BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25867_g1_i1 len=1613 path=[1:0-154 9472:155-172 9490:173-198
7031:199-221 9526:222-276 9562:277-283 9574:284-286 704:287-300
718:301-325 9589:326-336 471:337-361 496:362-364 2407:365-388
9639:389-393 9644:394-396 9647:397-405 9656:406-435 9680:436-459
9704:460-517 1999:518-563 5034:564-602 9763:603-631 5101:632-688
5158:689-717 5187:718-757 9849:758-769 5239:770-784 9879:785-799
5268:800-859 1864:860-877 9916:878-886 9925:887-893 5359:894-918
5384:919-931 5397:932-955 9978:956-961 5427:962-965 5431:966-985
5451:986-1024 5490:1025-1056 5522:1057-1090 10019:1091-1155
5620:1156-1173 2157:1174-1197 5661:1198-1258 2234:1259-1403
10211:1404-1409 5868:1410-1522 1550:1523-1527 5985:1528-1584
6042:1585-1612]

Length=1613
                                                                      Score     E

gb|ABC69397.1|  CYP71D48v1                                              587   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009612725.1|  PREDICTED: premnaspirodiene oxygenase-like         583   0.0      
gb|ABC69396.1|  CYP71D48v2                                              581   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006355983.1|  PREDICTED: premnaspirodiene oxygenase-like         581   0.0      
ref|XP_009623936.1|  PREDICTED: premnaspirodiene oxygenase-like i...    579   0.0      
ref|XP_009766832.1|  PREDICTED: premnaspirodiene oxygenase-like         577   0.0      
gb|ABC69395.1|  CYP71D47v2                                              577   0.0      Nicotiana tabacum [American tobacco]
dbj|BAC53923.1|  cytochrome P450                                        576   0.0      Petunia x hybrida [garden petunia]
ref|XP_004242036.1|  PREDICTED: premnaspirodiene oxygenase-like         575   0.0      
gb|ABC69394.1|  CYP71D47v1                                              575   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009770332.1|  PREDICTED: premnaspirodiene oxygenase-like         575   0.0      
ref|XP_006365912.1|  PREDICTED: premnaspirodiene oxygenase-like         573   0.0      
ref|XP_006361940.1|  PREDICTED: premnaspirodiene oxygenase-like         571   0.0      
ref|XP_004237369.1|  PREDICTED: premnaspirodiene oxygenase              571   0.0      
emb|CDP08465.1|  unnamed protein product                                567   0.0      
sp|A6YIH8.1|C7D55_HYOMU  RecName: Full=Premnaspirodiene oxygenase...    566   0.0      Hyoscyamus muticus
gb|ABC69405.1|  CYP71D51v3                                              567   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009758268.1|  PREDICTED: premnaspirodiene oxygenase              567   0.0      
ref|XP_004233564.1|  PREDICTED: premnaspirodiene oxygenase-like         565   0.0      
gb|AAF27282.1|AF122821_1  cytochrome P450                               563   0.0      Capsicum annuum
gb|ABC69403.1|  CYP71D51v1                                              563   0.0      Nicotiana tabacum [American tobacco]
emb|CAC24711.1|  cytochrome P450                                        563   0.0      Solanum tuberosum [potatoes]
dbj|BAN58140.1|  putative premaspirodiene oxygenase                     561   0.0      
ref|XP_006339043.1|  PREDICTED: premnaspirodiene oxygenase-like         561   0.0      
ref|XP_009623934.1|  PREDICTED: premnaspirodiene oxygenase-like         561   0.0      
ref|XP_006350396.1|  PREDICTED: premnaspirodiene oxygenase-like         560   0.0      
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like         560   0.0      
ref|XP_006365938.1|  PREDICTED: premnaspirodiene oxygenase-like         557   0.0      
ref|XP_004228510.1|  PREDICTED: premnaspirodiene oxygenase-like         556   0.0      
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7             555   0.0      Solanum chacoense
ref|XP_006365979.1|  PREDICTED: premnaspirodiene oxygenase-like         556   0.0      
ref|XP_006350393.1|  PREDICTED: cytochrome P450 71D7-like               555   0.0      
ref|XP_006350395.1|  PREDICTED: premnaspirodiene oxygenase-like         554   0.0      
ref|XP_009622900.1|  PREDICTED: cytochrome P450 71D7-like               553   0.0      
gb|ABC69399.1|  CYP71D49v1                                              553   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009608635.1|  PREDICTED: premnaspirodiene oxygenase-like         553   0.0      
gb|ABC69402.1|  CYP71D5v2                                               552   0.0      Nicotiana tabacum [American tobacco]
gb|ABC69398.1|  CYP71D5v3                                               551   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009764618.1|  PREDICTED: cytochrome P450 71D7-like isoform X1    551   0.0      
gb|ABC69400.1|  CYP71D49v3                                              550   0.0      Nicotiana tabacum [American tobacco]
ref|XP_004242219.2|  PREDICTED: cytochrome P450 71D7-like               550   0.0      
ref|XP_006339044.1|  PREDICTED: premnaspirodiene oxygenase-like         550   0.0      
ref|XP_006341699.1|  PREDICTED: premnaspirodiene oxygenase-like         550   0.0      
ref|XP_004241764.1|  PREDICTED: premnaspirodiene oxygenase-like         550   0.0      
ref|XP_006355212.1|  PREDICTED: premnaspirodiene oxygenase-like         549   0.0      
ref|XP_009765480.1|  PREDICTED: premnaspirodiene oxygenase-like         549   0.0      
ref|XP_006339046.1|  PREDICTED: premnaspirodiene oxygenase-like         548   0.0      
ref|XP_009598320.1|  PREDICTED: premnaspirodiene oxygenase-like         548   0.0      
ref|XP_004246079.1|  PREDICTED: cytochrome P450 71D7-like               548   0.0      
ref|XP_006367966.1|  PREDICTED: premnaspirodiene oxygenase-like         548   0.0      
ref|XP_004243471.1|  PREDICTED: premnaspirodiene oxygenase-like         546   0.0      
ref|XP_006359503.1|  PREDICTED: premnaspirodiene oxygenase-like         546   0.0      
ref|XP_006367127.1|  PREDICTED: premnaspirodiene oxygenase-like i...    546   0.0      
ref|XP_006350394.1|  PREDICTED: cytochrome P450 71D6-like               545   0.0      
ref|XP_006350417.1|  PREDICTED: cytochrome P450 71D7-like               543   0.0      
ref|XP_004245943.1|  PREDICTED: premnaspirodiene oxygenase-like         541   0.0      
ref|XP_009772938.1|  PREDICTED: premnaspirodiene oxygenase-like         541   0.0      
ref|XP_006365962.1|  PREDICTED: cytochrome P450 71D7-like               540   0.0      
ref|XP_009794456.1|  PREDICTED: premnaspirodiene oxygenase-like         538   0.0      
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like         537   0.0      
ref|XP_004249520.2|  PREDICTED: premnaspirodiene oxygenase-like         538   0.0      
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like         537   0.0      
ref|XP_006341698.1|  PREDICTED: premnaspirodiene oxygenase-like         536   0.0      
ref|XP_006352953.1|  PREDICTED: premnaspirodiene oxygenase-like         536   0.0      
ref|XP_009619325.1|  PREDICTED: premnaspirodiene oxygenase-like         536   0.0      
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...    535   0.0      
ref|XP_009606204.1|  PREDICTED: premnaspirodiene oxygenase-like         535   0.0      
emb|CDP07872.1|  unnamed protein product                                534   0.0      
ref|XP_009625417.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxylase    533   0.0      
ref|XP_004250027.1|  PREDICTED: cytochrome P450 71D7                    533   0.0      
ref|XP_009765039.1|  PREDICTED: premnaspirodiene oxygenase-like         532   0.0      
ref|XP_004228511.1|  PREDICTED: premnaspirodiene oxygenase-like         531   0.0      
ref|XP_009611155.1|  PREDICTED: premnaspirodiene oxygenase-like         531   0.0      
emb|CDP18841.1|  unnamed protein product                                531   0.0      
ref|XP_009801864.1|  PREDICTED: LOW QUALITY PROTEIN: 5-epiaristol...    530   2e-180   
sp|P93530.1|C71D6_SOLCH  RecName: Full=Cytochrome P450 71D6             529   3e-180   Solanum chacoense
gb|KHN42275.1|  Cytochrome P450 71D8                                    529   6e-180   
ref|XP_003529672.2|  PREDICTED: cytochrome P450 71D8-like               529   9e-180   
sp|Q94FM7.2|C71DK_TOBAC  RecName: Full=5-epiaristolochene 1,3-dih...    527   2e-179   Nicotiana tabacum [American tobacco]
ref|XP_009771988.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    526   8e-179   
ref|XP_004249519.1|  PREDICTED: premnaspirodiene oxygenase-like         526   1e-178   
gb|ABC69421.1|  CYP71D20v2                                              525   1e-178   Nicotiana tabacum [American tobacco]
ref|XP_009803037.1|  PREDICTED: premnaspirodiene oxygenase-like         524   4e-178   
emb|CDP20259.1|  unnamed protein product                                522   2e-177   
ref|XP_009587552.1|  PREDICTED: premnaspirodiene oxygenase-like         522   2e-177   
emb|CDP07879.1|  unnamed protein product                                522   2e-177   
ref|XP_004249812.1|  PREDICTED: premnaspirodiene oxygenase-like         521   6e-177   
ref|XP_009794009.1|  PREDICTED: premnaspirodiene oxygenase-like         521   6e-177   
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like         520   2e-176   
ref|XP_009612418.1|  PREDICTED: premnaspirodiene oxygenase-like         518   4e-176   
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like         517   1e-175   
emb|CDP07882.1|  unnamed protein product                                519   2e-175   
ref|XP_006357930.1|  PREDICTED: cytochrome P450 71D7-like               514   1e-174   
ref|XP_002522721.1|  cytochrome P450, putative                          513   4e-174   Ricinus communis
ref|XP_009793271.1|  PREDICTED: premnaspirodiene oxygenase-like         513   5e-174   
ref|XP_009612417.1|  PREDICTED: premnaspirodiene oxygenase-like         512   1e-173   
gb|AHH25653.1|  cytochrome P450 CYP71D                                  512   2e-173   
ref|XP_009794007.1|  PREDICTED: premnaspirodiene oxygenase-like         511   2e-173   
ref|XP_011081964.1|  PREDICTED: premnaspirodiene oxygenase-like         511   4e-173   
ref|XP_007154033.1|  hypothetical protein PHAVU_003G085400g             511   5e-173   
ref|XP_009624011.1|  PREDICTED: premnaspirodiene oxygenase-like i...    508   2e-172   
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         509   2e-172   
gb|AAD47832.1|  cytochrome P450                                         508   4e-172   Nicotiana tabacum [American tobacco]
ref|XP_009617877.1|  PREDICTED: premnaspirodiene oxygenase-like         508   8e-172   
ref|XP_009357363.1|  PREDICTED: premnaspirodiene oxygenase-like         508   8e-172   
gb|KDP39257.1|  hypothetical protein JCGZ_01014                         507   1e-171   
ref|XP_007020549.1|  Cytochrome P450                                    506   2e-171   
ref|XP_011081934.1|  PREDICTED: cytochrome P450 71D95-like              506   4e-171   
ref|XP_004231934.1|  PREDICTED: premnaspirodiene oxygenase-like         506   5e-171   
emb|CDP07881.1|  unnamed protein product                                517   6e-171   
gb|EYU21978.1|  hypothetical protein MIMGU_mgv1a004623mg                506   7e-171   
ref|XP_004228509.1|  PREDICTED: premnaspirodiene oxygenase-like         504   1e-170   
ref|XP_004511998.1|  PREDICTED: cytochrome P450 71D8-like               505   1e-170   
gb|KDP26294.1|  hypothetical protein JCGZ_22279                         505   1e-170   
ref|XP_003611883.1|  Cytochrome P450                                    504   2e-170   
gb|KEH34024.1|  cytochrome P450 family 71 protein                       503   4e-170   
ref|XP_011082374.1|  PREDICTED: premnaspirodiene oxygenase-like         503   1e-169   
ref|XP_008385924.1|  PREDICTED: premnaspirodiene oxygenase-like         503   1e-169   
ref|XP_006339045.1|  PREDICTED: premnaspirodiene oxygenase-like         502   2e-169   
gb|KEH34017.1|  cytochrome P450 family 71 protein                       502   2e-169   
emb|CDP10756.1|  unnamed protein product                                501   6e-169   
ref|XP_011082249.1|  PREDICTED: premnaspirodiene oxygenase-like         501   6e-169   
ref|XP_003516583.1|  PREDICTED: cytochrome P450 71D8-like               499   1e-168   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               499   2e-168   
emb|CDP07887.1|  unnamed protein product                                498   3e-168   
gb|AFK45297.1|  unknown                                                 497   7e-168   
ref|XP_003516584.1|  PREDICTED: cytochrome P450 71D8-like               498   7e-168   
ref|XP_010644548.1|  PREDICTED: premnaspirodiene oxygenase-like         496   2e-167   
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like               496   2e-167   
ref|XP_003611886.1|  Cytochrome P450                                    496   4e-167   
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               495   4e-167   
ref|XP_006345633.1|  PREDICTED: premnaspirodiene oxygenase-like         496   4e-167   
ref|XP_011087047.1|  PREDICTED: premnaspirodiene oxygenase-like         493   5e-166   
emb|CDP07886.1|  unnamed protein product                                492   5e-166   
ref|XP_003537457.1|  PREDICTED: cytochrome P450 71D8-like               492   1e-165   
ref|XP_006475119.1|  PREDICTED: premnaspirodiene oxygenase-like         492   1e-165   
emb|CDP10758.1|  unnamed protein product                                492   1e-165   
ref|XP_003550472.2|  PREDICTED: cytochrome P450 71D8-like               493   2e-165   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             492   2e-165   
ref|XP_004512032.1|  PREDICTED: cytochrome P450 71D8-like               491   4e-165   
ref|XP_010653207.1|  PREDICTED: cytochrome P450 71D9-like               490   6e-165   
gb|KDP39256.1|  hypothetical protein JCGZ_01013                         489   1e-164   
ref|XP_010655870.1|  PREDICTED: cytochrome P450 71D10-like              489   1e-164   
ref|XP_006363816.1|  PREDICTED: premnaspirodiene oxygenase-like i...    489   2e-164   
ref|XP_003610580.1|  Cytochrome P450                                    488   4e-164   
ref|XP_007147597.1|  hypothetical protein PHAVU_006G138100g             488   4e-164   
ref|XP_011081935.1|  PREDICTED: cytochrome P450 71D95-like              487   8e-164   
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg                488   9e-164   
ref|XP_003530791.1|  PREDICTED: cytochrome P450 71D9-like               487   1e-163   
ref|XP_009347232.1|  PREDICTED: cytochrome P450 71D11-like              486   2e-163   
ref|XP_007146610.1|  hypothetical protein PHAVU_006G054700g             486   2e-163   
ref|XP_004247352.1|  PREDICTED: premnaspirodiene oxygenase-like         486   2e-163   
ref|XP_006367128.1|  PREDICTED: premnaspirodiene oxygenase-like i...    483   3e-163   
gb|KHM99473.1|  Cytochrome P450 71D11                                   484   5e-163   
gb|KDO38617.1|  hypothetical protein CISIN_1g045050mg                   485   5e-163   
gb|AIZ01224.1|  epi-aristolochene dihydroxylase                         483   5e-163   
ref|XP_003517257.1|  PREDICTED: cytochrome P450 71D8-like               485   6e-163   
ref|XP_003551489.1|  PREDICTED: cytochrome P450 71D9-like               485   6e-163   
gb|KDP39287.1|  hypothetical protein JCGZ_01044                         485   6e-163   
ref|XP_003537455.1|  PREDICTED: cytochrome P450 71D8-like               485   7e-163   
gb|AAO32822.1|  cytochrome P450 71D1                                    484   7e-163   Catharanthus roseus [chatas]
gb|AGB55871.1|  flavonoid 6-hydroxylase 2                               484   8e-163   
gb|KHN43612.1|  Cytochrome P450 71D9                                    484   8e-163   
gb|ACD42776.1|  cytochrome P450 71D1                                    484   9e-163   Catharanthus roseus [chatas]
ref|XP_010655881.1|  PREDICTED: cytochrome P450 71D10-like              484   2e-162   
ref|XP_002522762.1|  cytochrome P450, putative                          483   3e-162   Ricinus communis
ref|XP_004511999.1|  PREDICTED: cytochrome P450 71D8-like               483   3e-162   
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like               483   3e-162   
gb|KEH34016.1|  cytochrome P450 family 71 protein                       482   4e-162   
sp|O81974.1|C71D8_SOYBN  RecName: Full=Cytochrome P450 71D8; AltN...    483   4e-162   Glycine max [soybeans]
ref|XP_003611884.1|  Cytochrome P450                                    483   5e-162   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               483   5e-162   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    483   6e-162   
ref|XP_008345750.1|  PREDICTED: cytochrome P450 71D8-like               483   6e-162   
ref|XP_002523467.1|  cytochrome P450, putative                          483   7e-162   Ricinus communis
ref|XP_008791005.1|  PREDICTED: premnaspirodiene oxygenase-like         482   8e-162   
ref|XP_008779150.1|  PREDICTED: premnaspirodiene oxygenase-like         482   1e-161   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              482   1e-161   
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like         481   2e-161   
gb|KHM99028.1|  Cytochrome P450 71D11                                   481   2e-161   
ref|XP_003600328.1|  Cytochrome P450                                    481   3e-161   
ref|XP_006605460.1|  PREDICTED: cytochrome P450 71D11-like              481   3e-161   
gb|EYU31465.1|  hypothetical protein MIMGU_mgv1a004885mg                481   4e-161   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       481   4e-161   
ref|XP_008777955.1|  PREDICTED: premnaspirodiene oxygenase-like         480   4e-161   
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              481   5e-161   
gb|KDP39024.1|  hypothetical protein JCGZ_00781                         481   6e-161   
ref|XP_008778500.1|  PREDICTED: premnaspirodiene oxygenase-like         480   6e-161   
gb|KDP29297.1|  hypothetical protein JCGZ_19400                         481   9e-161   
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                    481   9e-161   
ref|XP_008807779.1|  PREDICTED: premnaspirodiene oxygenase-like         479   1e-160   
gb|KEH26493.1|  cytochrome P450 family 71 protein                       479   1e-160   
ref|XP_008807778.1|  PREDICTED: premnaspirodiene oxygenase-like         479   1e-160   
ref|XP_006351653.1|  PREDICTED: premnaspirodiene oxygenase-like         479   2e-160   
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like              479   2e-160   
ref|XP_009615716.1|  PREDICTED: premnaspirodiene oxygenase-like         479   2e-160   
ref|XP_007156881.1|  hypothetical protein PHAVU_002G025000g             479   2e-160   
ref|XP_003517259.1|  PREDICTED: cytochrome P450 71D8-like               478   2e-160   
gb|KEH15784.1|  cytochrome P450 family 71 protein                       478   3e-160   
ref|XP_004232610.1|  PREDICTED: premnaspirodiene oxygenase-like         478   3e-160   
ref|XP_007146612.1|  hypothetical protein PHAVU_006G054900g             477   5e-160   
sp|E1B2Z9.1|C7AV8_CICIN  RecName: Full=Cytochrome P450 71AV8; Alt...    477   7e-160   
gb|AJD25162.1|  cytochrome P450 CYP71D374                               477   7e-160   
gb|KEH34014.1|  cytochrome P450 family 71 protein                       477   7e-160   
ref|XP_004512033.1|  PREDICTED: cytochrome P450 71D8-like               477   8e-160   
ref|XP_006346274.1|  PREDICTED: premnaspirodiene oxygenase-like         478   9e-160   
gb|AAK62343.2|  elicitor-inducible cytochrome P450                      476   9e-160   Nicotiana tabacum [American tobacco]
ref|XP_007146605.1|  hypothetical protein PHAVU_006G054200g             476   2e-159   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               476   2e-159   
ref|XP_011082254.1|  PREDICTED: premnaspirodiene oxygenase              476   2e-159   
gb|KHN36164.1|  Cytochrome P450 71D8                                    476   2e-159   
ref|XP_007020553.1|  Cytochrome P450 71D10, putative                    476   3e-159   
gb|KHN36162.1|  Cytochrome P450 71D8                                    473   4e-159   
ref|XP_007156884.1|  hypothetical protein PHAVU_002G025300g             475   4e-159   
ref|XP_007146608.1|  hypothetical protein PHAVU_006G054500g             475   4e-159   
ref|XP_003617704.1|  Cytochrome P450                                    475   4e-159   
gb|KHM99475.1|  Cytochrome P450 71D9                                    474   5e-159   
ref|XP_006452551.1|  hypothetical protein CICLE_v10010293mg             474   8e-159   
ref|XP_010061472.1|  PREDICTED: cytochrome P450 71D11-like              475   8e-159   
ref|XP_010910161.1|  PREDICTED: premnaspirodiene oxygenase-like         474   9e-159   
gb|AES59944.2|  cytochrome P450 family 71 protein                       474   9e-159   
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g             474   9e-159   
ref|XP_003589693.1|  Cytochrome P450                                    474   1e-158   
gb|KDO37182.1|  hypothetical protein CISIN_1g010699mg                   474   1e-158   
gb|AET00662.2|  cytochrome P450 family 71 protein                       474   1e-158   
gb|KHG02344.1|  Cytochrome P450                                         474   2e-158   
gb|AGB55874.1|  flavonoid 6-hydroxylase 3                               473   2e-158   
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             473   2e-158   
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...    473   3e-158   
gb|AIA09039.1|  costunolide synthase                                    472   4e-158   
sp|D5JBW9.1|GAO_SAUCO  RecName: Full=Germacrene A oxidase; Short=...    472   5e-158   
gb|ADD84654.1|  CYP71D175                                               473   5e-158   Scoparia dulcis [escobilla]
ref|XP_010921587.1|  PREDICTED: premnaspirodiene oxygenase-like         473   6e-158   
gb|AGC29947.1|  CYP71BE30                                               472   6e-158   
ref|XP_003600322.1|  Cytochrome P450                                    472   6e-158   
gb|AEX07771.1|  cytochrome P450                                         472   6e-158   
ref|XP_004491491.1|  PREDICTED: premnaspirodiene oxygenase-like         473   6e-158   
gb|AGN04217.1|  cytochrome P450                                         472   7e-158   
gb|AIA09038.1|  costunolide synthase                                    472   7e-158   
ref|XP_006452560.1|  hypothetical protein CICLE_v10008075mg             471   1e-157   
ref|XP_008778208.1|  PREDICTED: premnaspirodiene oxygenase-like         472   1e-157   
ref|XP_010910607.1|  PREDICTED: premnaspirodiene oxygenase-like         471   1e-157   
gb|AFO64615.1|  cytochrome P450 mono-oxygenase                          471   1e-157   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              472   1e-157   
dbj|BAM68819.1|  putative cytochrome P450 monooxygenase CYP71AV1        471   1e-157   
sp|Q1PS23.1|AMO_ARTAN  RecName: Full=Amorpha-4,11-diene 12-monoox...    471   1e-157   Artemisia annua [sweet Annie]
ref|XP_003589691.1|  Cytochrome P450                                    471   1e-157   
gb|KHG11859.1|  Cytochrome P450                                         471   2e-157   
gb|KEH41118.1|  cytochrome P450 family 71 protein                       471   2e-157   
gb|AFP19100.1|  amorphadiene oxidase                                    471   2e-157   
gb|ABE57266.1|  amorpha-4,11-diene monooxygenase                        471   2e-157   Artemisia annua [sweet Annie]
gb|KHN39921.1|  Cytochrome P450 71D8                                    471   2e-157   
gb|KHM99472.1|  Cytochrome P450 71D11                                   471   2e-157   
ref|XP_003600339.1|  Cytochrome P450                                    471   2e-157   
dbj|BAM68808.1|  cytochrome P450 monooxygenase CYP71AV1                 470   2e-157   
gb|KDP39285.1|  hypothetical protein JCGZ_01042                         471   3e-157   
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like               471   3e-157   
gb|ABC41927.1|  amorpha-4,11-diene monooxygenase                        470   3e-157   Artemisia annua [sweet Annie]
ref|XP_007153133.1|  hypothetical protein PHAVU_003G009500g             471   3e-157   
ref|XP_007153130.1|  hypothetical protein PHAVU_003G009200g             471   3e-157   
ref|XP_004304108.1|  PREDICTED: cytochrome P450 71D11-like              471   3e-157   
gb|AGO03787.1|  cytochrome P450                                         470   4e-157   
ref|XP_009775980.1|  PREDICTED: premnaspirodiene oxygenase-like         470   5e-157   
ref|XP_003617706.1|  Cytochrome P450 71D10                              470   5e-157   
ref|XP_006364814.1|  PREDICTED: premnaspirodiene oxygenase-like         471   6e-157   
ref|XP_008779112.1|  PREDICTED: premnaspirodiene oxygenase-like         469   6e-157   
dbj|BAM68810.1|  putative CYP71AV1 ortholog                             469   7e-157   
dbj|BAM68809.1|  putative CYP71AV1 ortholog                             469   8e-157   
gb|ABG91755.1|  amorpha-4,11-diene C-12 oxidase                         469   8e-157   Artemisia annua [sweet Annie]
ref|XP_003537216.1|  PREDICTED: cytochrome P450 71D8-like               469   9e-157   
ref|XP_002522903.1|  cytochrome P450, putative                          470   1e-156   Ricinus communis
ref|XP_007020557.1|  Cytochrome P450, putative                          469   1e-156   
ref|XP_003617731.1|  Cytochrome P450                                    469   1e-156   
dbj|BAM68815.1|  cytochrome P450 monooxygenase CYP71AV2                 468   1e-156   
gb|ABI31728.1|  amorpha-4,11-diene C-12 oxidase                         468   2e-156   Artemisia annua [sweet Annie]
ref|XP_004295868.1|  PREDICTED: cytochrome P450 71D11-like              469   2e-156   
gb|KHN42024.1|  Cytochrome P450 71D8                                    467   2e-156   
ref|XP_003535170.1|  PREDICTED: cytochrome P450 71D8-like               468   2e-156   
ref|XP_003520242.1|  PREDICTED: cytochrome P450 71D8-like               468   2e-156   
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             468   3e-156   
ref|XP_007099625.1|  Cytochrome P450 71D10, putative                    473   3e-156   
gb|KHN08718.1|  Cytochrome P450 71D8                                    468   3e-156   
gb|ADU25498.1|  cytochrome P450 monooxygenase                           467   3e-156   
ref|XP_010064672.1|  PREDICTED: cytochrome P450 71D11-like              468   3e-156   
gb|KEH25843.1|  cytochrome P450 family 71 protein                       468   3e-156   
ref|XP_003537212.1|  PREDICTED: cytochrome P450 71D8-like               468   4e-156   
ref|XP_008794219.1|  PREDICTED: premnaspirodiene oxygenase-like         467   5e-156   
gb|AIA09035.1|  germacrene A oxidase                                    467   5e-156   
gb|ABG49365.1|  P450 monooxygenase                                      467   5e-156   
gb|ABG49366.1|  P450 monooxygenase                                      467   6e-156   
ref|XP_007156882.1|  hypothetical protein PHAVU_002G025100g             467   6e-156   
ref|XP_003617701.1|  Cytochrome P450                                    468   6e-156   
ref|XP_007216122.1|  hypothetical protein PRUPE_ppa018839mg             468   7e-156   
gb|AHN62855.1|  germacrene A oxidase                                    466   7e-156   
ref|XP_007161221.1|  hypothetical protein PHAVU_001G052100g             468   7e-156   
ref|XP_003617705.1|  Cytochrome P450                                    466   1e-155   
ref|XP_003535171.1|  PREDICTED: cytochrome P450 71D8-like               466   1e-155   
gb|EYU21953.1|  hypothetical protein MIMGU_mgv1a025918mg                466   2e-155   
ref|XP_006380104.1|  hypothetical protein POPTR_0008s21950g             465   2e-155   
ref|XP_004491658.1|  PREDICTED: uncharacterized protein LOC101503808    482   3e-155   
ref|XP_007156883.1|  hypothetical protein PHAVU_002G025200g             466   3e-155   
emb|CDP17903.1|  unnamed protein product                                464   3e-155   
ref|XP_003535169.1|  PREDICTED: cytochrome P450 71D8-like               465   4e-155   
gb|KDP39254.1|  hypothetical protein JCGZ_01011                         465   4e-155   
gb|AIA09036.1|  germacrene A oxidase                                    464   4e-155   
dbj|BAM68816.1|  putative cytochrome P450 monooxygenase CYP71AV1        465   4e-155   
gb|AGO03789.1|  germacrene A oxidase                                    464   4e-155   
ref|XP_003600330.1|  Cytochrome P450                                    465   4e-155   
ref|XP_003617703.1|  Cytochrome P450                                    473   5e-155   
ref|XP_007020556.1|  Cytochrome P450 71D10, putative                    465   5e-155   
gb|KCW68416.1|  hypothetical protein EUGRSUZ_F02065                     466   5e-155   
ref|XP_011081932.1|  PREDICTED: cytochrome P450 71D95-like              464   6e-155   
gb|ABO32530.1|  cytochrome P450-dependent monooxygenase-like protein    464   6e-155   
gb|AES70585.2|  cytochrome P450 family 71 protein                       468   6e-155   
ref|XP_003615865.1|  Cytochrome P450                                    464   8e-155   
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              464   8e-155   
gb|KCW76838.1|  hypothetical protein EUGRSUZ_D01192                     464   1e-154   
gb|ACF74516.1|  amorpha-4,11-diene monooxygenase                        464   1e-154   
sp|G3GBK0.1|C7BL3_CICIN  RecName: Full=Costunolide synthase; Shor...    463   1e-154   
gb|KEH25835.1|  cytochrome P450 family 71 protein                       463   1e-154   
ref|XP_010932987.1|  PREDICTED: premnaspirodiene oxygenase-like         463   2e-154   
sp|D5JBX1.1|GAO_BARSP  RecName: Full=Germacrene A oxidase; Short=...    463   2e-154   
ref|XP_004247351.1|  PREDICTED: premnaspirodiene oxygenase-like         463   2e-154   
ref|XP_011077043.1|  PREDICTED: premnaspirodiene oxygenase-like         463   2e-154   
ref|XP_003636315.1|  Cytochrome P450                                    463   2e-154   
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg             463   3e-154   
dbj|BAM68817.1|  putative cytochrome P450 monooxygenase CYP71AV1        462   4e-154   
emb|CDP07893.1|  unnamed protein product                                462   4e-154   
ref|XP_010061471.1|  PREDICTED: cytochrome P450 71D11-like              462   5e-154   
dbj|BAM68818.1|  putative cytochrome P450 monooxygenase CYP71AV1        462   6e-154   
dbj|BAM68811.1|  putative CYP71AV1 ortholog                             462   6e-154   
gb|KHM99474.1|  Cytochrome P450 71D11                                   462   9e-154   
ref|XP_003520239.1|  PREDICTED: cytochrome P450 71D8-like               461   1e-153   
ref|XP_003600327.1|  Cytochrome P450                                    461   1e-153   
gb|KEH19671.1|  cytochrome P450 family 71 protein                       461   2e-153   
ref|XP_008219722.1|  PREDICTED: premnaspirodiene oxygenase-like         461   2e-153   
gb|AED99878.1|  cytochrome P450                                         461   2e-153   
gb|KEH16965.1|  cytochrome P450 family 71 protein                       461   3e-153   
ref|XP_006421138.1|  hypothetical protein CICLE_v10004785mg             461   3e-153   
gb|KDP42338.1|  hypothetical protein JCGZ_02811                         460   3e-153   
ref|XP_003549267.1|  PREDICTED: cytochrome P450 71D11-like              461   4e-153   
dbj|BAM68814.1|  putative cytochrome P450 monooxygenase CYP71AV11       460   4e-153   
gb|KDP27295.1|  hypothetical protein JCGZ_20283                         460   4e-153   
gb|KEH34025.1|  cytochrome P450 family 71 protein                       460   4e-153   
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg             460   5e-153   
ref|XP_003535173.1|  PREDICTED: cytochrome P450 71D8-like               459   5e-153   
gb|KHN36161.1|  Cytochrome P450 71D8                                    457   5e-153   
ref|XP_006474923.1|  PREDICTED: cytochrome P450 71D11-like              459   7e-153   
gb|AHK60843.1|  CYP71D2                                                 459   7e-153   
dbj|BAM68813.1|  cytochrome P450 monooxygenase CYP71AV11                458   1e-152   
gb|KDP25063.1|  hypothetical protein JCGZ_22598                         458   2e-152   
ref|XP_006435925.1|  hypothetical protein CICLE_v10031280mg             458   2e-152   
gb|KHN01537.1|  Cytochrome P450 71D11                                   458   2e-152   
gb|KDP36253.1|  hypothetical protein JCGZ_09818                         458   3e-152   
ref|XP_003532168.1|  PREDICTED: cytochrome P450 71D11                   458   3e-152   
gb|ABO32531.1|  cytochrome P450-dependent monooxygenase-like protein    458   4e-152   
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like              457   4e-152   
dbj|BAM68821.1|  putative cytochrome P450 monooxygenase CYP71AV11v2     457   6e-152   
gb|KHN48844.1|  Cytochrome P450 71D8                                    457   7e-152   
sp|D5J9U8.1|GAO_LACSA  RecName: Full=Germacrene A oxidase; Short=...    456   8e-152   
ref|XP_002513339.1|  cytochrome P450, putative                          456   9e-152   
ref|XP_007213458.1|  hypothetical protein PRUPE_ppa024556mg             456   1e-151   
ref|XP_006575708.1|  PREDICTED: cytochrome P450 71D10-like              456   1e-151   
gb|KCW68417.1|  hypothetical protein EUGRSUZ_F02067                     456   1e-151   
ref|XP_011073878.1|  PREDICTED: premnaspirodiene oxygenase-like         457   1e-151   
gb|KDP39022.1|  hypothetical protein JCGZ_00779                         454   1e-151   
ref|XP_003555570.2|  PREDICTED: cytochrome P450 71D11-like              457   2e-151   
ref|XP_007226700.1|  hypothetical protein PRUPE_ppa020463mg             455   2e-151   
ref|XP_003600334.1|  Cytochrome P450                                    459   2e-151   
ref|XP_004516744.1|  PREDICTED: cytochrome P450 71D10-like              455   2e-151   
sp|O22307.1|C71DB_LOTJA  RecName: Full=Cytochrome P450 71D11            454   3e-151   
ref|XP_006596106.1|  PREDICTED: cytochrome P450 71D11-like              456   4e-151   
ref|XP_004516745.1|  PREDICTED: cytochrome P450 71D10-like              455   4e-151   
sp|H2DH20.1|C7D13_PANGI  RecName: Full=Cytochrome P450 CYP71D313        455   4e-151   
gb|KCW68415.1|  hypothetical protein EUGRSUZ_F02064                     454   4e-151   
ref|XP_010027348.1|  PREDICTED: cytochrome P450 CYP71D312-like          455   6e-151   
ref|XP_003617715.1|  Cytochrome P450                                    454   7e-151   
dbj|BAM68820.1|  putative cytochrome P450 monooxygenase CYP71AV11v1     454   7e-151   
ref|XP_003519623.2|  PREDICTED: cytochrome P450 71D10-like              454   8e-151   
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...    454   8e-151   
ref|XP_006359946.1|  PREDICTED: premnaspirodiene oxygenase-like         454   8e-151   
ref|XP_003545101.1|  PREDICTED: cytochrome P450 71D10-like              454   1e-150   
gb|ADA70806.1|  cytochrome P450 CYP71D177                               454   1e-150   
ref|XP_006452559.1|  hypothetical protein CICLE_v10010637mg             456   1e-150   
gb|AED99876.1|  cytochrome P450                                         453   2e-150   
gb|KHN37234.1|  Cytochrome P450 71D11                                   453   2e-150   
ref|XP_007212707.1|  hypothetical protein PRUPE_ppa018666mg             452   2e-150   
ref|XP_009344944.1|  PREDICTED: premnaspirodiene oxygenase-like         454   3e-150   
ref|XP_011097781.1|  PREDICTED: premnaspirodiene oxygenase-like         452   3e-150   
ref|XP_004516743.1|  PREDICTED: cytochrome P450 71D10-like              452   4e-150   
dbj|BAM68812.1|  cytochrome P450 monooxygenase CYP71AV10                452   4e-150   
emb|CDP11812.1|  unnamed protein product                                452   5e-150   
gb|AED99873.1|  cytochrome P450                                         452   5e-150   
gb|KHN43883.1|  Cytochrome P450 71D10                                   451   6e-150   
ref|XP_010027347.1|  PREDICTED: premnaspirodiene oxygenase-like         452   7e-150   
gb|KCW62217.1|  hypothetical protein EUGRSUZ_H04878                     452   7e-150   
ref|XP_009344942.1|  PREDICTED: premnaspirodiene oxygenase-like         452   7e-150   
gb|EYU39554.1|  hypothetical protein MIMGU_mgv1a004505mg                452   9e-150   
ref|XP_010104087.1|  Premnaspirodiene oxygenase                         451   1e-149   
sp|D5JBX0.1|GAO_HELAN  RecName: Full=Germacrene A oxidase; Short=...    451   1e-149   
ref|XP_011097779.1|  PREDICTED: cytochrome P450 71D11-like              451   1e-149   
gb|ABC59080.1|  cytochrome P450 monooxygenase CYP71D64                  451   1e-149   
ref|XP_003615871.1|  Cytochrome P450                                    451   1e-149   
gb|KDP42339.1|  hypothetical protein JCGZ_02812                         450   1e-149   
sp|D5JBW8.1|GAO_CICIN  RecName: Full=Germacrene A oxidase; Short=...    450   2e-149   
sp|F8S1I0.1|C7BL2_LACSA  RecName: Full=Costunolide synthase; Shor...    450   2e-149   
emb|CDP07805.1|  unnamed protein product                                447   4e-149   
ref|XP_010104090.1|  Cytochrome P450 71D10                              450   4e-149   
ref|NP_001240107.1|  uncharacterized protein LOC100818520               449   4e-149   
gb|KHG00772.1|  Cytochrome P450                                         449   6e-149   
gb|AJD25166.1|  cytochrome P450 CYP71D413                               449   6e-149   
emb|CDP10755.1|  unnamed protein product                                446   7e-149   
ref|XP_009344943.1|  PREDICTED: premnaspirodiene oxygenase-like         450   7e-149   
ref|XP_004501854.1|  PREDICTED: cytochrome P450 71A1-like               449   7e-149   
gb|KHN29541.1|  Cytochrome P450 71D11                                   449   8e-149   
ref|XP_009616520.1|  PREDICTED: premnaspirodiene oxygenase-like         449   8e-149   
gb|KDP39288.1|  hypothetical protein JCGZ_01045                         447   9e-149   
ref|XP_007033123.1|  Cytochrome P450 71D10, putative                    448   1e-148   
gb|KDP39016.1|  hypothetical protein JCGZ_00773                         447   1e-148   
ref|XP_008370832.1|  PREDICTED: premnaspirodiene oxygenase-like         446   2e-148   
ref|XP_008362104.1|  PREDICTED: premnaspirodiene oxygenase-like         449   3e-148   
ref|XP_003518341.1|  PREDICTED: premnaspirodiene oxygenase-like         447   3e-148   
ref|XP_011095806.1|  PREDICTED: cytochrome P450 71D10-like              447   3e-148   
ref|XP_003636936.1|  Cytochrome P450                                    447   3e-148   
ref|XP_003600323.1|  Cytochrome P450                                    447   5e-148   
gb|KHG19246.1|  Cytochrome P450                                         446   6e-148   
ref|XP_003551491.1|  PREDICTED: cytochrome P450 71D9-like               446   6e-148   
gb|AGB55870.1|  flavonoid 6-hydroxylase 1                               446   8e-148   
ref|XP_009371764.1|  PREDICTED: premnaspirodiene oxygenase-like         447   9e-148   
sp|O81971.1|C71D9_SOYBN  RecName: Full=Cytochrome P450 71D9; AltN...    446   1e-147   
ref|XP_006447773.1|  hypothetical protein CICLE_v10014947mg             446   1e-147   
ref|XP_006841358.1|  hypothetical protein AMTR_s00181p00020940          446   1e-147   
gb|KDO58402.1|  hypothetical protein CISIN_1g010334mg                   446   2e-147   
gb|AGB55868.1|  flavonoid 6-hydroxylase 1                               445   2e-147   
ref|XP_006469495.1|  PREDICTED: premnaspirodiene oxygenase-like         446   2e-147   
ref|XP_004305998.1|  PREDICTED: cytochrome P450 71D11-like              445   4e-147   
gb|AHB62239.1|  cytochrome P450                                         444   6e-147   
ref|XP_003617772.1|  Cytochrome P450                                    444   8e-147   
gb|KCW62218.1|  hypothetical protein EUGRSUZ_H04879                     442   1e-146   
gb|KHN08732.1|  Cytochrome P450 71D9                                    442   2e-146   
ref|XP_007148446.1|  hypothetical protein PHAVU_006G209500g             443   2e-146   
gb|KCW62216.1|  hypothetical protein EUGRSUZ_H04877                     442   2e-146   
gb|KHN03535.1|  Cytochrome P450 71D8                                    440   2e-146   
ref|XP_011002269.1|  PREDICTED: cytochrome P450 71D9-like               442   2e-146   
ref|XP_007020552.1|  Cytochrome P450 71D10, putative                    443   3e-146   
gb|AED99871.1|  cytochrome P450                                         442   3e-146   
ref|XP_009371645.1|  PREDICTED: premnaspirodiene oxygenase-like         444   5e-146   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             440   7e-146   
ref|XP_008372134.1|  PREDICTED: premnaspirodiene oxygenase-like         442   8e-146   
ref|XP_007148447.1|  hypothetical protein PHAVU_006G209600g             441   8e-146   
gb|AGO03790.1|  costunolide                                             441   9e-146   
ref|XP_006474922.1|  PREDICTED: cytochrome P450 71D11-like isofor...    440   1e-145   
gb|KEH29697.1|  cytochrome P450 family 71 protein                       441   1e-145   
ref|XP_007142403.1|  hypothetical protein PHAVU_008G277500g             440   1e-145   
gb|KCW76712.1|  hypothetical protein EUGRSUZ_D01067                     440   2e-145   
ref|XP_009594272.1|  PREDICTED: premnaspirodiene oxygenase-like         440   2e-145   
gb|KHN40981.1|  Premnaspirodiene oxygenase                              439   2e-145   
ref|XP_007142054.1|  hypothetical protein PHAVU_008G248600g             439   3e-145   
ref|XP_009344946.1|  PREDICTED: cytochrome P450 71D8-like               441   4e-145   
gb|KHN33492.1|  Cytochrome P450 71D10-like protein                      439   6e-145   
gb|AJD25165.1|  cytochrome P450 CYP71D412                               439   7e-145   
ref|XP_004305992.1|  PREDICTED: cytochrome P450 71D11-like              439   7e-145   
ref|XP_006841384.1|  hypothetical protein AMTR_s00181p00056510          439   8e-145   
gb|KEH34015.1|  cytochrome P450 family 71 protein                       436   8e-145   
gb|ADA70805.1|  cytochrome P450 CYP71D176                               438   1e-144   
gb|EYU27425.1|  hypothetical protein MIMGU_mgv1a024069mg                439   1e-144   
ref|XP_007033124.1|  Cytochrome P450 71D10, putative                    438   1e-144   
ref|XP_006447873.1|  hypothetical protein CICLE_v10017726mg             437   1e-144   
ref|XP_009795889.1|  PREDICTED: premnaspirodiene oxygenase-like         438   1e-144   
emb|CDP20311.1|  unnamed protein product                                442   2e-144   
gb|AHN62856.1|  costunolide synthase                                    437   3e-144   
ref|XP_010102938.1|  Cytochrome P450 71A1                               437   3e-144   
ref|NP_001236165.1|  cytochrome P450 71D10                              437   5e-144   
gb|KDP39255.1|  hypothetical protein JCGZ_01012                         436   7e-144   
sp|H2DH19.1|C7D31_PANGI  RecName: Full=Cytochrome P450 CYP71D312        434   7e-144   
gb|KDO69448.1|  hypothetical protein CISIN_1g010315mg                   436   9e-144   
ref|XP_006476912.1|  PREDICTED: cytochrome P450 71A1-like               436   1e-143   
ref|XP_010907203.1|  PREDICTED: premnaspirodiene oxygenase-like         436   1e-143   
gb|EMS65365.1|  Cytochrome P450 99A2                                    436   1e-143   
ref|XP_004288803.1|  PREDICTED: cytochrome P450 71D11-like              436   2e-143   
ref|XP_009780363.1|  PREDICTED: premnaspirodiene oxygenase-like         436   2e-143   
ref|XP_008372132.1|  PREDICTED: premnaspirodiene oxygenase-like         436   2e-143   
gb|KHN12340.1|  Cytochrome P450 71D10                                   435   2e-143   
ref|XP_007037782.1|  Cytochrome P450 71A1                               435   2e-143   
ref|XP_006856371.1|  hypothetical protein AMTR_s00047p00189560          435   2e-143   
ref|XP_003532742.2|  PREDICTED: cytochrome P450 71D10                   435   2e-143   
ref|XP_002310060.1|  hypothetical protein POPTR_0007s07420g             435   2e-143   
ref|XP_003600319.1|  Cytochrome P450                                    435   3e-143   
gb|ABF70062.1|  cytochrome P450 family protein                          434   4e-143   
ref|XP_009388203.1|  PREDICTED: premnaspirodiene oxygenase-like         434   4e-143   
ref|XP_008353446.1|  PREDICTED: premnaspirodiene oxygenase-like         438   5e-143   
dbj|BAO45903.1|  cytochrome P450 71D10                                  433   9e-143   
gb|KDO62257.1|  hypothetical protein CISIN_1g038414mg                   432   1e-142   
gb|KDP30978.1|  hypothetical protein JCGZ_11354                         434   1e-142   
gb|KDP39284.1|  hypothetical protein JCGZ_01041                         431   2e-142   
ref|XP_007022417.1|  Cytochrome P450 71D10, putative                    433   2e-142   
gb|EYU21980.1|  hypothetical protein MIMGU_mgv1a004765mg                433   2e-142   
ref|XP_002514827.1|  cytochrome P450, putative                          433   2e-142   
ref|XP_003615863.1|  Cytochrome P450                                    431   3e-142   
ref|XP_002276558.2|  PREDICTED: cytochrome P450 71A1-like               432   3e-142   



