKIHHQIDKILESVLQEHKAARK  261

Query  828  NRNNNKAKDHEEDIVDVLL  884
               N+K K H+ED+VDVLL
Sbjct  262  VTINHKDKMHKEDLVDVLL  280



>ref|XP_009619866.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/255 (50%), Positives = 185/255 (73%), Gaps = 6/255 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            R++ ++ ++LPPGPWKLP++GS+ HL+GG  PH  LR+L++KYGP+MHLQLGE+S +V++
Sbjct  23   RNSSSQTKRLPPGPWKLPILGSMLHLLGGH-PHHVLRDLAKKYGPLMHLQLGEVSLVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RP +++  +V Y  TD+ FSPYG+YWRQMRKIC+LELLS K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPLLVAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSFNS RQ+E+  +I   ++S   P+N+T++   FTSS   ++AFG+  +E Q+ F+ L
Sbjct  142  VKSFNSIRQDEVHRMIEFFRSSPGKPVNVTKRFALFTSSMTCRSAFGQEHKE-QDEFVRL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK+  +L  GF VA++FPS  ++H ++G K +++ VH E+D+I E II EHK        
Sbjct  201  VKKVSNLMEGFDVANIFPSLNFLHVLTGMKAKVMNVHHELDEILENIITEHK----KVAK  256

Query  840  NKAKDHEEDIVDVLL  884
               +   E IVDVLL
Sbjct  257  TICESGGEGIVDVLL  271



>ref|XP_009625417.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase [Nicotiana tomentosiformis]
Length=504

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/257 (51%), Positives = 193/257 (75%), Gaps = 5/257 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWK+P++GS+ H+VGG  PH  LR+L++KYGP+MHLQ GEISA+V++
Sbjct  23   KNSNSQTKKLPPGPWKIPILGSMLHMVGGE-PHHVLRDLAKKYGPLMHLQFGEISAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            S ++AK + KTHD+VFA+RPK+++ D++ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82   SREMAKEVLKTHDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAP--INLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            V+SF+S R++E+  LI SI++  S+   +N T++I WF SS   ++AFG+V +  Q+ F 
Sbjct  142  VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLK-GQDVFA  200

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANR  833
              ++E + LA GF VAD+FPS K++H +SG K +LL  H +VD I E +I EHK N+A  
Sbjct  201  KKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATG  260

Query  834  NNNKAKDHEEDIVDVLL  884
              N A    ED++DVLL
Sbjct  261  KTNGALGG-EDLIDVLL  276



>ref|XP_009612418.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 186/255 (73%), Gaps = 8/255 (3%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++  + ++LPPGPWKLPL+GS+ H++GG LPH  L NL++KYGP+MHLQLGE+S +V++
Sbjct  23   KNSNNQTKRLPPGPWKLPLLGSMFHILGG-LPHHVLTNLAKKYGPLMHLQLGEMSVVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RPK+++ ++V Y C+D+AF PYGDYWRQMRKIC++ELLS K 
Sbjct  82   SPEMAKEVLKTHDLAFASRPKLLAAEIVIYNCSDIAFCPYGDYWRQMRKICMIELLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSF+S R++E+  +I   ++S    +N+T++I  F SS   ++AFG+V +E Q+  I+L
Sbjct  142  VKSFSSIRRDEVHGMIEFFRSSTGKQVNITKRIYQFASSMTCRSAFGKVFKE-QDELILL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK   +L  GF VAD+FPS K++H +SG K +++ VH ++D I E II E K    +   
Sbjct  201  VKRNTALVEGFDVADIFPSLKFLHVLSGMKAKVMDVHHKLDVILENIINERKKIATDELG  260

Query  840  NKAKDHEEDIVDVLL  884
                  +E ++DVLL
Sbjct  261  ------DEGLIDVLL  269



>ref|XP_003516584.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN36163.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/283 (47%), Positives = 195/283 (69%), Gaps = 4/283 (1%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
            ME +  F  +++ +F+   +    L+ + N A   KLPPGP KLPLIG++H L V GSLP
Sbjct  1    MEAQTYFLVIALSLFILLNWLAKYLKLKPNVA--HKLPPGPKKLPLIGNMHQLAVAGSLP  58

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            HR L+ L+  YGP+MHLQLGEISA+V+SSP +AK ITKTHD+ F  RP+++S  ++ Y  
Sbjct  59   HRALQKLAHIYGPLMHLQLGEISAVVVSSPNMAKEITKTHDVAFVQRPQIISAQILSYGG  118

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
             DV F+PYGDYWRQMRK+ V ELLS K V+SF+  R++E ++ I SI+AS  +PINLT K
Sbjct  119  LDVVFAPYGDYWRQMRKVFVSELLSAKRVQSFSFIREDETAKFIDSIRASEGSPINLTRK  178

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            +    S+++++AA G  + +DQ+ F+  +++ +   GGF +ADLFPS K IH+++G+K +
Sbjct  179  VFSLVSASVSRAAIGN-KSKDQDEFMYWLQKVIGSVGGFDLADLFPSMKSIHFITGSKAK  237

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            L K+   VDK+ E I+ EH +      + + +  +ED+VDVLL
Sbjct  238  LEKLLNRVDKVLENIVREHLERQIRAKDGRVEVEDEDLVDVLL  280



>ref|XP_009606204.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=527

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 125/255 (49%), Positives = 186/255 (73%), Gaps = 4/255 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLP++GS+ HL+GG  PH  L +L++KYGP+MHLQLGE+S + ++
Sbjct  49   KNSHSQTKRLPPGPWKLPVLGSMFHLLGGP-PHHVLGDLAKKYGPLMHLQLGEVSVVSVT  107

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            SP++AK + KTHDL FA+RP +++  +V Y  TD+ FSPYGDYWRQMRKIC+LELLS K 
Sbjct  108  SPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSAKN  167

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            V+SF+S R++E+  +I   ++S   P+N++++I  FT+S   ++AFG+  +E Q+ F  L
Sbjct  168  VRSFSSVRRDEVFHMIEYFRSSSGKPVNVSKRISLFTTSMTCRSAFGQEYKE-QDEFARL  226

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNN  839
            VK+  SL  GF VAD+FPS K++H +SG K +++  H E+D I E II EHK     +NN
Sbjct  227  VKKVSSLMEGFDVADIFPSLKFLHVLSGMKAKVMDAHHELDAILENIINEHKKIATGKNN  286

Query  840  NKAKDHEEDIVDVLL  884
            N+     E ++DVLL
Sbjct  287  NELGG--EGLIDVLL  299



>ref|XP_004228509.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=495

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 173/234 (74%), Gaps = 2/234 (1%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWKLPLIGS+ HL+GG LPH   R+L++KYGPIMHLQLGE+S +V++
Sbjct  23   KNSNSKSKRLPPGPWKLPLIGSMFHLLGG-LPHHVFRDLAKKYGPIMHLQLGEVSLVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            S  +AK + KTHDL FA RPK++  ++++YK TD+ FSPYGDYWRQMRKIC+LE LS K 
Sbjct  82   SADMAKQVLKTHDLAFAFRPKLLVGEILFYKGTDIVFSPYGDYWRQMRKICLLEFLSAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVL  659
            VKSFNS RQ+E+  +I   ++S    IN+T++I  F+SS   ++ FG+V +E Q + + L
Sbjct  142  VKSFNSIRQDEVHHMIEFFRSSSGETINVTKRIYQFSSSMTCRSVFGKVFKE-QNKLMEL  200

Query  660  VKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDN  821
             KEA     GF VAD+FPS K++H + G K +++  H E+D I E II EHK+N
Sbjct  201  AKEASRFLKGFDVADIFPSLKFLHVLCGMKGKIMDAHHELDAILENIINEHKNN  254



>ref|XP_004512032.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=508

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 198/285 (69%), Gaps = 8/285 (3%)
 Frame = +3

Query  36   EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGS-L  212
            E++  F+  P  V++ L ++   Y  +  +      KLPPGP KLPLIG+LH L   S L
Sbjct  5    EVQLSFVLIPFFVLLLLHWLTKHYKPKTIA-----YKLPPGPRKLPLIGNLHQLAFASKL  59

Query  213  PHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYK  392
            PH  L+ LS KYGP+MHLQLGEIS +++SSP+ AK + KTHD+VFANRPK++S  ++ Y 
Sbjct  60   PHHALKILSHKYGPLMHLQLGEISTVIVSSPKFAKEVMKTHDVVFANRPKLLSPQILAYG  119

Query  393  CTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTE  572
              D+ FSPYGDYWRQMRKICVLE+LS K V+SF+  R++E ++ I SIK+   + INLT 
Sbjct  120  FKDIVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYIREDETTKFIKSIKSFSGSTINLTS  179

Query  573  KICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKP  752
            +I    +S I++AAFG  + EDQ+ F+ L+++A++L+GG  + DLFPS K IH ++G K 
Sbjct  180  RIFSVINSIISRAAFGD-KSEDQDEFVSLIRKAIALSGGLELDDLFPSMKPIHILTGMKS  238

Query  753  RLLKVHREVDKIFELIIEEHKDNMA-NRNNNKAKDHEEDIVDVLL  884
            +  K+H+ VDKI + ++ +H++  A  ++  K +  +ED+VDVLL
Sbjct  239  KFEKIHKRVDKILDNVVRKHEEKRAITKDEKKIEAEKEDLVDVLL  283



>ref|XP_003611886.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94844.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   268 bits (684),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 191/275 (69%), Gaps = 7/275 (3%)
 Frame = +3

Query  72   VIVFLSFVFCIYTLRRRSNPARRQ-KLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRK  245
            VI F   +F ++ L + S   +   KLPPGP K PLIG+L  L +    PH  L  LS K
Sbjct  9    VIPFF-LLFVLHWLAKYSKTKKSHSKLPPGPMKFPLIGNLPQLAMSKKRPHHALHELSHK  67

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MH+QLGEIS +++SSP+LAK I KTHD  FANRPK++S +++ Y   D+ FSPYGD
Sbjct  68   YGPLMHIQLGEISTVIVSSPKLAKEIMKTHDAAFANRPKLLSPEIMAYGSKDIVFSPYGD  127

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            +WRQMRKICV ELLS K V+SF+  R++E  +LI SI++S  + INLT +I    SS I+
Sbjct  128  FWRQMRKICVFELLSAKRVQSFSYIREDETKKLIQSIQSSTGSTINLTSRIFSMVSSNIS  187

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            +AAFG  + +DQ+ F+ LV++ + ++ GFGV DLFPS K +H +SG KP+L K+H+ VDK
Sbjct  188  RAAFGD-KSKDQDEFVDLVRKVVEMSSGFGVDDLFPSIKPLHILSGMKPKLEKIHKRVDK  246

Query  786  IFELIIEEHKD--NMANRNNNKAKDHEEDIVDVLL  884
            I E II +H++    A  ++N   D+ ED++DVLL
Sbjct  247  IIENIIRQHQEKRERAKEDDNNEVDN-EDLLDVLL  280



>ref|XP_003611883.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94841.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/252 (52%), Positives = 180/252 (71%), Gaps = 6/252 (2%)
 Frame = +3

Query  144  KLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKA  320
            KLPPGP KLPLIG+LH +   GSLPHR  + L+ KYGPI+HL+LGE SA+VISSP+LAK 
Sbjct  33   KLPPGPMKLPLIGNLHQIAALGSLPHRAFKQLAHKYGPIVHLKLGETSAVVISSPKLAKE  92

Query  321  ITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSF  500
            I KTHD++FANRP + +  ++ Y   D+AFSPYGDYWRQMRKIC+LELLS K V+SF+  
Sbjct  93   ILKTHDVIFANRPHLQASHIMTYGSKDIAFSPYGDYWRQMRKICMLELLSNKRVQSFSYI  152

Query  501  RQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            R++E    I SI++S  + +NLT +I    SST++++AFG  + EDQ+ F+ ++++A+  
Sbjct  153  REDETRNFIKSIQSSEGSSVNLTNRIFSLVSSTVSRSAFGD-KTEDQDEFVSVIRKAIES  211

Query  681  AGGFGVADLFPS-KKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDH  857
             GG   ADLFPS K  I  ++GTK ++LK+H++ DKI E+I+ +H++        K    
Sbjct  212  VGGLEPADLFPSMKSIIQMLTGTKSKVLKMHKKADKILEIIVRKHQEKQRRAKEGKVSSD  271

Query  858  E---EDIVDVLL  884
            E   ED+VDVLL
Sbjct  272  EVEQEDLVDVLL  283



>ref|XP_009771988.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Nicotiana 
sylvestris]
Length=504

 Score =   267 bits (683),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 193/257 (75%), Gaps = 5/257 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWK+P++GS+ H++GG  PH  LR+L++KYGPIMHLQ GEISA+V++
Sbjct  23   KNSNSQTKQLPPGPWKIPILGSMLHMLGGE-PHHILRDLAKKYGPIMHLQFGEISAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            S ++AK + KTHD+VFA+RPK+++ D++ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82   SREMAKEVLKTHDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAP--INLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            V+SF+S R++E+  LI SI++  S+   +N T++I WF SS   ++AFG+V +  Q+ F 
Sbjct  142  VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLK-GQDVFA  200

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANR  833
              ++E + LA GF VAD+FPS K++H +SG K +LL  H +VD I E +I EHK N+A  
Sbjct  201  KKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATG  260

Query  834  NNNKAKDHEEDIVDVLL  884
              N A    ED++DVLL
Sbjct  261  KTNGALGG-EDLIDVLL  276



>ref|XP_004512033.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=510

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 191/276 (69%), Gaps = 7/276 (3%)
 Frame = +3

Query  63   PVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLS  239
            P  V + L F    Y L+        + LPPGP KLP IG+LH +   GSLPHR  + L+
Sbjct  12   PFFVFLMLRFFAKFYKLKTFG----YKLLPPGPTKLPFIGNLHQIASLGSLPHRAFQQLA  67

Query  240  RKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPY  419
             KYGPIMHL+LG+ISA+VI+SP+LAK I KTHD+ FANRP + S  ++ Y   D+AFSPY
Sbjct  68   HKYGPIMHLKLGQISAVVITSPKLAKEILKTHDITFANRPNLESAHIMTYGSIDIAFSPY  127

Query  420  GDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSST  599
            GDY+RQMRKIC+LELLS K V+SF+  R++E ++ I  IK+S  + +NLT +I    SST
Sbjct  128  GDYYRQMRKICMLELLSAKRVQSFSYIREDETNKFIELIKSSEGSEVNLTNRIFSLVSST  187

Query  600  IAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKW-IHYVSGTKPRLLKVHRE  776
            ++++AFG  + EDQ+ F+ ++++A+   GG   ADLFPS K+ IH ++G K +L K+H++
Sbjct  188  VSRSAFGD-KTEDQDEFVSVIRKAIESVGGLEPADLFPSFKYIIHVLTGNKSKLEKMHKQ  246

Query  777  VDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             DKI E+I+ +H++    +  + + + +ED+VDVLL
Sbjct  247  ADKILEIIVSKHQEKQRRKKLDGSDEEQEDLVDVLL  282



>ref|XP_003600339.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70590.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=511

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/273 (47%), Positives = 194/273 (71%), Gaps = 6/273 (2%)
 Frame = +3

Query  78   VFLSFVFCIYTLRRRSN----PARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            +F  F+F I  L+ RS+     +  + +PPGPWKLP++G++ +LV  + P R LR+L++K
Sbjct  11   LFTIFMFMIIALKIRSHYKKYASSTKNIPPGPWKLPILGNILNLVTTN-PPRKLRDLAKK  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGEI  IV+SSP++A+ + KTHD++FA+RP ++  ++V Y  TD+AFSPYGD
Sbjct  70   YGPLMHLQLGEIFFIVVSSPEVAREVLKTHDIIFASRPHLLVLEIVSYNSTDIAFSPYGD  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC +ELLST+ VKS    RQ+E++ L++ I A+  +  NLT+++     +  +
Sbjct  130  YWRQLRKICAIELLSTRRVKSLWPKRQKEINSLLNKIDANEGSEFNLTQEVISMLYTFTS  189

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            KAAFG+ +  +QE F+ +VK+ + LAGGF + DLFPS +WI  +SG KP+L K+ ++VD+
Sbjct  190  KAAFGK-KYLEQEEFLSVVKQLIKLAGGFYLGDLFPSAQWIQTLSGMKPKLKKLSQQVDR  248

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I   II +HK+ M+ R      + EED++D LL
Sbjct  249  ILGHIINDHKEAMSKRAKEGLAEVEEDLIDCLL  281



>ref|XP_006341719.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/273 (49%), Positives = 193/273 (71%), Gaps = 9/273 (3%)
 Frame = +3

Query  78   VFLSF-VFCIYTLRRRSNPARRQ--KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKY  248
            +FLSF VF +  ++  S   R +   LPPGP KLPLIG+LH L+G SLPH TLR+++ +Y
Sbjct  10   IFLSFLVFLVIAIKLISESMRGKGANLPPGPRKLPLIGNLHQLMG-SLPHHTLRDMANEY  68

Query  249  GPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDY  428
            GPIMHL+ GE+  +++SS + AK + KTHDLVFA+RPK++  D++ Y  T + FSPYGD+
Sbjct  69   GPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADRPKILVADIIGYNSTQITFSPYGDH  128

Query  429  WRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKAS-GSAPINLTEKICWFTSSTIA  605
            WRQ+RKICV ELL+ K V+SF S RQEE+ +LI +I  +     INL++ I   T++ IA
Sbjct  129  WRQLRKICVAELLNVKRVQSFESLRQEEVKDLIKTISLNPAGTTINLSQMIFTLTNNIIA  188

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            +AAFGR + E+Q+ FI  +++ + LAGGF + D FPS K++H ++G K  + K+H ++DK
Sbjct  189  RAAFGR-KLENQDEFIATLRKIVDLAGGFDLPDTFPSLKFLHPLTGAKAAMEKIHHQIDK  247

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I E +++EHK   A R     ++ +ED+VDVLL
Sbjct  248  ILESVLQEHK---AARKLAINREDKEDLVDVLL  277



>emb|CDP07887.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 194/278 (70%), Gaps = 5/278 (2%)
 Frame = +3

Query  57   FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
            FN ++  +FL+FV C+    +RS  A  QKLPP P KLP+IG++HHLVG S PH  LR L
Sbjct  5    FNFIAFFLFLAFVLCLIKEWKRSKAA--QKLPPSPSKLPVIGNMHHLVG-SPPHHALRKL  61

Query  237  SRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSP  416
            +R++G +M+LQLGEIS+IV+SSP LAK I KTHDL FANR + ++  ++ Y  +D+A  P
Sbjct  62   ARQHGALMYLQLGEISSIVVSSPHLAKEIMKTHDLAFANRAEFLTSKILMYNSSDIACCP  121