>gb|ABC69397.1| CYP71D48v1 [Nicotiana tabacum]
Length=504

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/510 (57%), Positives = 393/510 (77%), Gaps = 13/510 (3%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
             ME +F  N V+ ++FLS +F ++    +    R+  LPPGPWKLP IGSLHHL V G LP
Sbjct  1     MEIQF-SNLVAFLLFLSSIFLVF----KKWKTRKLNLPPGPWKLPFIGSLHHLAVAGPLP  55

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H  L+NL+++YGP+MHLQLG+I  +VIS PQ+A+ + KTHDL FA+RP ++  DI+ Y S
Sbjct  56    HHGLKNLAKRYGPLMHLQLGQIPTLVISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDS  115

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             TD+AFSPYG+YWRQ+RKIC+LELLS KMVK F S RQ+ELS +VSSIR  +    P NLT
Sbjct  116   TDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSSIR--TTPNLPVNLT  173

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             +K+ WFTSS+I + A G++C  DQ K I  +++++SLAGGF + D FP+ K IH   G K
Sbjct  174   DKIFWFTSSVICRSALGKICG-DQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSK  232

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKEGGELQFPITE  929
              KL+K H ++D+I + ++ +HK+N  A+    +G+   ED++DVLLRV+E GE+Q PIT+
Sbjct  233   SKLVKAHRKIDEILENVVNEHKQNR-ADGKKGNGEFGGEDLIDVLLRVRESGEVQIPITD  291

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNK-TFDDKDLE  1106
             DNIK+++ DMFS G+ETS+TTIIWA++EM+K+PSV+AKAQAEVRQALKG K +F + D++
Sbjct  292   DNIKSILIDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKGKKISFQEIDID  351

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              L YLKLVIKETLR+HPP+PL+ PRE ME+ KI  Y IP KTRVI+NAWA+  +P+SW+D
Sbjct  352   KLKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPQSWDD  411

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
             PE F PERFEN+S+DF+GNH++FIPFGAGRR+CPG+ F   ++   LA LLYHF+W+LP+
Sbjct  412   PESFTPERFENNSIDFLGNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPN  471

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             G S ++ DMTE+ G+ A++K DL LIA P+
Sbjct  472   GQSHENFDMTESPGISATRKDDLVLIATPY  501



>ref|XP_009612725.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=503

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/509 (57%), Positives = 391/509 (77%), Gaps = 13/509 (3%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
             ME +F  N V+ ++FLS +F ++    +    R+  LPPGPWKLP IGSLHHL V G LP
Sbjct  1     MEIQF-SNLVAFLLFLSSIFLVF----KKWKTRKLNLPPGPWKLPFIGSLHHLAVAGPLP  55

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H  L+NL+++YGP+MHLQLG+I  +VIS PQ+A+ + KTHDL FA+RP ++  DI+ Y S
Sbjct  56    HHGLKNLAKRYGPLMHLQLGQIPTLVISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDS  115

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             TD+AFSPYG+YWRQ+RKIC+LELLS KMVK F S RQ+ELS +VS IR  +    P NLT
Sbjct  116   TDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSYIR--TTPNLPVNLT  173

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             +K+ WFTSS+I + A G++C  DQ K I  +++++SLAGGF + D FP+ K IH   G K
Sbjct  174   DKIFWFTSSVICRSALGKICG-DQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSK  232

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKEGGELQFPITE  929
              KL+K H ++D+I + ++ +HK+N  A+    +G+   ED++DVLLRV+E GE+Q PIT+
Sbjct  233   SKLVKAHRKIDEILENVVNEHKQNR-ADGKKGNGEFGGEDLIDVLLRVRESGEIQIPITD  291

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNK-TFDDKDLE  1106
             DNIK+++ DMFS G+ETS+TTIIWA++EM+K+PSV+AKAQAEVRQALKG K +F + D++
Sbjct  292   DNIKSILIDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKGKKISFQEIDID  351

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              L YLKLVIKETLR+HPP+PL+ PRE ME+ KI  Y IP KTRVI+NAWA+  +P+SW+D
Sbjct  352   KLKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPQSWDD  411

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
             PE F PERFEN+S+DF+GNH++FIPFGAGRR+CPG+ F   ++   LA LLYHF+W+LP+
Sbjct  412   PESFTPERFENNSIDFLGNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPN  471

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             G + ++ DMTE+ G+ A++K DL LIA P
Sbjct  472   GQTHQNFDMTESPGISATRKDDLILIATP  500



>gb|ABC69396.1| CYP71D48v2 [Nicotiana tabacum]
Length=503

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/509 (57%), Positives = 390/509 (77%), Gaps = 13/509 (3%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
             ME +F  N V+ ++FLS +F ++    +    R+  LPPGPWKLP IGSLHHL V G LP
Sbjct  1     MEIQF-SNLVAFLLFLSSIFLVF----KKWKTRKLNLPPGPWKLPFIGSLHHLAVAGPLP  55

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H  L+NL+++YGP+MHLQLG+I  +VIS PQ+A+ + KTHDL FA+RP ++  DI+ Y S
Sbjct  56    HHGLKNLAKRYGPLMHLQLGQIPTLVISSPQMAKEVLKTHDLAFATRPKLVVADIIHYDS  115

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             TD+A SPYG+YWRQ+RKIC+LELLS KMVK F S RQ+ELS +VSSIR  +    P NLT
Sbjct  116   TDIALSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMVSSIR--TTPNLPVNLT  173

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             +K+ WFTSS+I + A G++C  DQ K I  +++++SLAGGF + D FP+ K IH   G K
Sbjct  174   DKIFWFTSSVICRSALGKICG-DQDKLIIFMREIISLAGGFSIADFFPTWKMIHDIDGSK  232

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKEGGELQFPITE  929
              KL+K H ++D+I + ++ +HK+N  A+    +G+   ED++DVLLRV+E GE+Q PIT+
Sbjct  233   SKLVKAHRKIDEILENVVNEHKQNR-ADGKKGNGEFGGEDLIDVLLRVRESGEVQIPITD  291

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNK-TFDDKDLE  1106
             DNIK+++ DMFS G+ETS+TTIIWA++EM+K+PSV+AKAQAEV QALKG K +F + D++
Sbjct  292   DNIKSILIDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVSQALKGKKISFQEIDID  351

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              L YLKLVIKETLR+HPP+PL+ PRE ME+ KI  Y IP KTRVI+NAWA+  +P+SW+D
Sbjct  352   KLKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPQSWDD  411

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
             PE F PERFEN+S+DF+GNH++FIPFGAGRR+CPG+ F   ++   LA LLYHF+W+LP+
Sbjct  412   PESFTPERFENNSIDFLGNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPN  471

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             G + ++ DMTE+ G+ A++K DL LIA P
Sbjct  472   GQTHQNFDMTESPGISATRKDDLILIATP  500



>ref|XP_006355983.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Solanum 
tuberosum]
Length=514

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/501 (59%), Positives = 378/501 (75%), Gaps = 7/501 (1%)
 Frame = +3

Query  54    LFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLR  230
             LFN VS+++FLS    +  L R+ +  ++Q+LPPGPW+LP IGSLHHL+ GG LPHR  R
Sbjct  9     LFNLVSLLIFLS---SLVILVRKWSKNKKQRLPPGPWRLPFIGSLHHLIIGGQLPHRVFR  65

Query  231   NLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAF  410
             NL+R+YGPIM+LQLGEI  V+IS P +A+ I +THDL FA RP  ++ +I+FY + D+ F
Sbjct  66    NLARRYGPIMYLQLGEIPVVIISSPTIAQEILRTHDLAFADRPQFVSTNIIFYNNKDIVF  125

Query  411   SPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLS-SETGFPTNLTEKVS  587
             S YGDYWRQMRKIC++ELLS+KMVKSF   RQ+ELS+L+SSI  +        N++EKV 
Sbjct  126   SQYGDYWRQMRKICMVELLSVKMVKSFSGIRQDELSSLISSICSTRGGATVLINMSEKVF  185

Query  588   WFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLL  767
              F +S+  + AFG++C + + +FI L+K+VL  AGGFD+ DLFPS K +H  SG+K +L+
Sbjct  186   RFINSVTCRSAFGKIC-KGKDEFITLMKEVLFFAGGFDVADLFPSWKLLHNISGVKSRLM  244

Query  768   KLHHELDKIFDIIIGDHKENH-LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKA  944
               H ++D I + II +H EN  +    N    DED+VDVLLR+KE  +LQFPIT D+IKA
Sbjct  245   NAHQKVDAIMENIINEHIENKAIGKKRNGEFGDEDLVDVLLRIKENSQLQFPITNDHIKA  304

Query  945   VINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLK  1124
             VI D+F  GTE S+ TIIWA+SEM++ P+VMAKAQ EVRQ  KG K +D+KD+E LTYLK
Sbjct  305   VITDIFIAGTEASSLTIIWALSEMMRNPNVMAKAQHEVRQVFKGKKNYDEKDIEKLTYLK  364

Query  1125  LVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLP  1304
             LVIKETLRLH P PL+ PRE  E   I  YIIP KTRV++N WALA +P+ W++P  F+P
Sbjct  365   LVIKETLRLHTPGPLMGPRECRENTNIDGYIIPQKTRVLVNVWALARDPKYWQNPTSFIP  424

Query  1305  ERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKD  1484
             ERFENSS+DFMGN +EFIPFG+GRRMCPGI FA  ++  SLA LLYHF WELP+GV+PKD
Sbjct  425   ERFENSSIDFMGNDFEFIPFGSGRRMCPGIQFALANVGFSLAQLLYHFEWELPNGVNPKD  484

Query  1485  LDMTEAVGVIASKKKDLCLIA  1547
             LDMTE  G+ ASKKKDL LIA
Sbjct  485   LDMTETHGLTASKKKDLYLIA  505



>ref|XP_009623936.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/509 (58%), Positives = 372/509 (73%), Gaps = 6/509 (1%)
 Frame = +3

Query  36    EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
             E +H F F  +S+++FLSF+F    +R+ S    + +LPPGPW LPLIG+LH L+ G LP
Sbjct  2     ETQH-FPFIFISLLIFLSFIFRFVLIRKNSRIVTK-RLPPGPWSLPLIGNLHQLMNGRLP  59

Query  216   -HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYK  392
              H TLR+LS++YGPI HL LGEIS +V+S P++A+ I KT DL FA+RP  M+ DI+FY 
Sbjct  60    IHHTLRSLSQRYGPIFHLCLGEISIIVVSSPEMAKEIMKTQDLRFATRPEFMSGDIIFYN  119

Query  393   STDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNL  572
              TD+   PYG+YWR MRK+CVLELLS KMVKSF S RQEE+S+L+SSI  + +     NL
Sbjct  120   YTDIGTCPYGEYWRNMRKVCVLELLSAKMVKSFNSIRQEEMSSLISSINSTPDDSL-INL  178

Query  573   TEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGM  752
             ++K+ WFTSS+  + AFG+V   DQ K I L+K V  LAGGFDL DLFPS+KW+H  SG+
Sbjct  179   SDKMFWFTSSVTCRSAFGKVI-HDQDKLIMLVKDVTLLAGGFDLADLFPSRKWLHEISGL  237

Query  753   KPKLLKLHHELDKIFDIIIGDHKENH-LANSTNSSGKDEDIVDVLLRVKEGGELQFPITE  929
             K K+LK+H ++D I + II +H+ N  +    N     ED++DVLLRV E GEL  PIT 
Sbjct  238   KSKMLKVHTKIDVILENIINEHRNNRTIGKKGNGESGGEDLIDVLLRVMESGELGTPITN  297

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLEN  1109
              NIK VI DMF  G ETS+TTIIWA++EMI+ PSVMAKAQ EVR+ LKG +TF+D D+E 
Sbjct  298   KNIKGVIFDMFLAGAETSSTTIIWALAEMIRNPSVMAKAQLEVREVLKGKRTFEDSDIEE  357

Query  1110  LTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDP  1289
             L YLKLVIKETLRLHPP+PL+ PRE  EE KI +Y IP KTRV++NAWA+  +   W D 
Sbjct  358   LKYLKLVIKETLRLHPPIPLLLPRECREETKIEQYTIPIKTRVLVNAWAIGRDTRYWHDS  417

Query  1290  ERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDG  1469
             E F+PERFEN+S+DF GNH+EFIPFGAGRRMCPG+ F   ++   LA LLYHF+W+ P G
Sbjct  418   ESFIPERFENNSIDFKGNHFEFIPFGAGRRMCPGLLFGLVNVGHPLAQLLYHFDWKTPPG  477

Query  1470  VSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +S    DMTE  GV A +K DLCLIA PF
Sbjct  478   ISSDSFDMTETDGVTARRKNDLCLIATPF  506



>ref|XP_009766832.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=503

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/478 (59%), Positives = 371/478 (78%), Gaps = 7/478 (1%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQ  308
              R+  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I  ++IS PQ
Sbjct  27    TRKLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLIISSPQ  86

Query  309   LARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKS  488
             +A+ + KTHDL FA+RP ++  DI+ Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK 
Sbjct  87    MAKEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKF  146

Query  489   FCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALL  668
             F S RQ+ELS +VSSIR  +      NLT+K+ WFTSS+  + A G++C  DQ K I  +
Sbjct  147   FSSIRQDELSKMVSSIR--TTPNLTVNLTDKIFWFTSSVTCRSALGKICG-DQDKLIIFM  203

Query  669   KQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTN  848
             ++++SLAGGF + D FP+ K IH   G K KL+K H ++D+I   ++ +HK+N  A+   
Sbjct  204   REIISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNR-ADGKK  262

Query  849   SSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
              +G+   ED++DVLLRV+E GE+Q PIT+DNIK+++ DMFS G+ETS+TTIIWA++EM+K
Sbjct  263   GNGEFGGEDLIDVLLRVRESGEVQIPITDDNIKSILIDMFSAGSETSSTTIIWALAEMMK  322

Query  1023  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1202
             +PSV+AKAQAEVRQALK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ K
Sbjct  323   KPSVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTK  382

Query  1203  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1382
             I  Y IP KTRVI+NAWA+  +PESW+DPE F+PERFENSS+DF+GNH++FIPFGAGRR+
Sbjct  383   IDGYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERFENSSIDFLGNHHQFIPFGAGRRI  442

Query  1383  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             CPG+ F   ++   LA LLYHF+W+LP+G S ++ DMTE+ G+ A++K DL LIA P+
Sbjct  443   CPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLIATPY  500



>gb|ABC69395.1| CYP71D47v2 [Nicotiana tabacum]
Length=503

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/478 (59%), Positives = 371/478 (78%), Gaps = 7/478 (1%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQ  308
              R+  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I  ++IS PQ
Sbjct  27    TRKLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLIISSPQ  86

Query  309   LARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKS  488
             +A+ + KTHDL FA+RP ++A DI+ Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK 
Sbjct  87    MAKEVLKTHDLAFATRPKLVAADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKF  146

Query  489   FCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALL  668
             F S RQ+ELS ++SSIR  +      NLT+K+ WFTSS+  + A G++C  DQ K I  +
Sbjct  147   FSSIRQDELSKMLSSIR--TTPNLTVNLTDKIFWFTSSVTCRSALGKICG-DQDKLIIFM  203

Query  669   KQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTN  848
             ++++SLAGGF + D FP+ K IH   G K KL+K H ++D+I   ++ +HK+N  A+   
Sbjct  204   REIISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNR-ADGKK  262

Query  849   SSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
              +G+   ED++DVLLRV+E GE+Q PIT DNIK+++ DMFS G+ETS+TTIIWA++EM+K
Sbjct  263   GNGEFGGEDLIDVLLRVRESGEVQIPITNDNIKSILIDMFSAGSETSSTTIIWALAEMMK  322

Query  1023  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1202
             +PSV+AKAQAEVRQALK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ K
Sbjct  323   KPSVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTK  382

Query  1203  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1382
             I  Y IP KTRVI+NAWA+  +PESW+DPE F+PERFENSS+DF+GNH++FIPFGAGRR+
Sbjct  383   IDGYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERFENSSIDFLGNHHQFIPFGAGRRI  442

Query  1383  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             CPG+ F   ++   LA LLYHF+W+LP+G S ++ DMTE+ G+ A++K DL LIA P+
Sbjct  443   CPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLIATPY  500



>dbj|BAC53923.1| cytochrome P450 [Petunia x hybrida]
Length=502

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/472 (61%), Positives = 363/472 (77%), Gaps = 5/472 (1%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             LPPGPWKLP IGSLHHLV  G LPH  L NL+++YGP+M LQLGE   V IS PQ+A+ +
Sbjct  32    LPPGPWKLPFIGSLHHLVFAGPLPHHGLTNLAKRYGPLMLLQLGEQPTVFISSPQMAKEV  91

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              KTHDL FA+RP +   +I+ Y STD+AFSPYG+YWRQ+RKICV+ELLS KMV SF S R
Sbjct  92    LKTHDLAFATRPKLTFAEIIKYGSTDIAFSPYGEYWRQIRKICVMELLSAKMVNSFSSIR  151

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             ++ELSN++S IRL      P NLTEKV WFTSS++ + A G++C +DQ K I L++++LS
Sbjct  152   EDELSNMISWIRL--RPNIPVNLTEKVKWFTSSVVCRSALGKIC-KDQNKLIILMREILS  208

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST-NSSGK  860
             LA   +  D FP  K++H   G K +LLK HH++D+I   I+ +HK+N +     N    
Sbjct  209   LAISVNFADFFPRWKFLHDLGGSKTRLLKEHHKIDEILQDIVNEHKQNRVNGKMGNGEFG  268

Query  861   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1040
              ED++DVLLRV+E G+ Q PIT+DNIKAVI DMFS GTETS+TTIIWA++EM+K+PSV+A
Sbjct  269   GEDLIDVLLRVRESGQHQLPITDDNIKAVIVDMFSAGTETSSTTIIWALAEMMKKPSVLA  328

Query  1041  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1220
             KAQAEVRQA+KG K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE MEE KI  + I
Sbjct  329   KAQAEVRQAMKGKKGFQLIDLDELKYLKLVIKETLRMHPPIPLLIPRECMEETKINGFNI  388

Query  1221  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1400
             P KTRVI+N WA+  NPESWEDPE F+PERFEN+ +DF GNH++FIPFGAGRRMCPG+ F
Sbjct  389   PLKTRVIVNIWAIGRNPESWEDPESFMPERFENNPIDFTGNHHQFIPFGAGRRMCPGMLF  448

Query  1401  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
               T++A  LA LL+HF+W+LP+G SP+DLDMTE+ GV A++K DL  +A P+
Sbjct  449   GLTNVAQLLAQLLHHFDWKLPNGQSPQDLDMTESPGVSATRKDDLVFVATPY  500



>ref|XP_004242036.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/473 (62%), Positives = 373/473 (79%), Gaps = 5/473 (1%)
 Frame = +3

Query  135   RRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLA  314
             ++Q+LPPGPW+LP IG+LHHL+GG LPHR LR+LS++YGPIM+LQLG++  VVI+ P +A
Sbjct  25    KKQRLPPGPWRLPFIGNLHHLIGGGLPHRVLRDLSQRYGPIMYLQLGQVPTVVITSPTIA  84

Query  315   RAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  494
             + I KTHDL FA RP +++ +I+FY + DVAFS YGDYWRQMRKIC++ELLS KMVKSF 
Sbjct  85    QEILKTHDLAFADRPQLVSTNIIFYNNKDVAFSQYGDYWRQMRKICIVELLSTKMVKSFS  144

Query  495   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  674
               RQ+ELS+L+SSIR +   G   N+TEKV  FT+ +  + AFG++C +D+ +F+ALLK+
Sbjct  145   GIRQDELSSLISSIRSTR--GTTINMTEKVFQFTNCVTCRSAFGKIC-KDRNEFVALLKK  201

Query  675   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST-NS  851
             +L  AGGFDL DLFPS K +H  SG+K +L+K H ++D I + II +H EN +A    N 
Sbjct  202   ILVFAGGFDLADLFPSWKLLHNISGVKSRLVKAHQKIDAIMENIINEHIENKVAGKKGNG  261

Query  852   SGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1031
                DED+VDV LRVKE  ELQFPIT+++IKAVI+D+F  GTETS+ TIIWA+SE++K P+
Sbjct  262   EFGDEDLVDVFLRVKENAELQFPITKEHIKAVISDIFIAGTETSSATIIWALSELMKNPN  321

Query  1032  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1211
             VMAKAQ+EVRQ LKG K + ++D+E LTYLKLVIKETLRLH P+PLI PRE  E+  I  
Sbjct  322   VMAKAQSEVRQVLKGKKNYGEEDIEKLTYLKLVIKETLRLHTPVPLIGPRECREKTNIDG  381

Query  1212  YIIPPKTRVIINAWALATNPESWE-DPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1388
             Y IP   RV++NAWALA +P++W+ +PE F+PERFENSS+DFMGNH+EFIPFGAGRR+CP
Sbjct  382   YTIPHNARVLVNAWALARDPKNWDKNPESFIPERFENSSIDFMGNHFEFIPFGAGRRICP  441

Query  1389  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1547
             GI F   ++AL LA LLYHF WELP GV+PKDLDM+E  G+ ASK KDL L A
Sbjct  442   GIQFGLANVALPLAQLLYHFEWELPYGVNPKDLDMSETHGLTASKAKDLYLNA  494



>gb|ABC69394.1| CYP71D47v1 [Nicotiana tabacum]
Length=503

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/478 (59%), Positives = 370/478 (77%), Gaps = 7/478 (1%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQ  308
              R+  LPPGPWKLP IGSLHHL V G LPH  L+NL+++YGP+MHLQLG+I  ++IS PQ
Sbjct  27    TRKLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKRYGPLMHLQLGQIPTLIISSPQ  86

Query  309   LARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKS  488
             +A+ + KTHDL FA+RP ++  DI+ Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK 
Sbjct  87    MAKEVLKTHDLAFATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKF  146

Query  489   FCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALL  668
             F S RQ+ELS ++SSIR  +      NLT+K+ WFTSS+  + A G++C  DQ K I  +
Sbjct  147   FSSIRQDELSKMLSSIR--TTPNLTVNLTDKIFWFTSSVTCRSALGKICG-DQDKLIIFM  203

Query  669   KQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTN  848
             ++++SLAGGF + D FP+ K IH   G K KL+K H ++D+I   ++ +HK+N  A+   
Sbjct  204   REIISLAGGFSIADFFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNR-ADGKK  262

Query  849   SSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
              +G+   ED++DVLLRV+E GE+Q PIT DNIK+++ DMFS G+ETS+TTIIWA++EM+K
Sbjct  263   GNGEFGGEDLIDVLLRVRESGEVQIPITNDNIKSILIDMFSAGSETSSTTIIWALAEMMK  322

Query  1023  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1202
             +PSV+AKAQAEVRQALK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ K
Sbjct  323   KPSVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTK  382

Query  1203  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1382
             I  Y IP KTRVI+NAWA+  +PESW+DPE F+PERFENSS+DF+GNH++FIPFGAGRR+
Sbjct  383   IDGYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERFENSSIDFLGNHHQFIPFGAGRRI  442

Query  1383  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             CPG+ F   ++   LA LLYHF+W+LP+G S ++ DMTE+ G+ A++K DL LIA P+
Sbjct  443   CPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLIATPY  500



>ref|XP_009770332.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=523

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/519 (56%), Positives = 384/519 (74%), Gaps = 8/519 (2%)
 Frame = +3

Query  12    LVGSSFVSEMEHKFLFNP-VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSL  188
             ++   F+SEME K L +  +SV++F+SF+F +  + + S     + LPPGPW  PLIG+L
Sbjct  6     IIYDPFLSEMEAKHLSSIFISVLIFVSFIFRLVQIWKASK-TFNKILPPGPWSPPLIGNL  64

Query  189   HHLVGGSLP-HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNI  365
             H  + G LP H TLR+LSR+YGPI HL+LGEIS +V+S P++A+ I KT DL FA+RP  
Sbjct  65    HLFMNGRLPVHHTLRSLSRRYGPIFHLRLGEISIIVVSSPEMAKEIMKTQDLRFATRPEF  124

Query  366   MALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLS  545
             MA DI+FY  TD+   PYGD+WR MRK+C++ELLS KMVKSF S RQ E+S+L+SS+   
Sbjct  125   MAGDIIFYNYTDIITCPYGDHWRNMRKVCIVELLSAKMVKSFNSIRQAEMSSLISSVNSM  184

Query  546   SETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSK  725
              +     NL++K+ WFTSS+  + AFG+V   DQ K I L+K + SLA GFDL D+FPS+
Sbjct  185   PDDSL-INLSDKMFWFTSSVTCRSAFGKVI-HDQDKLIMLVKDISSLAAGFDLADMFPSR  242

Query  726   KWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD--EDIVDVLLRVKE  899
             KW+H  +G+K K+LK+H ++D I + I+ +H+E+  AN   S+G+   ED++DVLLRV E
Sbjct  243   KWLHKITGLKSKMLKVHKKVDAILENILNEHQESR-ANGKKSNGETGGEDLIDVLLRVME  301

Query  900   GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGN  1079
              GEL  PIT +NIK+VI DMF  G ETSATTIIWAM+EMI+ PSVMAKAQ EVR+ LKG 
Sbjct  302   SGELGTPITNENIKSVIFDMFLAGAETSATTIIWAMAEMIRNPSVMAKAQLEVREVLKGK  361

Query  1080  KTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWAL  1259
             +TF+D DLE L YL LVIKETLRLHPP+PL+ PRE  EE KI +YIIP KTRV++N WA+
Sbjct  362   RTFEDIDLEELKYLNLVIKETLRLHPPVPLLIPRECREETKIDKYIIPIKTRVLVNVWAI  421

Query  1260  ATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLL  1439
                  +W +PE F+PERFEN+S+DF GNH+EFIPFGAGRRMCPG+ F   ++   LA LL
Sbjct  422   GRESTNWHNPESFIPERFENNSIDFRGNHFEFIPFGAGRRMCPGLLFGLVNVGHPLAQLL  481

Query  1440  YHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             YHF+W+ P G++P +L+MTE +GV   +K DLCLIA PF
Sbjct  482   YHFDWKTPHGIAPDNLNMTETIGVAGGRKDDLCLIATPF  520



>ref|XP_006365912.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=512

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/500 (60%), Positives = 367/500 (73%), Gaps = 5/500 (1%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLSR  242
             +S+++FL F+F ++ + ++S     +KLPPGPWKLP+IG+LH L   G LPH TLR LS+
Sbjct  12    ISLLLFLYFIFYLFQIWKKSK-TLTKKLPPGPWKLPIIGNLHQLASHGGLPHHTLRTLSQ  70

Query  243   KYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYG  422
             KYGP+ HLQLGEISA+V+S P++A+ I KT D+ FA+RP  M   I+FY  +D+A  PYG
Sbjct  71    KYGPLTHLQLGEISAIVVSSPEMAKEIMKTQDVRFATRPQSMTGSIIFYNYSDIALCPYG  130

Query  423   DYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSS  602
             DYWR MRKICVLELLS KMVKSF S RQEE+S+LVSSI  S+      NL+ K+ WFT S
Sbjct  131   DYWRNMRKICVLELLSAKMVKSFNSIRQEEMSSLVSSIINSTPDESLVNLSNKIFWFTGS  190

Query  603   LIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHE  782
             +  + AFG+V   DQ K I L+K+ +SL+ GFDL DLFPS KW+H  SGMK +LLK H +
Sbjct  191   VTCRSAFGKVV-HDQDKLIMLVKEAVSLSSGFDLTDLFPSHKWLHGISGMKSRLLKAHEK  249

Query  783   LDKIFDIIIGDHKENHL-ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDM  959
             +D I + +I +H EN    N  N     ED++DVLLRV E GE   PIT  NIKAVI +M
Sbjct  250   VDVILEKLINEHCENRANGNKGNGESGAEDLIDVLLRVMESGEFGMPITNQNIKAVIFEM  309

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKE  1139
             F  G ETS+TTIIWA SEMIK P VMAKAQ EVR+A KG KTF+D DLE L YLKLVIKE
Sbjct  310   FMAGAETSSTTIIWAFSEMIKNPGVMAKAQLEVREAFKGKKTFEDIDLEELKYLKLVIKE  369

Query  1140  TlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESW-EDPERFLPERFE  1316
             TLRLHP  PL+ PRE  EE +I  Y IP KT+VI+NAWA+  +   W +DPE F+PERFE
Sbjct  370   TLRLHPAAPLLIPRECREETQIDGYNIPIKTKVIVNAWAIGRDSRYWHDDPESFIPERFE  429

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
             NSS+DF GN++EFIPFGAGRRMCPG+     ++  SLA LLYHF+W+LPDGVS  D DMT
Sbjct  430   NSSIDFRGNNFEFIPFGAGRRMCPGMLSGLATVGHSLAKLLYHFDWKLPDGVSVDDFDMT  489

Query  1497  EAVGVIASKKKDLCLIARPF  1556
             EA GV AS+K DLCLIA PF
Sbjct  490   EAEGVAASRKNDLCLIATPF  509



>ref|XP_006361940.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/473 (59%), Positives = 369/473 (78%), Gaps = 6/473 (1%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             LPPGPWKLP IGSLHHL V G LPH  L+NL++ YG +MHLQLGEI  V+IS P++A+ +
Sbjct  32    LPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKCYGALMHLQLGEIPTVIISSPRMAKEV  91

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              KTHDLVFA+RP ++  DIV Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK F S R
Sbjct  92    LKTHDLVFATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIR  151

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             Q+ELS +VSSIR +     P NLT+K+ WFTSS+  + A G++C  DQ K I  +++++S
Sbjct  152   QDELSKMVSSIR-TMPNNLPVNLTDKIFWFTSSVTCRSALGKICC-DQDKLIIFMREIIS  209

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  860
             LAGGF + D FP+ K +H   G K +L+K H ++D+I + ++ +HK+N  A+    +G+ 
Sbjct  210   LAGGFSVADFFPTWKMLHDVGGSKTRLVKAHRKIDEILENVVNEHKQNR-ADGKKGNGEF  268

Query  861   -DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
               ED++DVLLRV+E GE+Q PIT+DNIKA++ DMFS G+ETS+TTIIWA++EM+K+PSV+
Sbjct  269   GGEDLIDVLLRVRESGEVQIPITDDNIKAILVDMFSAGSETSSTTIIWALAEMMKKPSVL  328

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
             AKAQAEVRQ LK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI  Y 
Sbjct  329   AKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYN  388

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             IP KTRVI+NAWA+  +PESW+DPE F PERFENSS+DF+G+H++FIPFGAGRR+CPG+ 
Sbjct  389   IPFKTRVIVNAWAIGRDPESWDDPESFSPERFENSSIDFLGSHHQFIPFGAGRRICPGML  448

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             F   ++   LA LLYHF+W+LP+G S ++LD+TE+ G+ A++K DL LIA P+
Sbjct  449   FGLANVGQPLAQLLYHFDWKLPNGQSHENLDLTESPGISATRKDDLVLIATPY  501



>ref|XP_004237369.1| PREDICTED: premnaspirodiene oxygenase [Solanum lycopersicum]
Length=501