Query  417  YGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAP--INLTEKICWFT  590
            YGDYWRQMRKIC LELLS K V+SF S RQ+E S L++S++A  +A   IN++EK+  +T
Sbjct  122  YGDYWRQMRKICTLELLSAKNVRSFGSIRQDEASHLLASVQALAAAGKLINISEKLYSYT  181

Query  591  SSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVH  770
            SS + +AAFG+V ++    F+ L  E+  L+  F ++DLFPS K +H +   K +L+K+H
Sbjct  182  SSMVCRAAFGKVSKDLHREFLQLTSESAPLSSTFDISDLFPSFKILHPLLSVKSQLVKIH  241

Query  771  REVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             ++DK+   II++H DN A  N    +   ED++DVLL
Sbjct  242  LKMDKLLGNIIDQHVDNRARTNMATGESGNEDLIDVLL  279



>ref|XP_009587552.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 182/258 (71%), Gaps = 4/258 (2%)
 Frame = +3

Query  114  RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIV  293
            R+    +++Q+LPPGPW+LPLIGSLHHL+G   PHR  R+L+RKYGP+M+L+LGE+  ++
Sbjct  30   RKSETSSQKQRLPPGPWRLPLIGSLHHLIGAH-PHRIFRDLARKYGPVMYLELGEVPTVI  88

Query  294  ISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLST  473
            ISSP  AK   KTHDL FANRP+  S  +V Y   D+AFS YGDYW+QMRKIC++ELLS 
Sbjct  89   ISSPSAAKETLKTHDLAFANRPQFTSTYIVMYNNKDIAFSEYGDYWKQMRKICIMELLSA  148

Query  474  KMVKSFNSFRQEELSELISSIKA-SGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERF  650
            +MVKSF+S R++E+S L+SS+ +  G++ +N+TEKI  +      +  FG++ + D+E  
Sbjct  149  RMVKSFSSIRKDEISNLLSSVHSVKGTSEVNMTEKIVRYACFVTCRLVFGKLGK-DREVL  207

Query  651  IVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMAN  830
            I L+K+ L LAGG  V DLFPS K ++ ++G K RL+K+H+ VD + E I+ EH  + A 
Sbjct  208  IDLMKKMLLLAGG-DVCDLFPSWKLLYKMTGAKSRLVKMHQVVDSVLENIVNEHIRSRAA  266

Query  831  RNNNKAKDHEEDIVDVLL  884
             N    +   ED+VDV L
Sbjct  267  GNKGNGEYGGEDLVDVFL  284



>ref|XP_009347232.1| PREDICTED: cytochrome P450 71D11-like [Pyrus x bretschneideri]
Length=512

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 195/285 (68%), Gaps = 9/285 (3%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQ-KLPPGPWKLPLIGSLHHLVGGSLP  215
            ME ++ F  V +  FL  V  +  + +RS        LPPGPWKLP IG++H LVG S P
Sbjct  1    MELQWPFFQV-LFAFLLVVITVLKIAKRSKTKESAVNLPPGPWKLPFIGNIHQLVG-SQP  58

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  LRNL++KYGPIMHLQLGE+S +V+SS + AK + KTHD+V ++RP +++  ++ Y+ 
Sbjct  59   HHGLRNLAKKYGPIMHLQLGEVSTVVVSSAEYAKEVMKTHDVVLSSRPYLLASRIMSYEA  118

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
            T++AF+P GDYWRQ+RKIC LELLSTK V+ F   R+EE+  LI+ I ++   PINLTEK
Sbjct  119  TNIAFAPCGDYWRQLRKICTLELLSTKRVQGFRPLREEEVGNLITWIGSNAGLPINLTEK  178

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            I   T +  ++AAFG+ + ED E+FI  VKE++++A GF +AD+FPS K ++ + G +P 
Sbjct  179  IYSSTYTFTSRAAFGK-KSEDHEKFIDAVKESITVAAGFDLADVFPSAKLLNLIGGIRPT  237

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE--EDIVDVLL  884
            L ++ +  D+I E II EHK     R+  K+ + E  ED+VDVLL
Sbjct  238  LERLKKVTDRIMENIINEHK---KKRSTTKSGEGEAGEDLVDVLL  279



>gb|AFK35275.1| unknown [Lotus japonicus]
Length=316

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 184/269 (68%), Gaps = 4/269 (1%)
 Frame = +3

Query  81   FLSFVFCIYTLRRR-SNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPI  257
            FLS +  +  LR+    P     +PPGPWKLP+IGS+ HLVG S PHR LR+L++KYGP+
Sbjct  15   FLSMIVALMILRKNLKKPDSIPNIPPGPWKLPIIGSIPHLVG-SPPHRKLRDLAKKYGPL  73

Query  258  MHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQ  437
            MHLQLGE+  I++SS + AK + KTHD+ FA+RP+ +  D+V+Y  T + FSPYGDYWRQ
Sbjct  74   MHLQLGEVIFIIVSSAEYAKEVMKTHDVTFASRPRSLFTDIVFYGSTGIGFSPYGDYWRQ  133

Query  438  MRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAF  617
            +RKIC +ELLS K V+S    R+EE+  LI  I +   + +NL++ I     +  +++AF
Sbjct  134  VRKICNVELLSMKRVQSLWPIREEEVKNLIQRIASEEGSVVNLSQAIDSLIFTITSRSAF  193

Query  618  GRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFEL  797
            G+ R  +QE FI  V+E ++LAGGF +ADLFPS KW+  ++  + +   +H+++D+I E 
Sbjct  194  GK-RYMEQEEFISCVREVMTLAGGFNIADLFPSAKWLENLTRMRSKFEYLHQKMDRILET  252

Query  798  IIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            II++HK N +     + +  EED++DVLL
Sbjct  253  IIDDHKAN-SRTKEGQVEGGEEDLIDVLL  280



>gb|EYU21978.1| hypothetical protein MIMGU_mgv1a004623mg [Erythranthe guttata]
Length=517

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/291 (47%), Positives = 199/291 (68%), Gaps = 13/291 (4%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
            ME +F F   + I+ LSF+F       R +     KLPP PWKLPLIG LHH+  G LPH
Sbjct  1    MEIQFPFTFTNAILLLSFIFFFIYKGYRKSRNTTAKLPPSPWKLPLIGHLHHI--GKLPH  58

Query  219  RTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCT  398
            R+ + LS K+GP+MH+ LGE++AIV+SSP LAK + K HD  FA+RP  ++ ++++Y  +
Sbjct  59   RSFQKLSEKHGPLMHVMLGEVTAIVVSSPALAKQVLKAHDPTFADRPVTIAGEILWYNSS  118

Query  399  DVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKI  578
            +++FS YGDYWRQMRKIC+LELLS K VKSF+S R +E+S+LI SIK S S  ++LTEKI
Sbjct  119  NISFSQYGDYWRQMRKICILELLSAKNVKSFSSIRNDEVSQLIESIKISSST-VDLTEKI  177

Query  579  CWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRL  758
               TSS   +AAFG+V + D+++ I + KE ++L  GF V+DL+PS K +  +S  + RL
Sbjct  178  FGMTSSITCRAAFGKVCK-DKDQLIGMFKEGITLVSGFDVSDLYPSSKMLKALSCNRMRL  236

Query  759  LKVHREVDKIFELIIEEHKDNM-----ANRNNNKAKDH----EEDIVDVLL  884
            +K+  ++D I + +I+EH+ N+     A+  N++ + +     ED+VDVLL
Sbjct  237  MKMRLKLDLILDDVIDEHRRNLEKIVFADEENSERRGNGEFGNEDLVDVLL  287



>ref|XP_007156881.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
 gb|ESW28875.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
Length=504

 Score =   265 bits (677),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/248 (51%), Positives = 177/248 (71%), Gaps = 2/248 (1%)
 Frame = +3

Query  144  KLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKA  320
            KLPPGP +LP+IG+LH L V GSLPHR L+ LS +YGP+MHLQLGEISA+V SSP++ K 
Sbjct  34   KLPPGPKRLPIIGNLHQLAVAGSLPHRALQKLSHEYGPLMHLQLGEISAVVASSPEMVKE  93

Query  321  ITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSF  500
            ITKTHD+ F  RP+ +S  ++ Y   DV F+PYGDYWRQMRKI V ELLSTK V+SF+  
Sbjct  94   ITKTHDVAFLQRPQFISGQILSYGGIDVVFAPYGDYWRQMRKIFVSELLSTKRVQSFSFI  153

Query  501  RQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            R++E  + I SI+ S  +PINL+ +I    S+++++AAFG + + D   F++L+K+ +  
Sbjct  154  REDETEKFIDSIRTSAGSPINLSSRIFSLVSTSVSRAAFGNISK-DHIEFMLLIKKVMGS  212

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE  860
             GGF +ADLFPS K IH+++G K +L K+  +VD+  E I+ EH++        + +  +
Sbjct  213  VGGFDLADLFPSMKSIHFITGKKAKLEKLLNQVDRFLESIVREHQEKQRRAKEGRVQIKD  272

Query  861  EDIVDVLL  884
            ED+VDVLL
Sbjct  273  EDLVDVLL  280



>ref|XP_003600330.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70581.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/246 (50%), Positives = 180/246 (73%), Gaps = 3/246 (1%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAIT  326
            +PPGPWKLP+IG++H+L+G S PHR LR LS KYGP+MHLQLGE+  I++SS + A  I 
Sbjct  38   IPPGPWKLPIIGNIHNLIG-SPPHRKLRELSNKYGPLMHLQLGEVFFIIVSSAEYAMEIM  96

Query  327  KTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQ  506
            KTHD++F++RP  ++ ++V+Y  T +AFSPYGDYWRQ+RKIC +ELLS K V+S    R+
Sbjct  97   KTHDVIFSSRPSTLTSEIVFYDSTSIAFSPYGDYWRQLRKICTVELLSIKRVQSLWPIRE  156

Query  507  EELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAG  686
            +E++ LI  I +     +NL++++     S  ++AAFG+ +  +Q+ F+  V+E L LAG
Sbjct  157  QEINNLIRRIASEEGRVVNLSQQVVPMMFSITSRAAFGK-KYMEQDEFVSTVREVLQLAG  215

Query  687  GFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEED  866
            GF + DLFPS KW+  ++G +PRL K+H +VD+I ELII++HKD   +R+ +   + EED
Sbjct  216  GFYIGDLFPSAKWLQNLTGMRPRLEKLHEKVDRILELIIDDHKDK-KSRSKDDLVEGEED  274

Query  867  IVDVLL  884
            ++DVLL
Sbjct  275  LIDVLL  280



>ref|XP_003611884.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94842.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   265 bits (677),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/285 (48%), Positives = 192/285 (67%), Gaps = 7/285 (2%)
 Frame = +3

Query  36   EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSL  212
            E +  F+  P S+ + L ++   Y   +        KLPP P KLPLIG+LH L   G L
Sbjct  2    EFQLSFVIIPFSIFILLHWLATKYYKPK----TIFYKLPPSPRKLPLIGNLHQLAFAGKL  57

Query  213  PHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYK  392
            PH  L+ LS+KYGP+MHLQLGEI+A+V+SS  LAK + KTHD+VFANRPK+ S  ++ Y 
Sbjct  58   PHHGLQKLSQKYGPLMHLQLGEINAVVVSSSNLAKEVMKTHDVVFANRPKLPSLKILAYG  117

Query  393  CTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTE  572
              D+ FSPYGDYWRQMRKICVLE+LS K V+SF+  R++E  + I SIK+   + INLT 
Sbjct  118  FKDIVFSPYGDYWRQMRKICVLEILSAKRVQSFSYIREDETKKFIESIKSFAGSKINLTT  177

Query  573  KICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKP  752
            +I    +S I +AA G  + EDQE F+ L+++A++++ G  + DLFPS K IH ++G K 
Sbjct  178  RIFSVINSIILRAALGD-KSEDQEEFVSLIRKAVAVSSGLELIDLFPSMKLIHVLTGMKK  236

Query  753  RLLKVHREVDKIFELIIEEHKDNMANRN-NNKAKDHEEDIVDVLL  884
             + K+H+ VDKI + ++ +H++  A  N  NK++  +ED+VDVLL
Sbjct  237  NVEKIHKRVDKILDNVVRKHQEKRARGNEGNKSEIEKEDLVDVLL  281



>ref|XP_011082374.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=517

 Score =   265 bits (678),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/295 (46%), Positives = 197/295 (67%), Gaps = 17/295 (6%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
            M   F  N  +V + +  +F +    ++S P    KLPPGP KLP+IG LH +   +LP 
Sbjct  1    MGFVFPLNLTAVALLVPVIFLLIKKWKKSKPVS-VKLPPGPKKLPIIGDLHLI--SALPF  57

Query  219  RTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCT  398
            R+ R+L+++YGPIMHL+LGE+  IV+SSP++AK + + HD  FA+RP+ ++  +++Y   
Sbjct  58   RSFRDLAKQYGPIMHLKLGEVPTIVVSSPEIAKEVLREHDPNFADRPEAIAMKIMWYNYI  117

Query  399  DVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKI  578
            D+AFSPYGDYWRQMRKIC++ELL+ K V+SF+S R +E+S LI SI+ S   P+NLTEKI
Sbjct  118  DIAFSPYGDYWRQMRKICIIELLNAKNVRSFSSIRNDEVSRLIKSIRLSSGEPVNLTEKI  177

Query  579  CWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRL  758
               TSS   +AAFG+V + D +  I L+KE + +AGGF +ADLFPS K I+ +S +K RL
Sbjct  178  FSLTSSITCRAAFGKVCK-DSDALIKLLKEGIQMAGGFEIADLFPSSKIINALSWSKLRL  236

Query  759  LKVHREVDKIFELIIEEHKDNMAN--RNNNKAKDHE-----------EDIVDVLL  884
            + + R++D I + II+EHK+N+A   R N   +  E           ED+VDV L
Sbjct  237  VMMRRKLDVILDDIIKEHKENLAKMARENGDGEGKESARRGNGEFGNEDLVDVFL  291



>sp|Q94FM7.2|C71DK_TOBAC RecName: Full=5-epiaristolochene 1,3-dihydroxylase; Short=NtEAH; 
AltName: Full=Cytochrome P450 71D20 [Nicotiana tabacum]
 gb|AAK62342.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=504

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 193/257 (75%), Gaps = 5/257 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWK+P++GS+ H++GG  PH  LR+L++KYGP+MHLQLGEISA+V++
Sbjct  23   KNSNSQSKKLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            S  +AK + KTHD+VFA+RPK+++ D++ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82   SRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAP--INLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            V+SF+S R++E+  LI SI++  S+   +N T++I WF SS   ++AFG+V +  Q+ F 
Sbjct  142  VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLK-GQDIFA  200

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANR  833
              ++E + LA GF V D+FP+ K++H +SG K +LL  H +VD I E +I EHK N+A  
Sbjct  201  KKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAG  260

Query  834  NNNKAKDHEEDIVDVLL  884
             +N A    ED++DVLL
Sbjct  261  KSNGALGG-EDLIDVLL  276



>ref|XP_004511999.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   265 bits (677),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 129/249 (52%), Positives = 183/249 (73%), Gaps = 3/249 (1%)
 Frame = +3

Query  144  KLPPGPWKLPLIGSLHHLVGGS-LPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKA  320
            KLPPGP KLPLIG+LH L   S LPH  L+ LS KYGP+MHLQLGEIS +V+SSP+LAK 
Sbjct  33   KLPPGPRKLPLIGNLHQLAFASKLPHHALKILSHKYGPLMHLQLGEISTVVVSSPKLAKE  92

Query  321  ITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSF  500
            + KTHD+VFANRPK++S  ++ Y   D+ FSPYGDYWRQMRKICVLE+LS K V+SF+  
Sbjct  93   VMKTHDVVFANRPKLLSPQILAYGFKDIVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYI  152

Query  501  RQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            R++E ++ I SIK+   + INLT +I    +S I++AAFG  + EDQ+ F+ L+++A+++
Sbjct  153  REDETTKFIKSIKSFSGSTINLTSRIFSVINSIISRAAFGD-KSEDQDEFVSLIRKAIAM  211

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMA-NRNNNKAKDH  857
            +GG  + DLFPS K I+ ++G K +  K+H+ +DKI + +I +H++     ++  K +  
Sbjct  212  SGGLELDDLFPSMKPINILTGMKSKFEKIHKRIDKILDNVIRKHEEKRTITKDEKKIEAE  271

Query  858  EEDIVDVLL  884
            +ED+VDVLL
Sbjct  272  KEDLVDVLL  280



>ref|XP_009801864.1| PREDICTED: LOW QUALITY PROTEIN: 5-epiaristolochene 1,3-dihydroxylase-like 
[Nicotiana sylvestris]
Length=504

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 193/257 (75%), Gaps = 5/257 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWK+P++GS+ H++GG  PH  LR+L++KYGP+MHLQLGEISA+V++
Sbjct  23   KNSNSQSKKLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            S  +AK + KTHD+VFA+RPK+++ D++ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82   SRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAP--INLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            V+SF+S R++E+  LI SI++  S+   +N T++I WF SS   ++AFG+V +  Q+ F 
Sbjct  142  VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLK-GQDIFA  200

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANR  833
              ++E + LA GF V D+FP+ K++H +SG K +LL  H +VD I E +I EHK N+A  
Sbjct  201  KKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAG  260

Query  834  NNNKAKDHEEDIVDVLL  884
             +N A    ED++DVLL
Sbjct  261  KSNGALGG-EDLIDVLL  276



>ref|XP_008246006.1| PREDICTED: cytochrome P450 71D11-like [Prunus mume]
Length=514

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 192/273 (70%), Gaps = 4/273 (1%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            ++ ++F+  V  I  +R ++  +    LPPGPWKLP+IG+LH L  GSLPH  LR+L++K
Sbjct  12   LAFLLFMIMVLKIGKIRGKTKYSA-SNLPPGPWKLPVIGNLHQL-AGSLPHHRLRDLAKK  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGE+SA+V+SS + AK + KTHDL+FA+RP +++  ++ Y  TD+ ++PYG+
Sbjct  70   YGPLMHLKLGEVSAVVVSSAEFAKEVMKTHDLIFASRPTILAAKILSYGSTDIGYAPYGE  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC LELLSTK V+SF   R+EE+  LI  I +   +PIN+T ++   T +  +
Sbjct  130  YWRQLRKICTLELLSTKRVQSFRPIREEEVVNLIQWIASRAGSPINITREVYSSTYTITS  189

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + AFG+  R DQE+FI +VKE +  A GF + D+FPS   +H +SG + +L ++H+E D+
Sbjct  190  RTAFGKKTR-DQEKFIYIVKEFVKAASGFALTDIFPSVSLLHLLSGMRLKLERLHKEADR  248

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I   II+EH+ ++    + +  + EED+VDVLL
Sbjct  249  ILGNIIKEHQRDLVTTKSGEG-EAEEDLVDVLL  280



>ref|XP_009803037.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=512

 Score =   265 bits (677),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 132/258 (51%), Positives = 186/258 (72%), Gaps = 4/258 (2%)
 Frame = +3