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/479 (58%), Positives = 371/479 (77%), Gaps = 2/479 (0%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SAVV++
Sbjct  23    KNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P +A+ + KTHD+ FASRP ++A +IV Y  +D+AF PYGDYWRQMRKICVLELLS K 
Sbjct  82    SPDMAKEVLKTHDIAFASRPKLLAPEIVCYSRSDIAFCPYGDYWRQMRKICVLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+S+ S R++E+  LV+ IR SS    P N TE++  FTSS+  + AFG+V  E Q KFI
Sbjct  142   VRSYSSIRRDEVDRLVNFIRSSSSFREPVNFTERLFLFTSSMTCRSAFGKVFKE-QDKFI  200

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+N    
Sbjct  201   QLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIVNAHHKVDAIVEDVINEHKKNIAMG  260

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVLLR+   G LQFPIT DNIKA+I DMF+ GTETS++T++WAM +++
Sbjct  261   KTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQLM  320

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV AKAQAEVR+A K  +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  EE 
Sbjct  321   KNPSVFAKAQAEVREAFKDRETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  380

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y +P KT+V++N WAL  +P+ W+D E F PERFE SSVDF+GN++E++PFG GRR
Sbjct  381   DINGYTVPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQSSVDFIGNNFEYLPFGGGRR  440

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++ L LA LLYHF+W+LP+G+ PKDL++TE VGV A++K DL L+A P+
Sbjct  441   ICPGISFGLANVYLPLAQLLYHFDWKLPNGMEPKDLNLTELVGVTAARKDDLILVATPY  499



>emb|CDP08465.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/482 (57%), Positives = 363/482 (75%), Gaps = 4/482 (1%)
 Frame = +3

Query  102   IYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEI  281
             I  L+R       QKLPPGPWKLP IG +HHL+G SLPHR L+NL++KYG +MHLQLGE+
Sbjct  24    IKELKRSQKTKTIQKLPPGPWKLPFIGCMHHLIG-SLPHRCLKNLAQKYGSLMHLQLGEV  82

Query  282   SAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLE  461
             S ++++ P LA+ I KTHDL FA+RP ++A  I+ Y + D+AFSPYGDYWRQMRKI VLE
Sbjct  83    SLIIVTSPNLAKEIMKTHDLSFATRPELLAFKIICYDTKDIAFSPYGDYWRQMRKISVLE  142

Query  462   LLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSE  641
             LLS K V+SF + RQ+E+ +LV +IR     G   NLTE+V  + SS++ + AFG+V  E
Sbjct  143   LLSAKSVRSFENIRQDEVLHLVEAIR--PLAGKKVNLTEQVFSYASSMVCRAAFGQVSKE  200

Query  642   DQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHK  821
             DQ +F+ L+KQV +LAGGFD+ DLFPS K +H  +GMKPKLLK+HH++D IF+ +I +H 
Sbjct  201   DQYEFVQLMKQVAALAGGFDIADLFPSYKILHVLTGMKPKLLKIHHKMDSIFEKLIEEHI  260

Query  822   ENHLANST-NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  998
             +N   N    +    ED++DVLLR+++ G LQFPIT +NIKA+I DMF+ GTETS++T+ 
Sbjct  261   KNQTRNKKLVADSNQEDLIDVLLRIRDSGNLQFPITNNNIKAIIFDMFAAGTETSSSTVE  320

Query  999   WAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihp  1178
             WAMSEMI+ P VMAKAQ E+RQ+ KG +  D+ D++ L YLKLVIKETLRLHPP PL+ P
Sbjct  321   WAMSEMIRNPDVMAKAQREIRQSFKGKQNIDEADVQGLRYLKLVIKETLRLHPPFPLLLP  380

Query  1179  rESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFI  1358
             RE  E+ ++  Y IP KT+V+IN WA+  +PE W DPE F+PERF+N+ VDF GNH+EF+
Sbjct  381   RECREQCELNGYTIPIKTKVMINFWAIGRDPEHWSDPESFVPERFDNNPVDFTGNHFEFV  440

Query  1359  PFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLC  1538
             PFGAGRR+CPG+SFA  ++ L LA LL HFNW LPDG+  ++LDM E  G+ A++K +L 
Sbjct  441   PFGAGRRICPGMSFALANVELPLALLLCHFNWRLPDGMKSRELDMLENNGITATRKNNLY  500

Query  1539  LI  1544
             L+
Sbjct  501   LV  502



>sp|A6YIH8.1|C7D55_HYOMU RecName: Full=Premnaspirodiene oxygenase; Short=HPO; AltName: 
Full=Cytochrome P450 71D55 [Hyoscyamus muticus]
 gb|ABS00393.1| cytochrome P450 hydroxylase [Hyoscyamus muticus]
Length=502

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/479 (57%), Positives = 372/479 (78%), Gaps = 4/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SAVV++
Sbjct  23    KNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P +A+ + KTHD+ FASRP ++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  82    SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  LV+ +R  S T  P N TE++  FTSS+  + AFG+V  E Q  FI
Sbjct  142   VRSFSSIRRDEVLRLVNFVR--SSTSEPVNFTERLFLFTSSMTCRSAFGKVFKE-QETFI  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V+ LAGGFD+ D+FPS K++H  +GM+ K++K HH++D I + +I +HK+N    
Sbjct  199   QLIKEVIGLAGGFDVADIFPSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNLAMG  258

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVLLR+   G LQFPIT DNIKA+I DMF+ GTETS++T++WAM +M+
Sbjct  259   KTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQMM  318

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             + P+++AKAQAEVR+A KG +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  EE 
Sbjct  319   RNPTILAKAQAEVREAFKGKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
             +I  Y IP KT+V++N WAL  +P+ W+D + F PERFE  SVDF+GN++E++PFG GRR
Sbjct  379   EINGYTIPVKTKVMVNVWALGRDPKYWDDADNFKPERFEQCSVDFIGNNFEYLPFGGGRR  438

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++ L LA LLYHF+W+LP G+ PKDLD+TE VGV A++K DL L+A P+
Sbjct  439   ICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTELVGVTAARKSDLMLVATPY  497



>gb|ABC69405.1| CYP71D51v3 [Nicotiana tabacum]
Length=514

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 368/479 (77%), Gaps = 4/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SAVV++
Sbjct  35    KNSNSQSKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  93

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P  A+ + KTHD+ FASRP+++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  94    SPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKN  153

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V++F S R+ E+  L++ IR SS  G P N+TE++  FTSS+  + AFG+V  E Q KFI
Sbjct  154   VRTFSSIRRNEVLRLINFIRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKE-QDKFI  210

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+N    
Sbjct  211   QLIKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIG  270

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVLLR+   G LQFPIT DNIKA+I DMF+ GTETS++TI+WAM EM+
Sbjct  271   KTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVEMV  330

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K P+V AKAQAEVR+A +G +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  EE 
Sbjct  331   KNPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECREET  390

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W D E F+PERFE  S DF+GN++E++PFG GRR
Sbjct  391   NINGYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERFEQCSKDFVGNNFEYLPFGGGRR  450

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   +  L LA LLYHF+W+LP G+ P DLD+TE VGV A++K DL L+A P+
Sbjct  451   ICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSDLYLVATPY  509



>ref|XP_009758268.1| PREDICTED: premnaspirodiene oxygenase [Nicotiana sylvestris]
 gb|ABC69404.1| CYP71D51v2 [Nicotiana tabacum]
 gb|AGK30193.1| cytochrome P450 CYP71D51 [Nicotiana tabacum]
Length=514

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 368/479 (77%), Gaps = 4/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SAVV++
Sbjct  35    KNSNSQSKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  93

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P  A+ + KTHD+ FASRP+++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  94    SPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKN  153

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V++F S R+ E+  L++ IR SS  G P N+TE++  FTSS+  + AFG+V  E Q KFI
Sbjct  154   VRTFSSIRRNEVLRLINFIRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKE-QDKFI  210

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+N    
Sbjct  211   QLIKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIG  270

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVLLR+   G LQFPIT DNIKA+I DMF+ GTETS++TI+WAM EM+
Sbjct  271   KTNGALGGEDLIDVLLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVEMV  330

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K P+V AKAQAEVR+A +G +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  EE 
Sbjct  331   KNPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECREET  390

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W D E F+PERFE  S DF+GN++E++PFG GRR
Sbjct  391   NINGYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERFEQCSKDFVGNNFEYLPFGGGRR  450

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   +  L LA LLYHF+W+LP G+ P DLD+TE VGV A++K DL L+A P+
Sbjct  451   ICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSDLYLVATPY  509



>ref|XP_004233564.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/473 (59%), Positives = 369/473 (78%), Gaps = 6/473 (1%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             LPPGPWKLP IGSLHHL + G LPH  L+NL+++YG +++LQLGEI  V+IS P++A+ +
Sbjct  32    LPPGPWKLPFIGSLHHLALAGPLPHHGLKNLAKRYGALIYLQLGEIPTVIISSPRMAKEV  91

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              KTHDLVFA+RP ++  DIV Y S+D+AFSPYG+YWRQ+RKIC+LELLS KMVK F S R
Sbjct  92    LKTHDLVFATRPKLVVADIVHYDSSDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIR  151

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             Q+ELS +VSSIR +     P NLT+K+ WFTSS+  + A G++C  DQ K I  +++++S
Sbjct  152   QDELSKMVSSIR-TMPNNHPVNLTDKIFWFTSSVTCRSALGKICC-DQDKLIIFMREIIS  209

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  860
             LAGGF + D FP+ K +H   G K +LLK H ++D+I + ++ +HK+N  A+    +G+ 
Sbjct  210   LAGGFSVADFFPTWKMLHDVGGSKTRLLKAHRKIDEILENVVNEHKQNR-ADGKKGNGEF  268

Query  861   -DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
               ED++DVLLRV+E GE+Q PIT+DNIK+++ DMFS G+ETS+TTIIWA++EM+K+PSV+
Sbjct  269   GGEDLIDVLLRVRESGEVQIPITDDNIKSILVDMFSAGSETSSTTIIWALAEMMKKPSVL  328

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
             AKAQAEVRQ LK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE ME+ KI  Y 
Sbjct  329   AKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYN  388

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             IP KTRVI+NAWA+  +PESW+DPE F PERFENSSVDF+G+H++FIPFGAGRR+CPG+ 
Sbjct  389   IPFKTRVIVNAWAIGRDPESWDDPESFSPERFENSSVDFLGSHHQFIPFGAGRRICPGML  448

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             F   ++   LA LLYHF+W+LP+G S + LD+TE+ G+ A++K DL LIA P+
Sbjct  449   FGLANVGQPLAQLLYHFDWKLPNGQSHESLDLTESPGISATRKDDLVLIATPY  501



>gb|AAF27282.1|AF122821_1 cytochrome P450 [Capsicum annuum]
Length=502

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/478 (58%), Positives = 369/478 (77%), Gaps = 7/478 (1%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQ  308
              ++  LPPGPWKLP IGSLHHL V G LPH  L+NL++ YGP+MHL+LGEI  V+IS P+
Sbjct  27    TQKLNLPPGPWKLPFIGSLHHLAVAGPLPHHGLKNLAKLYGPLMHLRLGEIPTVIISSPR  86

Query  309   LARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKS  488
             +A+ + KTHDL FA+RP ++  DIV Y STD+AFSPYG+YWRQ+RKIC+LELLS KMVK 
Sbjct  87    MAKEVLKTHDLAFATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKF  146

Query  489   FCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALL  668
             F S RQ+ELS +VSSIR  +   FP NLT+K+ WFTSS+  + A G++C  DQ K I  +
Sbjct  147   FSSIRQDELSMMVSSIR--TMPNFPVNLTDKIFWFTSSVTCRSALGKIC-RDQDKLIIFM  203

Query  669   KQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTN  848
             ++++SL GGF + D FP+ K +H   G K +LLK H ++D+I + ++ +HK+N  A+   
Sbjct  204   REIISLTGGFSIADFFPTWKMLHDVGGSKTRLLKAHRKIDEILEHVVNEHKQNR-ADGQK  262

Query  849   SSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
              +G+   ED++DVLLRV+E GE+Q  IT+DNIK+++ DMFS G+ETS+TTIIWA++EM+K
Sbjct  263   GNGEFGGEDLIDVLLRVRESGEVQISITDDNIKSILVDMFSAGSETSSTTIIWALAEMMK  322

Query  1023  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1202
             +PSV+AKAQAEVRQ LK  K F   DL+ L YLKLVIKETLR+HPP+PL+ PRE M++ K
Sbjct  323   KPSVLAKAQAEVRQVLKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMKDTK  382

Query  1203  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1382
             I  Y IP KTRVI+NAWA+  +PESW+DPE F PERFENSSVDF+G+H++FIPFGAGRR+
Sbjct  383   IDGYNIPFKTRVIVNAWAIGRDPESWDDPESFSPERFENSSVDFLGSHHQFIPFGAGRRI  442

Query  1383  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             CPG+ F   ++   LA LLYHF+ +LP+G S ++LDMTE+ G+ A++K DL LIA P+
Sbjct  443   CPGMLFGLANVGQPLAQLLYHFDRKLPNGQSHENLDMTESPGISATRKDDLVLIATPY  500



>gb|ABC69403.1| CYP71D51v1 [Nicotiana tabacum]
Length=514

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/479 (57%), Positives = 367/479 (77%), Gaps = 4/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWKLP++GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SAVV++
Sbjct  35    KNSNSQSKKLPPGPWKLPILGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  93

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P  A+ + KTHD+ FASRP+++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  94    SPDTAKEVLKTHDIAFASRPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKN  153

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V++F S R+ E+  L++ IR SS  G P N+TE++  FTSS+  + AFG+V  E Q KFI
Sbjct  154   VRTFSSIRRNEVLRLINFIRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKE-QDKFI  210

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+N    
Sbjct  211   QLIKEVILLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNLAIG  270

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DV LR+   G LQFPIT DNIKA+I DMF+ GTETS++TI+WAM EM+
Sbjct  271   KTNGALGGEDLIDVPLRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVEMV  330

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K P+V AKAQAEVR+A +G +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  EE 
Sbjct  331   KNPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECREET  390

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W D E F+PERFE  S DF+GN++E++PFG GRR
Sbjct  391   NINGYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERFEQCSKDFVGNNFEYLPFGGGRR  450

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   +  L LA LLYHF+W+LP G+ P DLD+TE VGV A++K DL L+A P+
Sbjct  451   ICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSDLYLVATPY  509



>emb|CAC24711.1| cytochrome P450 [Solanum tuberosum]
Length=502

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/479 (57%), Positives = 369/479 (77%), Gaps = 4/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWKLPL+GS+ H+ GG LPH  LR+L++KYGP+MHLQLGE+SAVV++
Sbjct  23    KNSNSQSKKLPPGPWKLPLLGSMLHMAGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P +A+ + KTHD+ FASRP ++A +IV Y  +D+AF PYGDYWRQMRKICVLELLS K 
Sbjct  82    SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+S+ S R++E+  LV+ IR SS  G P N TE++  FTSS+  + AFG+V  E Q KFI
Sbjct  142   VRSYGSIRRDEVDRLVNFIRSSS--GEPVNFTERLFLFTSSMTCRSAFGKVFKE-QDKFI  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  HH++D I + +I +HK+     
Sbjct  199   QLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHHKVDAIVEDVINEHKKKFAIG  258

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVL+R+   G LQFPIT DNIKA+I DMF+ GTETS++T++WAM +M+
Sbjct  259   KTNGALGGEDLIDVLIRLMNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQMM  318

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV+AKAQAEVR+A K  +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  EE 
Sbjct  319   KNPSVIAKAQAEVREAFKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF+GN++E++PFG GRR
Sbjct  379   DINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQRSVDFVGNNFEYLPFGGGRR  438

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++ L LA LLYHF+W+LP G+ PKDL++TE VGV A++K DL L+A P+
Sbjct  439   ICPGISFGLANVYLPLAHLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILVATPY  497



>dbj|BAN58140.1| putative premaspirodiene oxygenase [Hyoscyamus albus]
Length=502

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/479 (57%), Positives = 371/479 (77%), Gaps = 4/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SAVV++
Sbjct  23    KNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P +A+ + KTHD+ FASRP ++A +IV Y  +D+AF PYGDYWRQMRKICVLE+LS K 
Sbjct  82    SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  LV+ +R  S T  P N TE++  FTSS+  + AFG+V  E Q  FI
Sbjct  142   VRSFSSIRRDEVLRLVNFVR--SCTSKPVNFTERLFLFTSSMTCRSAFGKVFKE-QETFI  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V+ LAGGFD+ D+FPS K++H  +GM+ K++K HH++D I + +I +HK+N    
Sbjct  199   QLIKEVIGLAGGFDVADIFPSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNLAMG  258

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVLLR+   G LQFPIT +NIKA+I DMF+ GTETS++T++WAM +M+
Sbjct  259   KTNGALGGEDLIDVLLRLMNDGGLQFPITNNNIKAIIFDMFAAGTETSSSTLVWAMVQMM  318

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             + P+++AKAQ EVR+A KG +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  EE 
Sbjct  319   RNPTILAKAQEEVREAFKGKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
             +I  Y IP KT+V++N WAL  +P+ WED + F PERFE  SVDF+GN++E++PFG GRR
Sbjct  379   EIDGYTIPVKTKVMVNVWALGRDPKYWEDADDFKPERFEQCSVDFIGNNFEYLPFGGGRR  438

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++ L LA LLYHF+W+LP G+ PKDLD+TE VGV A++K DL L+A P+
Sbjct  439   ICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTELVGVTAARKSDLMLVATPY  497



>ref|XP_006339043.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=509

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/485 (56%), Positives = 367/485 (76%), Gaps = 6/485 (1%)
 Frame = +3

Query  111   LRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPHRTLRNLSRKYGPIMHLQLGEISA  287
             ++R+ +    +KLPPGPWKLP +GS+HHLV  G LPH  L NLS+KYGP+MHLQLGEIS 
Sbjct  24    VQRKKSRNLNKKLPPGPWKLPFLGSIHHLVLEGGLPHHALTNLSKKYGPLMHLQLGEIST  83

Query  288   VVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELL  467
             V++S   +AR + KTHDL FASRP + ++D + YKSTD+AF+PYG+YWRQMRK+CV+ELL
Sbjct  84    VIVSSTDMAREVLKTHDLAFASRPKLASVDTICYKSTDIAFTPYGEYWRQMRKVCVMELL  143

Query  468   SMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQ  647
             + K V+SF S R++E S LV  I+ SS  G P N+TE++ W+ SS+  K AFG +  +DQ
Sbjct  144   TAKNVRSFSSIRKDEASGLVQFIQ-SSTCGEPINVTERILWYQSSITCKAAFGELL-KDQ  201

Query  648   GKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN  827
              KFI ++K+V+ LAGGF+L D+FPS K +   SG++ ++LK+H  +D I + +I +HK+N
Sbjct  202   EKFIQMVKEVMELAGGFNLADIFPSIKILQVLSGVRSRILKVHKNVDAIVEDVINEHKKN  261

Query  828   HLANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIW  1001
              +A+    +G    ED+VDVLLR+ E GEL+ PIT DNIKA++ D+FS GTETS+TT  W
Sbjct  262   -IASGKKGNGAFGGEDLVDVLLRLMESGELKIPITNDNIKAIMIDLFSAGTETSSTTATW  320

Query  1002  AMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihpr  1181
             AM+EM++ PSV+ KAQAEVR+A KG +TFD+  +E L YLK V+KET RLHPPLPL+ PR
Sbjct  321   AMTEMMRNPSVLKKAQAEVREAFKGKETFDEDVIEELKYLKQVVKETFRLHPPLPLLVPR  380

Query  1182  ESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIP  1361
             E  EE  I  Y IP KTRV++N W++  +P+ WED E F+PERFE SSVDFMGN++EF+P
Sbjct  381   ECREETNINGYTIPLKTRVMVNVWSMGRDPKYWEDAESFIPERFEQSSVDFMGNNFEFLP  440

Query  1362  FGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCL  1541
             FGAGRRMCPGI+F   ++ L LA LLYHF+W+LPDG   +D+DMTE  G+ A++K +L L
Sbjct  441   FGAGRRMCPGITFGLINVHLPLAKLLYHFDWKLPDGQKSEDMDMTEVSGITAARKSELYL  500

Query  1542  IARPF  1556
             IA P+
Sbjct  501   IATPY  505



>ref|XP_009623934.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/509 (56%), Positives = 371/509 (73%), Gaps = 6/509 (1%)
 Frame = +3

Query  39    MEHKFL-FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
             ME K L F  +SV++F+SF+  ++ + + S    +  LPPGPW LPLIG+LH L+ G LP
Sbjct  1     MEAKHLSFIFISVLIFVSFIIRLFQIWKASKTFNKL-LPPGPWSLPLIGNLHLLMNGRLP  59

Query  216   -HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYK  392
              H T R+LSR+YGPI HL+LGEIS +V+S P++A+ I KT DL FA+RP  M+ DI+FY 
Sbjct  60    VHHTFRSLSRRYGPIFHLRLGEISIIVVSSPEMAKEIMKTQDLRFATRPEFMSGDIIFYN  119

Query  393   STDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNL  572
              TD+   PYGD+WR MRK+C++ELLS KMVKSF S RQ E+S+L+SSI    +     NL
Sbjct  120   YTDIITCPYGDHWRNMRKVCIVELLSAKMVKSFNSIRQAEMSSLISSINSMPDDSL-INL  178

Query  573   TEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGM  752
             ++K+ WFTSS+  + AFG+V   DQ K I L+K + SLA GFDL D+FPS+KW+H  +G+
Sbjct  179   SDKMFWFTSSVTCRSAFGKVI-HDQHKLIMLVKDIASLAAGFDLADMFPSRKWLHKITGL  237

Query  753   KPKLLKLHHELDKIFDIIIGDHKENHL-ANSTNSSGKDEDIVDVLLRVKEGGELQFPITE  929
             K K+LK+H ++D I + II +H+E+       N     ED++DVLLRV E GEL  P+T+
Sbjct  238   KSKMLKVHTKVDAILENIINEHRESRTNGKKGNGETGGEDLIDVLLRVMESGELGTPLTK  297

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLEN  1109
              NIK VI DMF  G ETS+TTIIWA++EMI+ PSVMAKAQ EVR+ LKG +TF+D DLE 
Sbjct  298   KNIKGVIFDMFLAGAETSSTTIIWALAEMIRNPSVMAKAQLEVREVLKGKRTFEDIDLEE  357

Query  1110  LTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDP  1289
             L YL LVIKETLRLHPP+PL+ PRE  EE KI +Y IP KTRV++N WA+    + W +P
Sbjct  358   LKYLNLVIKETLRLHPPVPLLLPRECREETKIDKYTIPIKTRVLVNVWAMGRESKYWHNP  417

Query  1290  ERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDG  1469
             E F+PERFEN+S+DF GNH+EFIPFGAGRR+CPG+ F   ++   LA LLYH++W+ P G
Sbjct  418   ESFIPERFENNSIDFKGNHFEFIPFGAGRRICPGLLFGLVNVGHPLAQLLYHYDWKTPPG  477

Query  1470  VSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             ++P +LDMTE +GV   +K DLCLI  PF
Sbjct  478   ITPDNLDMTETIGVAGGRKDDLCLIVTPF  506



>ref|XP_006350396.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/479 (57%), Positives = 369/479 (77%), Gaps = 4/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWKLPL+GS+ H+ GG LPH  LR+L++KYGP+MHLQLGE+SAVV++
Sbjct  23    KNSNSQSKKLPPGPWKLPLLGSMLHMAGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P +A+ + KTHD+ FASRP ++A +IV Y  +D+AF PYGDYWRQMRKICVLELLS K 
Sbjct  82    SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+S+ S R++E+  LV+ IR SS  G P N TE++  FTSS+  + AFG+V  E Q KFI
Sbjct  142   VRSYGSIRRDEVDRLVNFIRSSS--GEPVNFTERLFLFTSSMTCRSAFGKVFKE-QDKFI  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V+ LAGGFD+ D+FPS K++H  SGMK K++  H ++D I + +I +HK+N    
Sbjct  199   QLIKEVIGLAGGFDVADIFPSLKFLHVLSGMKGKIMNAHDKVDAIVEDVINEHKKNIAMG  258

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVL+R+   G LQFPIT +NIKA+I DMF+ GTETS++T++WAM +M+
Sbjct  259   KTNGALGGEDLIDVLIRLMNDGGLQFPITNNNIKAIIFDMFAAGTETSSSTLVWAMVQMM  318

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV AKAQAEVR+A K  +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  EE 
Sbjct  319   KNPSVFAKAQAEVREAFKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF+GN++E++PFG+GRR
Sbjct  379   DINSYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQRSVDFVGNNFEYLPFGSGRR  438

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++ L LA LLYHF+W+LP G+ PKDL++TE VGV A++K DL L+A P+
Sbjct  439   ICPGISFGLANVYLPLAHLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILVATPY  497



>ref|XP_009796910.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/500 (56%), Positives = 371/500 (74%), Gaps = 6/500 (1%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
             F+ VS+ +F SF+F +       N A+R  LPPGPWKLP++GS+ H+VGG LPHR LR+L
Sbjct  4     FDLVSIFIFASFLFLLKKWMNSKNQAKR--LPPGPWKLPILGSMLHMVGG-LPHRVLRDL  60

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             ++KYGP+MHLQLGE+S VV++ P++A+ + KTHDL FASRP ++A +IV Y S+DVAF+P
Sbjct  61    AKKYGPLMHLQLGEVSVVVVTSPEIAKEVLKTHDLAFASRPKLLAAEIVLYDSSDVAFAP  120

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YGDYWRQMRKICVLE+LS K V+SF S R++E+  L+   R SS  G P N T+++S F 
Sbjct  121   YGDYWRQMRKICVLEVLSTKNVRSFSSIRRDEVVRLIEFFRSSS--GKPVNFTKRISLFM  178

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
             S +I + AFG V  E Q +FI ++K V +L  GFD+ D+FPS K++H  +GM+ K + LH
Sbjct  179   SFIICRSAFGTVFKE-QDEFIQVMKDVTALLEGFDVADIFPSLKFLHVLTGMRAKAMNLH  237

Query  777   HELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIND  956
             H++D I D II +HK+N      N     ED++DVLLR+K+ G  QFPIT DNIKA+I D
Sbjct  238   HKVDDIVDNIINEHKKNLATGKFNGQLGGEDLIDVLLRLKKDGGFQFPITNDNIKAIIYD  297

Query  957   MFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIK  1136
             MF+ GTET++TTI WAM EMI+  SV AKAQAEVR+     +TFD+ D+E L YLKLVIK
Sbjct  298   MFAAGTETTSTTIDWAMVEMIRNASVFAKAQAEVREVFNRKETFDENDVEELKYLKLVIK  357

Query  1137  ETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE  1316
             ETLRLHPPLPL+ PRE  EE  I  Y IP K++V++N WA+  +P++W+D E F PERFE
Sbjct  358   ETLRLHPPLPLMLPRECREETNINGYTIPLKSKVMVNVWAIGRDPKNWDDAESFKPERFE  417

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
              SSVDF+GN++E++PFG+GRR+CPGI F   +I L LA LLY+F+W+LP G++P DLDMT
Sbjct  418   QSSVDFVGNNFEYLPFGSGRRICPGILFGLANIYLPLAQLLYYFDWKLPTGINPSDLDMT  477

Query  1497  EAVGVIASKKKDLCLIARPF  1556
             E+ G   ++K +L LIA P+
Sbjct  478   ESDGASCARKSNLYLIASPY  497



>ref|XP_006365938.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=514

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/484 (57%), Positives = 361/484 (75%), Gaps = 8/484 (2%)
 Frame = +3

Query  111   LRRRSNPARRQ----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGE  278
             +++ S P  R     +LPPGPW+LPLIG+LHHL+GG LPH   R LS++YGP+M+LQLGE
Sbjct  25    VKKWSKPKNRNEKQFRLPPGPWRLPLIGNLHHLIGGGLPHHIFRKLSQRYGPLMYLQLGE  84

Query  279   ISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVL  458
             +  VVIS   +A+ I +THD  FA RP + + +I+FY S D+AFSPYGDYWRQMRKIC L
Sbjct  85    VPTVVISSTTIAKEILRTHDHAFACRPQLTSTNIIFYNSIDIAFSPYGDYWRQMRKICTL  144

Query  459   ELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCS  638
             EL S+KM+K F + R++EL++L+SSIR  S  G P N+T+K+  FT+ +I + AFG+VC 
Sbjct  145   ELFSIKMIKLFSAIREDELTSLISSIR--SMRGSPVNMTKKIFLFTNCIICRSAFGKVC-  201

Query  639   EDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDH  818
             +D+G+F+  LK+VL LA GF + DL+PS K +H   G K +++  H ++D + + I+ +H
Sbjct  202   KDRGEFLTTLKEVLLLAAGFFMADLYPSWKLLHNLRGEKTRMVNAHKKVDAVMEEILNEH  261

Query  819   KENHLANST-NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTI  995
              EN  A    N    DED+VDVLLRVKE  ELQ+PIT D+IKAVI D+F  GT +S++TI
Sbjct  262   IENKAAGKKGNGEFGDEDLVDVLLRVKENAELQYPITNDHIKAVIFDIFLGGTGSSSSTI  321

Query  996   IWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplih  1175
             IWA+SEMIK P+VM KAQ+EVRQ  KG + F ++++ENLTYLK VIKETLRLH P PL+ 
Sbjct  322   IWALSEMIKNPNVMIKAQSEVRQVFKGKQNFSEEEVENLTYLKSVIKETLRLHTPAPLLG  381

Query  1176  prESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEF  1355
              RE  E+  I  Y IP K RV++NAWALA +PESW+DPE F+PERFENSS+DFMGNH+EF
Sbjct  382   SRECREQRVIDGYTIPLKARVLVNAWALARDPESWDDPENFIPERFENSSIDFMGNHFEF  441

Query  1356  IPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDL  1535
             IPFG+GRR+CPG+     ++   LA LLYHF WELP+G +P+DLDMTE  G+ A KK++L
Sbjct  442   IPFGSGRRVCPGLLLGVANVIHPLAQLLYHFEWELPNGTNPEDLDMTETHGLTAEKKENL  501

Query  1536  CLIA  1547
              LIA
Sbjct  502   YLIA  505



>ref|XP_004228510.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/501 (55%), Positives = 370/501 (74%), Gaps = 4/501 (1%)
 Frame = +3

Query  54    LFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
              FN +S+ +F+SF+F +  L+  SN    + LPPGPWKLP +GS+ H++GG LPHR LR+
Sbjct  3     FFNLISISLFVSFLFLLKKLKN-SNSQINKSLPPGPWKLPFVGSMFHMIGG-LPHRVLRD  60

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L++KYG I+HLQLGE+S VV++ P +A+ + KTHDL FASRP ++A +IV Y  TD+AF 
Sbjct  61    LAKKYGSILHLQLGEVSLVVVTSPIMAKQVLKTHDLAFASRPRLLAAEIVLYNCTDIAFC  120

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYGDYWRQMRKICVLE+LS K V+SF S RQ+E   LV   R SS +  P N+T+++S F
Sbjct  121   PYGDYWRQMRKICVLEVLSGKNVRSFGSIRQDETIRLVEFFRSSSSSE-PVNVTKRISLF  179

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
             TS +I + AFG +  E Q +FI ++K V SL  GF++ D+FPS K++H  SGMK K + L
Sbjct  180   TSFIICRSAFGTIFKE-QDEFIQVMKGVTSLLEGFNVADIFPSLKFLHVLSGMKSKTMYL  238

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
             HH++D I + +I +HK+N +   TN     ED++DVLLR+ E G+LQFPIT DNIKA++ 
Sbjct  239   HHKVDTIVENVINEHKKNLVNGKTNGELGGEDLIDVLLRLMEDGDLQFPITNDNIKAIVY  298

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             DMF+ GTET++TTI WAM EMIK  S++ KAQ EVR+  +G  TFD+ D+E L YLKLV+
Sbjct  299   DMFAAGTETTSTTIDWAMVEMIKNSSILVKAQKEVREVFRGKDTFDENDVEELKYLKLVV  358

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KETLRLHPPLPL+ PRE  EE  I  Y IP KT++I+N WA+  +P+ W+D E F PERF
Sbjct  359   KETLRLHPPLPLMLPRECREEVDIDGYTIPSKTKLIVNVWAIGRDPKYWDDAESFKPERF  418

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
             E SS+DF+GN++EF+PFG+GRR+CPGISF   ++ L LA LLYHF+W+LP G+ P DLDM
Sbjct  419   EQSSLDFVGNNFEFLPFGSGRRICPGISFGLANVYLPLANLLYHFDWKLPPGIKPSDLDM  478

Query  1494  TEAVGVIASKKKDLCLIARPF  1556
             TE+ G   ++K +L LI  P+
Sbjct  479   TESDGASCTRKSNLYLIMTPY  499



>sp|P93531.1|C71D7_SOLCH RecName: Full=Cytochrome P450 71D7 [Solanum chacoense]
 gb|AAB61965.1| putative cytochrome P450 [Solanum chacoense]
Length=500

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/476 (56%), Positives = 357/476 (75%), Gaps = 2/476 (0%)
 Frame = +3

Query  126   NPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYP  305
             N ++ +KLPPGPWKLP IG +HHL GG LPHR LR+L+ KYGP+MHLQLGE+SAVV++ P
Sbjct  24    NNSQTKKLPPGPWKLPFIGGMHHLAGG-LPHRVLRDLAEKYGPLMHLQLGEVSAVVVTSP  82

Query  306   QLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  485
             ++A+ + KTHD+ FASRP ++A+DI+ Y   D+AFSPYGDYWRQMRKIC++E+LS K V+
Sbjct  83    EMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGDYWRQMRKICIMEVLSAKSVR  142

Query  486   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  665
             SF S R +E+  L+ SI+    +G   N TE++ WFTSS+  + AFG+V  E Q  FI L
Sbjct  143   SFSSIRHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKE-QEVFIKL  201

Query  666   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  845
             +++V+SLA GFD+ D+FPS K++H   G K KLL  H ++D I + +I +HK+N     +
Sbjct  202   IREVISLAEGFDVADIFPSYKFLHGFGGAKQKLLNAHRKVDSIVEDVIKEHKKNLATRKS  261

Query  846   NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1025
             + +   ED+VD L+R+     LQFPI  DNIKAVI D+F+ GTETS+TT +WAM+EM+K 
Sbjct  262   DDAIGGEDLVDALVRLMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMAEMLKN  321

Query  1026  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1205
             PSV AKAQA+VR+A +   TFD+ D+E L YLKLVIKET+RLH P+PL+ PRE  EE +I
Sbjct  322   PSVFAKAQAKVREAFRDKVTFDENDVEELKYLKLVIKETMRLHAPVPLLVPRECREETEI  381

Query  1206  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1385
               Y IP KT+V++N WAL  +P+ W+D E F PERFE  S+DF+GN++E++PFG GRR+C
Sbjct  382   NGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSIDFIGNNFEYLPFGGGRRIC  441

Query  1386  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             PGISF   ++ L LA LLYHF+W+LP G+ PKDLD+TE+ G+ A++K DL LIA P
Sbjct  442   PGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTESAGITAARKGDLYLIATP  497



>ref|XP_006365979.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=521

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/514 (55%), Positives = 374/514 (73%), Gaps = 13/514 (3%)
 Frame = +3

Query  36    EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSL------HHL  197
             E+ +   +N V++++  SF+F ++    R + A+++KLPPGPW+LP+IGSL      HHL
Sbjct  2     EIIYSSTYNFVALLILFSFLFTLFDKLLRKSLAKQEKLPPGPWRLPIIGSLPIIGSLHHL  61

Query  198   VGGSL-PHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMAL  374
              G  L PHRTL+NL+ KYGPIM+LQLGEI AV++S P + + I KTH+L FA++P + ++
Sbjct  62    RGALLFPHRTLKNLATKYGPIMYLQLGEIRAVIVSSPNMVKEILKTHELAFATKPQLTSI  121

Query  375   DIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSET  554
             DI  Y   D+AF+PYGD WRQMR ICV ELLS KMVKSF S +++E+  L+SSIR S+  
Sbjct  122   DITTYNYKDIAFAPYGDKWRQMRNICVTELLSTKMVKSFSSIQKDEIMRLLSSIR-STNG  180

Query  555   GFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWI  734
                 NLTE +  +T+S+  + AFG+V + +Q + I LL+ VL   GGFD+ DLFPS K +
Sbjct  181   SHLVNLTELILRYTNSVTCRSAFGKVYT-NQDQLINLLRDVLDTLGGFDVADLFPSWKLL  239

Query  735   HYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK---DEDIVDVLLRVKEGG  905
             H  SG+K KLLK+H ++D+  + I+ +H +N       +  K    ED+VDVLLRVKE G
Sbjct  240   HKMSGVKSKLLKMHKKVDEALENIVNEHIKNRSLGCKGNGEKLVGGEDLVDVLLRVKENG  299

Query  906   ELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKT  1085
             ELQFPIT D+IKA+I+DMF+ GTETSA TIIWA+SEM++RP++MAKAQ EVRQ  KGN T
Sbjct  300   ELQFPITSDHIKAIISDMFAAGTETSAATIIWALSEMMRRPNIMAKAQNEVRQVFKGNTT  359

Query  1086  FDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALAT  1265
              ++ DL+ L YLKLVIKETLRLHPP  L+   E  ++  I  Y IPPKTRV+IN WAL  
Sbjct  360   INEDDLDKLIYLKLVIKETLRLHPPSTLLPR-ECRKQTYINGYTIPPKTRVLINTWALGR  418

Query  1266  NPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYH  1445
             + ESW+D E F+PERFENS VD+MGN++EFIPFG+GRR+CPG+ F  T++   LA LLYH
Sbjct  419   DSESWDDTESFIPERFENSHVDYMGNYFEFIPFGSGRRICPGMQFGLTNVKHPLAQLLYH  478

Query  1446  FNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1547
             F+W LP G +P+DLDM E  G+ A+K KDLCLIA
Sbjct  479   FDWVLPYGANPEDLDMIEKNGLSAAKHKDLCLIA  512



>ref|XP_006350393.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/476 (56%), Positives = 356/476 (75%), Gaps = 2/476 (0%)
 Frame = +3

Query  126   NPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYP  305
             N ++ +KLPPGPWKLP IGS+HHL GG LPHR LR+L+ KYGP+MHLQLGE+SAVV++ P
Sbjct  24    NNSQTKKLPPGPWKLPFIGSMHHLAGG-LPHRVLRDLAEKYGPLMHLQLGEVSAVVVTSP  82

Query  306   QLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  485
             ++A+ + KTHD+ FASRP ++A+DI+ Y   D+AFSPYG+YWRQMRKIC++E+LS K V+
Sbjct  83    EMAKQVLKTHDIAFASRPKLLAMDIICYNRRDIAFSPYGEYWRQMRKICIMEVLSAKNVR  142

Query  486   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  665
             SF S R +E+  L+ SI+    +G   N TE++ WFTSS+  + AFG+V  E Q  FI L
Sbjct  143   SFSSIRHDEVVRLIDSIQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKE-QEVFIKL  201

Query  666   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  845
             +++V+SLA GFD+ D+FPS K++H   G K KLL  H ++D I + +I +HK+N     +
Sbjct  202   IREVISLAEGFDVADIFPSYKFLHGFGGAKKKLLNAHRKVDSIVEDVIKEHKKNIATRKS  261

Query  846   NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1025
             + +   ED+VDVLLR+     LQFPI  DNIKAVI D+F+ GTETS+TT +WAM+EM+K 
Sbjct  262   DDAIGGEDLVDVLLRLMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMAEMLKN  321

Query  1026  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1205
             PSV AKAQAEVR+A +   TFD  D+E L YLKLVIKET+RLH P+PL+ PRE  EE +I
Sbjct  322   PSVFAKAQAEVREAFRDKVTFDGNDVEELKYLKLVIKETMRLHAPVPLLVPRECREETEI  381

Query  1206  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1385
               Y IP KT+V++N WAL  +P+ W+D E F PERFE  S+DF+GN++E++PFG GRR+C
Sbjct  382   NGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSIDFIGNNFEYLPFGGGRRIC  441

Query  1386  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             PGISF   ++   LA LLYHF+W+LP G+ PKDLD+TE+ G+  ++K DL LIA P
Sbjct  442   PGISFGLANVYFPLAQLLYHFDWKLPTGMEPKDLDLTESAGITVARKGDLYLIATP  497



>ref|XP_006350395.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/479 (57%), Positives = 365/479 (76%), Gaps = 4/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWKLPL+GS+ H+VGG LPH  LR+L++KYGP+MHLQLGE+SAVV++
Sbjct  23    KNSNSQSKKLPPGPWKLPLLGSMLHMVGG-LPHHVLRDLAKKYGPLMHLQLGEVSAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P +A+ + KTHD+ FASRP ++A +IV Y  +D+AF PYGDYWRQM KICVLELLS K 
Sbjct  82    SPDMAKEVLKTHDIAFASRPKLLAPEIVCYNRSDIAFCPYGDYWRQMHKICVLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+S+ S R++E+  LV+ IR SS  G P N  E++  FTSS+  + AFG+V  E Q KFI
Sbjct  142   VRSYGSIRRDEVDRLVNLIRSSS--GEPVNFIERLFLFTSSMTCRSAFGKVFKE-QDKFI  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V+ LAGGFD+ DLFPS K +H  SGMK K++  HH++D I + +I +HK+N    
Sbjct  199   QLIKEVIGLAGGFDVADLFPSLKLLHVLSGMKGKIMNAHHKIDAIVEDVINEHKKNIAMG  258

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVL+R+   G LQFPIT  NIKA+I DMF+  TETS++T+ WAM +M+
Sbjct  259   KTNGALGGEDLIDVLIRLMNDGGLQFPITNVNIKAIIFDMFAAETETSSSTLDWAMVQMM  318

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV+AKAQAEVR+A K  +TFD+ D+E L YLKLVIKETLRLHPP+PL+ PRE  EE 
Sbjct  319   KNPSVIAKAQAEVREAFKDKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREET  378

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF+GN++E++PFG GRR
Sbjct  379   DINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFIGNNFEYLPFGGGRR  438

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++ L LA LLYHF+W+LP G+ PKDL++TE VGV A++K DL L+A P+
Sbjct  439   ICPGISFGLANVYLPLAQLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILVATPY  497



>ref|XP_009622900.1| PREDICTED: cytochrome P450 71D7-like [Nicotiana tomentosiformis]
 gb|ABC69401.1| CYP71D49v2 [Nicotiana tabacum]
Length=505

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/497 (56%), Positives = 365/497 (73%), Gaps = 8/497 (2%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
             FN +++++F+SF+F +        P    KLPPGPW+LPLIGSLHHL  G LPH  LR+L
Sbjct  8     FNLIALLLFISFLFILLKKWNTKIP----KLPPGPWRLPLIGSLHHL-KGKLPHHHLRDL  62

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             +RKYGP+M+LQLGE+  VVIS P++A+A+ KTHDL FA+RP  M+ DIVFYKS D++F+P
Sbjct  63    ARKYGPLMYLQLGEVPVVVISSPRIAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAP  122

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YGDYWRQMRKI   ELLS KM+KSF + R++ELS L+SSIRL++ +    N+ EK+ WFT
Sbjct  123   YGDYWRQMRKILTQELLSNKMLKSFSTIRKDELSKLLSSIRLATASS-AVNINEKLLWFT  181

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
             S +  ++AFG++C+ D+ + I L++++L+L+GGFD+ DLFPS K +H  S MK +L  +H
Sbjct  182   SCMTCRLAFGKICN-DRDELIMLIREILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVH  240

Query  777   HELDKIFDIIIGDHKENHLAN-STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
             H+ + I + II +HKENH A    N+    ED++D LLRVKE  ELQFPI  DN+KAVI 
Sbjct  241   HKYNLIMENIINEHKENHAAGIKGNNEFGGEDMIDALLRVKENNELQFPIENDNMKAVIL  300

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D+F  GTETS T IIWA+SE++K PSVMAKAQAEVR+  K N+  D+ DL+ L YLK VI
Sbjct  301   DLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENLDENDLDKLPYLKSVI  360

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KETLR+HPP+PL+ PRE  E+ +I  Y +P K RV++NAWA+  +PESWEDPE F PERF
Sbjct  361   KETLRMHPPVPLLGPRECREQTEIDGYTVPLKARVMVNAWAIGRDPESWEDPESFKPERF  420

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
             EN SVD  GNHY+FIPFG+GRRMCPG+SF   +    LA LLY F+W+ P  V+  D   
Sbjct  421   ENISVDLTGNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYFFDWKFPHKVNAADFHT  480

Query  1494  TEAVGVIASKKKDLCLI  1544
             TE   V A+ K DL LI
Sbjct  481   TETSRVFAASKDDLYLI  497



>gb|ABC69399.1| CYP71D49v1 [Nicotiana tabacum]
Length=505

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/497 (56%), Positives = 365/497 (73%), Gaps = 8/497 (2%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
             FN +++++F+SF+F +        P    KLPPGPW+LPLIGSLHHL  G LPH  LR+L
Sbjct  8     FNLIALLLFISFLFILLKKWNTKIP----KLPPGPWRLPLIGSLHHL-KGKLPHHHLRDL  62

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             +RKYGP+M+LQLGE+  VVIS P++A+A+ KTHDL FA+RP  M+ DIVFYKS D++F+P
Sbjct  63    ARKYGPLMYLQLGEVPVVVISSPRIAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAP  122

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YGDYWRQMRKI   ELLS KM+KSF + R++ELS L+SSIRL++ +    N+ EK+ WFT
Sbjct  123   YGDYWRQMRKILTQELLSNKMLKSFSTIRKDELSKLLSSIRLATASS-AVNINEKLLWFT  181

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
             S +  ++AFG++C+ D+ + I L++++L+L+GGFD+ DLFPS K +H  S MK +L  +H
Sbjct  182   SCMTCRLAFGKICN-DRDELIMLIREILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVH  240

Query  777   HELDKIFDIIIGDHKENHLAN-STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
             H+ + I + II +HKENH A    N+    ED++D LLRVKE  ELQFPI  DN+KAVI 
Sbjct  241   HKYNLIMENIINEHKENHAAGIKGNNEFGGEDMIDALLRVKENNELQFPIENDNMKAVIL  300

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D+F  GTETS T IIWA+SE++K PSVMAKAQAEVR+  K N+  D+ DL+ L YLK VI
Sbjct  301   DLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENLDENDLDKLPYLKSVI  360

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KETLR+HPP+PL+ PRE  E+ +I  Y +P K RV++NAWA+  +PESWEDPE F PERF
Sbjct  361   KETLRMHPPVPLLGPRECREQTEIDGYTVPLKARVMVNAWAIGRDPESWEDPESFKPERF  420

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
             EN SVD  GNHY+FIPFG+GRRMCPG+SF   +    LA LLY F+W+ P  V+  D   
Sbjct  421   ENISVDLTGNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYLFDWKFPHKVNAADFHT  480

Query  1494  TEAVGVIASKKKDLCLI  1544
             TE   V A+ K DL LI
Sbjct  481   TETSRVFAASKDDLYLI  497



>ref|XP_009608635.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=511

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/478 (58%), Positives = 356/478 (74%), Gaps = 4/478 (1%)
 Frame = +3

Query  117   RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVI  296
             R+ +  R+Q+LPPGPW+ P+IGSLHHL+G  +PHRTLR+L++KYGP+M+LQLG+   V+I
Sbjct  28    RQWSRNRKQRLPPGPWRFPIIGSLHHLMGREVPHRTLRSLAQKYGPLMYLQLGQAPTVII  87

Query  297   SYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  476
             S P +A+ + KTHDL FA+R  + + +I+FY + D+ FS Y DYWRQMRKIC+LELLS K
Sbjct  88    SSPSMAKQVLKTHDLAFANRAQLTSSNIIFYNNKDIVFSQYSDYWRQMRKICILELLSTK  147

Query  477   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  656
             MVKSF + RQ+ELS       + S  G P NLTEK+   T+S+  + AFG V  +D+ +F
Sbjct  148   MVKSFSAIRQDELS--SLISSIRSMRGSPVNLTEKIFQLTNSITGRAAFGNVF-KDRHEF  204

Query  657   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  836
             + L+K+VL LAGGFD+ DLFPS K +H  SG+K +L+  H ++D+I + I+ +H EN  A
Sbjct  205   MKLMKEVLELAGGFDVADLFPSWKLLHKMSGVKSRLVNAHRKVDEIMEDILNEHIENKAA  264

Query  837   -NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1013
              N        ED+VDV LR+KE  ELQFPIT DNIKAVI D+F  G+ETS+T IIWA+SE
Sbjct  265   GNKGIGEFGGEDLVDVFLRIKENAELQFPITNDNIKAVIFDIFLAGSETSSTAIIWALSE  324

Query  1014  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1193
             MIK P++MAKAQ+EVRQ  KG K +D++DLE LTYL LVIKETLRLHP + L+ PRE  E
Sbjct  325   MIKNPNIMAKAQSEVRQVFKGKKKYDEEDLEKLTYLNLVIKETLRLHPSVSLLPPRECRE  384

Query  1194  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1373
             +  I  Y IP KTR+I+NAWAL  +PESW DPE F+PERF+NSS++F GNH+EFIPFGAG
Sbjct  385   QTDIDGYTIPLKTRIIVNAWALGRDPESWHDPESFIPERFKNSSIEFTGNHFEFIPFGAG  444

Query  1374  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1547
             RRMCPGI F   ++ L LA LL HF WELP   + +DLDMTE  G+ A+K+KDL L+A
Sbjct  445   RRMCPGIQFGLVNVGLPLAQLLQHFEWELPHETNSQDLDMTETRGLSAAKQKDLYLVA  502



>gb|ABC69402.1| CYP71D5v2 [Nicotiana tabacum]
Length=504

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/472 (58%), Positives = 354/472 (75%), Gaps = 5/472 (1%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQL  311
             A+  KLPPGPW+LP IGSLHHL  G LPH  LR+L+RKYGP+M+LQLGEI  VVIS P++
Sbjct  29    AKIPKLPPGPWRLPFIGSLHHL-KGKLPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRV  87

Query  312   ARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSF  491
             A+A+ KTHDL FA+RP  M+ DIVFYKS D++F+P+GDYWRQMRKI   ELLS KM+KS+
Sbjct  88    AKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSY  147

Query  492   CSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLK  671
                R++ELS L+SSIRL  ETG   N+ EK+ WFTS +  ++AFG++C+ D+ + I L++
Sbjct  148   SLIRKDELSKLLSSIRL--ETGSAVNINEKLLWFTSCMTCRLAFGKICN-DRDELIMLIR  204

Query  672   QVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STN  848
             ++L+L+GGFD+GDLFPS K +H  S MK +L  +HH+ D + + II +H+ENH A    N
Sbjct  205   EILTLSGGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGN  264

Query  849   SSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1028
             +    ED++D LLR KE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SE++K P
Sbjct  265   NEFGGEDMIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHP  324

Query  1029  SVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1208
             SVMAKAQAEVR+  K N+ FD+ DL+ L YLK VIKETLR+HPP+PL+ PRE  ++ +I 
Sbjct  325   SVMAKAQAEVRKVFKENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEID  384

Query  1209  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1388
              Y +P K RV++NAWA+  +PESWEDPE F PERFEN+SVD  GNHY+FIPFG+GRRMCP
Sbjct  385   GYTVPIKARVMVNAWAIGRDPESWEDPESFKPERFENTSVDLTGNHYQFIPFGSGRRMCP  444

Query  1389  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             G+SF   +    LA LLY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  445   GMSFGLVNTGHPLAQLLYCFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>gb|ABC69398.1| CYP71D5v3 [Nicotiana tabacum]
Length=504