Query  114  RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIV  293
            R     +++Q+LPPGPW+LPLIGSLHHL+G   PHR  R+L+RKYGP+M+L+LGE+  ++
Sbjct  30   RNSETSSQKQRLPPGPWRLPLIGSLHHLIGAH-PHRIFRDLARKYGPVMYLELGEVPTVI  88

Query  294  ISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLST  473
            ISSP  AK   KTHDL F+NRP+  S  +V Y   D+AF+ YGDYW+QMRKIC++ELLS 
Sbjct  89   ISSPSAAKETLKTHDLAFSNRPQFTSTYIVMYNNKDIAFAEYGDYWKQMRKICIMELLSA  148

Query  474  KMVKSFNSFRQEELSELISSIKA-SGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERF  650
            +MVKSF+S R++ELS L+SS+++  G++ +N+TEKI  F SS   +  FG++ + D+E  
Sbjct  149  RMVKSFSSIRKDELSSLLSSVQSVKGTSEVNMTEKIVRFASSVTCRLVFGKLSK-DRELL  207

Query  651  IVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMAN  830
            I L+K+ L LAGG  V DLFPS K ++ +SG K RL+K+H+EVD + + I+ EH  + A+
Sbjct  208  IELMKKTLLLAGG-DVGDLFPSWKLLYKMSGAKSRLVKMHQEVDSVLDNIVNEHIRSRAD  266

Query  831  RNNNKAKDHEEDIVDVLL  884
             N    +   ED+VDV L
Sbjct  267  GNKGNGEYGGEDLVDVFL  284



>ref|XP_003537455.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42025.1| Cytochrome P450 71D8 [Glycine soja]
Length=504

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 197/282 (70%), Gaps = 11/282 (4%)
 Frame = +3

Query  57   FNPVSVI----VFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLPHR  221
            ++P+S++    VFL   + + T +++S+     KLPPGPW+LP+IG+LH L +  SLP +
Sbjct  3    YSPLSIVITFFVFLLLHWLVKTYKQKSS----HKLPPGPWRLPIIGNLHQLALAASLPDQ  58

Query  222  TLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTD  401
             L+ L RKYGP+MHLQLGEIS +V+SSP++A  + KTHD+ F  RP++++   + Y  TD
Sbjct  59   ALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATD  118

Query  402  VAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKIC  581
            +AF+PYGDYWRQ+RKIC LELLS K V+SF+  RQ+E  +LI SI +S  +PI+L+ K+ 
Sbjct  119  IAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIHSSAGSPIDLSGKLF  178

Query  582  WFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLL  761
                +T+++AAFG+   +DQ+ F+ LV++A+++ GGF V D+FPS K +H ++  K ++ 
Sbjct  179  SLLGTTVSRAAFGK-ENDDQDEFMSLVRKAITMTGGFEVDDMFPSLKPLHLLTRQKAKVE  237

Query  762  KVHREVDKIFELIIEEHKDNMAN-RNNNKAKDHEEDIVDVLL  884
             VH+  DKI E I+ +H +     +  N ++  +ED+VDVLL
Sbjct  238  HVHQRADKILEDILRKHMEKRTRVKEGNGSEAEQEDLVDVLL  279



>sp|O81974.1|C71D8_SOYBN RecName: Full=Cytochrome P450 71D8; AltName: Full=Cytochrome 
P450 CP7 [Glycine max]
 emb|CAA71517.1| putative cytochrome P450 [Glycine max]
Length=504

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/282 (45%), Positives = 197/282 (70%), Gaps = 11/282 (4%)
 Frame = +3

Query  57   FNPVSVI----VFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLPHR  221
            ++P+S++    VFL   + + T +++S+     KLPPGPW+LP+IG+LH L +  SLP +
Sbjct  3    YSPLSIVITFFVFLLLHWLVKTYKQKSS----HKLPPGPWRLPIIGNLHQLALAASLPDQ  58

Query  222  TLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTD  401
             L+ L RKYGP+MHLQLGEIS +V+SSP++A  + KTHD+ F  RP++++   + Y  TD
Sbjct  59   ALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATD  118

Query  402  VAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKIC  581
            +AF+PYGDYWRQ+RKIC LELLS K V+SF+  RQ+E  +LI SI +S  +PI+L+ K+ 
Sbjct  119  IAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIHSSAGSPIDLSGKLF  178

Query  582  WFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLL  761
                +T+++AAFG+   +DQ+ F+ LV++A+++ GGF V D+FPS K +H ++  K ++ 
Sbjct  179  SLLGTTVSRAAFGK-ENDDQDEFMSLVRKAITMTGGFEVDDMFPSLKPLHLLTRQKAKVE  237

Query  762  KVHREVDKIFELIIEEHKDNMAN-RNNNKAKDHEEDIVDVLL  884
             VH+  DKI E I+ +H +     +  N ++  +ED+VDVLL
Sbjct  238  HVHQRADKILEDILRKHMEKRTRVKEGNGSEAEQEDLVDVLL  279



>ref|XP_007146606.1| hypothetical protein PHAVU_006G054300g [Phaseolus vulgaris]
 gb|ESW18600.1| hypothetical protein PHAVU_006G054300g [Phaseolus vulgaris]
Length=508

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 190/283 (67%), Gaps = 5/283 (2%)
 Frame = +3

Query  39   MEHKFLFNPVSVI-VFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
            M    L+ P  +  +FL+ V      + R       K+P GP KLP+IG++++L+  S P
Sbjct  1    MAQLVLYFPALIFFIFLTLVVQKIGKKPRKTDETTSKIPHGPTKLPIIGNIYNLLF-SQP  59

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  LR+L+ KYGP+MHLQLGEIS IVISSP+ AK + KTHD+ FA RPK+++ D++ Y  
Sbjct  60   HIKLRDLALKYGPLMHLQLGEISTIVISSPECAKEVMKTHDINFATRPKVLAVDIMSYNS  119

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
            TD+AF+PYG+YWRQ+RKIC LELLS K V S+   R+EELS L+  I +   +PINLT+ 
Sbjct  120  TDIAFAPYGEYWRQLRKICTLELLSLKRVNSYQPIREEELSNLVKWIDSKKGSPINLTQA  179

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            +     S  +++AFG+ + +DQE FI+++K+ +  AGGF + DLFPS  W+ +V+G +P+
Sbjct  180  VLSSIYSIASRSAFGK-KYKDQENFILVIKKLIKAAGGFDIGDLFPSATWLQHVTGMRPK  238

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            L  +H++ D+I E II EHK+  A    N  +   ED+VDVL+
Sbjct  239  LENLHQQADQIMENIINEHKE--AKSEANDYEREAEDLVDVLI  279



>dbj|BAM68819.1| putative cytochrome P450 monooxygenase CYP71AV1 [Artemisia chamaemelifolia]
Length=495

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/274 (47%), Positives = 184/274 (67%), Gaps = 12/274 (4%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             + I   + +F +Y    RS   +     P PW+LP+IG +HHL+G +LPHR +  L+RK
Sbjct  13   TTTIALATILFFVYKFATRSKSTKNSL--PEPWRLPIIGHMHHLIG-TLPHRGVMELARK  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YG +MHLQLGE+S IV+SSP+ AK I  T+D+ FA RP+ ++ ++V Y  TD+A SPYG+
Sbjct  70   YGSLMHLQLGEVSTIVVSSPKWAKEILTTYDITFAYRPETLTGEIVAYHNTDIALSPYGE  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTI  602
            YWRQ+RKIC LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E +    ++ +
Sbjct  130  YWRQLRKICTLELLSVKKVKSFQSLREEECWNLVQQIKASGSGRPVNLSENVFKLIATIL  189

Query  603  AKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVD  782
             +AAFG+ R +DQE F  + KE    AGGF VAD+FPSKK++H++SG + RL  +H+++D
Sbjct  190  CRAAFGK-RIKDQEEFTEIAKEIAKQAGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLD  248

Query  783  KIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             +   ++ EH  N +++ N       E ++DVLL
Sbjct  249  NLINNLVAEHTINTSSKAN-------ETLLDVLL  275



>ref|XP_004506715.1| PREDICTED: cytochrome P450 71D9-like [Cicer arietinum]
Length=507

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 192/277 (69%), Gaps = 8/277 (3%)
 Frame = +3

Query  72   VIVFLSFVFCIYTLRRRSNPARRQK------LPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
            ++++LS++F    L       R++K      LPPGP KLP+IG++H+L+  S PH+ LR+
Sbjct  4    LVLYLSYIFSFVLLTLIVQKIRKKKSYSTYNLPPGPIKLPIIGNIHNLLS-SQPHKKLRD  62

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L++KYGP+MHLQLGE+S I+ISSP+ A  + KTHD+ FA+RP++++ +++ Y  T++AF+
Sbjct  63   LAKKYGPLMHLQLGEVSTIIISSPECASEVMKTHDINFASRPQILATEIMSYNTTNIAFA  122

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTS  593
            PYG+YWRQ+RKIC LELLS K V S+ S R+E    L+  I +   + +NLT+ +     
Sbjct  123  PYGNYWRQLRKICTLELLSLKRVNSYKSIREEVFFNLVERIGSENGSVVNLTQAVISSIY  182

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
            + +++ AFG    +DQE+FI ++K+++ +A GF + DLFPS KWI +V+G +P+L + HR
Sbjct  183  TIVSRTAFGN-ECKDQEKFISILKQSIKVASGFNLGDLFPSSKWIQHVTGLRPKLEEFHR  241

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + D+I E II EH++    +  +   + EED+VDVLL
Sbjct  242  QTDQIVENIINEHREAKYTKAKDDQGEVEEDLVDVLL  278



>gb|KEH26014.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=278

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/254 (48%), Positives = 182/254 (72%), Gaps = 5/254 (2%)
 Frame = +3

Query  81   FLSFVFCIYTLRRRSNPARR---QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
            F  F+F I  L+ R++  +    + +PPGPWKLP++G++ HLV  + P R LR+L++KYG
Sbjct  9    FTIFMFMIIALKIRNHYKKYDFGKNIPPGPWKLPILGNILHLVAIN-PPRRLRDLAKKYG  67

Query  252  PIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYW  431
            P+MHLQLGEI  IVISSP++AK + KTHD++FA+RP +++ D+  Y   D+AFSPYGDYW
Sbjct  68   PLMHLQLGEIFFIVISSPEVAKEVLKTHDIIFASRPHLLATDIASYNSMDIAFSPYGDYW  127

Query  432  RQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKA  611
            RQ+RKIC +ELLST+ VKS    RQ+E++ L+  I ++  +  NLTE++     +  +KA
Sbjct  128  RQLRKICAIELLSTRRVKSLWPVRQKEINFLLKKIASNEGSEFNLTEEVMSMMYTFTSKA  187

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+ +  +QE FI +VK+ + LAGGF + DLFPS +WI  +SG KP+L K+ ++VD+I 
Sbjct  188  AFGK-KYLEQEEFISVVKQLIKLAGGFYIGDLFPSAQWIQNISGLKPKLEKLSQQVDRIL  246

Query  792  ELIIEEHKDNMANR  833
              II +HK+ ++ R
Sbjct  247  GHIITDHKEKISRR  260



>gb|KEH34017.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=504

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 190/277 (69%), Gaps = 8/277 (3%)
 Frame = +3

Query  72   VIVFLSFVFCIYTLRRRSNPARRQK------LPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
            +I++L ++F    L         +K      +PPGP KLP+IG++H+L+  S PHR LR+
Sbjct  4    LILYLPYIFSFILLTLVVQKIGNKKSYSTYNIPPGPIKLPIIGNIHNLLT-SQPHRKLRD  62

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L++KYGP+MHLQLGE+SA+VISSP+ A  + KTHD+ FA+RP++++ +++ Y  T++AF+
Sbjct  63   LAKKYGPLMHLQLGEVSAMVISSPECAGEVMKTHDIHFASRPQILATEIMSYNSTNIAFA  122

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTS  593
            PYG+YWRQ+RKIC LELLS K V S+   R+E  S L+  I +    PIN+TE +     
Sbjct  123  PYGNYWRQLRKICTLELLSLKRVNSYQPIREEVFSNLVKWIASRDGIPINITEAVRSSIY  182

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
            + +++AAFG    +DQ++FI +VK+++ +AGGF + DLFPS KW+  V+G +P+L + HR
Sbjct  183  TIVSRAAFGN-ECKDQDKFISVVKQSIKVAGGFDLGDLFPSAKWLQLVTGMRPKLERFHR  241

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + D+I E II EHK+    +  +     EED+VDVLL
Sbjct  242  QTDQILENIINEHKEEKYTKAKDDQGKVEEDLVDVLL  278



>ref|XP_007020557.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY12082.1| Cytochrome P450, putative [Theobroma cacao]
Length=505

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/273 (48%), Positives = 189/273 (69%), Gaps = 6/273 (2%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            ++ ++FLS +  +    +   P+  Q+LPPGPWKLP IG++H L GGSLPH TLRNL+ K
Sbjct  12   LTTLLFLSMIARVGKALKDKKPS--QRLPPGPWKLPFIGNIHQL-GGSLPHCTLRNLALK  68

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            +GP+MHLQLG +S +V+SSP+ A+   + +D+ FA+RP  ++  ++ Y CT++ FSPYG 
Sbjct  69   HGPLMHLQLGAVSTVVLSSPEFAEEAMRKNDVTFASRPYQLAPGIISYDCTNIVFSPYGS  128

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YW+Q+RKICV+ELLS++ VKSF   R+E +S LI ++ +S S+PINL++KI   T ST A
Sbjct  129  YWKQLRKICVMELLSSQRVKSFKRVREEMVSSLIKTMSSSQSSPINLSQKIFSLTYSTTA  188

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            K AFG  + + QE F+ ++ E   LA G  +ADL+PS K +  +SG + +L K+HRE D 
Sbjct  189  KVAFGS-KCKGQETFVSVITEVNKLATGLTLADLYPSVKALQMISGIRTKLEKLHREADG  247

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I E +I EHK+    R  N +   E+DIVD+LL
Sbjct  248  ILENVIAEHKER--PRKENGSGGDEKDIVDMLL  278



>ref|XP_004304108.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=516

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 179/257 (70%), Gaps = 6/257 (2%)
 Frame = +3

Query  114  RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIV  293
            R  +N +    LPPGPWKLP+IG++H L+G +LPHR LR+L++KYGP+MHL+LGE+S IV
Sbjct  28   RGHNNNSSASNLPPGPWKLPIIGNIHQLIG-TLPHRGLRDLAKKYGPVMHLRLGEVSTIV  86

Query  294  ISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLST  473
            +SS +LAK + KTHD++FA+RP+++   ++YY   D+AF+PYGDYWR++RKIC  ELLS 
Sbjct  87   VSSAELAKEVMKTHDIIFASRPQVLVTRILYYDSKDIAFAPYGDYWRELRKICTQELLSA  146

Query  474  KMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            K V+S+   R++E+  LI  I +    PINLT+K+   T S  ++AAFG ++ +DQE FI
Sbjct  147  KRVQSYRPIREKEVLNLIKWIGSRAGLPINLTQKVLSATYSITSQAAFG-IQCKDQEEFI  205

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANR  833
              VK+ +    GF VAD+FPS K +H +SG  P+L ++ ++ D+I E II+EH       
Sbjct  206  YAVKDIIKAVSGFNVADVFPSFKLLHRISGVHPKLQRLQKQADRILENIIKEH----IQA  261

Query  834  NNNKAKDHEEDIVDVLL  884
                  D  +D+VDVLL
Sbjct  262  TTTAKSDEAQDLVDVLL  278



>ref|XP_011081934.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=501

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/283 (48%), Positives = 196/283 (69%), Gaps = 9/283 (3%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFC-IYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
            ME +   +  ++++F SF+F  I    +  +P + +KLPP P +LP+IG LHHLVGG LP
Sbjct  1    MEIQLPVSFTTLLLFSSFIFLLIRAWMKPKSPRKYEKLPPSPPQLPVIGHLHHLVGG-LP  59

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  LR +++KYGP+++L+LGE+SA+VISS +  K + K  D   A+RP+ +   +++Y  
Sbjct  60   HHALRRVAQKYGPVLYLKLGEVSAVVISSREATKEVVKVQDPACADRPESIGSKIMWYDY  119

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
            TD+AFS Y +YWRQMRKIC+LELLS K VKSF S RQ+E+S L+ S+++S    INLTEK
Sbjct  120  TDIAFSAYNEYWRQMRKICILELLSAKNVKSFGSIRQDEVSRLMKSLQSSSGQAINLTEK  179

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            +  FTSS   +AAFG+V R D++  I ++K+A+++AGGF +ADLFPS K +H +S  K +
Sbjct  180  VFAFTSSITCRAAFGKVMR-DRDVLIAMLKKAVTMAGGFELADLFPSSKLLHVLSWNKYK  238

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            LL++ R++D I + I+EEHK   +           EDIVDVLL
Sbjct  239  LLRMRRKLDTILDAILEEHKLKQSGEFGG------EDIVDVLL  275



>gb|AIA09036.1| germacrene A oxidase [Cynara cardunculus var. altilis]
 gb|AIA09037.1| germacrene A oxidase [Cynara cardunculus var. scolymus]
Length=486

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 189/271 (70%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            IV  S +F ++ L  R  P   + L P PW+LP+IG +HHL+G ++PHR + +LSRKYG 
Sbjct  7    IVVASILFILFKLATR--PKSNKNLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLSRKYGS  63

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+S IV+SSP+ AK I  T+D+  ANRP+ ++ +++ Y  TD+  +PYG+YWR
Sbjct  64   LMHLQLGEVSTIVVSSPKWAKEILTTYDITLANRPETLTGEIIAYHNTDIVLAPYGEYWR  123

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RK+C LELLS K VKSF S R+EE  +L+  +KASGS  P++L+E I    ++ +++A
Sbjct  124  QLRKLCTLELLSVKKVKSFQSLREEECWDLVQEVKASGSGRPVDLSENIFKMIATILSRA  183

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+ F  +VKE L   GGF VAD+FPSKK++H++SG + RL  +H+++D + 
Sbjct  184  AFGKGIK-DQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNLI  242

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              I+ EH  N ++++N       E ++DVLL
Sbjct  243  NNIVSEHPGNTSSKSN-------ETLLDVLL  266



>gb|KHN08718.1| Cytochrome P450 71D8 [Glycine soja]
Length=501

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 187/273 (68%), Gaps = 1/273 (0%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRK  245
            S ++ +   F ++ L +    +  QKLPPGP KLP+IG+LH L   GSLPH  LR+L++K
Sbjct  5    SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGEISA+V SSP++AK I KTHD+ F  RP ++   ++ Y    +AF+PYGD
Sbjct  65   YGPLMHLQLGEISAVVASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            +WRQMRK+C  ELLSTK V+SF S R++E ++ I SI+ S  +PINLT +I     ++I+
Sbjct  125  HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + AFG + +E  E  + L+++ +   GGF +AD+FPS  ++++++G   RL K+H++VDK
Sbjct  185  RVAFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + E II EH++       + A+  ++D +D+LL
Sbjct  245  VLENIIREHQEKNKIAKEDAAELEDQDFIDLLL  277



>ref|XP_002523467.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38926.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/267 (45%), Positives = 189/267 (71%), Gaps = 3/267 (1%)
 Frame = +3

Query  84   LSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMH  263
            L F+F ++ + ++SN   +  LPPGPWKLP+IG++H+++G SLPH +L NL++K+GPIMH
Sbjct  14   LLFIFTVFLIMKKSN-IHKLPLPPGPWKLPIIGNIHNVLG-SLPHHSLHNLAKKFGPIMH  71

Query  264  LQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMR  443
            LQLGE++AI++SSP++AK I KTHD++FA+RP +++  +++   TDVAF+PYG++WRQMR
Sbjct  72   LQLGEVNAIIVSSPEIAKEIMKTHDVIFASRPFVVALKIIFGNTTDVAFAPYGEFWRQMR  131

Query  444  KICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGR  623
            KICV+E+LS K V+SF   R+EE+   I  I  S  + +N+++ +  +  + I +AAFG+
Sbjct  132  KICVVEILSAKRVQSFRPIREEEILNAIKEITCSEGSMVNISKVLLSYAYNVILRAAFGK  191

Query  624  VRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELII  803
            +  E+QE  I L+K+A  ++ GF +ADLFPS K IH + G + R  + ++E DKI + +I
Sbjct  192  I-TEEQEALIPLIKDAAEVSAGFSIADLFPSIKLIHNLDGMRSRTERAYQEADKIIDTVI  250

Query  804  EEHKDNMANRNNNKAKDHEEDIVDVLL  884
              HK      +N  +     D++DVLL
Sbjct  251  NYHKLRRKASSNKISDQESNDLIDVLL  277



>ref|XP_007213422.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
 gb|EMJ14621.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
Length=475

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 193/273 (71%), Gaps = 4/273 (1%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            ++ ++F+  V  I  +R ++       LPPGPWKLP+IG+LH L  GSLPH+ LR+L++K
Sbjct  12   LAFLLFMIMVLKIGKIRGKTK-CSASNLPPGPWKLPVIGNLHQL-AGSLPHQRLRDLAKK  69

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGE+S +V+SS + AK + KTHDL+FA+RP +++  ++ Y  T + F+PYG+
Sbjct  70   YGPLMHLKLGEVSTVVVSSAEFAKEVMKTHDLIFASRPHVLAPRILSYDFTSIVFAPYGE  129

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWR++RKIC LELLS K V+S+   R+EE+ +LI  I +   +PINLT++I   T +  +
Sbjct  130  YWRKLRKICTLELLSAKRVRSYRPIREEEVRKLIKLIASRAGSPINLTQEIYSSTFTITS  189

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            +AAFG+  R DQE+FI +VKE    A GF +AD+FPS   +H +SG + ++ ++H+E D+
Sbjct  190  RAAFGKKNR-DQEKFIYIVKEVAKAASGFALADVFPSVSLLHLLSGMRHKIERLHKEADR  248

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I   II+EH+ +M    +++  + EED+VDVLL
Sbjct  249  IMGNIIKEHQRDMVTTKSSEG-EAEEDLVDVLL  280



>ref|XP_003600328.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70579.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/274 (46%), Positives = 191/274 (70%), Gaps = 3/274 (1%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             S+   L FVF    +  + + +  Q LPPGP KLP+IG++H+L+G SLPH  LR+LS K
Sbjct  9    TSIFSLLMFVFIANKILTKKSESSAQNLPPGPLKLPIIGNIHNLIG-SLPHHRLRDLSTK  67

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGE+S IV+SS + AK + K HDLVFA+RP + +  ++ Y    +AF+PYGD
Sbjct  68   YGPLMHLKLGEVSTIVVSSAEYAKEVMKNHDLVFASRPPIQASKIMSYDSLGLAFAPYGD  127

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWR +RKIC LELLS+K V+SF   R EE++ LI  I +   + IN T+++    S+  +
Sbjct  128  YWRNLRKICTLELLSSKRVQSFQPIRSEEVTNLIKWISSKEGSQINFTKEVFSTISTITS  187

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + AFG+  +E+Q +FI +V++A+ +AGGF + DL+PS + +  +SG KP+L K+H++ D 
Sbjct  188  RTAFGKKCKENQ-KFISIVRDAIKIAGGFDLGDLYPSCRLLQNISGLKPKLEKLHKQADL  246

Query  786  IFELIIEEHKD-NMANRNNNKAKDHEEDIVDVLL  884
            I + II+EH++ N +  N N+ ++ EED+VDVLL
Sbjct  247  IMQNIIDEHREVNKSRVNENQGEEVEEDLVDVLL  280



>sp|D5JBW9.1|GAO_SAUCO RecName: Full=Germacrene A oxidase; Short=SlGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Saussurea costus]
 gb|ADF43081.1| germacrene A oxidase [Saussurea costus]
Length=488

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 188/271 (69%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + VF ++ L  R  P   +KL P PW+LP+IG +HHL+G ++PHR + +L+RKYG 
Sbjct  9    IAVATIVFVLFKLATR--PKSNKKLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLARKYGS  65

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+S IV+SSP+ AK I  THD+ FANRP+ ++ +++ Y  TD+  +PYG+YWR
Sbjct  66   LMHLQLGEVSTIVVSSPKWAKEILTTHDITFANRPETLTGEIIAYHNTDIVLAPYGEYWR  125

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RK+C LELLS K VKSF S R+EE   L+  +K SGS  P++L+E I    ++ +++A
Sbjct  126  QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEVKESGSGRPVDLSENIFKMIATILSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+ F  +VKE L   GGF VAD+FPSKK++H++SG + RL  +H+++D + 
Sbjct  186  AFGKGIK-DQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNLI  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              I+ EH  N ++++N       E ++DV+L
Sbjct  245  NNIVAEHPGNNSSKSN-------ETLLDVML  268



>ref|XP_003535170.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 ref|XP_003535172.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 ref|XP_003537208.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN08716.1| Cytochrome P450 71D8 [Glycine soja]
 gb|KHN13522.1| Cytochrome P450 71D8 [Glycine soja]
 gb|KHN28263.1| Cytochrome P450 71D8 [Glycine soja]
Length=501

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/273 (45%), Positives = 187/273 (68%), Gaps = 1/273 (0%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRK  245
            S ++ +   F ++ L +    +  QKLPPGP KLP+IG+LH L   GSLPH  LR+L++K
Sbjct  5    SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGEISA+V SSP++AK I KTHD+ F  RP ++   ++ Y    +AF+PYGD
Sbjct  65   YGPLMHLQLGEISAVVASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            +WRQMRK+C  ELLSTK V+SF S R++E ++ I SI+ S  +PINLT +I     ++I+
Sbjct  125  HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + AFG + +E  E  + L+++ +   GGF +AD+FPS  ++++++G   RL K+H++VDK
Sbjct  185  RVAFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + E II EH++       + A+  ++D +D+LL
Sbjct  245  VLENIIREHQEKNKIAKEDGAELEDQDFIDLLL  277



>ref|XP_006346274.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/252 (50%), Positives = 183/252 (73%), Gaps = 4/252 (2%)
 Frame = +3

Query  132  ARRQ-KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQ  308
            A++Q KLPPGPW+LP IGSLHHL+G    H TLRN +++YGP+M+LQLGEI  ++ISSP 
Sbjct  47   AKKQIKLPPGPWRLPFIGSLHHLIGRGPLHCTLRNFAQRYGPLMYLQLGEIPVVIISSPT  106

Query  309  LAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKS  488
            +AK +  THDL F++RP+ MS ++ +Y   ++AF P+ +YW+QMRKIC ++LLS KMVKS
Sbjct  107  IAKELLTTHDLAFSDRPQSMSTNITFYNNKNIAFCPHDNYWKQMRKICNVQLLSVKMVKS  166

Query  489  FNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKE  668
            F + R++E+S  +SSI+++  +PIN+TEKI WFT+S    A FG++ + +++ FI L+K+
Sbjct  167  FGAIRKDEISSPVSSIRSTKGSPINMTEKIFWFTNSVTCSAPFGKIFK-NRDEFIKLLKD  225

Query  669  ALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKA  848
             + L  GF VAD F    +   +SG + RL+ VH++VD+I E I++EH +N A RN    
Sbjct  226  MVILVSGFDVADFFLLGSY--KLSGVESRLMNVHKKVDEIMEDILKEHLENKATRNKGIG  283

Query  849  KDHEEDIVDVLL  884
            +   ED+VDVLL
Sbjct  284  EFGGEDLVDVLL  295



>gb|KEH34016.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/246 (48%), Positives = 177/246 (72%), Gaps = 2/246 (1%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAIT  326
            +PPGP KLP+IG++H+L+  S PHR LR+L++KYGP+MHLQLGE+S +VISSP+ A  + 
Sbjct  1    MPPGPIKLPIIGNIHNLLS-SQPHRKLRDLAKKYGPVMHLQLGEVSNMVISSPECASEVM  59

Query  327  KTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQ  506
            KTHD+ F++RP+++  +++ Y  T +AF+PYG+YWRQ+RKIC LELLS K V S+   R+
Sbjct  60   KTHDIHFSSRPQILVTEIISYNSTSIAFAPYGNYWRQIRKICTLELLSLKRVNSYQPIRE  119

Query  507  EELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAG  686
            E LS L+  I +    PIN++E +     + ++++AFG    +DQE+FI LV++ + +AG
Sbjct  120  EVLSNLVKWIASQKGTPINISEAVLSTMYTIVSRSAFGN-ECKDQEKFISLVRQTIKVAG  178

Query  687  GFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEED  866
            GF + DLFPS KW+  ++G +P+L ++HR+ D+I E II EHK+    +  +     EED
Sbjct  179  GFNLGDLFPSAKWLQRITGLRPKLERIHRQTDQILENIINEHKEEKYTKAKDDQGRVEED  238

Query  867  IVDVLL  884
            +VDVLL
Sbjct  239  LVDVLL  244



>ref|XP_007154033.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
 gb|ESW26027.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
Length=511

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/284 (48%), Positives = 194/284 (68%), Gaps = 16/284 (6%)
 Frame = +3

Query  57   FNPVSVIVFLSFVFCIYTLRRR-----SNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPH  218
            F P S++VF  F+  ++   R      +  +   KLPPGPWKLP+IG+LH L    +LPH
Sbjct  3    FQP-SLLVFAPFLLLLFWFTRIYKNKITVKSVVHKLPPGPWKLPVIGNLHQLARADTLPH  61

Query  219  RTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCT  398
             TL++LS KYGP+MHLQLGEISA+++SSP +AK I KTHDL F  RP+++   ++ Y  T
Sbjct  62   HTLQSLSHKYGPLMHLQLGEISAVIVSSPDMAKEIMKTHDLNFVQRPQLLCPKILAYGST  121

Query  399  DVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIK--ASGSAPINLTE  572
            D+AF+PYG+YWRQMRKIC LELLS K V SF+  R+EE+++LI SI+  A   + +N++E
Sbjct  122  DIAFAPYGEYWRQMRKICTLELLSAKRVHSFSFIREEEVAKLIRSIQLCACAGSQVNVSE  181

Query  573  KICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKP  752
             +  F S+ +++ AFG+ + E     + L+K+   LAGGF +ADLFPS K +H+++  K 
Sbjct  182  NVFSFLSTLVSRTAFGK-KSEKGNELLCLLKKGAELAGGFDLADLFPSLKAVHFLTRMKT  240

Query  753  RLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            +L  +H+E+DKI E II EH+    +RN     D EE++VDVLL
Sbjct  241  KLENMHKELDKILESIISEHQSK--HRNG----DAEENLVDVLL  278



>ref|XP_008385787.1| PREDICTED: cytochrome P450 71D11-like [Malus domestica]
Length=512

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 191/278 (69%), Gaps = 11/278 (4%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTL----RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
            S  V  +F+  + T+    +R         LPPGPWKLP IG++H LVG S PH  LR L
Sbjct  7    SFQVLFTFLLVVITVLKIAKRGETKDSAVNLPPGPWKLPFIGNIHQLVG-SQPHHGLRKL  65

Query  237  SRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSP  416
            ++KYGP+MHLQLGE+S +V+SS + AK + KTHD+VFA+RP +++  ++ Y+ T++AF+ 
Sbjct  66   AKKYGPLMHLQLGEVSTVVVSSAEYAKEVMKTHDVVFASRPHLLASRIMSYESTNIAFAS  125

Query  417  YGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSS  596
             GDYWRQ+RKIC LELLSTK V+ F   R+EE+  LI+ I ++ S+PINLTEKI   T +
Sbjct  126  CGDYWRQLRKICTLELLSTKRVQGFRPLREEEVGNLITWIGSNASSPINLTEKIYSSTYT  185

Query  597  TIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHRE  776
              ++AAFG+ + ED E+FI  VKE++++A GF +AD+FPS K ++ + G +P L ++ + 
Sbjct  186  FTSRAAFGK-KSEDHEKFIDAVKESITVAAGFDLADVFPSAKLLNLIGGIRPTLERLKKV  244

Query  777  VDKIFELIIEEHKDNMANRNNNKAKDHE--EDIVDVLL  884
             D+I E II EHK     R+  K+ + E  ED+VDVLL
Sbjct  245  TDRIMENIINEHK---KXRSTTKSGEGEAGEDLVDVLL  279



>ref|XP_003537212.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=501

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 187/273 (68%), Gaps = 1/273 (0%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRK  245
            S ++ +   F ++ L +    +  QKLPPGP KLP+IG+LH L   GSLPH  LR+L++K
Sbjct  5    SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGEISA++ SSP++AK I KTHD+ F  RP ++   ++ Y    +AF+PYGD
Sbjct  65   YGPLMHLQLGEISAVIASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            +WRQMRK+C  ELLSTK V+SF S R++E ++ I SI+ S  +PINLT +I     ++I+
Sbjct  125  HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + AFG + +E  E  + L+++ +   GGF +AD+FPS  ++++++G   RL K+H++VDK
Sbjct  185  RVAFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + E II EH++       + A+  ++D +D+LL
Sbjct  245  VLENIIREHQEKNKIAKEDGAELEDQDFIDLLL  277



>ref|XP_011087047.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=498

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 181/250 (72%), Gaps = 7/250 (3%)
 Frame = +3

Query  138  RQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAK  317
            R KLPPGPWKLPLIGSLHHL GGS PH  LRNL+RKYGPIMHLQLGEISA+VIS+P++AK
Sbjct  30   RPKLPPGPWKLPLIGSLHHLSGGSGPHYALRNLARKYGPIMHLQLGEISAVVISAPRVAK  89

Query  318  AITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNS  497
             +  THDL F++R ++ S  ++ Y   D+  +PYGDYW+QMR+IC  ELLS+K V+SF++
Sbjct  90   ELLTTHDLAFSSRARLPSLAIITYNYQDMVMAPYGDYWKQMRRICFSELLSSKNVRSFST  149

Query  498  FRQEELSELISSIKASGS-APINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEAL  674
             R EE   L+ SI++  S  P++L +K+  +T+  + +AAFG+  R  ++ F+ L+ E  
Sbjct  150  IRDEEAVNLVESIRSHPSLMPMDLAQKVLSYTNDVLCRAAFGK-SRGGKDEFLPLIIEFG  208

Query  675  SLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKD  854
            + +GGF VADLFPS  ++  V+G + +L+K+H ++D++  +II+EH + +  R    A  
Sbjct  209  TSSGGFDVADLFPSITFLPAVTGLRTKLMKLHHKLDQVLNVIIDEHMERL--RFGQHA--  264

Query  855  HEEDIVDVLL  884
             EEDIVDVLL
Sbjct  265  -EEDIVDVLL  273



>ref|XP_006357930.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=498

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 184/251 (73%), Gaps = 2/251 (1%)
 Frame = +3

Query  135  RRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLA  314
            ++ +LPPGPW+LP IGSLHHL+G    H  LRNL+++YGP+M+LQLGEI  ++ISS  +A
Sbjct  27   KQTRLPPGPWRLPFIGSLHHLIGRGHLHPNLRNLAQRYGPLMYLQLGEIPVVIISSSTIA  86

Query  315  KAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFN  494
            K +  THDL FA+RP+  S  +++Y   D+ FSPY +Y +QMRKIC ++L S KMVKSF+
Sbjct  87   KELLTTHDLAFADRPQSTSTTIIFYNNKDIVFSPYDNYCKQMRKICKVQLFSAKMVKSFS  146

Query  495  SFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEAL  674
            + R++E+S LISSI+++  +PIN+TEKI WFT+S    AAFG++ + D++ FI L+K+ L
Sbjct  147  TIRKDEISSLISSIRSTRDSPINMTEKIFWFTNSVTCSAAFGKMFK-DRDEFIKLLKDIL  205

Query  675  SLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKD  854
             LA GF V DLFPS K +H +SG + RL+  H++VD+I E I++EH +N ANRN      
Sbjct  206  ILASGFCVTDLFPSWKLLHKLSGAESRLMNAHKKVDEIMEDILKEHLENKANRNKGIGDQ  265

Query  855  H-EEDIVDVLL  884
               ED+VDVLL
Sbjct  266  FGGEDLVDVLL  276



>gb|AIA09035.1| germacrene A oxidase [Cynara cardunculus var. scolymus]
Length=486

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 188/271 (69%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            IV  S +F ++ L  R  P   + L P PW+LP+IG +HHL+G ++PHR + +LSRKYG 
Sbjct  7    IVVASILFILFKLATR--PKSNKNLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLSRKYGS  63

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+S IV+SSP+ AK I  T+D+  ANRP+ ++ +++ Y  TD+  +PYG+YWR
Sbjct  64   LMHLQLGEVSTIVVSSPKWAKEILTTYDITLANRPETLTGEIIAYHNTDIVLAPYGEYWR  123

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RK+C LELLS K VKSF S R+EE   L+  +KASGS  P++L+E I    ++ +++A
Sbjct  124  QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEVKASGSGRPVDLSENIFKMIATILSRA  183

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+ F  +VKE L   GGF VAD+FPSKK++H++SG + RL  +H+++D + 
Sbjct  184  AFGKGIK-DQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNLI  242

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              I+ EH  N ++++N       E ++DVLL
Sbjct  243  NNIVAEHPGNTSSKSN-------ETLLDVLL  266



>gb|EYU21988.1| hypothetical protein MIMGU_mgv1a004711mg [Erythranthe guttata]
Length=513

 Score =   263 bits (671),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/293 (45%), Positives = 196/293 (67%), Gaps = 14/293 (5%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
            M+  F +N  ++ +F+  +  +    R+S     + LPPGP  LP+IG LHHL   +LP 
Sbjct  1    MDFGFSWNFTTLALFVPVILLLIRKWRKSKSDSVKNLPPGPTPLPIIGDLHHLT--ALPF  58