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/472 (58%), Positives = 354/472 (75%), Gaps = 5/472 (1%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQL  311
             A+  KLPPGPW+LP IGSLHHL  G LPH  LR+L+RKYGP+M+LQLGEI  VVIS P++
Sbjct  29    AKIPKLPPGPWRLPFIGSLHHL-KGKLPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRV  87

Query  312   ARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSF  491
             A+A+ KTHDL FA+RP  M+ DIVFYKS D++F+P+GDYWRQMRKI   ELLS KM+KS+
Sbjct  88    AKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSY  147

Query  492   CSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLK  671
                R++ELS L+SSIRL  ETG   N+ EK+ WFTS +  ++AFG++C+ D+ + I L++
Sbjct  148   SLIRKDELSKLLSSIRL--ETGSAVNINEKLLWFTSCMTCRLAFGKICN-DRDELIMLIR  204

Query  672   QVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STN  848
             ++L+L+GGFD+GDLFPS K +H  S MK +L  +HH+ D + + II +H+ENH A    N
Sbjct  205   EILTLSGGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGN  264

Query  849   SSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1028
             +    ED++D LLR KE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SE++K P
Sbjct  265   NEFGGEDMIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHP  324

Query  1029  SVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1208
             SVMAKAQAEVR+  K N+ FD+ DL+ L YLK VIKETLR+HPP+PL+ PRE  ++ +I 
Sbjct  325   SVMAKAQAEVRKVFKENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEID  384

Query  1209  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1388
              Y +P K RV++NAWA+  +PESWEDPE F PERFEN+SVD  GNHY+FIPFG+GRRMCP
Sbjct  385   GYTVPIKARVMVNAWAIGRDPESWEDPESFKPERFENTSVDLTGNHYQFIPFGSGRRMCP  444

Query  1389  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             G+SF   +    LA LLY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  445   GMSFGLVNTGHPLAQLLYCFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>ref|XP_009764618.1| PREDICTED: cytochrome P450 71D7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009764619.1| PREDICTED: cytochrome P450 71D7-like isoform X2 [Nicotiana sylvestris]
Length=504

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/468 (59%), Positives = 352/468 (75%), Gaps = 5/468 (1%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             KLPPGPW+LP IGSLHHL  G LPH  LR+L+RKYGP+M+LQLGEI  VVIS P++A+A+
Sbjct  33    KLPPGPWRLPFIGSLHHL-KGKLPHHNLRDLARKYGPLMYLQLGEIPVVVISSPRVAKAV  91

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              KTHDL FA+RP  M+ DIVFYKS D++F+P+GDYWRQMRKI   ELLS KM+KS+   R
Sbjct  92    LKTHDLAFATRPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIR  151

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             ++ELS L+SSIRL  ETG   N+ EK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDELSKLLSSIRL--ETGSAVNINEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILT  208

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  860
             L+GGFD+GDLFPS K +H  S MK +L  +HH+ D + + II +H+ENH A    N+   
Sbjct  209   LSGGFDVGDLFPSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFG  268

Query  861   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1040
              ED++D LLR KE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SE++K PSVMA
Sbjct  269   GEDMIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMA  328

Query  1041  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1220
             KAQAEVR+  K N+ FD+ DL+ L YLK VIKETLR+HPP+PL+ PRE  ++ +I  Y +
Sbjct  329   KAQAEVRKVFKENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEIDGYTV  388

Query  1221  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1400
             P K RV++NAWA+  +PESWEDPE F PERFEN+SVD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  389   PIKARVMVNAWAIGRDPESWEDPESFKPERFENTSVDLTGNHYQFIPFGSGRRMCPGMSF  448

Query  1401  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
                +    LA LLY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  449   GLVNTGHPLAQLLYCFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>gb|ABC69400.1| CYP71D49v3 [Nicotiana tabacum]
Length=505

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/497 (56%), Positives = 364/497 (73%), Gaps = 8/497 (2%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
             FN +++++F+SF+F +        P    KLPPGPW+LPLIGSLHHL  G LPH  LR+L
Sbjct  8     FNLIALLLFISFLFILLKKWNTKIP----KLPPGPWRLPLIGSLHHL-KGKLPHHHLRDL  62

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             +RKYGP+M+LQLGE+  VVIS P++A+A+ KTHDL FA+RP  M+ DIVFYKS D++F+P
Sbjct  63    ARKYGPLMYLQLGEVPVVVISSPRIAKAVLKTHDLAFATRPRFMSSDIVFYKSRDISFAP  122

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YGDYWRQMRKI   ELLS KM+KSF + R++ LS L+SSIRL++ +    N+ EK+ WFT
Sbjct  123   YGDYWRQMRKILTQELLSNKMLKSFSTIRKDGLSKLLSSIRLATASS-AVNINEKLLWFT  181

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
             S +  ++AFG++C+ D+ + I L++++L+L+GGFD+ DLFPS K +H  S MK +L  +H
Sbjct  182   SCMTCRLAFGKICN-DRDELIMLIREILALSGGFDVCDLFPSWKLLHNMSNMKARLTNVH  240

Query  777   HELDKIFDIIIGDHKENHLAN-STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
             H+ + I + II +HKENH A    N+    ED++D LLRVKE  ELQFPI  DN+KAVI 
Sbjct  241   HKYNLIMENIINEHKENHAAGIKGNNEFGGEDMIDALLRVKENNELQFPIENDNMKAVIL  300

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D+F  GTETS T IIWA+SE++K PSVMAKAQAEVR+  K N+  D+ DL+ L YLK VI
Sbjct  301   DLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENLDENDLDKLPYLKSVI  360

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KETLR+HPP+PL+ PRE  E+ +I  Y +P K RV++NAWA+  +PESWEDPE F PERF
Sbjct  361   KETLRMHPPVPLLGPRECREQTEIDGYTVPLKARVMVNAWAIGRDPESWEDPESFKPERF  420

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
             EN SVD  GNHY+FIPFG+GRRMCPG+SF   +    LA LLY F+W+ P  V+  D   
Sbjct  421   ENISVDLTGNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYFFDWKFPHKVNAADFHT  480

Query  1494  TEAVGVIASKKKDLCLI  1544
             TE   V A+ K DL LI
Sbjct  481   TETSRVFAASKDDLYLI  497



>ref|XP_004242219.2| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/499 (54%), Positives = 360/499 (72%), Gaps = 9/499 (2%)
 Frame = +3

Query  60    NPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLS  239
             N VS I+  SF+F I+   RRS   ++Q LPPGPW+LPLIGSLHHL+ G  PHR  R+L+
Sbjct  4     NLVSFILLFSFLFIIFRKLRRS---QKQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLA  60

Query  240   RKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPY  419
             RKYGP+M+L+LGE+  V+IS P  ++ + KTHDL FASRP   + DIV Y + D+AF+ Y
Sbjct  61    RKYGPVMYLELGEVPTVIISSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEY  120

Query  420   GDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTS  599
             GDYW+QMRKIC++ELLS KMVKSF S R++ELS+++SSI  S       N+TE +  FTS
Sbjct  121   GDYWKQMRKICIMELLSAKMVKSFSSIRKDELSSVLSSID-SVRGCCEVNMTEIIVRFTS  179

Query  600   SLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHH  779
             S+  ++ FG++C  D+ + I L+K  L L GGFD+GD FPS K ++  SG K KL+K+H 
Sbjct  180   SVTCRLVFGKLC-RDRDELINLMKDALFLVGGFDIGDFFPSWKLLYKMSGAKSKLVKMHQ  238

Query  780   ELDKIFDIIIGDHKENHLAN-STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIND  956
             ++D + + I+ +H +N  A    N +   ED+VDV LR+KE  +LQFPIT D+IKAVI D
Sbjct  239   KVDSVLERIVNEHIKNREAGIKGNGAHGGEDLVDVFLRIKENDQLQFPITNDHIKAVILD  298

Query  957   MFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIK  1136
             MF+ GTETS+T IIWA+SE++K P+VMAKAQ+EVRQA K    FD++DL+NL YLKLVIK
Sbjct  299   MFTAGTETSSTAIIWALSELMKHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVIK  358

Query  1137  ETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE  1316
             ET  L    P I  RE  EE  +  Y IP K  V++N WA+  +PE W+DPE F+PERFE
Sbjct  359   ET--LRLHAPSIVHRECREETTVDGYTIPAKATVLVNTWAMGRDPEVWDDPESFIPERFE  416

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGV-SPKDLDM  1493
             NS +D++GN+YEF+PFGAG+R+CPG+ F   ++   LA LLYHFNW LP G  +PK LDM
Sbjct  417   NSPIDYLGNNYEFLPFGAGKRICPGMQFGIANVKQPLARLLYHFNWGLPYGTNNPKHLDM  476

Query  1494  TEAVGVIASKKKDLCLIAR  1550
             +E  G+ A+K+KDL LIA+
Sbjct  477   SEKSGLSAAKEKDLYLIAK  495



>ref|XP_006339044.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 359/475 (76%), Gaps = 6/475 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
             +KLPPGPW LP +GSLHHL + G LPH  L NL +KYGP MHLQLGE S VV+S   +AR
Sbjct  34    KKLPPGPWNLPFLGSLHHLALEGGLPHHALTNLGKKYGPFMHLQLGETSMVVVSSLDMAR  93

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              + KTHDL FASRP +++LDI+FYKSTD+AFS YG+YWRQMRKICVLEL + K V+SF S
Sbjct  94    EVMKTHDLAFASRPKLVSLDIIFYKSTDIAFSSYGEYWRQMRKICVLELFTAKNVRSFSS  153

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R++E S+LV  IR SS  G P N+TE++SW+ SS  ++ AFG++  +DQ KFI L+K++
Sbjct  154   IRRDEASSLVQFIR-SSTRGEPINVTEQISWYESSNTSRAAFGKLL-KDQEKFIGLVKEL  211

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
             + LA GF + D FPS K +H  SG++ ++LK+H  +D I + +I +HK+N +A+    +G
Sbjct  212   VELASGFSVADFFPSIKILHVLSGVRSRILKVHKNVDAIVEDVINEHKKN-IASGKKGNG  270

Query  858   K--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1031
                 ED+VDVLLR+KE  EL+ PIT DNIKA++ D+F  GTETS TTIIWAMSEM++ PS
Sbjct  271   AFGGEDLVDVLLRLKESRELKIPITNDNIKAIMIDLFGAGTETSGTTIIWAMSEMMRNPS  330

Query  1032  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1211
             V+AKAQAEVR+A KG +TF++  +E L YLK V+KET RLHPP PL+ PRE  EE  I  
Sbjct  331   VLAKAQAEVREAFKGKETFNEDVIEELKYLKQVVKETFRLHPPAPLLIPRECREETSING  390

Query  1212  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1391
             Y IP KTRVI+N +A+  +P+ WED E F+PERFE  SVDFMGN+++++PFGAGRRMCPG
Sbjct  391   YTIPLKTRVIVNVYAMGRDPKYWEDAESFIPERFEQISVDFMGNNFKYLPFGAGRRMCPG  450

Query  1392  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             I F   ++ L LA LLYHF+W+LPDGV  +D+DMTE  G+ A++K +L LIA P+
Sbjct  451   ILFGLINVYLPLANLLYHFDWKLPDGVKLEDVDMTEFFGITAARKSELYLIATPY  505



>ref|XP_006341699.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=501

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/504 (56%), Positives = 358/504 (71%), Gaps = 8/504 (2%)
 Frame = +3

Query  48    KFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTL  227
             + LF   S+++FLSF+     L R+ +    +KLPPGPWKLP IG+LH L+ G LPH T 
Sbjct  2     ELLFIITSLVLFLSFIL----LLRKQSKIFNKKLPPGPWKLPFIGNLHQLMNGRLPHHTF  57

Query  228   RNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVA  407
             R+LSRKYGPI HL+LGE+S VV+S P  A+ I K  DL FA+RP ++  +I+ Y  +D+ 
Sbjct  58    RDLSRKYGPIFHLRLGEVSHVVVSSPDTAKEIMKIQDLHFATRPQLLFGEIIMYNHSDIG  117

Query  408   FSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVS  587
               PYGDYWR MRK+C LELLS KMV+SF S RQ E+S+L+SSI  +S      NLT+K+ 
Sbjct  118   TCPYGDYWRNMRKVCTLELLSTKMVRSFDSIRQAEMSSLISSI--NSMPDSLINLTDKIF  175

Query  588   WFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLL  767
             WFT  +  + AFG++    Q K I LLK +  LAGGFDL D+FPS+KW+H   G+K K+L
Sbjct  176   WFTGPVTCRSAFGKII-HGQDKLIMLLKDITLLAGGFDLTDVFPSRKWLHGICGLKSKIL  234

Query  768   KLHHELDKIFDIIIGDHKENHL-ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKA  944
             K+H+E+D I + II +H  N       NS  + ED++DVLLRV E GEL  PIT +NIKA
Sbjct  235   KVHNEMDAILENIINEHCRNRANGKKGNSESEGEDLIDVLLRVMESGELGTPITNNNIKA  294

Query  945   VINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLK  1124
             VI DMF  G ETS+TTIIWA +EMI+ PS+MAKAQ EVR+ LKG K F+D DLE L YLK
Sbjct  295   VIFDMFLAGAETSSTTIIWAFAEMIRNPSIMAKAQLEVREVLKGKKVFEDIDLEELKYLK  354

Query  1125  LVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLP  1304
             LVIKETLRLHPPLPL+ PRE  EE +IGEY IP KTRV++NAWA+  +P+ W + E F+P
Sbjct  355   LVIKETLRLHPPLPLLLPRECREETRIGEYTIPIKTRVLVNAWAIGRDPKYWHNSESFIP  414

Query  1305  ERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKD  1484
             ERF+NSS+DF GNH+EFIPFGAGRRMCPG  F   ++  SLA LLYHF+W+ P     ++
Sbjct  415   ERFDNSSIDFRGNHFEFIPFGAGRRMCPGWLFCLMNVEHSLAQLLYHFDWKSPYEGPLEN  474

Query  1485  LDMTEAVGVIASKKKDLCLIARPF  1556
              DMT   G  A +K DLC IA PF
Sbjct  475   FDMTVTNGATARRKDDLCSIATPF  498



>ref|XP_004241764.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=513

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/483 (57%), Positives = 360/483 (75%), Gaps = 8/483 (2%)
 Frame = +3

Query  111   LRRRSNPARRQKLPPGPWKLPLIGSLHHLVGG-SLPHRTLRNLSRKYGPIMHLQLGEISA  287
             L R+S+ A+ +KLPPGPW+LP+IGSLHHL G  S PHRTL+NL+ KYGPIM+LQLGEI A
Sbjct  26    LLRKSSTAK-EKLPPGPWRLPIIGSLHHLRGALSFPHRTLKNLATKYGPIMYLQLGEIPA  84

Query  288   VVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELL  467
             V++S P + + I KTH+L FA++P + ++DI  Y   D+AF+PYGD WRQMR ICV ELL
Sbjct  85    VIVSSPIMVKEILKTHELAFATKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTELL  144

Query  468   SMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQ  647
               K VKSF S R++E++ L+SSIR ++ T    NLTE +  +T+S+  + AFG+VC+ +Q
Sbjct  145   GTKTVKSFSSIRKDEITRLLSSIRSTNGTRL-VNLTELILRYTNSVTCRSAFGKVCT-NQ  202

Query  648   GKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN  827
                I LL+ VL   GGFD+ DLFPS K +H  SG+K +LL++H ++D+  + I+ +H +N
Sbjct  203   HHLINLLRDVLDTLGGFDVSDLFPSWKLLHKMSGVKSELLRMHKKVDEALENIVNEHIKN  262

Query  828   HLANSTNSSGK---DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  998
                    +  K    ED+VDVLLR+KE GELQFPIT D+IKA+I+DMF+ GTETSA TII
Sbjct  263   RALGCKGNGDKLIGGEDLVDVLLRIKENGELQFPITSDHIKAIISDMFAAGTETSAATII  322

Query  999   WAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihp  1178
             WA+SEM+++P +MAKAQ EVRQ  KG  TF + DL+ LTYLKLVIKETLRLHPP  L+  
Sbjct  323   WALSEMMRKPKIMAKAQNEVRQVFKGKITFYEDDLDKLTYLKLVIKETLRLHPPSTLLPR  382

Query  1179  rESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFI  1358
              E  ++  I  Y IPPKTRV+IN WAL  + ESW+DPE F+PERFENS VD+MGN+Y+FI
Sbjct  383   -ECRKQTYINGYTIPPKTRVLINTWALGRDSESWDDPESFIPERFENSPVDYMGNYYKFI  441

Query  1359  PFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLC  1538
             PFG+GRR+CPG+ F  T++   LA LLYHF+W LP G +P+DLDM E  G+ A+K +DLC
Sbjct  442   PFGSGRRICPGMQFGLTNVKHPLAQLLYHFDWVLPYGANPEDLDMIEKNGLSAAKHRDLC  501

Query  1539  LIA  1547
             LIA
Sbjct  502   LIA  504



>ref|XP_006355212.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=504

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/468 (59%), Positives = 349/468 (75%), Gaps = 5/468 (1%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             KLPPGPW+LPLIGSLHHL  G LPH  LR+L+RK+GP+M+LQLGE+  VVIS P++A+A+
Sbjct  33    KLPPGPWRLPLIGSLHHL-KGKLPHHNLRDLARKHGPLMYLQLGEVPVVVISSPRIAKAV  91

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              KTHDL FA+RP  MA DIVFYKS D++F+PYGDYWRQMRK+   ELLS KM+KS+   R
Sbjct  92    LKTHDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLSNKMLKSYNMIR  151

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             ++ELS L+SSIRLS  TG   N+TEK+ WFTS +  ++AFG++C+ D+ + I L++++L+
Sbjct  152   KDELSKLLSSIRLS--TGSAVNITEKLLWFTSCMTCRLAFGKICN-DRDELIMLIREILA  208

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STNSSGK  860
             L+GGFD+ DLFPS K +H  S MK +L  +HH+ D+I + II +HKENH A    N+   
Sbjct  209   LSGGFDVCDLFPSWKLLHNMSNMKARLTNVHHKYDQIMENIINEHKENHAAGIKGNNEFG  268

Query  861   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1040
              ED++D LLRVKE  ELQFPI  DN+KAVI D+F  GTETS T IIWA+SEM+K  +VMA
Sbjct  269   GEDMIDALLRVKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSEMMKHQNVMA  328

Query  1041  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1220
             KAQAEVRQ  K  +  D+ DL+ L YLK VIKETLR+HPP+PL+ PRE  E+ +I  Y +
Sbjct  329   KAQAEVRQVFKEKENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTV  388

Query  1221  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1400
             P   RV++NAWA+  +PESWEDPE F PERFEN SVD  GNHY+FIPFG+GRRMCPG+SF
Sbjct  389   PLNARVMVNAWAIGRDPESWEDPESFKPERFENISVDLTGNHYQFIPFGSGRRMCPGMSF  448

Query  1401  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
                +    LA  LY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  449   GLVNTGHPLAQFLYQFDWKLPDKVNANDFSTTETSRVFAASKDDLYLI  496



>ref|XP_009765480.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=511

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/473 (59%), Positives = 358/473 (76%), Gaps = 7/473 (1%)
 Frame = +3

Query  150   PPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGP-IMHLQLGEISAVVISYPQLARAI  323
             PPGPWKLP++GS+HHL + G  PH  L NL++KYGP +MHLQLGEIS VV+S   +AR +
Sbjct  37    PPGPWKLPILGSVHHLALEGGHPHHALANLAKKYGPDLMHLQLGEISTVVVSSLDMAREV  96

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              KTHDL FASRP ++AL+I+FYKSTD+AFS YGDYWRQMRK+ VLELLS K V+SF S R
Sbjct  97    LKTHDLAFASRPKLLALEIIFYKSTDIAFSAYGDYWRQMRKVAVLELLSAKNVRSFTSIR  156

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             ++E S L+  IR SS T  P N+TE++ W+ SS+  K AFG +  +DQ KFI +++++  
Sbjct  157   RDEASRLIQIIR-SSPTDEPINVTERILWYESSMTCKAAFGELL-KDQKKFILIVRELTE  214

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  860
             L+GGF + D+FPS K +H  SGMK ++L  H  +D I + +I +H +N LAN    +G  
Sbjct  215   LSGGFSVADIFPSIKILHLLSGMKGRILNTHKRVDAIVEDVINEHIKN-LANGKAGNGAL  273

Query  861   -DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
               ED+VDVLLR+KE GELQ PIT DNIKAV+ D+FS GTETS+TT IWAM+EM++ P V 
Sbjct  274   GGEDLVDVLLRLKESGELQIPITNDNIKAVMIDLFSAGTETSSTTTIWAMTEMMRNPKVY  333

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
             AKAQAEVR+  KG +T D+ ++E L YLK V+KETLRLHPPLPL+ PRE  EE  I  Y 
Sbjct  334   AKAQAEVREVFKGKETIDEDNIEELKYLKQVVKETLRLHPPLPLLLPRECREETNINGYT  393

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             IP KTRV++NAWA+  +P+ WED E+F PERFE+ SVDFMGN++E++PFG+GRRMCPGIS
Sbjct  394   IPLKTRVMVNAWAIGRDPKYWEDAEQFKPERFEHGSVDFMGNNFEYLPFGSGRRMCPGIS  453

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             F   ++ L LA LLYH +W+LPDGV P+DLDMTE   + A++K +L LIA P+
Sbjct  454   FGLINVHLPLAKLLYHCDWKLPDGVKPEDLDMTEFTAITAARKSELYLIATPY  506



>ref|XP_006339046.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/475 (58%), Positives = 362/475 (76%), Gaps = 6/475 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
             +KLPPGPWKLP IGS+HHL + G LPH  L NL +K+GP MHLQLGEIS +V+S   +AR
Sbjct  34    KKLPPGPWKLPFIGSVHHLPLEGGLPHHALTNLGKKHGPFMHLQLGEISTIVVSSMDMAR  93

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              + KTHDL FASR  ++ALDI+ YKSTD+AFSPYGDYWRQM K+CVLELL+ K V+SF S
Sbjct  94    EVLKTHDLAFASRSKLLALDIICYKSTDIAFSPYGDYWRQMCKVCVLELLTTKNVRSFSS  153

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R++E S+LV  IR SS    P N+TE++ W+ SS+  K AFG +  +DQ KF+ +L+++
Sbjct  154   IRRDEASHLVQFIR-SSTRDEPINVTERILWYQSSITCKTAFGELL-KDQEKFLGILREL  211

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
             + +AGGF L D+FPS K +   SG+K K+LK+H   D I + +I +HK+N +A+    +G
Sbjct  212   MEVAGGFSLADIFPSIKILQVLSGLKSKILKVHKNADVIVEDVINEHKKN-IASGKKGNG  270

Query  858   K--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1031
                 E++VDVLLR+KE GEL+ PIT DNIKA+I D+FS G+ETS TT IWAMSEM+++PS
Sbjct  271   AFGGENLVDVLLRLKESGELKIPITNDNIKAIIIDLFSAGSETSGTTTIWAMSEMMRKPS  330

Query  1032  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1211
             V+AKAQAEVR+  KG +TFD+  +E L YLK V+KETLRLHPP+PL+ PR+  EE  I  
Sbjct  331   VLAKAQAEVRETFKGKETFDEDVIEELKYLKQVVKETLRLHPPVPLLIPRKCREETNING  390

Query  1212  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1391
             Y IP KTRV++N +A+  +P+ WED E F+PERFE SSVDFMGN++E++PFGAGRRMCPG
Sbjct  391   YTIPLKTRVMVNVYAMGRDPKYWEDAEIFIPERFEQSSVDFMGNNFEYLPFGAGRRMCPG  450

Query  1392  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             I+F   ++ L LA LLYHF+W+LPDG+ PK +DMTE  G+ A++K +L LIA P+
Sbjct  451   ITFGLINVYLPLAKLLYHFDWKLPDGLKPKYVDMTEFSGITAARKSELYLIATPY  505



>ref|XP_009598320.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=502

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/501 (53%), Positives = 364/501 (73%), Gaps = 6/501 (1%)
 Frame = +3

Query  54    LFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
              FN VS+ +F+S +F     ++ +N  +R  LPPGPWK+P +GS+ H++GG LPH  L N
Sbjct  3     FFNLVSIFLFVSSLFLFMKWKKSNNQTKR--LPPGPWKVPFLGSMFHMLGG-LPHHVLTN  59

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L++KYGP+MHLQLGE+S VV++ P++A+ + KTHDL FASRP ++A+DIV Y  TD+AFS
Sbjct  60    LAKKYGPLMHLQLGEMSVVVVTSPEMAKEVLKTHDLAFASRPKLVAVDIVGYNGTDIAFS  119

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYGDYWRQMRKICV+ELLS K V+SF S R++E+ +L+   R  S  G P N+T+++  F
Sbjct  120   PYGDYWRQMRKICVMELLSAKNVRSFNSIRRDEVCSLIEFFR--SSAGEPVNVTKRIYVF  177

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
              SS+I + AFG+V  E Q + I L+K V  L GGFD+ D+FPS+K +H  SG K K + L
Sbjct  178   ASSMIFRSAFGKVIKE-QDECIRLIKDVSGLVGGFDVADIFPSQKVLHVLSGKKGKTMYL  236

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
             HH++D I + +I +HK+N      N     ED++DVLLR+ + G LQFPIT DNIKA+  
Sbjct  237   HHKIDTIIENVINEHKQNLATGKFNGQLGSEDLIDVLLRLMKDGSLQFPITTDNIKAIFI  296

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D+F+ GTETS++T+ WAM EM+K PS++ KAQ+EVR A KG + FD+ D+E L YLKLVI
Sbjct  297   DLFAGGTETSSSTVTWAMVEMMKNPSILIKAQSEVRDAFKGKEAFDENDVEELKYLKLVI  356

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KET RLHPPLPL+ PRE  EE  I  Y IP KT +++N WA+  +P+ W D E F PERF
Sbjct  357   KETFRLHPPLPLLIPRECREETNINGYTIPLKTTIMVNVWAMGRDPKYWVDAENFKPERF  416