Query  219  RTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCT  398
            R+ R LS+KYGP+MHL+LG++S IV+SSP++AK + K HD  FA+RP+ +  ++++Y  T
Sbjct  59   RSFRELSKKYGPLMHLKLGQVSTIVVSSPEIAKQMLKEHDPSFADRPRSVGIEIMWYDYT  118

Query  399  DVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIK--ASGSAPINLTE  572
            ++AFSPYG+YWRQMRKICV+ELLS K V+SF S R++E+S L+ S++  A+   PINLT+
Sbjct  119  NIAFSPYGNYWRQMRKICVIELLSPKSVRSFASIRKDEVSGLVDSLRRCAASGEPINLTD  178

Query  573  KICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKP  752
            KI    SS   +AAFG+V + D E  I L+KE + +A GF ++DLFP  K I+ +S  + 
Sbjct  179  KIFSLMSSITCRAAFGKVSK-DNEALIKLLKEGIEMASGFEISDLFPGSKIINALSKGRF  237

Query  753  RLLKVHREVDKIFELIIEEHKDNMANRNNNKAK---------DHEEDIVDVLL  884
            +LLK+ R++D+I + II+EHK N+A      A+         D  ED+VDV L
Sbjct  238  KLLKMRRKLDEILDSIIDEHKANLAKMATENAESAVKRGNGDDGNEDLVDVFL  290



>gb|KDP39257.1| hypothetical protein JCGZ_01014 [Jatropha curcas]
Length=485

 Score =   261 bits (668),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 181/258 (70%), Gaps = 5/258 (2%)
 Frame = +3

Query  114  RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIV  293
            R+       + LPPGP KLP+IG++H L+G SLPH  LR+L++K+G IMHLQLGE+S IV
Sbjct  3    RKSKTKEATKNLPPGPRKLPIIGNIHQLIG-SLPHHCLRDLAKKHGGIMHLQLGEVSNIV  61

Query  294  ISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLST  473
            ISSP+ AK + KTHD+VFA RP +++  ++ Y  TD+AFSPY DYWRQ+RKIC+LELLS 
Sbjct  62   ISSPEAAKEVMKTHDIVFAQRPFLLAASIISYNFTDIAFSPYADYWRQLRKICILELLSA  121

Query  474  KMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            K V+SF   R+EE+S LI++I +S     N + K+   T    A+A FG  + EDQE FI
Sbjct  122  KRVQSFRFIREEEVSNLITAISSSSGKAFNFSRKLFSLTYGIAARATFGE-KCEDQEEFI  180

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHK-DNMAN  830
             +V+E   +AGGF +ADLFPS K++H +SG + RL+++ +E D++   II++H+  N   
Sbjct  181  PIVEEITEVAGGFSLADLFPSVKFLHSISGMRSRLIRLQKEADRVIGNIIDDHRAKNKTG  240

Query  831  RNNNKAKDHEEDIVDVLL  884
            +   + +D  +D+VDVLL
Sbjct  241  KVGGEGQD--DDLVDVLL  256



>ref|XP_003551489.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
 gb|AGB55872.1| flavonoid 6-hydroxylase 2 [Glycine max]
 gb|AGB55873.1| flavonoid 6-hydroxylase 2 [Glycine max]
Length=498

 Score =   262 bits (669),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/273 (44%), Positives = 189/273 (69%), Gaps = 3/273 (1%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             S++    F+F  + +  +  PA    LPPGPWK+P+IG++H++VG SLPH  LR+LS K
Sbjct  9    TSILSIFIFMFLGHKIITK-KPASTPNLPPGPWKIPIIGNIHNVVG-SLPHHRLRDLSAK  66

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGE+S IV+SSP+ AK +  THDL+F++RP +++  ++ Y    ++F+PYGD
Sbjct  67   YGPLMHLKLGEVSTIVVSSPEYAKEVLSTHDLIFSSRPPILASKIMSYDSMGMSFAPYGD  126

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWR++RKIC  ELLS+K V+SF   R EEL+  I  I +   +PINLT+++    S+ ++
Sbjct  127  YWRRLRKICASELLSSKRVQSFQPIRGEELTNFIKRIASKEGSPINLTKEVLLTVSTIVS  186

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + A G   R D ++FI  V+EA   AGGF + DL+PS +W+ ++SG KP+L K H++ D+
Sbjct  187  RTALGNKCR-DHKKFISAVREATEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADR  245

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I + I+ EH++  ++  + + ++  +D+VDVL+
Sbjct  246  IMQNIVNEHREAKSSATHGQGEEVADDLVDVLM  278



>gb|AGB55871.1| flavonoid 6-hydroxylase 2 [Glycine max]
Length=498

 Score =   261 bits (668),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 194/283 (69%), Gaps = 6/283 (2%)
 Frame = +3

Query  36   EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
            +++  +  + +S+ +F+     I T +  S P     LPPGPWK+P+IG++H++VG SLP
Sbjct  2    DLQTLYFTSILSIFIFMFLGHKIITKKPTSTP----NLPPGPWKIPIIGNIHNVVG-SLP  56

Query  216  HRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKC  395
            H  LR+LS KYGP+MHL+LGE+S IV+SSP+ AK +  THDL+F++RP +++  ++ Y  
Sbjct  57   HHRLRDLSAKYGPLMHLKLGEVSTIVVSSPEYAKEVLSTHDLIFSSRPPILASKIMSYDS  116

Query  396  TDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEK  575
              ++F+PYGDYWR++RKIC  ELLS+K V+SF   R EEL+  I  I +   +PINLT++
Sbjct  117  MGMSFAPYGDYWRRLRKICASELLSSKRVQSFQPIRGEELTNFIKRIASKEGSPINLTKE  176

Query  576  ICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPR  755
            +    S+ +++ A G   R D ++FI  V+EA   AGGF + DL+PS +W+ ++SG KP+
Sbjct  177  VLLTVSTIVSRTALGNKCR-DHKKFISAVREATEAAGGFDLGDLYPSAEWLQHISGLKPK  235

Query  756  LLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            L K H++ D+I + I+ EH++  ++  + + ++  +D+VDVL+
Sbjct  236  LEKYHQQADRIMQNIVNEHREAKSSATHGQGEEVADDLVDVLM  278



>gb|KEH34013.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score =   262 bits (669),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 173/246 (70%), Gaps = 2/246 (1%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAIT  326
            LP GP KLP+IG++H+L+  S PHR L +L++KYGP+MHLQLGE+S IVISS + AK + 
Sbjct  37   LPKGPRKLPIIGNIHNLLS-SQPHRKLSDLAKKYGPLMHLQLGEVSTIVISSAEFAKEVM  95

Query  327  KTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQ  506
            KTHD+ FA RPK+++ D++ Y  T ++FSPYGDYWRQ RKIC LELLS K V S+   R+
Sbjct  96   KTHDIHFATRPKVLAIDIMSYNSTSISFSPYGDYWRQARKICTLELLSLKRVNSYQPIRE  155

Query  507  EELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAG  686
            E  S LI SI +   +PIN TE +     + +++AAFG  + +DQE+FI +VKE++ +A 
Sbjct  156  EVFSNLIKSIASENGSPINFTEAVLSSIYTIVSRAAFGN-KCKDQEKFISVVKESVKIAA  214

Query  687  GFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEED  866
            GF + D FPS KW+ YV+G +P++ K H++ D+I E II+EHK     +      +  ED
Sbjct  215  GFDLGDSFPSSKWLQYVTGLRPKIEKFHQQTDEILENIIDEHKREKYTKVKGDQGEVAED  274

Query  867  IVDVLL  884
            +VD+LL
Sbjct  275  LVDILL  280



>gb|KHN43612.1| Cytochrome P450 71D9 [Glycine soja]
Length=481

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 180/252 (71%), Gaps = 2/252 (1%)
 Frame = +3

Query  129  PARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQ  308
            PA    LPPGPWK+P+IG++H++VG SLPH  LR+LS KYGP+MHL+LGE+S IV+SSP+
Sbjct  12   PASTPNLPPGPWKIPIIGNIHNVVG-SLPHHRLRDLSAKYGPLMHLKLGEVSTIVVSSPE  70

Query  309  LAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKS  488
             AK +  THDL+F++RP +++  ++ Y    ++F+PYGDYWR++RKIC  ELLS+K V+S
Sbjct  71   YAKEVLSTHDLIFSSRPPILASKIMSYDSMGMSFAPYGDYWRRLRKICASELLSSKRVQS  130

Query  489  FNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKE  668
            F   R EEL+  I  I +   +PINLT+++    S+ +++ A G   R D ++FI  V+E
Sbjct  131  FQPIRGEELTNFIKRIASKEGSPINLTKEVLLTVSTIVSRTALGNKCR-DHKKFISAVRE  189

Query  669  ALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKA  848
            A   AGGF + DL+PS +W+ ++SG KP+L K H++ D+I + I+ EH++  ++  + + 
Sbjct  190  ATEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADRIMQNIVNEHREAKSSATHGQG  249

Query  849  KDHEEDIVDVLL  884
            ++  +D+VDVL+
Sbjct  250  EEVADDLVDVLM  261



>ref|XP_006475119.1| PREDICTED: premnaspirodiene oxygenase-like [Citrus sinensis]
Length=507

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 193/282 (68%), Gaps = 6/282 (2%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
            MEH+F   P+ ++ FL F F I+  + ++N +    LPPGPW+LP+IG+LH LVG SLPH
Sbjct  1    MEHQFPPFPI-ILSFLLFAFMIWK-KSKNNHSTLLNLPPGPWRLPVIGNLHQLVG-SLPH  57

Query  219  RTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCT  398
              L +L++KYGP+MHLQLG++S IVISSP+ AK + +THD+ FA+RP +++     Y  T
Sbjct  58   HCLSDLAKKYGPLMHLQLGQVSHIVISSPEAAKEVMRTHDMSFASRPFLLAASFFTYNFT  117

Query  399  DVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKI  578
            ++AF+P+GDYWRQ+RKIC LEL S K V+SF S R+EE+S LI+SI ++   P+NL++ +
Sbjct  118  NIAFAPHGDYWRQLRKICTLELFSAKRVQSFRSIREEEVSNLITSISSNSGLPVNLSKMV  177

Query  579  CWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRL  758
                +    +AAFG VR +DQE  + +  +A+ L GGF +AD+FPS K +  ++G +P L
Sbjct  178  FSLINGITTRAAFG-VRCQDQEELMTVFHKAIELGGGFNLADVFPSIKLLGKLTGIEPEL  236

Query  759  LKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             ++H+ +D+I   II EHK+  A       +   +D+V VLL
Sbjct  237  ERLHQALDRILGNIINEHKEGKA--LGKTVEGEADDLVHVLL  276



>ref|XP_004491491.1| PREDICTED: premnaspirodiene oxygenase-like [Cicer arietinum]
Length=515

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 132/291 (45%), Positives = 190/291 (65%), Gaps = 18/291 (6%)
 Frame = +3

Query  39   MEH------KFLFNPVSVIVFLSFVFCI-YTLRRRSNPARRQKLPPGPWKLPLIGSLHHL  197
            MEH       F+    S I+FL+ +  +   +  R      +K PPGPWKLP+IGS+HHL
Sbjct  1    MEHPNISFLHFILFSTSFILFLTQIIKVGKIILLRVTKTTHKKFPPGPWKLPIIGSIHHL  60

Query  198  VGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFD  377
            +G SLPH +LR LS+ YGP+MHL+LGE+S IV+SSP+ AK I KT+D  FA RP  +  D
Sbjct  61   IG-SLPHHSLRQLSKIYGPLMHLKLGEVSTIVVSSPEFAKEILKTYDSNFAQRPHQIGAD  119

Query  378  VVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAP  557
            ++ Y  +D+A +PYG YW+Q+RK+C  ELL TK V+SF S R++E+  LI+ I  +  + 
Sbjct  120  IMCYGSSDIATAPYGSYWKQLRKLCSQELLCTKRVRSFQSIREQEVHNLITYISNNIGSC  179

Query  558  INLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYV  737
            INL+EK+   TS+  +++AFG++ + DQ+ FI L+K+ ++LA GF V DLFPS+KW+H +
Sbjct  180  INLSEKVACMTSTITSRSAFGKICK-DQQEFISLIKKLVTLAEGFVVIDLFPSQKWLHLI  238

Query  738  SGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNN---------KAKDHEE  863
            SG KP+L ++HR+ D I E II+E      N             + KDH+E
Sbjct  239  SGMKPKLEELHRKFDNIIENIIKEAVTKKGNDGETIESFLSVLLRIKDHDE  289



>gb|ABC69421.1| CYP71D20v2 [Nicotiana tabacum]
Length=504

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/257 (50%), Positives = 192/257 (75%), Gaps = 5/257 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ +KLPPGPWK+P++GS+ H++GG  PH  LR+L++K GP+MHLQLGEISA+V++
Sbjct  23   KNSNSQSKKLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKDGPLMHLQLGEISAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            S  +AK + KTHD+VFA+RPK+++ D++ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82   SRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAP--INLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            V+SF+S R++E+  LI SI++  S+   +N T++I WF SS   ++AFG+V +  Q+ F 
Sbjct  142  VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLK-GQDIFA  200

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANR  833
              ++E + LA GF V D+FP+ K++H +SG K +LL  H +VD I E +I EHK N+A  
Sbjct  201  KKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAG  260

Query  834  NNNKAKDHEEDIVDVLL  884
             +N A    ED++DVLL
Sbjct  261  KSNGALGG-EDLIDVLL  276



>ref|XP_003535171.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=501

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/273 (45%), Positives = 187/273 (68%), Gaps = 1/273 (0%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRK  245
            S ++ +   F ++ L +    +  QKLPPGP KLP+IG+LH L   GSLPH  LR+L++K
Sbjct  5    SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGEISA+V SSP++AK I KTHD+ F  RP ++   ++ Y    +AF+PYGD
Sbjct  65   YGPLMHLQLGEISAVVASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            +WRQMRK+C  ELLSTK V+SF S R++E ++ I SI+ S  +PINLT +I     ++I+
Sbjct  125  HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + AFG + +E  E  + L+++ +   GGF +AD+FPS  ++++++G   RL K+H++V+K
Sbjct  185  RVAFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVNK  244

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + E II EH++       + A+  ++D +D+LL
Sbjct  245  VLENIIREHQEKNKIAKEDGAELEDQDFIDLLL  277



>ref|XP_003535169.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=501

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 187/273 (68%), Gaps = 1/273 (0%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRK  245
            S ++ +   F ++ L +    +  QKLPPGP KLP+IG+LH L   GSLPH  LR+L++K
Sbjct  5    SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGEISA++ SSP++AK I KTHD+ F  RP ++   ++ Y    +AF+PYGD
Sbjct  65   YGPLMHLQLGEISAVIASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            +WRQMRK+C  ELLSTK V+SF S R++E ++ I SI+ S  +PINLT +I     ++I+
Sbjct  125  HWRQMRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + +FG + +E  E  + L+++ +   GGF +AD+FPS  ++++++G   RL K+H++VDK
Sbjct  185  RVSFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + E II EH++       + A+  ++D +D+LL
Sbjct  245  VLENIIREHQEKNKIAKEDGAELEDQDFIDLLL  277



>ref|XP_010061472.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=511

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/272 (49%), Positives = 188/272 (69%), Gaps = 4/272 (1%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKY  248
            SV+ F  F+F +  L  +S+     KLPPGP KLPLIG+LH L+G S PHR LR+L++K+
Sbjct  10   SVVSFCIFIFILRKLCHKSDVKGLPKLPPGPRKLPLIGNLHQLLG-SPPHRALRDLAKKH  68

Query  249  GPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDY  428
            GP+MHLQLGE+  +++SS ++AK + KTHDL FA RP +++ +V+ Y  TD+AF+PYG+Y
Sbjct  69   GPLMHLQLGEVPHVIVSSAEMAKEVMKTHDLTFATRPPLLASEVMSYGSTDIAFAPYGEY  128

Query  429  WRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAK  608
            WRQ+RKIC LEL S K V+SF   R+EE S L+  + ++  +PINLT+K+        + 
Sbjct  129  WRQLRKICTLELFSVKRVQSFRHIREEETSNLVKWVASNAGSPINLTQKLFSTNYGATSI  188

Query  609  AAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKI  788
            AAFG+  +E QE FI +V EA  LA GF V D+FPS KW+H +S  KPRL K+HR+ D +
Sbjct  189  AAFGKKFKE-QEEFISVVTEANKLAAGFEVGDVFPSSKWLHVISRMKPRLEKLHRQADHM  247

Query  789  FELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
               II E ++  A R +++ +   +D++DVLL
Sbjct  248  MNNIIRERREERAKRRDDETR--HDDLIDVLL  277



>gb|KEH34024.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 190/277 (69%), Gaps = 8/277 (3%)
 Frame = +3

Query  72   VIVFLSFVFCIYTLRRRSNPARRQK------LPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
            ++++L ++F    L       R++K      +PPGP KLP+IG++H+L+  S PH+ LR+
Sbjct  4    LVLYLPYIFFFILLTLIVQKIRKKKSYSAYNIPPGPRKLPIIGNIHNLLS-SQPHQKLRD  62

Query  234  LSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFS  413
            L++KYGP+MHLQLGE+SA+VISSP+ A  + KTHD+ F++RP++++ +++ Y  T +AF+
Sbjct  63   LAKKYGPVMHLQLGEVSAMVISSPECASEVMKTHDIHFSSRPQILATEIMSYNSTSIAFA  122

Query  414  PYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTS  593
            PYG+YWRQ+RKIC LELLS K V S+   R+E    L   I +    PIN+TE +     
Sbjct  123  PYGNYWRQLRKICTLELLSLKRVNSYQPIREEVFFNLAKWIASQVGIPINITEAVRSSIY  182

Query  594  STIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHR  773
            + +++AAFG    +DQ++FI +VK+++ +AGGF + DLFPS KW+  V+G +P+L + HR
Sbjct  183  TIVSRAAFGN-ECKDQDKFISVVKQSIKVAGGFDLGDLFPSAKWLQLVTGMRPKLERFHR  241

Query  774  EVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + D+IFE II EHK+    +  +     EED++DVLL
Sbjct  242  QTDQIFENIINEHKEEKYTKAKDDQGKVEEDLIDVLL  278



>ref|XP_004511997.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=506

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 188/276 (68%), Gaps = 9/276 (3%)
 Frame = +3

Query  63   PVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLS  239
            P  V + L F    Y L++  +     KLPPGP KLP IG+LH +   GSLPHR  + L+
Sbjct  11   PFFVFLMLRFFAKYYMLKKFGH-----KLPPGPMKLPFIGNLHQIASLGSLPHRAFQQLA  65

Query  240  RKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPY  419
             KYGPIMHL+LG+IS IVI+SP+LAK I KTHD+VFANRP + S  ++ Y   D+AFSPY
Sbjct  66   HKYGPIMHLKLGQISTIVITSPKLAKEILKTHDIVFANRPHLESAHIMSYGSKDIAFSPY  125

Query  420  GDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSST  599
            GDY+RQMRKIC+LELLS K V+SF+  R++E +  I  IK+S  + +NLT +I    SS 
Sbjct  126  GDYYRQMRKICMLELLSAKRVQSFSYIREDETNIFIELIKSSAGSEVNLTNRIFSLVSSI  185

Query  600  IAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKW-IHYVSGTKPRLLKVHRE  776
            ++++AFG  + EDQ+ F+ ++++ +   GG   ADLFPS K+ IH ++G K +L K+ ++
Sbjct  186  VSRSAFGD-KTEDQDEFVRVIRKTIESVGGLEPADLFPSMKYIIHVLTGNKSKLEKMQKQ  244

Query  777  VDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             DKI E+I+ +H++    R    + + +ED+VDVLL
Sbjct  245  SDKILEIIVGKHQEK-QRRAKEGSDEEQEDLVDVLL  279



>gb|AAK62343.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=473

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 185/245 (76%), Gaps = 4/245 (2%)
 Frame = +3

Query  120  RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVIS  299
            +++ ++ ++LPPGPWK+P++GS+ H++GG  PH  LR+L++KYGPIMHLQ GEISA+V++
Sbjct  23   KNSNSQTKQLPPGPWKIPILGSMLHMLGGE-PHHILRDLAKKYGPIMHLQFGEISAVVVT  81

Query  300  SPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKM  479
            S ++AK + KTHD+VFA+RPK+++ D++ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82   SREMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480  VKSFNSFRQEELSELISSIKASGSAP--INLTEKICWFTSSTIAKAAFGRVRREDQERFI  653
            V+SF+S R++E+  LI SI++  S+   +N T++I WF SS   ++AFG+V +  Q+ F 
Sbjct  142  VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLK-GQDVFA  200

Query  654  VLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANR  833
              ++E + LA GF VAD+FPS K++H +SG K +LL  H +VD I E +I EHK N+A  
Sbjct  201  KKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATG  260

Query  834  NNNKA  848
              N A
Sbjct  261  KTNGA  265



>ref|XP_003589691.1| Cytochrome P450 [Medicago truncatula]
 gb|AES59942.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/279 (46%), Positives = 191/279 (68%), Gaps = 11/279 (4%)
 Frame = +3

Query  54   LFNPVSVIVFLSFVFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRT  224
            +F  +++++F  F+F +  L +  N  ++     LPPGPWKLP+IG +HHLV  S PH+ 
Sbjct  5    IFYLLALVLF--FIFMLVVLTKGRNLKKKSSAPNLPPGPWKLPIIGHIHHLVS-STPHQK  61

Query  225  LRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDV  404
            LR+L++ YGP+MHLQLGEISAIV+SSP+ A+ + KTHD++FA++PK+++ D++ Y  TD+
Sbjct  62   LRDLAKVYGPLMHLQLGEISAIVVSSPEYAREVMKTHDIIFASKPKIVAIDILLYGSTDI  121

Query  405  AFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICW  584
            AFSPYG+YWRQ+RKIC +ELL+ K V SF   R+EE + LI SI +   +PIN+T+ +  
Sbjct  122  AFSPYGNYWRQLRKICTIELLTQKRVSSFRPIREEEFTNLIKSIDSQQGSPINITQAVVT  181

Query  585  FTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLK  764
               +   +AAFG  + + QE+ + L     S+ GGF + +LFPS KW+  VSG + ++  
Sbjct  182  SIMTITTRAAFGN-KCKGQEQLVSLAN-GESVGGGFDIGELFPSAKWLQLVSGFRSKIEV  239

Query  765  VHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVL  881
            +HR++D I   II EHK+    ++  K  + EED+VDVL
Sbjct  240  LHRQIDLILVNIINEHKE---AKSKAKEGEVEEDLVDVL  275



>dbj|BAM68810.1| putative CYP71AV1 ortholog [Artemisia absinthium]
Length=495

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 184/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +F IY    RS   +     P PW+LP+IG +HHL+G ++PHR + +L+RKYG 
Sbjct  16   IALATILFFIYKFATRSKSTKNSL--PEPWRLPIIGHMHHLIG-TIPHRGVMDLARKYGS  72

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+S IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TD+  +PYG+YWR
Sbjct  73   LMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWR  132

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RK+C LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E I    ++ +++A
Sbjct  133  QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENIFKLIATILSRA  192

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+ F  +VKE L   GGF VAD+FPSKK++H++SG + RL  +H ++D + 
Sbjct  193  AFGKGIK-DQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHMKLDNLI  251

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              ++ EH  N +++ N       E ++DVLL
Sbjct  252  NNLVAEHTVNTSSKTN-------ETLLDVLL  275



>gb|AGC29947.1| CYP71BE30 [Sinopodophyllum hexandrum]
Length=498

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/252 (50%), Positives = 182/252 (72%), Gaps = 7/252 (3%)
 Frame = +3

Query  132  ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQL  311
             +R +LPPGPWKLPLIGSLHHL+ G LPH TLR+L++K+G +MHLQLG++S +V++SP++
Sbjct  23   GKRSQLPPGPWKLPLIGSLHHLLVG-LPHHTLRDLAKKHGSLMHLQLGQVSTVVVTSPRI  81

Query  312  AKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSF  491
            AK + KTHD++F +RP M +  +V Y   D+  +PYG++WRQMRKI  LE+ S K V+SF
Sbjct  82   AKEMFKTHDIMFLDRPFMFAPSIVTYGAKDIVLAPYGEFWRQMRKISTLEVFSAKRVQSF  141

Query  492  NSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEA  671
             S R++E+S LI SI +   +  NLT++I  F +   A+ AFG  + +DQE F+ ++ + 
Sbjct  142  QSVREDEVSMLIESISSMNGSVFNLTKRIFSFMNDLTARVAFGN-KCKDQEAFVSMMDQV  200

Query  672  LSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAK  851
            + ++GGFGVADL+PS + I+ +SG K  +  +H++ D+I E II+EH      RNNN  K
Sbjct  201  IKVSGGFGVADLYPSLEIINVISGLKSEMEGIHQKTDEILENIIKEH----MQRNNNPNK  256

Query  852  D-HEEDIVDVLL  884
            D +EEDIVDVLL
Sbjct  257  DVNEEDIVDVLL  268



>ref|XP_007153133.1| hypothetical protein PHAVU_003G009500g [Phaseolus vulgaris]
 gb|ESW25127.1| hypothetical protein PHAVU_003G009500g [Phaseolus vulgaris]
Length=509

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 178/248 (72%), Gaps = 5/248 (2%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKA  320
            QK+ PGPWKLP+IG++H+L+  S PH  LR+L++ YGP MHLQLGE+  I++SSP+ AK 
Sbjct  36   QKILPGPWKLPIIGNIHNLLT-STPHTKLRDLAKIYGPFMHLQLGEVFTIIVSSPEYAKE  94

Query  321  ITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSF  500
            I KTHDL FA+RPK+++ D++ Y+ T++ F+ YG+YWRQ+RKIC +EL + K V SF   
Sbjct  95   IMKTHDLNFASRPKILASDILSYESTNIVFASYGNYWRQLRKICTVELFTHKRVSSFQPV  154

Query  501  RQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            R+EEL+ L+  I +   +P NLT+ +     + +A+AAFG+ + +DQE FI +VKE + +
Sbjct  155  REEELAHLVRMIDSHEGSPFNLTQAVLSSVYNLMARAAFGK-KCKDQEEFISVVKEGVKI  213

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE  860
              GF + DLFPS KW+  V+G +P+L ++HR++D+I E II EHK     ++  +  + E
Sbjct  214  GSGFNIGDLFPSAKWLQTVTGLRPKLERMHRKIDRILEDIISEHK---GAKSKGRGGEAE  270

Query  861  EDIVDVLL  884
            ED+VDVLL
Sbjct  271  EDLVDVLL  278



>ref|XP_004506687.1| PREDICTED: cytochrome P450 71D11-like [Cicer arietinum]
Length=509

 Score =   259 bits (663),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/274 (46%), Positives = 185/274 (68%), Gaps = 7/274 (3%)
 Frame = +3

Query  78   VFLSFVFCIYTLRRRSNPARRQ-----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSR  242
            +F  F+F I  L+   N  ++       LPP PWKLP+IG++ HLV  + P R LR+L++
Sbjct  8    LFTIFLFMIIALKLIRNHYKKSDSTSTNLPPSPWKLPIIGNILHLVTSN-PPRKLRDLAK  66

Query  243  KYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYG  422
            +YGP+MHLQLGEI  IV+SS ++AK + KTHD+ FA+RP +M+ D+  Y  TD+AFSPYG
Sbjct  67   RYGPLMHLQLGEIFFIVVSSAEVAKEVLKTHDITFASRPHLMATDIASYNSTDIAFSPYG  126

Query  423  DYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTI  602
            DYWRQ+RKIC +ELLS + VKS    R++E++ L+  I ++  +  NL++ +  F  +  
Sbjct  127  DYWRQLRKICAIELLSVRRVKSLWPIREKEMNSLLKKIASNEGSQFNLSQAVISFMYTFT  186

Query  603  AKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVD  782
            +KAAFG+   E++E FI + K+ + LAGGF + DLFPS  W+H +SG KP+L K+ + VD
Sbjct  187  SKAAFGKKYAEEEE-FISVAKQLIKLAGGFYIGDLFPSATWLHNLSGMKPKLEKLSQHVD  245

Query  783  KIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            +I   II +HK+  + R      + EED++DVLL
Sbjct  246  RILGHIINDHKEERSRRAKEGVAEAEEDLIDVLL  279



>gb|KEH41118.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=504

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 134/272 (49%), Positives = 188/272 (69%), Gaps = 15/272 (6%)
 Frame = +3

Query  90   FVFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIM  260
            F+F +  L+ R N  ++     LPPGPWKLP+IG +HHLV  S PH+ LR+L++ +GP+M
Sbjct  12   FLFMLVALKIRKNLKKKGSSPNLPPGPWKLPIIGHIHHLVT-STPHQKLRDLAKIHGPLM  70

Query  261  HLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQM  440
             LQLGEI AIV+SSP  AK + KTHD++FA+RPK+++ +++ Y  T++ FSPYG+YWR +
Sbjct  71   QLQLGEIFAIVVSSPDYAKEVLKTHDVIFASRPKILAIEILSYGFTNIGFSPYGNYWRHL  130

Query  441  RKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFG  620
            RKIC +ELLS K V SF+  R+E  + LI  I +   + INLTE +   T + +++AAFG
Sbjct  131  RKICTMELLSQKHVSSFHPIREEVFTNLIKRIGSKQGSSINLTELVVSSTFAILSRAAFG  190

Query  621  RVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELI  800
              + +DQE F  L K   S+AGGF + +LFPS KWI  VSG +P+L ++HR +D+I E I
Sbjct  191  N-KCKDQEEFASLGK-GESIAGGFDIGELFPSSKWIQLVSGLRPKLERLHRRIDRILENI  248

Query  801  IEEHKDNMANRNNNKAK----DHEEDIVDVLL  884
            I EHK+      N+KAK    + EED+VDVLL
Sbjct  249  IIEHKE-----ANSKAKECQEEAEEDLVDVLL  275



>ref|XP_006363816.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363817.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=503

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/272 (50%), Positives = 187/272 (69%), Gaps = 11/272 (4%)
 Frame = +3

Query  72   VIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
            +I FL FV     L ++S    + KLPPGP KLPLIG+LH L   SLPH TL+NLS KYG
Sbjct  13   LIAFLLFVAIALKLWKKSK--IQYKLPPGPRKLPLIGNLHQL-SNSLPHHTLKNLSNKYG  69

Query  252  PIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYW  431
            P+MHLQLGE+SA+++SSPQ+AK + KTHD++FANRP+++S  ++      ++FSPYG  W
Sbjct  70   PMMHLQLGEVSAVIVSSPQVAKEVLKTHDIIFANRPQLLSVQILSNNSPTLSFSPYGANW  129

Query  432  RQMRKICVLELLSTKMVKSFNSFRQEELSELISSIK-ASGSAPINLTEKICWFTSSTIAK  608
            RQ+RK+CVLELLS K V+SF S R+EE+  LI +I       PI+++E +   T++  A+
Sbjct  130  RQLRKVCVLELLSAKRVQSFESIREEEVENLIEAISFIQPQVPIDISEMLFSMTNNITAR  189

Query  609  AAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKI  788
            AAFG+ + + ++ FI  +K    L+GGF + DLFPS K  H +SG +  L KVH+ VDKI
Sbjct  190  AAFGK-KCKHKDEFIKAMKTITELSGGFDIPDLFPSLKIFHSLSGVRSALEKVHQNVDKI  248

Query  789  FELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            FE II+EHK       N +   ++ED+VDVLL
Sbjct  249  FEDIIQEHK------ANKRDMLYKEDLVDVLL  274



>ref|XP_006452551.1| hypothetical protein CICLE_v10010293mg [Citrus clementina]
 ref|XP_006474926.1| PREDICTED: cytochrome P450 71D10-like [Citrus sinensis]
 gb|ESR65791.1| hypothetical protein CICLE_v10010293mg [Citrus clementina]
Length=501

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 178/248 (72%), Gaps = 5/248 (2%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKA  320
            QKLPPGPW+LPLIG+LH LV  SLPH +LR+L++K+GP+MHL+LGE+S IV+SS ++AK 
Sbjct  36   QKLPPGPWRLPLIGNLHQLVA-SLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKE  94

Query  321  ITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSF  500
            + KTHDLVFA RP ++S     Y  T++  +PYG YWRQ+R+IC +ELLSTK V+SF S 
Sbjct  95   VLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSI  154

Query  501  RQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            R+EE+S LI +++++  + INL EKI   T    A+AAFG+ + +DQE FI +VKE + +
Sbjct  155  REEEVSNLIKTVRSNEGSVINLREKIFTMTFGITARAAFGK-KCKDQEVFISVVKEFIKI  213

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHE  860
              GF ++DL+PS K +  +SG + +L K+H E D+IF  I++EHK+    R      + E
Sbjct  214  MSGFSISDLYPSIKLLQEISGVRRKLKKLHLESDRIFGEILDEHKE---KRTKTAQAEAE  270

Query  861  EDIVDVLL  884
            ED +DV +
Sbjct  271  EDPIDVFM  278



>gb|KHM99472.1| Cytochrome P450 71D11 [Glycine soja]
Length=508

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 191/274 (70%), Gaps = 9/274 (3%)
 Frame = +3

Query  78   VFLSFVFCIYTLRRRSNPARRQ-----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSR  242
              +SF+F    +++     ++      K+P GP KLP+IG++++L+  S PHR LR+++ 
Sbjct  10   ALISFIFLTLIVQKIGRKPKKTDDTTFKIPDGPRKLPIIGNIYNLLS-SQPHRKLRDMAL  68

Query  243  KYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYG  422
            KYGP+M+LQLGE+S IVISSP+ AK + KTHD+ FA RPK+++ D++ Y  T++AF+PYG
Sbjct  69   KYGPLMYLQLGEVSTIVISSPECAKEVMKTHDINFATRPKVLAIDIMSYNSTNIAFAPYG  128

Query  423  DYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTI  602
            +YWRQ+RKIC LELLS K V S+   R+EELS L+  I +   + INLT+ +     +  
Sbjct  129  NYWRQLRKICTLELLSLKRVNSYQPIREEELSNLVKWIDSHKGSSINLTQAVLSSIYTIA  188

Query  603  AKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVD  782
            ++AAFG+ + +DQE+FI +VK+   LA GFG+ DLFPS  W+ +V+G +P++ ++H++ D
Sbjct  189  SRAAFGK-KCKDQEKFISVVKKTSKLAAGFGIEDLFPSVTWLQHVTGVRPKIERLHQQAD  247

Query  783  KIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            +I E II EHK+  +    N+++   ED+VDVL+
Sbjct  248  QIMENIINEHKEAKSKAKGNQSE--AEDLVDVLI  279



>ref|XP_008345750.1| PREDICTED: cytochrome P450 71D8-like [Malus domestica]
Length=519

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/281 (48%), Positives = 185/281 (66%), Gaps = 16/281 (6%)
 Frame = +3

Query  75   IVFLSFVF-CIYTL--------RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTL  227
            I FL+ +F C+  L        +R +      +LPPGPWK+PLIG+LH +   SLPH  +
Sbjct  9    IFFLAVIFTCLVALVTPLVIYWKRHATSTTTVRLPPGPWKVPLIGNLHQMAASSLPHXCM  68

Query  228  RNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVA  407
             +L+ KYGPIMHL+LG++SA+VISSP+  + + KTHD+ F+ RP  ++ +++ Y  + + 
Sbjct  69   TDLANKYGPIMHLKLGQLSAVVISSPEFVQEMLKTHDVAFSQRPTFLAAEILSYN-SGII  127

Query  408  FSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWF  587
            FSPY D+WRQMRKIC+LELLS K V+SF S RQEE S L+ SI  S   P NL+E I   
Sbjct  128  FSPYNDFWRQMRKICMLELLSAKRVESFASIRQEEASNLVESISLSDGHPFNLSEMIFSX  187

Query  588  TSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKV  767
             S  IA+AAFG+  +  QE F+  +++A+ LA  F V DLFPS K++ YV   KP + KV
Sbjct  188  QSVIIARAAFGKKCKYQQE-FLSQLQDAVRLAAEFDVPDLFPSLKFLRYVINLKPAVEKV  246

Query  768  HREVDKIFELIIEEHKDNMANRNNNKA--KDHEEDIVDVLL  884
            H+++DKI + II +H+     RN   A   DH+EDIVDVLL
Sbjct  247  HQKMDKILDEIISDHR---VKRNEESAAGDDHQEDIVDVLL  284



>ref|XP_003530792.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
Length=512

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 191/274 (70%), Gaps = 9/274 (3%)
 Frame = +3

Query  78   VFLSFVFCIYTLRRRSNPARRQ-----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSR  242
              +SF+F    +++     ++      K+P GP KLP+IG++++L+  S PHR LR+++ 
Sbjct  10   ALISFIFLTLIVQKIGRKPKKTDDTTFKIPDGPRKLPIIGNIYNLLS-SQPHRKLRDMAL  68

Query  243  KYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYG  422
            KYGP+M+LQLGE+S IVISSP+ AK + KTHD+ FA RPK+++ D++ Y  T++AF+PYG
Sbjct  69   KYGPLMYLQLGEVSTIVISSPECAKEVMKTHDINFATRPKVLAIDIMSYNSTNIAFAPYG  128

Query  423  DYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTI  602
            +YWRQ+RKIC LELLS K V S+   R+EELS L+  I +   + INLT+ +     +  
Sbjct  129  NYWRQLRKICTLELLSLKRVNSYQPIREEELSNLVKWIDSHKGSSINLTQAVLSSIYTIA  188