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
             ++S++DF GN++EF+PFG+GRR+CPGISF   +I L LA LLYHF+W LP G++P DLD+
Sbjct  417   QHSTMDFTGNNFEFLPFGSGRRICPGISFGLANIYLPLAQLLYHFDWNLPTGINPSDLDL  476

Query  1494  TEAVGVIASKKKDLCLIARPF  1556
              E+ G+   +K D  LIA P+
Sbjct  477   AESAGLAVLRKSDFYLIATPY  497



>ref|XP_004246079.1| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/472 (57%), Positives = 351/472 (74%), Gaps = 5/472 (1%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQL  311
              +  KLPPGPW+LPLIG+LHHL  G LPH  LR+L+RK+GP+M+LQLGE+  VVIS P++
Sbjct  29    TKNTKLPPGPWRLPLIGNLHHL-KGKLPHHNLRDLARKHGPLMYLQLGEVPVVVISSPRI  87

Query  312   ARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSF  491
             A+A+ KTHDL FA+RP  MA DIVFYKS D++F+PYGDYWRQMRK+   ELL+ KMVKS+
Sbjct  88    AKAVLKTHDLAFATRPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLNNKMVKSY  147

Query  492   CSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLK  671
                R++ELS L+SSIRL+  TG   N+TEK+ WFTS +  ++AFG++C+ D+ + I L++
Sbjct  148   NMIRKDELSKLLSSIRLA--TGSAVNITEKLLWFTSCMTCRLAFGKICN-DRDELIMLIR  204

Query  672   QVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN-STN  848
             ++L+L+GGFD+ DLFPS K +   S MK +L  +HH+ D+I + II +HK+NH A    N
Sbjct  205   EILALSGGFDVCDLFPSWKLLQNMSNMKARLTNVHHKYDQIMENIINEHKQNHAAGIKGN  264

Query  849   SSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRP  1028
             +    ED++D LLR KE  ELQFPI  DN+KAVI D+F  GTETS T IIWA++EM+K P
Sbjct  265   NEFGGEDMIDALLRAKENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALTEMMKHP  324

Query  1029  SVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1208
             +VMAKAQAEVRQ  K N+ FD+ DL+ L YLK VIKETLR+HPP+PL+ PRE  E+ +I 
Sbjct  325   NVMAKAQAEVRQVFKDNENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEID  384

Query  1209  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1388
              Y +P   RV++NAWA+  +PESWEDPE F PERFEN +VD  GNHY+FIPFG+GRRMCP
Sbjct  385   GYTVPLNARVMVNAWAIGRDPESWEDPESFKPERFENVAVDLTGNHYQFIPFGSGRRMCP  444

Query  1389  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             G+SF   +    LA  LY F+W+LPD V+  D   TE   V A+ K DL LI
Sbjct  445   GMSFGLVNTGHPLAQFLYQFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>ref|XP_006367966.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/515 (55%), Positives = 364/515 (71%), Gaps = 11/515 (2%)
 Frame = +3

Query  27    FVSEMEHK----FLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHH  194
               S+ME++    F+F  +S+++FLS  F +    ++S    +  LPPGPW+LP IG+LH 
Sbjct  6     LASKMEYQHFPYFIF--ISLVLFLSSFFLVSQKWKKSKSPNKT-LPPGPWRLPFIGNLHQ  62

Query  195   LVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMAL  374
             L+   LPHR+LRNLS+KYGPIMHL+LG IS +VIS  ++A+ I KT DL F  RP IM+ 
Sbjct  63    LMS-DLPHRSLRNLSKKYGPIMHLRLGNISTIVISSSEMAKEIMKTQDLHFVDRPQIMST  121

Query  375   DIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSET  554
              I+FY  TD+ FS YGDYWR MRK+CVLELLS KMVKS  S RQEE+SNL+SS+R S+  
Sbjct  122   SIIFYDCTDIGFSSYGDYWRNMRKVCVLELLSTKMVKSLASIRQEEISNLISSLRSSTPD  181

Query  555   GFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWI  734
                 NL+ K+ WFT+++  +   G++   D+ KFI L+K + SL GGFDL DLFPS+KW+
Sbjct  182   SL-INLSNKIFWFTNTVTCRAVSGKII-HDRNKFIMLVKDIYSLIGGFDLTDLFPSQKWL  239

Query  735   HYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST-NSSGKDEDIVDVLLRVKEGGEL  911
             H  SGMK KL K H ++D+I + I+ DH++N    +  N    +ED VD LLRV E  E 
Sbjct  240   HNISGMKYKLSKAHSKVDEILEQIVNDHRDNRAKGTKYNGESGNEDFVDALLRVMESEEF  299

Query  912   QFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFD  1091
                IT  NIKAVI DMF  GTET++TT+IWA  E+IK P VM KAQ EVR+ L G KTF+
Sbjct  300   GPRITNQNIKAVILDMFLAGTETASTTLIWAFLELIKNPRVMVKAQLEVRERLNGKKTFN  359

Query  1092  DKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNP  1271
             D DLE L YL+ VIKETLRLHPP PL+ PRE  EE KI  Y IP KT+V++NAW++  +P
Sbjct  360   DTDLEELNYLQFVIKETLRLHPPAPLLIPRECREETKIDGYTIPVKTKVLVNAWSIGRDP  419

Query  1272  ESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFN  1451
             + W + E F+PERFENSS+DF GNH+EFIPFGAGRRMCPG+ F   +IA  L+ LLYHF+
Sbjct  420   KYWHNSESFIPERFENSSIDFRGNHFEFIPFGAGRRMCPGMLFGLVNIAHPLSQLLYHFD  479

Query  1452  WELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             W++P GV+P DLD  E  G+ A +K DL LIA PF
Sbjct  480   WKVPHGVNPNDLDTIETEGLTARRKNDLYLIATPF  514



>ref|XP_004243471.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/478 (58%), Positives = 355/478 (74%), Gaps = 8/478 (2%)
 Frame = +3

Query  138   RQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
             + +LPPGPW+LP+IGS+HHL  G LPH+ L+ LS KYGPIM+LQLGE+  VV+S   +A+
Sbjct  27    KNRLPPGPWRLPIIGSVHHLTSG-LPHQVLKKLSFKYGPIMYLQLGEVPTVVVSSSHMAK  85

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              I KTHDL FASRP  M   I+ Y   D+AFSPYGDYWR MRK+ VLELLS KMVKSF  
Sbjct  86    QILKTHDLAFASRPETMMGKIICYNCKDIAFSPYGDYWRHMRKLTVLELLSAKMVKSFSP  145

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              RQ+ELSNL+SSIR S     P NL EK+ WF ++   + AFG VC +DQ + I L+ Q 
Sbjct  146   IRQDELSNLLSSIR-SMNLDSPINLVEKLLWFMNAATCRSAFGNVC-KDQRELITLIHQA  203

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-ANSTNSS  854
              SL+GGF+L DLFPSKK++H  SGM+ KL+   +++D++ D II  H+EN     S N  
Sbjct  204   QSLSGGFELADLFPSKKYLHGISGMESKLMNARYKIDQVLDNIINVHRENRANGKSCNGE  263

Query  855   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1034
                ED++DV LRV E G+   P+T DNIKAVI DMF  G++TS++T+IWA+SE+++ P++
Sbjct  264   SGAEDLIDVFLRVMESGQFPVPLTNDNIKAVILDMFVAGSDTSSSTVIWALSELMRNPNI  323

Query  1035  MAKAQAEVRQALKGNKTFDDK---DLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1205
             MAKAQAEVR+ + G KT DD    DLEN++YL LVIKETLRLHPP PL+ PRE  EE KI
Sbjct  324   MAKAQAEVREVM-GKKTCDDDIDTDLENVSYLMLVIKETLRLHPPTPLLVPRECREETKI  382

Query  1206  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1385
              E+ IP K++V++N WA+  +PE+WE+PE F+PERFENSS++F GNH+EF+PFGAGRR+C
Sbjct  383   DEFTIPLKSKVMVNVWAIGRDPENWENPECFVPERFENSSIEFTGNHFEFLPFGAGRRIC  442

Query  1386  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
             PGI F    + L LA LLY+F+W+LP G+S  DLDMTEA G+ A ++KDL LIA P+V
Sbjct  443   PGIQFGLALVTLPLAHLLYNFDWKLPQGISASDLDMTEANGISARREKDLYLIATPYV  500



>ref|XP_006359503.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/481 (57%), Positives = 359/481 (75%), Gaps = 8/481 (2%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             R++   ++KLPPGPW+LP+IGS+HHL  G+ PHR L NLS+KYGPIM+LQLGE+  VV+S
Sbjct  25    RNSKTLKKKLPPGPWRLPIIGSVHHLTRGT-PHRVLGNLSQKYGPIMYLQLGEVPTVVVS  83

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P +A+ I KTHDL FASR   M   I+ Y STD+AFSPYGDYWR MRK+ VLELLS KM
Sbjct  84    SPHMAKQILKTHDLAFASRSVTMLGKILCYNSTDIAFSPYGDYWRHMRKLSVLELLSAKM  143

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF S R +ELSNL+SSI   S  G P NL+EK+ WF ++   +  FG+ C ++Q + +
Sbjct  144   VKSFSSIRHDELSNLLSSI--DSMVGSPINLSEKLFWFMNASTCRSTFGKTC-KNQNELV  200

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+++ +SL+ GF+L DLFPSK ++H  SGM+ KL+K  +++D + D II  H+ENH  N
Sbjct  201   TLIQRAMSLSSGFELADLFPSKTFLHGISGMESKLMKARNKVDILLDNIINVHRENH-TN  259

Query  840   STNSSGKD--EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1013
               N +G+   ED++DV LRV E GE QFP+T DNIKAVI DMF  G++TS+ T+IWA+SE
Sbjct  260   GKNYNGESGTEDLIDVFLRVMESGEFQFPLTNDNIKAVILDMFVAGSDTSSATVIWALSE  319

Query  1014  MIKRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             M+K PSVMAKAQAEVR+  KG +T  DD DLE L YLKLVIKETLRLHPP PL+ PRE  
Sbjct  320   MMKSPSVMAKAQAEVREVFKGKETCNDDTDLEKLNYLKLVIKETLRLHPPTPLLVPRECR  379

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             EE KI  + IP K++V++N WA+  +P+SWE+PE F+PERFENSS++F GN ++ +PFGA
Sbjct  380   EETKIDGFTIPLKSKVLVNVWAIGRDPKSWENPECFIPERFENSSIEFTGNCFQLLPFGA  439

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRRMCPGI F    + L LA LLY F+W+LP+G+  +DLDMTE+ G+ A ++ DL LI  
Sbjct  440   GRRMCPGIHFGIALVTLPLAHLLYKFDWKLPEGIHVRDLDMTESNGITARRENDLYLIGT  499

Query  1551  P  1553
             P
Sbjct  500   P  500



>ref|XP_006367127.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
Length=505

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/489 (56%), Positives = 358/489 (73%), Gaps = 8/489 (2%)
 Frame = +3

Query  105   YTLRRRSNPARRQK-LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEI  281
             + LR ++  +R +K LPPGPW+LP+IGS+HHL  G +PH  L+NLS+K+GPIM+LQLGE+
Sbjct  21    HKLRIKTKKSRNKKILPPGPWRLPIIGSVHHLTKG-IPHHVLKNLSQKFGPIMYLQLGEV  79

Query  282   SAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLE  461
               +V+S P +A+ I KTHDL FASR   M   I  Y  TD+AFSPYG+YWR MRK+C++E
Sbjct  80    PTIVVSSPHMAQKIMKTHDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRHMRKLCIME  139

Query  462   LLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSE  641
             LLS KMVKSF   R +ELS+LVSSI+    T  P N++EK+ WF +S+  + +FG+ C +
Sbjct  140   LLSAKMVKSFSPIRLDELSSLVSSIKSMKNT--PINVSEKLFWFMNSVTCRSSFGKACKD  197

Query  642   DQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHK  821
                  I+L+  VLSLAGGF+L DL+PSKK++   SGM  KL++  +++D + D +I  H+
Sbjct  198   QNEAMISLIHGVLSLAGGFELADLYPSKKFLSGISGMGSKLIEARNKVDTVLDKVIDVHR  257

Query  822   ENHLANSTNSS---GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATT  992
             ENH AN    +   G +ED++DV  RV   GEL F +T +NIKAVI DMF  G++TS++T
Sbjct  258   ENH-ANGKKCNAECGSNEDLIDVFFRVMGTGELPFTLTNNNIKAVILDMFVAGSDTSSST  316

Query  993   IIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplpli  1172
             + WA+SEM+K PSVMAKAQAEVR+  KG KTFDD DLE + YLKLVIKETLRLHPP PL+
Sbjct  317   VTWALSEMMKSPSVMAKAQAEVREVFKGKKTFDDDDLEKVDYLKLVIKETLRLHPPTPLL  376

Query  1173  hprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYE  1352
              PRE  EE +I  YIIP K++V++N WA+  +PESWED E F+PERFENSSVDF G H++
Sbjct  377   VPRECREETEIDGYIIPVKSKVLVNVWAIGRDPESWEDSESFIPERFENSSVDFSGTHFQ  436

Query  1353  FIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKD  1532
             F+PFGAGRR CPG  F    + L LA LLY+FNW LP+G+ P+DLDM EA G+ A + KD
Sbjct  437   FLPFGAGRRTCPGRLFGLALVTLPLAHLLYNFNWTLPNGMDPRDLDMNEANGMTARRDKD  496

Query  1533  LCLIARPFV  1559
             L LIA P+ 
Sbjct  497   LYLIATPYT  505



>ref|XP_006350394.1| PREDICTED: cytochrome P450 71D6-like [Solanum tuberosum]
Length=501

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/482 (56%), Positives = 359/482 (74%), Gaps = 3/482 (1%)
 Frame = +3

Query  114   RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             ++ S  ++ +KLPPGPWKLP IGS+HHL GG LPHR LR+L++KYGP+MHLQLGE+SAVV
Sbjct  20    KKYSKYSQTKKLPPGPWKLPFIGSMHHLAGG-LPHRVLRDLAKKYGPLMHLQLGEVSAVV  78

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
             ++ P +A+ I KTHD+ FASRP ++A+DI+ Y   D+AFSPYG+YW+QMRKICV+E+LS 
Sbjct  79    VTSPDIAKQILKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVMEVLSA  138

Query  474   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  653
             K V+SF S R +E+  L+ SI+ SS +G   NLTE+V WFTSS+  + AFG+V  E Q  
Sbjct  139   KSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNLTERVIWFTSSMTCRSAFGQVPKE-QDM  197

Query  654   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  833
             FI L+++V+SLA GFD+ D+FPS K++H     K KLL +H ++D I + +I +HK+N  
Sbjct  198   FIKLIREVISLAEGFDVADIFPSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNFS  257

Query  834   ANSTNSSG-KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1010
                 +      ED+VDVLLR+     LQFPI  DNIKA+I DMF+ GTETS+TT +WAM+
Sbjct  258   TRKNDDHALGGEDLVDVLLRLMNDKSLQFPINNDNIKAIIIDMFAAGTETSSTTTVWAMA  317

Query  1011  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             EM+K PSV+AKAQAEVR+A +   T D+ D+E L YLKLVIKET+RLH P+PL+ PRE  
Sbjct  318   EMLKNPSVLAKAQAEVREAFRNKVTLDENDVEELKYLKLVIKETMRLHAPIPLLVPRECR  377

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             EE +I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  S+DF+GN++E++PFG 
Sbjct  378   EETEINGYTIPVKTKVMVNVWALGRDPKYWDDVESFKPERFEQCSIDFIGNNFEYLPFGG  437

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRR+CPGISF   ++ L LA LL  F+W+LP G+ PKDLD+TE  G+  ++K DL LIA 
Sbjct  438   GRRICPGISFGLANVYLPLAQLLCRFDWKLPAGMEPKDLDLTELAGMSVARKGDLYLIAT  497

Query  1551  PF  1556
             P+
Sbjct  498   PY  499



>ref|XP_006350417.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 355/481 (74%), Gaps = 2/481 (0%)
 Frame = +3

Query  114   RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             ++ SN  + +KLPPGPWKLP IGS+HHL GG L HR LR+L++KYGP+MHLQLGE+SAVV
Sbjct  20    KKYSNNTQTKKLPPGPWKLPFIGSMHHLAGG-LSHRVLRDLAKKYGPLMHLQLGEVSAVV  78

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
              + P +A+ + K HD+ FASRP+++A DI+ Y   D+AF PYG+YWRQMRKICV+E+L  
Sbjct  79    ATSPDMAKQVLKIHDIAFASRPSLLATDIICYNRRDIAFIPYGEYWRQMRKICVMEVLGA  138

Query  474   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  653
             K V+SF S R++E+  L+ SI+ SS +G P N TEK+ WFTSS+  + AFG+V  E Q  
Sbjct  139   KNVRSFSSIRRDEVVRLIDSIQSSSFSGEPVNFTEKIIWFTSSMTCRSAFGQVLKE-QEV  197

Query  654   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  833
             FI L+++V+SL  GFD+ D+FPS K++H   G K +LL  H ++D I + +I +HK+N  
Sbjct  198   FIKLIREVISLTEGFDVADIFPSYKFLHGFGGAKKQLLNAHRKVDSIVEDVIKEHKKNLA  257

Query  834   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1013
                ++ S   ED+VDVLLR+     LQFPI  DNIKAVI D+F+ GTETS+TT +WAM+E
Sbjct  258   TRKSDDSIGGEDLVDVLLRLMNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMAE  317

Query  1014  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1193
             M K P++++KAQAEVR+A +    F + D+E+L YLKLVIKETLR+H P+PL+ PRE  E
Sbjct  318   MFKNPTLLSKAQAEVREAFRNKVKFGENDVEDLKYLKLVIKETLRIHAPIPLLVPRECRE  377

Query  1194  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1373
             E KI  Y IP KT+V++N WAL  +P+ W++ E F PERFE  S+DF+GN++EF+PFG G
Sbjct  378   ETKINGYTIPMKTKVMVNVWALGRDPKYWDNAESFKPERFEECSMDFVGNNFEFLPFGGG  437

Query  1374  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             RR+CPGISF   +I L LA LLYHF+W+LP G+ P+DLD+ E   + AS+K DL LI  P
Sbjct  438   RRICPGISFGLANIYLPLAQLLYHFDWKLPTGIEPRDLDLIELSRITASRKGDLYLIVTP  497

Query  1554  F  1556
             +
Sbjct  498   Y  498



>ref|XP_004245943.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=499

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/477 (56%), Positives = 348/477 (73%), Gaps = 5/477 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             R +    QKLPPGPWKLP+IGS+HHL+G  LPH  LRNLS+KYGPIMHL+LGEI  VV+S
Sbjct  23    RKSKKSNQKLPPGPWKLPIIGSMHHLIG-VLPHHVLRNLSKKYGPIMHLKLGEIDTVVVS  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
                +A+ + K HDL FA+RP +M+ DIVFY   D+ F+ YGDYW+QMRKIC+ ELLS KM
Sbjct  82    SAHMAKQVLKVHDLCFAARPELMSSDIVFYNQNDIVFAKYGDYWKQMRKICISELLSAKM  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF   RQ+E+ +LV+SIR  S      N++EK+   TSS+I + AFG+V  +D+   +
Sbjct  142   VKSFSLIRQDEVHDLVASIR--STPNVVVNISEKILRLTSSVICRSAFGKVW-DDRDNLL  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-A  836
              L+++VLSL+GGFD+ DLFPS   +H   GM+ +L  LH ++D I + II +HKEN    
Sbjct  199   MLMREVLSLSGGFDVADLFPSWTLLHGIGGMRNRLKSLHQKIDVILEKIIHEHKENRANG  258

Query  837   NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEM  1016
                NS    ED++DVLLRV E GELQFPIT D++KAV+ D+F  GTETS+  I WA+SE+
Sbjct  259   KKGNSEFGGEDLIDVLLRVMENGELQFPITNDSVKAVVLDLFFGGTETSSVIIQWALSEL  318

Query  1017  IKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEE  1196
             +K P VMAKAQAEVR+  KG K  +D  +E L YLKLVI ETLRLHP  PL+  R+  EE
Sbjct  319   MKNPKVMAKAQAEVRRVCKGKKDLNDNVVEELKYLKLVINETLRLHPASPLLGLRQCREE  378

Query  1197  AKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGR  1376
              KI  Y IP K++V++N WA+A +PESW+DPE F+PERFE +SVDF GNH+++IPFGAG 
Sbjct  379   TKIDGYTIPLKSQVVVNGWAIARDPESWDDPEAFVPERFEKNSVDFNGNHFQYIPFGAGS  438

Query  1377  RMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1547
             RMCPG+ F   ++   LA LLYHF+W+LP G  P+DLDMTE +G+ A++K DL LIA
Sbjct  439   RMCPGMHFGLANVVYPLAQLLYHFDWKLPYGQQPEDLDMTETLGISATRKNDLNLIA  495



>ref|XP_009772938.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/472 (56%), Positives = 354/472 (75%), Gaps = 4/472 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARA  320
             ++LPPGPWKLP+ GS  H+VGG LPHR LR+L++KYGP+MHLQLGE+S VV++ P++A+ 
Sbjct  30    KRLPPGPWKLPIRGSTLHMVGG-LPHRVLRDLAKKYGPLMHLQLGEVSVVVVTSPEIAKE  88

Query  321   ITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  500
             + KTHDL FASRP ++A +IV Y S+DVAF+PYGDYWRQMRKICVLE+LS K V+SF S 
Sbjct  89    VLKTHDLAFASRPKLLAAEIVLYDSSDVAFAPYGDYWRQMRKICVLEVLSTKNVRSFSSI  148

Query  501   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  680
             R++E+  LV   R SS  G P N T+++S F S +I + AFG V  E Q +FI ++K V 
Sbjct  149   RRDEVFRLVEFFRSSS--GKPVNYTKRISLFMSFIICRSAFGTVFKE-QDEFIQVMKNVT  205

Query  681   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK  860
             +L  GFD+ D+FPS K++H  +GM+ K + LHH++D I D +I +HKEN      +    
Sbjct  206   ALLEGFDVADIFPSLKFLHVVTGMRAKAMNLHHKVDAIVDNVINEHKENLATGKFSGQLG  265

Query  861   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1040
              ED++DVLLR+ + G  QFPIT DNIKA+I DMF+ GTET++TTI WAM EMI+  SV A
Sbjct  266   GEDLIDVLLRLMKDGGFQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVEMIRNASVFA  325

Query  1041  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1220
             KAQAEVR+     +TFD+ D+E L YLKLVIKETLRLHPPLPL+ P+E  EE  I  Y I
Sbjct  326   KAQAEVREVFSRKETFDENDVEKLKYLKLVIKETLRLHPPLPLMLPKECREETNINGYTI  385

Query  1221  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1400
             P K++V++N WA+  +P+ W+D E F PER+E SSVDF+GN++E++PFG+GRR+CPGISF
Sbjct  386   PLKSKVMVNVWAIGRDPKYWDDAESFKPERYEQSSVDFVGNNFEYLPFGSGRRICPGISF  445

Query  1401  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
                +I L LA LLY+F+W+LP G++P DLDMTE+ G   ++K +L L+A P+
Sbjct  446   GIVNIYLPLAQLLYYFDWKLPTGINPSDLDMTESDGASCARKSNLYLVASPY  497



>ref|XP_006365962.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=504

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/480 (54%), Positives = 351/480 (73%), Gaps = 6/480 (1%)
 Frame = +3

Query  117   RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVI  296
             R+   +++Q LPPGPW+LPLIGSLHHL+ G  PHR  R+L+RKYGP+ +L+LGE+  V+I
Sbjct  20    RKWRRSQKQNLPPGPWRLPLIGSLHHLISGHNPHRIFRDLARKYGPVTYLELGEVPTVII  79

Query  297   SYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  476
             S P  ++ + KTHDL FASRP   + DIV Y + D+AF+ YGDYW+QMRKIC++ELLS K
Sbjct  80    SSPSTSKQVLKTHDLAFASRPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSAK  139

Query  477   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  656
             MVKSF S R++ELS+++SS+  S       N+TEK+  FTSS+  ++ FG++C  D+ + 
Sbjct  140   MVKSFSSIRKDELSSVLSSMD-SVGGSCEVNMTEKIVRFTSSVTCRLVFGKLC-RDRDEL  197

Query  657   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  836
             I L+K  L L GGFD+GD FPS K ++  SG K KL+K+H  +D + + I+ +H +N +A
Sbjct  198   INLMKDALFLVGGFDVGDFFPSWKLLYKMSGAKSKLVKMHQNIDLVLERIVNEHIKNRVA  257

Query  837   N-STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1013
                 N +   ED+VD+ LR+KE  +LQFPI  D+IKAVI DMF+ GTETS+TTIIWA+SE
Sbjct  258   GIKGNGAYGGEDLVDIFLRIKENDQLQFPIINDHIKAVILDMFTAGTETSSTTIIWALSE  317

Query  1014  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1193
             ++K P+VMAKAQ+EVRQA K    FD++DL+NL YLKLVIKET  L    P I  RE  E
Sbjct  318   LMKHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVIKET--LRLHAPSIVHRECRE  375

Query  1194  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1373
             E  +  Y IP K  V++N WA+  +PE W+DPE F+PERFENS +D++GN+YEF+PFGAG
Sbjct  376   ETIVDGYTIPAKATVLVNTWAMGRDPEVWDDPESFIPERFENSPIDYLGNNYEFLPFGAG  435

Query  1374  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGV-SPKDLDMTEAVGVIASKKKDLCLIAR  1550
             +R+CPG+ F   ++   LA LLYHFNW LP G+ +PKDLDM+E  G+ A+K+KDL LIA+
Sbjct  436   KRICPGMQFGLANVKQPLARLLYHFNWGLPCGINTPKDLDMSEKSGLSAAKEKDLYLIAK  495



>ref|XP_009794456.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/501 (56%), Positives = 371/501 (74%), Gaps = 13/501 (3%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             VS ++F+SF+F +    R+S     ++LPPGPW+LP+IGS+HHL  G + HR LRNLS+K
Sbjct  7     VSFLLFISFIFLLIQKWRKS-----KRLPPGPWRLPIIGSVHHLTSG-VSHRVLRNLSQK  60