Query  603  AKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVD  782
            ++AAFG+ + +DQE+FI +VK+   LA GFG+ DLFPS  W+ +V+G +P++ ++H++ D
Sbjct  189  SRAAFGK-KCKDQEKFISVVKKTSKLAAGFGIEDLFPSVTWLQHVTGVRPKIERLHQQAD  247

Query  783  KIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            +I E II EHK+  +    N+++   ED+VDVL+
Sbjct  248  QIMENIINEHKEAKSKAKGNQSE--AEDLVDVLI  279



>dbj|BAM68809.1| putative CYP71AV1 ortholog [Artemisia afra]
Length=495

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +F +Y    RS   +     P PW+LP+IG +HHL+G ++PHR + +L+RKYG 
Sbjct  16   IALATILFFVYKFATRSKSTKNSL--PEPWRLPIIGHMHHLIG-TIPHRGVMDLARKYGS  72

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+S IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TD+  +PYG+YWR
Sbjct  73   LMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWR  132

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RK+C LELLS K VKSF S R+EE   L+  IKASGS  P NL+E +    ++ +++A
Sbjct  133  QLRKLCTLELLSIKKVKSFQSLREEECWNLVQEIKASGSGRPFNLSENVFKLIATILSRA  192

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+ F  +VKE L   GGF VAD+FPSKK++H++SG + RL  +H+++D + 
Sbjct  193  AFGKGIK-DQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHQKLDNLI  251

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              ++ EH    +N+ N       E ++DVLL
Sbjct  252  NNLVAEHTVTTSNKTN-------ETLLDVLL  275



>gb|AEX07771.1| cytochrome P450 [Catharanthus roseus]
Length=506

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/280 (47%), Positives = 195/280 (70%), Gaps = 6/280 (2%)
 Frame = +3

Query  57   FNPVSVIVFLS--FVFCIYTLR--RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRT  224
            F+  S  VF++  F+F   ++   RR    + + LPPGPWKLPLIG+LH  +G S+P++ 
Sbjct  3    FHESSPFVFITRGFIFIAISIAVLRRIISKKTKTLPPGPWKLPLIGNLHQFLG-SVPYQI  61

Query  225  LRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDV  404
            LR+L++K GP+MHLQLGE+SAIV +SPQ+AK ITKT DL FA+RP + +  +V Y   D+
Sbjct  62   LRDLAQKNGPLMHLQLGEVSAIVAASPQMAKEITKTLDLQFADRPVIQALRIVTYDYLDI  121

Query  405  AFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICW  584
            +F+ YG YWRQ+RKI V ELL++K V+SF S R++E S L+ +I ++    INL++ +  
Sbjct  122  SFNAYGKYWRQLRKIFVQELLTSKRVRSFCSIREDEFSNLVKTINSANGKSINLSKLMTS  181

Query  585  FTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLK  764
             T+S I K AFG+VR E +E FI L+ + L+LAGGF + DLFPS K +H + GT+ +L +
Sbjct  182  CTNSIINKVAFGKVRYE-REVFIDLINQILALAGGFKLVDLFPSYKILHVLEGTERKLWE  240

Query  765  VHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            +  ++DKI + +I+EH++N +        + +EDIVD+LL
Sbjct  241  IRGKIDKILDKVIDEHRENSSRTGKGNGCNGQEDIVDILL  280



>gb|AGO03789.1| germacrene A oxidase [Tanacetum cinerariifolium]
Length=488

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +F +Y    RS   +     P PW+LP+IG +HHL+G ++PHR + +L+RKYG 
Sbjct  9    IALATILFFVYKFATRSKSTKNSL--PEPWRLPIIGHMHHLIG-TIPHRGVMDLARKYGS  65

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+S IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TD+  +PYG+YWR
Sbjct  66   LMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWR  125

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RK+C LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E I    ++ +++A
Sbjct  126  QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENIFKLIATILSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  R DQ+ F  +VKE L   GGF VAD+FPSKK++H++SG + RL  +H ++D + 
Sbjct  186  AFGKGIR-DQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHTKLDNLI  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              ++ EH    +++ N       E ++DVLL
Sbjct  245  NNLVAEHTVKTSSKTN-------ETLLDVLL  268



>ref|XP_010921587.1| PREDICTED: premnaspirodiene oxygenase-like [Elaeis guineensis]
Length=507

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/283 (46%), Positives = 188/283 (66%), Gaps = 3/283 (1%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
            ME +F   P   +  L  V  I   +  S   R +KLPP PW+LP+IG LHHLVG ++PH
Sbjct  1    MELQFPTIPFLSLFLLFAVIAIKLTKSTSQKTRARKLPPSPWRLPIIGHLHHLVG-AVPH  59

Query  219  RTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCT  398
            R LR LS ++GP+MHL+LG++  IV+SSP+ AK I  THDL FA+R K+ + DV+ Y  T
Sbjct  60   RALRELSLRHGPLMHLRLGQVDHIVVSSPEAAKEILTTHDLTFASRTKLFASDVLAYGGT  119

Query  399  DVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKI  578
            ++ F+PYG YWR +RKICV ELLS K V SF + R+EE+S+L+ SI     +P+NL++ +
Sbjct  120  NLVFAPYGSYWRLLRKICVQELLSPKRVNSFRTCREEEMSDLVGSISTISKSPVNLSDLL  179

Query  579  CWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRL  758
               T + +++ AFG+ + +   RF    KE + L  G  VADLFPS K+I  +SG   + 
Sbjct  180  FLSTKNLVSRVAFGK-KCKHGLRFHAAAKEGIELVSGLCVADLFPSMKFIDVLSGGSSKA  238

Query  759  LKVHREVDKIFELIIEEHKDNMANRNNNK-AKDHEEDIVDVLL  884
             KVH+E+DK+ E II+EH++  ++ N+N+ A   +ED+VDVLL
Sbjct  239  SKVHQEIDKVLEEIIKEHQEKRSSMNSNRGAPGEDEDLVDVLL  281



>ref|XP_007020554.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12079.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=541

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/250 (49%), Positives = 178/250 (71%), Gaps = 6/250 (2%)
 Frame = +3

Query  144  KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAI  323
            +LPPGPWKLPLIG+LH LV  +LPH TL NL++KYGP+M L+LGE+  +V+SSP++AK +
Sbjct  36   RLPPGPWKLPLIGNLHQLVS-TLPHHTLSNLAKKYGPLMWLKLGEVPTLVVSSPEMAKEV  94

Query  324  TKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFR  503
             +THD+ F  RP +++  ++ Y   D+ FSPYG+YWRQM+KIC+ ELLST  V+SF S R
Sbjct  95   MRTHDITFCQRPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELLSTNRVQSFQSIR  154

Query  504  QEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLA  683
            ++E+S L+  I ++  +P+NL+EKI   T    A+AAFG+ +  D+E FI +  E   LA
Sbjct  155  EQEVSALMEIISSNARSPVNLSEKIYSLTYGITARAAFGK-KSGDEEEFIRIAIEVSKLA  213

Query  684  GGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKD---NMANRNNNKAKD  854
            GGF +AD++PS + +  +SG + +L K+H+  D+I E II++HK+    MAN      KD
Sbjct  214  GGFCLADMYPSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRNGMANTKTGNKKD  273

Query  855  HEEDIVDVLL  884
             EED+VD+LL
Sbjct  274  -EEDLVDILL  282



>gb|AHN62855.1| germacrene A oxidase [Tanacetum parthenium]
Length=488

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 184/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +F +Y    RS   +     P PW+LP+IG +HHL+G ++PHR + +L+RKYG 
Sbjct  9    IALATILFFVYKFATRSKSTKNSL--PEPWRLPIIGHMHHLIG-TIPHRGVMDLARKYGS  65

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+S IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TD+  +PYG+YWR
Sbjct  66   LMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWR  125

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RK+C LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E I    ++ +++A
Sbjct  126  QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENIFKLIATILSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+ F  +VKE L   GGF VAD+FPSKK++H++SG + RL  +H+++D + 
Sbjct  186  AFGKGIK-DQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHQKLDNLI  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              ++ EH    +++ N       E ++DVLL
Sbjct  245  NNLVAEHTVKTSSKTN-------ETLLDVLL  268



>ref|XP_004242298.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=348

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 174/239 (73%), Gaps = 1/239 (0%)
 Frame = +3

Query  168  LPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVF  347
            LP+IGSLHHL+G  LPHR LR+LS++YGPIM+LQ+G++  +VISSP +AK + KTHDL F
Sbjct  39   LPIIGSLHHLIGRGLPHRVLRDLSQRYGPIMYLQMGQVPTVVISSPTMAKQVLKTHDLAF  98

Query  348  ANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELI  527
             NRP++ S  +++Y   D+AFS YGDYWRQMRKIC LELLSTKMVKS+ + R++ELS LI
Sbjct  99   VNRPQLTSTSIIFYNNKDIAFSQYGDYWRQMRKICTLELLSTKMVKSYGAIREDELSSLI  158

Query  528  SSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADL  707
            SSI+++    IN+T+ I  F++S I ++AFG++ + ++E F+ ++KE L L  GF V DL
Sbjct  159  SSIRSTMGNTINMTQIIFLFSNSIICRSAFGKICK-NREEFLTILKEVLLLGAGFFVGDL  217

Query  708  FPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            FPS + IH + G K R++  H +VD + E I+ EH +N A       +  +ED+VDV L
Sbjct  218  FPSWRLIHNLRGEKTRMVNAHNKVDVVMEEILNEHIENKAAGKMGNGEFGDEDLVDVFL  276



>gb|ABG49366.1| P450 monooxygenase [Artemisia annua]
Length=488

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 184/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +F +Y    RS   +     P PW+LP+IG +HHL+G ++PHR + +L+RKYG 
Sbjct  9    IALATILFFVYKFATRSKSNKNSL--PEPWRLPIIGHMHHLIG-TIPHRGVMDLARKYGS  65

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+S IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TD+  +PYG+YWR
Sbjct  66   LMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWR  125

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RK+C LELLS K VKSF S R+EE   L+  IKA+GS  P+NL+E I    ++ +++A
Sbjct  126  QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEIKAAGSGRPVNLSENIFKLIATILSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+ F  +VKE L   GGF VAD+FPSKK++H++SG + RL  +H ++D + 
Sbjct  186  AFGKGIK-DQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHMKLDNLI  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              ++ EH  N +++ N       E ++DVLL
Sbjct  245  NNLVAEHTVNTSSKTN-------ETLLDVLL  268



>ref|XP_002513339.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48742.1| cytochrome P450, putative [Ricinus communis]
 gb|AIM47548.1| CYP726A17 [Ricinus communis]
Length=497

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 129/282 (46%), Positives = 188/282 (67%), Gaps = 9/282 (3%)
 Frame = +3

Query  39   MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
            ME + L  PV ++ F+ F+  I  + ++SNP      PPGPWKLPL+G++H L GG+LPH
Sbjct  1    MEKQILSFPV-LLSFVLFILMILRIWKKSNP------PPGPWKLPLLGNIHQLAGGALPH  53

Query  219  RTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCT  398
              LR+L++ YGP+M +QLG+ISA+VISS Q AK + KT   VFA RP +++  +V Y   
Sbjct  54   HRLRDLAKTYGPVMSIQLGQISAVVISSVQGAKEVLKTQGEVFAERPLIIAAKIVLYNRK  113

Query  399  DVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKI  578
            D+ F  YGD+WRQMRKIC LELLS K V+SF S R+EE+SE +  +++    P+NLT+ +
Sbjct  114  DIVFGSYGDHWRQMRKICTLELLSAKRVQSFRSVREEEVSEFVRFLQSKAGTPVNLTKTL  173

Query  579  CWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRL  758
               T+S +A+ + G+ + E QE F  ++     ++GGF VAD+FPS  ++H ++G K RL
Sbjct  174  FALTNSIMARTSIGK-KCEKQETFSSVIDGVTEVSGGFTVADVFPSLGFLHVITGMKSRL  232

Query  759  LKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             ++HR  D+IFE II EHK   A   N+  K+   +++DVLL
Sbjct  233  ERLHRVADQIFEDIIAEHKATRALSKNDDPKE-AANLLDVLL  273



>ref|XP_003535173.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=500

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/272 (44%), Positives = 185/272 (68%), Gaps = 1/272 (0%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRK  245
            S ++ +   F ++ L +    +  QKLPPGP KLP+IG+LH L   GSLPH  LR+L++K
Sbjct  5    SYLLLIGLFFVLHWLAKCYKSSVSQKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGEISA+V SSP++AK I KTHD+ F  RP ++   ++ Y    +AF+PYGD
Sbjct  65   YGPLMHLQLGEISAVVASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            +WRQ RK+C  ELLSTK V+SF S R++E ++ I SI+ S  +PINLT +I     ++I+
Sbjct  125  HWRQTRKMCATELLSTKRVQSFASIREDEAAKFIDSIRESAGSPINLTSRIFSLICASIS  184

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + AFG + ++  E  + L+++ +   GGF +AD+FPS  ++++++G   RL K+H++VDK
Sbjct  185  RVAFGGIYKDQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFLTGKMTRLKKLHKQVDK  244

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVL  881
            + E II EH++       + A+  ++D +D+L
Sbjct  245  VLENIIREHQEKNKIAKEDGAELEDQDFIDLL  276



>dbj|BAM68815.1| cytochrome P450 monooxygenase CYP71AV2 [Artemisia maritima]
Length=495

 Score =   257 bits (657),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +F +Y    RS   +     P PW+LP+IG +HHL+G ++PHR + +L+RKYG 
Sbjct  16   IALATILFFVYKFATRSKSNKNSL--PEPWRLPIIGHMHHLIG-TIPHRGVMDLARKYGS  72

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+S IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TD+  +PYG+YWR
Sbjct  73   LMHLQLGEVSTIVVSSPKWAKEILTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWR  132

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RK+C LELLS K VKSF S R+EE   L+  IKA+GS  P+NL+E I    ++ +++A
Sbjct  133  QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEIKAAGSGRPVNLSENIFKLIATILSRA  192

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ  F  +VKE L   GGF VAD+FPSKK++H++SG + RL  +H ++D + 
Sbjct  193  AFGKGIK-DQREFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHMKLDNLI  251

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              ++ EH  N +++ N       E ++DVLL
Sbjct  252  NNLVAEHTVNTSSKTN-------ETLLDVLL  275



>gb|ABC41927.1| amorpha-4,11-diene monooxygenase [Artemisia annua]
Length=488

 Score =   257 bits (656),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  9    IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIG-TTPHRGVRDLARKYGS  65

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+  IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TDV  +PYG+YWR
Sbjct  66   LMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWR  125

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RKIC LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E I    ++ +++A
Sbjct  126  QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENIFKLIATILSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+    +VKE L   GGF VAD+FPSKK++H++SG + RL  + +++D + 
Sbjct  186  AFGKGIK-DQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLI  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + ++ EH  N +++ N       E ++DVLL
Sbjct  245  DNLVAEHTVNTSSKTN-------ETLLDVLL  268



>ref|XP_011081964.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=513

 Score =   257 bits (657),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/261 (50%), Positives = 187/261 (72%), Gaps = 15/261 (6%)
 Frame = +3

Query  132  ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQL  311
             R +KLPPGPWKLP+IG LHH+  G+LPHR+ + L++KYGP+MH +LGE++A+V+SSP L
Sbjct  31   TRSRKLPPGPWKLPVIGHLHHI--GTLPHRSFQELAKKYGPLMHFKLGEVTAVVVSSPTL  88

Query  312  AKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSF  491
            +K + K HD  FA+RP+ ++ ++++Y  ++++FS YGDYWRQMRKIC+LELLS K VKSF
Sbjct  89   SKEVLKVHDPTFADRPENIAGEILWYNSSNISFSQYGDYWRQMRKICILELLSAKNVKSF  148

Query  492  NSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEA  671
             S R +E+S L+ SI AS  AP++LTEKI   TSS   +AAFG+V R D+++ I + KE 
Sbjct  149  GSIRNDEVSHLVDSIGASSGAPVDLTEKIFMLTSSITCRAAFGKVCR-DKDQLIEMFKEG  207

Query  672  LSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEH----------KDN  821
            ++L  GF V+DL+PS K +  +S  + +LL++ R++D I + II EH          KDN
Sbjct  208  ITLVSGFDVSDLYPSSKILRAISCNRRKLLRMRRKLDLILDDIIGEHRRNLAKIAADKDN  267

Query  822  MANRNNNKAKDHEEDIVDVLL  884
            +  R N +  +  ED+VDVLL
Sbjct  268  LERRGNGEFGN--EDLVDVLL  286



>ref|XP_003520242.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=502

 Score =   257 bits (656),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 119/273 (44%), Positives = 186/273 (68%), Gaps = 1/273 (0%)
 Frame = +3

Query  69   SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRK  245
            +  + ++  F ++ L +  N +   KLPPGP KLP+IG+LH L   GSLPH  LR+L++K
Sbjct  5    TFFLVIALFFLLHWLAKCYNSSVCHKLPPGPKKLPIIGNLHQLAEAGSLPHHALRDLAKK  64

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHLQLGEISA+V SSP++AK I KTHD+ F  RP ++   ++ Y    +AF+PYGD
Sbjct  65   YGPLMHLQLGEISAVVASSPKMAKEIVKTHDVSFLQRPHLVFGQMISYGGLGIAFAPYGD  124

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            +WRQMRK+C  ELLS K V+SF S R++E ++ I  I+ S  +PINLT +I     ++I+
Sbjct  125  HWRQMRKMCATELLSAKRVQSFASIREDEAAKFIDLIRESAGSPINLTSRIFSLICASIS  184

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            + AFG + +E  E  + L+++ +   GGF +AD+FPS  ++++++G   RL K+H++VDK
Sbjct  185  RVAFGGIYKEQDEFVVSLIRKIVESGGGFDLADVFPSIPFLYFITGKMARLKKLHKQVDK  244

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + E II++H +   +   + A+  ++D +D+LL
Sbjct  245  VLENIIKDHHEKNKSAKEDGAEVEDQDFIDLLL  277



>gb|ABG91755.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
Length=495

 Score =   256 bits (655),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  16   IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIG-TTPHRGVRDLARKYGS  72

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+  IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TDV  +PYG+YWR
Sbjct  73   LMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWR  132

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RKIC LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E I    ++ +++A
Sbjct  133  QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENIFKLIATILSRA  192

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+    +VKE L   GGF VAD+FPSKK++H++SG + RL  + +++D + 
Sbjct  193  AFGKGIK-DQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLI  251

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + ++ EH  N +++ N       E ++DVLL
Sbjct  252  DNLVAEHTVNTSSKTN-------ETLLDVLL  275



>gb|ABE57266.1| amorpha-4,11-diene monooxygenase [Artemisia annua]
Length=488

 Score =   256 bits (654),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  9    IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIG-TTPHRGVRDLARKYGS  65

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+  IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TDV  +PYG+YWR
Sbjct  66   LMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWR  125

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RKIC LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E +    ++ +++A
Sbjct  126  QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENVFKLIATILSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+    +VKE L   GGF VAD+FPSKK++H++SG + RL  + +++D + 
Sbjct  186  AFGKGIK-DQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLI  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + ++ EH  N +++ N       E ++DVLL
Sbjct  245  DNLVAEHTVNTSSKTN-------ETLLDVLL  268



>gb|AFP19100.1| amorphadiene oxidase [Artemisia annua]
Length=488

 Score =   256 bits (654),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  9    IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIG-TTPHRGVRDLARKYGS  65

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+  IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TDV  +PYG+YWR
Sbjct  66   LMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWR  125

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RKIC LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E +    ++ +++A
Sbjct  126  QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENVFKLIATILSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+    +VKE L   GGF VAD+FPSKK++H++SG + RL  + +++D + 
Sbjct  186  AFGKGIK-DQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLI  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + ++ EH  N +++ N       E ++DVLL
Sbjct  245  DNLVAEHTVNTSSKTN-------ETLLDVLL  268



>ref|XP_004295869.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/273 (46%), Positives = 186/273 (68%), Gaps = 8/273 (3%)
 Frame = +3

Query  78   VFLSF-VFCIYTLR---RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            V L+F +F +  L+   R    +    LPPGP +LP IG++H L  GSLPHR+LRNL+ K
Sbjct  10   VILTFSLFVVMVLKITIRGKTKSSSSNLPPGPRELPFIGNIHQL-AGSLPHRSLRNLANK  68

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YGP+MHL+LGEIS +V+SS + A+ + KTHD+ FA RP +++ D+V Y CT++ F+ YGD
Sbjct  69   YGPLMHLRLGEISTVVVSSAEFAREVMKTHDVTFATRPYLLAADIVNYNCTNIVFAKYGD  128

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIA  605
            YWRQ+RKIC LE+LS K V+S+   R+EE+  LI  I +   +PINLTEKI   T +   
Sbjct  129  YWRQLRKICTLEVLSPKRVQSYRPIREEEMLNLIKWIASKARSPINLTEKIYSSTYTITT  188

Query  606  KAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDK  785
            +AAFG+ + +  E FI  VKE + L GGF +AD+FPS + +H ++G +P+L ++H++ D+
Sbjct  189  RAAFGK-KSKYHEEFIDCVKEGIQLGGGFDLADVFPSYRLLHMITGLRPKLERLHKKTDR  247

Query  786  IFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            I E II+E +D   ++      + +E +++VLL
Sbjct  248  ILENIIKELRDKETSKGGE--SETQEHLIEVLL  278



>gb|AFO64615.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=488

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  9    IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIG-TTPHRRVRDLARKYGS  65

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+  IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TDV  +PYG+YWR
Sbjct  66   LMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWR  125

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RKIC LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E +    ++ +++A
Sbjct  126  QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENVFKLIATILSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+    +VKE L   GGF VAD+FPSKK++H++SG + RL  + +++D + 
Sbjct  186  AFGKGIK-DQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLI  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + ++ EH  N +++ N       E ++DVLL
Sbjct  245  DNLVAEHTVNTSSKTN-------ETLLDVLL  268



>gb|KCW68417.1| hypothetical protein EUGRSUZ_F02067, partial [Eucalyptus grandis]
Length=484

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/271 (46%), Positives = 186/271 (69%), Gaps = 4/271 (1%)
 Frame = +3

Query  72   VIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
            V+ F  F+F      ++S+     KLPPGP KLP+IG+LH L+G S  H  L  L++ YG
Sbjct  11   VLSFFIFIFTAIKYSQKSDVKGLSKLPPGPRKLPVIGNLHQLLG-SPAHCALWELAKIYG  69

Query  252  PIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYW  431
            P+MH+Q GE+  +VISS ++AK + KTHD+ FA RP++++ +V+ Y  TD+AF+PY +YW
Sbjct  70   PLMHMQFGEVPHVVISSAEMAKEVMKTHDITFATRPRLLATEVLSYGSTDIAFAPYSEYW  129

Query  432  RQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKA  611
            RQ+RKIC LELLS K V+SF   R+EE+S L+  + ++  +PINLT+++        + A
Sbjct  130  RQLRKICTLELLSAKRVQSFRHIREEEISNLVKWVASNAGSPINLTQRLFSTNYGATSIA  189

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  +E QE FI +VKEA+ LA GF V D+FPS KW+H ++G KPRL K+ +++D+I 
Sbjct  190  AFGKKVKE-QEEFITIVKEAIRLAAGFEVGDVFPSLKWLHVITGMKPRLEKLRQQLDRIM  248

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
              +I E ++  ANR++++     + +VDVLL
Sbjct  249  NNLIREKEEERANRSSDETT--LDGLVDVLL  277



>ref|XP_007020553.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12078.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=518

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 178/250 (71%), Gaps = 6/250 (2%)
 Frame = +3

Query  144  KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAI  323
            KLPPGPWKLPLIG+LH LV  +LPH TLR+L++KYGP+M L+LGE+  +V+SS ++AK +
Sbjct  42   KLPPGPWKLPLIGNLHQLVS-TLPHYTLRDLAKKYGPLMWLKLGEVPTLVVSSLEMAKEV  100

Query  324  TKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFR  503
             +THD+ F  RP +++  ++ Y   D+ FSPYG+YWRQM+KIC+ ELLST  V+SF S R
Sbjct  101  MRTHDVTFCQRPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELLSTNRVQSFQSIR  160

Query  504  QEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLA  683
            ++E+S L+  I ++  +P+NL+EKI   T    A+AAFG+ +  D+E FI +  E   LA
Sbjct  161  EQEVSALMEIISSNARSPVNLSEKIYSMTYGITARAAFGK-KSGDEEEFISIAIEVSKLA  219

Query  684  GGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKD---NMANRNNNKAKD  854
            GGF +AD++PS + +  +SG + +L K+H+  D+I E II++HK+    MAN      KD
Sbjct  220  GGFCLADMYPSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRNGMANTKTGNKKD  279

Query  855  HEEDIVDVLL  884
             EED+VDVLL
Sbjct  280  -EEDLVDVLL  288



>sp|Q1PS23.1|AMO_ARTAN RecName: Full=Amorpha-4,11-diene 12-monooxygenase; AltName: Full=Amorpha-4,11-diene 
C-12 oxidase; AltName: Full=Cytochrome 
P450 71AV1 [Artemisia annua]
 gb|ABB82944.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
 gb|AEQ63684.1| amorpha-4,11-diene oxidase [synthetic construct]
Length=495

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  16   IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIG-TTPHRGVRDLARKYGS  72

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+  IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TDV  +PYG+YWR
Sbjct  73   LMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWR  132

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RKIC LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E +    ++ +++A
Sbjct  133  QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENVFKLIATILSRA  192

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+    +VKE L   GGF VAD+FPSKK++H++SG + RL  + +++D + 
Sbjct  193  AFGKGIK-DQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLI  251

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + ++ EH  N +++ N       E ++DVLL
Sbjct  252  DNLVAEHTVNTSSKTN-------ETLLDVLL  275



>gb|KHM99474.1| Cytochrome P450 71D11, partial [Glycine soja]
Length=511

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/279 (47%), Positives = 191/279 (68%), Gaps = 16/279 (6%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRR-RSNPARRQ----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLS  239
            +V +SF F    +++ R  P +      K+P GP KLP+IG++++L+  S PHR LR+L+
Sbjct  11   LVLISFAFTTIIVQKIRKKPKKTDDTTCKIPHGPRKLPIIGNIYNLLC-SQPHRKLRDLA  69

Query  240  RKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPY  419
             KYGP+MHLQLG++S IVISSP+ A+ + KTHD+ FA RPK+++ +++ Y  T +AF+ Y
Sbjct  70   IKYGPVMHLQLGQVSTIVISSPECAREVMKTHDINFATRPKVLAIEIMSYNSTSIAFAGY  129

Query  420  GDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSST  599
            G+YWRQ+RKIC LELLS K V SF   R++EL  L+  I +   +PINLTE +     + 
Sbjct  130  GNYWRQLRKICTLELLSLKRVNSFQPIREDELFNLVKWIDSKKGSPINLTEAVLTSIYTI  189

Query  600  IAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREV  779
             ++AAFG+   +DQE+FI +VK+   LA GFG+ DLFPS  W+ +V+G + +L ++H++ 
Sbjct  190  ASRAAFGK-NCKDQEKFISVVKKTSKLAAGFGIEDLFPSVTWLQHVTGLRAKLERLHQQA  248

Query  780  DKIFELIIEEHKDNMANRNNNKAKDH----EEDIVDVLL  884
            D+I E II EHK+      N+KAKD     EED+VDVL+
Sbjct  249  DQIMENIINEHKE-----ANSKAKDDQSEAEEDLVDVLI  282



>ref|XP_003532168.1| PREDICTED: cytochrome P450 71D11 [Glycine max]
Length=509

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 130/279 (47%), Positives = 191/279 (68%), Gaps = 16/279 (6%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRR-RSNPARRQ----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLS  239
            +V +SF F    +++ R  P +      K+P GP KLP+IG++++L+  S PHR LR+L+
Sbjct  9    LVLISFAFTTIIVQKIRKKPKKTDDTTCKIPHGPRKLPIIGNIYNLLC-SQPHRKLRDLA  67

Query  240  RKYGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPY  419
             KYGP+MHLQLG++S IVISSP+ A+ + KTHD+ FA RPK+++ +++ Y  T +AF+ Y
Sbjct  68   IKYGPVMHLQLGQVSTIVISSPECAREVMKTHDINFATRPKVLAIEIMSYNSTSIAFAGY  127

Query  420  GDYWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSST  599
            G+YWRQ+RKIC LELLS K V SF   R++EL  L+  I +   +PINLTE +     + 
Sbjct  128  GNYWRQLRKICTLELLSLKRVNSFQPIREDELFNLVKWIDSKKGSPINLTEAVLTSIYTI  187

Query  600  IAKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREV  779
             ++AAFG+   +DQE+FI +VK+   LA GFG+ DLFPS  W+ +V+G + +L ++H++ 
Sbjct  188  ASRAAFGK-NCKDQEKFISVVKKTSKLAAGFGIEDLFPSVTWLQHVTGLRAKLERLHQQA  246

Query  780  DKIFELIIEEHKDNMANRNNNKAKDH----EEDIVDVLL  884
            D+I E II EHK+      N+KAKD     EED+VDVL+
Sbjct  247  DQIMENIINEHKE-----ANSKAKDDQSEAEEDLVDVLI  280



>gb|KDP29297.1| hypothetical protein JCGZ_19400 [Jatropha curcas]
Length=546

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/249 (50%), Positives = 179/249 (72%), Gaps = 3/249 (1%)
 Frame = +3

Query  141  QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKA  320
            ++LPPGP KLPLIG+LH+L G   PH  L  L+++YGP+MHLQLGEISAIV+S+P++A+ 
Sbjct  60   KRLPPGPIKLPLIGNLHNLAGAQ-PHHALTELAKEYGPLMHLQLGEISAIVVSNPRIAQV  118

Query  321  ITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSF  500
            I KTHDLVFA+RP++++  ++ Y   D+AFS  G+YW+QM++I ++ELL  K V+SF S 
Sbjct  119  IMKTHDLVFADRPEILAAKIITYGGQDIAFSKLGEYWKQMKRISLMELLGPKTVQSFASL  178

Query  501  RQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSL  680
            R+ E+ +LI SI  S   PIN TEKI   T+    KAAFG    +DQ+  I L KEA ++
Sbjct  179  RENEVEKLIQSIHLSKGKPINFTEKIFHLTNVITCKAAFGD-ECKDQDVVIALTKEATTI  237

Query  681  AGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRN-NNKAKDH  857
            AGGFG+AD+FPS +++  ++G K +L K+  E+  +F  II+EHK  + NR+ ++  +  
Sbjct  238  AGGFGIADVFPSMEFLQAITGVKGKLEKLRDELGDVFGNIIDEHKQKLMNRDGSDDVESE  297

Query  858  EEDIVDVLL  884
            +ED+VDVLL
Sbjct  298  KEDLVDVLL  306



>ref|XP_004232610.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 190/270 (70%), Gaps = 5/270 (2%)
 Frame = +3

Query  78   VFLSFVFCIYTLRRRSNPARRQ-KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
             F S +  I+T+   S   +    LPPGPWKLP IGS+HHL+   LPH TLR+L++K+GP
Sbjct  9    TFFSILLLIFTVNLLSKKRKSTLNLPPGPWKLPFIGSIHHLIASQLPHHTLRDLAKKHGP  68

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGEI  IVISSP++A+ + KTHDL F NRP ++S  ++ Y  +D+AF+PYG+YWR
Sbjct  69   LMHLQLGEIPTIVISSPRVAQEVLKTHDLAFTNRPGLLSVQILTYNYSDIAFAPYGNYWR  128

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSAPINLTEKICWFTSSTIAKAA  614
            QMRK+C LELLS K V SF S R+EE  +L+  +++   + INLTEKI   T++ I +AA
Sbjct  129  QMRKLCTLELLSAKNVVSFASIREEEAFDLLQDVESKSGSVINLTEKIYALTNAVICRAA  188

Query  615  FGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFE  794
            FG+ R+E+   F+ L+KE   +  G  ++++FPS K++  ++GTK +LLK+H++ DK+ +
Sbjct  189  FGKRRKEESTYFMSLIKELSLMITGLDISEVFPSLKFLQVITGTKEKLLKLHKKFDKVLD  248

Query  795  LIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            +IIEEHK    +  +++    + D+V++LL
Sbjct  249  MIIEEHK----HEYDDEESSRKTDLVNLLL  274



>gb|ABG49365.1| P450 monooxygenase [Artemisia annua]
 gb|ABM88788.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
Length=488

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 183/271 (68%), Gaps = 12/271 (4%)
 Frame = +3

Query  75   IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
            I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  9    IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIG-TTPHRGVRDLARKYGS  65

Query  255  IMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWR  434
            +MHLQLGE+  IV+SSP+ AK I  T+D+ FANRP+ ++ ++V Y  TDV  +PYG+YWR
Sbjct  66   LMHLQLGEVPTIVVSSPKWAKEILTTYDISFANRPETLTGEIVLYHNTDVVLAPYGEYWR  125

Query  435  QMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTIAKA  611
            Q+RKIC LELLS K VKSF S R+EE   L+  IKASGS  P+NL+E +    ++ +++A
Sbjct  126  QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIKASGSGRPVNLSENVFKLIATILSRA  185

Query  612  AFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIF  791
            AFG+  + DQ+    +VKE L   GGF VAD+FPSKK++H++SG + RL  + +++D + 
Sbjct  186  AFGKGIK-DQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNLI  244

Query  792  ELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
            + ++ EH  N +++ N       E ++DVLL
Sbjct  245  DNLVAEHTVNTSSKTN-------ETLLDVLL  268



>dbj|BAM68821.1| putative cytochrome P450 monooxygenase CYP71AV11v2 [Artemisia 
capillaris]
Length=496

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 182/274 (66%), Gaps = 16/274 (6%)
 Frame = +3

Query  66   VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
            ++ IVF    F IY    RS   +     P PW+LP+IG +HHL+G ++PHR L +L+RK
Sbjct  18   LATIVF----FVIYKFTTRSKSTKNSL--PEPWRLPIIGHMHHLIG-TIPHRGLMDLARK  70

Query  246  YGPIMHLQLGEISAIVISSPQLAKAITKTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGD  425
            YG +MHLQLGE+SAIV+SSP+ AK I  T+D+ F NRP+ +S +++ Y  TD+ F+PYG+
Sbjct  71   YGSLMHLQLGEVSAIVVSSPKAAKEIFTTYDITFGNRPETLSGEIIGYHNTDIVFAPYGE  130

Query  426  YWRQMRKICVLELLSTKMVKSFNSFRQEELSELISSIKASGSA-PINLTEKICWFTSSTI  602
            YWRQ+RKIC L+LLS K VKS+ S R+EE   L+  IKASGS  P+NL+E I    +   
Sbjct  131  YWRQVRKICTLDLLSAKKVKSYQSLREEECWNLVQEIKASGSGRPVNLSENIFKLIAMIF  190

Query  603  AKAAFGRVRREDQERFIVLVKEALSLAGGFGVADLFPSKKWIHYVSGTKPRLLKVHREVD  782
             +AAFG+  +E +E F   VKE L   GG  VAD+FPSKK++H++SG + RL  +H+++D
Sbjct  191  CRAAFGKGIKEHKE-FTENVKEMLKETGGMDVADIFPSKKFLHHLSGKRARLTSIHKKLD  249

Query  783  KIFELIIEEHKDNMANRNNNKAKDHEEDIVDVLL  884
             I   ++ EH    A++ N       E ++DVLL
Sbjct  250  NIINNVVAEHNVKTASKTN-------ETLLDVLL  276



>ref|XP_006364814.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=526

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 182/246 (74%), Gaps = 4/246 (2%)
 Frame = +3

Query  147  LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAIVISSPQLAKAIT  326
            LPPGPWKLP IGS+HHL+   LPH TLR+L++K+GP+MHLQLGEI  IVISSP++A+ + 
Sbjct  55   LPPGPWKLPFIGSIHHLIASQLPHHTLRDLAKKHGPLMHLQLGEIPTIVISSPRVAQEVL  114

Query  327  KTHDLVFANRPKMMSFDVVYYKCTDVAFSPYGDYWRQMRKICVLELLSTKMVKSFNSFRQ  506
            KTHD+ F NRP+++S  V+ Y C+D+AF+PYG+YWRQMRK+C LELLS K V SF S R+
Sbjct  115  KTHDIAFTNRPELLSVKVLTYNCSDIAFAPYGNYWRQMRKLCTLELLSAKNVVSFASIRE  174

Query  507  EELSELISSIKASGSAPINLTEKICWFTSSTIAKAAFGRVRREDQERFIVLVKEALSLAG  686
            EE   L+  +++   + INLTEKI   T++ I +AAFG+ R+E+   F+ L+KE   +  
Sbjct  175  EEALNLVQYVESKSGSIINLTEKIYALTNAVICRAAFGKRRKEESVYFMSLIKELSLMVS  234

Query  687  GFGVADLFPSKKWIHYVSGTKPRLLKVHREVDKIFELIIEEHKDNMANRNNNKAKDHEED  866
            G  ++++FPS K++  ++GTK +LLK+H++ DK+ ++IIEEHK    ++ + +    + D
Sbjct  235  GLDISEVFPSLKFLQVITGTKEKLLKLHKKFDKVLDMIIEEHK----HKYDEEESSRKND  290

Query  867  IVDVLL  884
            +V++LL
Sbjct  291  LVNLLL  296



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1798677760698