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             +GPIM+LQLGE+  VV+S P +A+ I KTHDL FASRP IM   I+ Y   D+AFSPYGD
Sbjct  61    FGPIMYLQLGEVPTVVVSSPHMAKQILKTHDLAFASRPEIMMGKIICYDCKDIAFSPYGD  120

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWR MRK+  LELLS KMVKSF   R++ELS+L+SSI   S    P NL EK+ WF ++ 
Sbjct  121   YWRHMRKLSTLELLSAKMVKSFSPIRRDELSSLLSSI--ESMGDLPINLVEKLLWFMNAA  178

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
               + AFG+VC +DQ + I L+ +  SL+GGF+L DLFPSKK++H  SGM+ KL++  +++
Sbjct  179   TCRSAFGKVC-KDQKELITLIHRAQSLSGGFELADLFPSKKFLHGISGMRSKLMEARNKI  237

Query  786   DKIFDIIIGDHKENHLANSTNSSGKD--EDIVDVLLRVKEGGELQFPITEDNIKAVINDM  959
             D + D II  H+EN  AN    +G+   ED +DV  RV E GEL FP+  DNIKAVI DM
Sbjct  238   DVVLDNIINVHRENR-ANGKCCNGESGAEDFIDVFQRVMESGELPFPLENDNIKAVILDM  296

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFD-DKDLENLTYLKLVIK  1136
             F  G++TS++T+IWA++EMIK PSVMAKAQAEVR+A KG KT D D DLE L+YL LVIK
Sbjct  297   FVAGSDTSSSTVIWALAEMIKNPSVMAKAQAEVREAFKGKKTCDEDTDLEKLSYLNLVIK  356

Query  1137  ETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE  1316
             ETLRLHPP PL+ PRE  EE +I  + IP K++V++N WA+  +PE+W +PE F+PERFE
Sbjct  357   ETLRLHPPTPLLVPRECREETEIDGFTIPLKSKVLVNVWAIGRDPENWGNPECFIPERFE  416

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
             NSS++F GNH++ +PFGAGRR+CPGI F    + L LA LL++F+W+LP+G++ +DLDMT
Sbjct  417   NSSIEFTGNHFQLLPFGAGRRICPGIQFGMALVTLPLAHLLHNFDWKLPEGINARDLDMT  476

Query  1497  EAVGVIASKKKDLCLIARPFV  1559
             EA G+ A ++KDL LIA P V
Sbjct  477   EANGISARREKDLYLIATPCV  497



>ref|XP_009769208.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/479 (56%), Positives = 358/479 (75%), Gaps = 7/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLP+IGS+ HL+GG LPH  LR+L++KYGPIMHLQLGE+S VVI+
Sbjct  23    KNSNSQTKRLPPGPWKLPIIGSMLHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP ++A  IVFY  TD+AFSPYG+YWRQMRKIC+LELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF S RQ+E+  ++   R  S  G P N+T++ + FTSS+  + AFG+   E Q +F 
Sbjct  142   VKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRFALFTSSMTCRSAFGQEYKE-QDEFA  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V +L  GFD+ D+FPS K++H  +GMK K++  H+ELD+I D II +HK+     
Sbjct  199   RLVKKVSNLMEGFDVADIFPSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHKK---VA  255

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN     E I+DVLLR+ + G LQFPIT DNIKA+I DMF+ GTETSATTI WAM EM+
Sbjct  256   KTNCESGSEGIIDVLLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSATTINWAMVEMM  315

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV AK QAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PRE  EE 
Sbjct  316   KNPSVFAKTQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREET  375

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              +  Y IP KT+V++N WA+  +P+ W+D E F PERFEN+S+D+ GN++E++PFG+GRR
Sbjct  376   DLNGYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERFENNSMDYTGNNFEYLPFGSGRR  435

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++   LA LLYHF+W+LP  ++P +LD+TEA G   ++K DL LIA P+
Sbjct  436   ICPGISFGLANVYFPLAQLLYHFDWKLPTEINPSELDLTEAAGAACARKNDLHLIATPY  494



>ref|XP_004249520.2| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=536

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/518 (53%), Positives = 374/518 (72%), Gaps = 5/518 (1%)
 Frame = +3

Query  9     RLVGSSFVSEMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSL  188
             R    SF   ME +F FN + + +FLSF++ +    ++S    + KLPPGPWKLP +GSL
Sbjct  18    RHASLSFSYLMEFQFPFNIIFLFLFLSFLYLLLVEWKKSRNLNK-KLPPGPWKLPFLGSL  76

Query  189   HHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIM  368
             HHL  G LPH  L  L +KYGP+MHLQLGEIS VV+S   +AR + KTHDL FASRP + 
Sbjct  77    HHLAIGGLPHHALTKLGKKYGPLMHLQLGEISTVVVSSMDMAREVLKTHDLAFASRPKLA  136

Query  369   ALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSS  548
             ++DI+ YKSTD+ FSPYG+YWRQMRK+CV+ELL+ K V+SF S   +E S LV  I+ SS
Sbjct  137   SIDIICYKSTDIVFSPYGEYWRQMRKVCVMELLTAKNVRSFSSILHDEASRLVQFIQ-SS  195

Query  549   ETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKK  728
               G P N+TE++ W+TSS+  K AFG    +DQ KFI ++K+++ LA GF L D+FPS K
Sbjct  196   THGEPINITERILWYTSSITCKTAFGDQLLKDQEKFIQMVKKLVELASGFSLADIFPSIK  255

Query  729   WIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKEG  902
              +   +G + ++LK+H  +D I + +I +HK+N LA+    +G    E++VDVL+R+   
Sbjct  256   ILGVLTGARSRILKVHKNVDAIVEDVINEHKKN-LASGKKGNGAFGGENLVDVLIRLMGS  314

Query  903   GELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNK  1082
             GEL+ PIT DNIKA++ D+FS GTETS+TT  WAM+EM++ P V+ KAQAEVR+A KG +
Sbjct  315   GELKIPITNDNIKAIMVDLFSAGTETSSTTATWAMTEMMRNPRVLKKAQAEVREAFKGKE  374

Query  1083  TFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALA  1262
             TFD+  +E L YL+ V+KETLRLHPP+PL+ PRE  EE  I  Y IP KTRV++N W++ 
Sbjct  375   TFDEDVIEELKYLRQVVKETLRLHPPVPLLAPRECREETNINGYTIPLKTRVMVNVWSMG  434

Query  1263  TNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLY  1442
              +P+ WED E F+PERF  SSVDF+GN++E++PFGAGRRMCPGI+F   ++ L LA LLY
Sbjct  435   RDPKYWEDAESFIPERFARSSVDFLGNNFEYLPFGAGRRMCPGITFGLFNVYLPLAKLLY  494

Query  1443  HFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             HF+W+LPDG  P+D+DMTE   + A++K +L LIA P+
Sbjct  495   HFDWKLPDGQKPEDVDMTELSAITAARKSELYLIATPY  532



>ref|XP_009776868.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/479 (56%), Positives = 358/479 (75%), Gaps = 7/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLP+IGS+ HL+GG LPH  LR+L++KYGPIMHLQLGE+S VVIS
Sbjct  23    KNSNSQTKRLPPGPWKLPIIGSMLHLLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIS  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP ++A  IVFY  TD+AFSPYG+YWRQMRKIC+LELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF S RQ+E+  ++   R  S  G P N+T++ + FTSS+  + AFG+   E Q +F 
Sbjct  142   VKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRFALFTSSMTCRSAFGQEYKE-QDEFA  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V +L  GFD+ D+FPS K++H  +GMK K++  H+ELD+I D II +HK+     
Sbjct  199   RLVKKVSNLMEGFDVADIFPSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHKK---VA  255

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN     E I+DVLLR+ + G LQFPIT DNIKA+I DMF+ GTETSATTI WAM EM+
Sbjct  256   KTNCESGSEGIIDVLLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSATTINWAMVEMM  315

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV AK QAEVR+ L+G +TF + D++   YLK+VIKET RLHPPLPL+ PRE  EE 
Sbjct  316   KNPSVFAKTQAEVRKILRGKETFGEIDVDEFKYLKMVIKETFRLHPPLPLLLPRECREET  375

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              +  Y IP KT+V++N WA+  +P+ W+D E F PERFEN+S+D+ GN++E++PFG+GRR
Sbjct  376   DLNGYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERFENNSMDYTGNNFEYLPFGSGRR  435

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++   LA LLYHF+W+LP  ++P +LD+TEA G   ++K DL LIA P+
Sbjct  436   ICPGISFGLANVYFPLAQLLYHFDWKLPTEINPSELDLTEAAGAACARKNDLHLIATPY  494



>ref|XP_006341698.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/473 (57%), Positives = 341/473 (72%), Gaps = 4/473 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARA  320
             +KLPPGPW+LP IG+LH L+ G LPH T R+LS+ YGPI HL+LGE+S VV+S P +A+ 
Sbjct  32    KKLPPGPWRLPFIGNLHQLMNGRLPHHTFRDLSQNYGPIFHLRLGEVSHVVVSSPDIAKE  91

Query  321   ITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  500
             I K  DL FA+RP +M  +I+ Y  +D+   PYGDYWR MRK+C+LELLS KMVKSF S 
Sbjct  92    IMKIQDLNFATRPQLMVGEIIMYNYSDIGTCPYGDYWRSMRKVCILELLSTKMVKSFDSI  151

Query  501   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  680
             RQ E+S+L+SSI  +S      NL++K+ WFT S+  + AFG++ +  Q K I L+K + 
Sbjct  152   RQAEMSSLISSI--NSMPDSLINLSDKIFWFTGSVTCRSAFGKIIN-GQDKLIMLIKDIT  208

Query  681   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-ANSTNSSG  857
              LAG  +L DLFPS+KW+H   G+K K+LK+H E D I + II +H++N       NS  
Sbjct  209   LLAGATELADLFPSRKWLHQIYGLKSKILKVHKEADVILENIINEHQKNRANGKKGNSEY  268

Query  858   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
               ED+VDVLLRV E GEL  PIT +NIKAVI DMF  G ETS+  IIWA++EMI+ PS+M
Sbjct  269   GGEDLVDVLLRVMESGELGTPITNNNIKAVIFDMFVAGAETSSAIIIWALAEMIRNPSIM  328

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
             AKA+ EVR+ LKG   F+D DLE L YLKLVIKETLRLHPP PL+ PRE  EE +IGEY 
Sbjct  329   AKAKFEVREVLKGKTIFEDTDLEELKYLKLVIKETLRLHPPFPLLLPRECREETRIGEYT  388

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             IP KTRV+INAWA+  +PE W +PE F+PERF+NSS+DF GNH+EFIPFGAGRRMCPG  
Sbjct  389   IPIKTRVLINAWAIGRDPEYWHNPESFIPERFDNSSIDFRGNHFEFIPFGAGRRMCPGWL  448

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             F   ++   LA LLYHF+W  P     ++ DMTE  G+ A +K DLCLIA PF
Sbjct  449   FGLMNVEHPLAQLLYHFDWRTPYEGPLENFDMTETDGITAIRKDDLCLIATPF  501



>ref|XP_006352953.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/480 (56%), Positives = 352/480 (73%), Gaps = 5/480 (1%)
 Frame = +3

Query  117   RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVI  296
             R+     ++ LPPGPWKLPLIGSLHHL+G +LPH  LRNLS+KYGP+MHL+LGEI AV++
Sbjct  25    RKWKEMNQRLLPPGPWKLPLIGSLHHLIG-ALPHHVLRNLSKKYGPLMHLKLGEIDAVIV  83

Query  297   SYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  476
             S P LA+ + K HDL FA+RP ++A DIVFY+  D+AF+ YGDYW+QMRKIC  ELLS K
Sbjct  84    SSPHLAKQVLKVHDLSFAARPKLVASDIVFYRQNDIAFAEYGDYWKQMRKICTSELLSSK  143

Query  477   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  656
             +VKSF   RQ+E+ NLV+SI   S      N++EKV   TSS+I + AFG+V  +D+   
Sbjct  144   IVKSFSLIRQDEVHNLVASI--CSMPNVVVNMSEKVLQLTSSVICRSAFGKVW-DDRDNL  200

Query  657   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-  833
             + +++++L+L  GFD+ DLFPS K +H  SG + +L+ +H++LD I + II DHK++   
Sbjct  201   LMIMRELLALLAGFDVVDLFPSWKLLHKISGKRNRLMNMHYKLDVILENIINDHKQSKAN  260

Query  834   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1013
                 N+  + E+++DVLLRV E  ELQFP+T DNIKAVI D+F  GTETSATTI W +SE
Sbjct  261   GGKGNNEFEGENLIDVLLRVMENDELQFPMTNDNIKAVILDIFFRGTETSATTIQWTLSE  320

Query  1014  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1193
             ++K P+VMAK Q EVR+     K +DD  L+ L YLKLVIKETLRLHPP PL+ PRE  E
Sbjct  321   LMKNPNVMAKVQEEVRKTFDRKKVYDDNILKELKYLKLVIKETLRLHPPGPLLPPRECRE  380

Query  1194  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1373
             E  I  Y I  KT++I+N WA+  +PESW+DPE F+PERFENS VDF GNHY+FIPFGAG
Sbjct  381   ETTIEGYTISLKTKLIVNCWAMGRDPESWDDPENFMPERFENSCVDFKGNHYQFIPFGAG  440

Query  1374  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
              RMCPG+ F   ++   LA LLYHF+W+LP G  P+DLDMTE +G+ A++K DL LIA P
Sbjct  441   SRMCPGMHFGLANVVYPLAQLLYHFDWQLPYGQQPEDLDMTETLGLSATRKHDLRLIAIP  500



>ref|XP_009619325.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/474 (57%), Positives = 363/474 (77%), Gaps = 8/474 (2%)
 Frame = +3

Query  135   RRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLA  314
             + Q+LPPGPW+LP IGSLHHL+GG LPHR+L+ L++KYGP+M+LQLG++  ++IS P++A
Sbjct  35    QNQRLPPGPWRLPFIGSLHHLIGGELPHRSLKKLAQKYGPLMYLQLGQVPTIIISSPRIA  94

Query  315   RAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  494
             + + KTHDL FA+RP + +  I+FY + D+ FS YGDYWRQMRKIC++ELLS KMVKSF 
Sbjct  95    KEVLKTHDLAFANRPQLTSSTIIFYNNIDMVFSQYGDYWRQMRKICIVELLSSKMVKSFS  154

Query  495   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  674
               R++ELS+L+SSIR  +E     N+TEK+  FT+S+  + AFG++C +D+G+F  LLK+
Sbjct  155   GIREKELSSLISSIRSMTE----VNITEKIFMFTNSVTCRSAFGKIC-KDRGEFRTLLKE  209

Query  675   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA-NSTNS  851
             VL LAGGF + DLFP  K +H  SGM+ +L+  H ++D+I + II +H  N  A N  N 
Sbjct  210   VLLLAGGFFVADLFPCWKLLHNLSGMESRLVNAHRKVDEIMENIINEHIANRAAGNKRNG  269

Query  852   SGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1031
                DED+VDV LR+KE  +L FPIT D+IKA++ D+F  GTETS+T +IWA++E++K P+
Sbjct  270   EFGDEDLVDVFLRIKEKDQLHFPITNDHIKAMLFDIFLGGTETSSTVLIWALAELMKNPN  329

Query  1032  VMAKAQAEVRQALKGNKTFDDKD--LENLTYLKLVIKETlrlhpplplihprESMEEAKI  1205
             VMAKAQ+EVRQ  KG K +D++D  +E L+YLKLVI ETLRLH P PL+ PRE  EE  I
Sbjct  330   VMAKAQSEVRQVFKGKKIYDEEDNIVEKLSYLKLVIMETLRLHTPAPLMGPRECREETNI  389

Query  1206  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1385
               Y IP KT+V++NAWALA + ESW DPE F+PERF+NSS+DFMGN++E+IPFG GRR+C
Sbjct  390   AGYNIPNKTKVLVNAWALARDVESWNDPESFIPERFDNSSIDFMGNYFEYIPFGTGRRIC  449

Query  1386  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1547
             PGI F   +I + LA LLY+F W+LP G++P+DLDMTE  G+  +K+KDL L+A
Sbjct  450   PGIQFGLANIGVPLAQLLYNFEWKLPYGINPQDLDMTETHGLTGAKQKDLYLVA  503



>ref|XP_009624010.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=502

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/477 (55%), Positives = 359/477 (75%), Gaps = 6/477 (1%)
 Frame = +3

Query  126   NPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYP  305
             N A+R  LPPGPWKLP++GS+ H+VGG LPHR LR+L++KYGP+MHL+LGE+S VV++ P
Sbjct  27    NQAKR--LPPGPWKLPILGSMLHMVGG-LPHRILRDLAKKYGPLMHLKLGEVSVVVVTSP  83

Query  306   QLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  485
             ++A+ + KTHDL FASRP ++A +IV Y S+D+AF+PYGDYWRQMRKICVLE+L+ K V+
Sbjct  84    EIAKEVLKTHDLAFASRPKLLAAEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVR  143

Query  486   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  665
             SF S R++E+  L+   R SS  G P N T+++S FTS +I + AFG V  E Q +FI +
Sbjct  144   SFSSIRRDEVFRLIEFFRSSS--GKPVNFTKRISLFTSFIICRSAFGTVFKE-QDEFIQV  200

Query  666   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANST  845
             +K V +L  G D+ D+FPS K++H  +G + K++ LHH++D I D +I +HK+N      
Sbjct  201   MKNVTALLEGLDVADIFPSLKFLHVLTGKRAKVMNLHHKVDSIVDNVINEHKKNLATGKF  260

Query  846   NSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1025
             N     ED++DVLLR+ + G+LQFPIT DNIKA+I DMF+ GTET++TTI WAM E+I+ 
Sbjct  261   NGQLGGEDLIDVLLRLMKDGDLQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVELIRN  320

Query  1026  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1205
              SV AKAQAEVR+  +  +TFD+ D+E L YLKLVIKETLRLHPPLPL+ PRE  EE  I
Sbjct  321   ASVFAKAQAEVREVFRRIETFDENDVEELKYLKLVIKETLRLHPPLPLMLPRECREETNI  380

Query  1206  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1385
               + IP K++V++N WA+  +P+ W+D E F PERFE SSVDF GN++E++PFG+GRR+C
Sbjct  381   NGFTIPLKSKVMVNVWAIGRDPKYWDDAENFKPERFEQSSVDFTGNNFEYLPFGSGRRIC  440

Query  1386  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             PGI F   +I L LA LLY+F+W+LP G++P DLD+TE+ G   ++K +L LIA P+
Sbjct  441   PGILFGLANIYLPLAQLLYYFDWKLPTGINPSDLDLTESDGASCARKSNLYLIASPY  497



>ref|XP_009606204.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=527

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/479 (55%), Positives = 359/479 (75%), Gaps = 5/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLP++GS+ HL+GG  PH  L +L++KYGP+MHLQLGE+S V ++
Sbjct  49    KNSHSQTKRLPPGPWKLPVLGSMFHLLGGP-PHHVLGDLAKKYGPLMHLQLGEVSVVSVT  107

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP ++A  IV Y  TD+ FSPYGDYWRQMRKIC+LELLS K 
Sbjct  108   SPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSAKN  167

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+ +++   R SS  G P N+++++S FT+S+  + AFG+   E Q +F 
Sbjct  168   VRSFSSVRRDEVFHMIEYFRSSS--GKPVNVSKRISLFTTSMTCRSAFGQEYKE-QDEFA  224

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V SL  GFD+ D+FPS K++H  SGMK K++  HHELD I + II +HK+     
Sbjct  225   RLVKKVSSLMEGFDVADIFPSLKFLHVLSGMKAKVMDAHHELDAILENIINEHKKIATGK  284

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
             + N  G  E ++DVLLR+ + G LQFPIT DNIKA+I DMF  GTETS+TTI WAM EMI
Sbjct  285   NNNELG-GEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFGAGTETSSTTIDWAMVEMI  343

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV AKAQAEVR+A +  +TFD+ D+E L YLKLVIKET RLHPP PL+ PRES EE 
Sbjct  344   KNPSVFAKAQAEVREAFREKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRESREET  403

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT++++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+GRR
Sbjct  404   DINGYTIPFKTKLMVNVWAIGRDPKYWDDVESFKPERFEHNSMDFIGNNFEYLPFGSGRR  463

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             MCPGISF   ++ L LA LLYHF+W+LP G++  DLDMTE+ GV  ++K DL L A P+
Sbjct  464   MCPGISFGLANVYLPLAQLLYHFDWKLPTGINSSDLDMTESSGVTCARKSDLYLTATPY  522



>emb|CDP07872.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/499 (54%), Positives = 366/499 (73%), Gaps = 6/499 (1%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
              N  +  +F++FV  +  + +RS  A  QKLPP PWKLP+IG +HHL  GS PH  LR L
Sbjct  5     LNFTAFFLFIAFVLTLIKVLKRSKTA--QKLPPSPWKLPIIGHMHHL-SGSPPHHALRKL  61

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             ++KYGP+MH+QLGEIS++V++ P+LA+ I KTHDL FA+R   +A  I+ Y  +D+A  P
Sbjct  62    AQKYGPLMHIQLGEISSIVVTSPRLAKEIMKTHDLAFANRGETLAGKIMLYNCSDIACCP  121

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YGDYWRQMRKIC LELLS K V+S  S RQEE  +LVSSI+  +  G   ++TEK+S + 
Sbjct  122   YGDYWRQMRKICTLELLSSKSVRSCGSIRQEEALHLVSSIKALANAGKSIDVTEKMSSYA  181

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
             S+++ + AFG+V ++D   F  L+K+  S+A  FD+ DL PS K +H    +K K+L + 
Sbjct  182   SAVLYRAAFGKVSNDDHFAFFQLIKESSSIASAFDVSDLLPSFKILHPFLSVKNKMLNIR  241

Query  777   HELDKIFDIIIGDHKENHLANSTNSSG--KDEDIVDVLLRVKEGGELQFPITEDNIKAVI  950
             ++LDK+ D II  H +N LA +  ++G   +EDI+DVLLRVKE GELQ P+T+DNIKAV+
Sbjct  242   YKLDKVLDKIIDQHMDN-LARTKIATGASDNEDIIDVLLRVKESGELQIPLTKDNIKAVL  300

Query  951   NDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLV  1130
             +D+F+ GTETS+TT+ WAMSEMI+ P VMAKAQ+E+R A +G  T ++ D++ L YL+ V
Sbjct  301   SDVFAGGTETSSTTVEWAMSEMIRNPGVMAKAQSEIRNAFRGKNTIEETDIQRLQYLRSV  360

Query  1131  IKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPER  1310
             IKETLRLHPP+PL+ PRE  EE +I  YIIP KTRV++NAWA+  +PE W+D E F PER
Sbjct  361   IKETLRLHPPIPLLIPRECREECEIDGYIIPVKTRVLVNAWAIGRDPEYWDDAESFKPER  420

Query  1311  FENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLD  1490
             FENSS+DF G+H+E++PFGAGRR+CPGI+F   ++ L LA LLYHF+W LP+G+   DLD
Sbjct  421   FENSSIDFNGSHFEYLPFGAGRRICPGIAFGLANVELPLALLLYHFDWRLPNGLDSNDLD  480

Query  1491  MTEAVGVIASKKKDLCLIA  1547
             MTE V + AS+  +L L+A
Sbjct  481   MTETVVITASRANNLRLLA  499



>ref|XP_009625417.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase [Nicotiana tomentosiformis]
Length=504

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/479 (55%), Positives = 356/479 (74%), Gaps = 2/479 (0%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWK+P++GS+ H+VGG  PH  LR+L++KYGP+MHLQ GEISAVV++
Sbjct  23    KNSNSQTKKLPPGPWKIPILGSMLHMVGGE-PHHVLRDLAKKYGPLMHLQFGEISAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
               ++A+ + KTHD+VFASRP I+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82    SREMAKEVLKTHDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  F 
Sbjct  142   VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDVFA  200

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
               +++V+ LA GFD+ D+FPS K++H  SGMK KLL  H ++D I + +I +HK+N    
Sbjct  201   KKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATG  260

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVLLR+     LQFPIT DNIKA+I DMF+ GTETS+TT +WAM+EM+
Sbjct  261   KTNGALGGEDLIDVLLRLMNDTSLQFPITNDNIKAIIVDMFAAGTETSSTTTVWAMAEMM  320

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV  KAQAEVR+A K   TFD+ D E L YLKLVIKETLRLHPP PL+ PRE  E+ 
Sbjct  321   KNPSVFTKAQAEVREAFKNKVTFDENDAEELKYLKLVIKETLRLHPPSPLLVPRECREDT  380

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG GRR
Sbjct  381   DINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGGRR  440

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPG+SF   ++ L LA LLYHF+W+LP G+ P+DLD+TE  G+  ++K D+ L A P+
Sbjct  441   ICPGMSFGLANLYLPLAQLLYHFDWKLPTGMKPRDLDLTELAGITIARKGDIYLKATPY  499



>ref|XP_004250027.1| PREDICTED: cytochrome P450 71D7 [Solanum lycopersicum]
Length=508

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/486 (54%), Positives = 358/486 (74%), Gaps = 8/486 (2%)
 Frame = +3

Query  117   RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVI  296
             + S     +KLPPGPWK+P IGS+HH+VGG  PH  LR+L++KYGP+MHLQLGE+  VV+
Sbjct  23    KNSKSQTTKKLPPGPWKIPFIGSIHHIVGG-YPHHVLRDLAKKYGPLMHLQLGEVCVVVV  81

Query  297   SYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  476
             +  ++A+ I KTHDL FASRP ++ +DI+ Y S D+AFSPYGDYW+QMRKI V+ELL+ K
Sbjct  82    TSSEMAKQIFKTHDLAFASRPKLLVMDIITYNSRDIAFSPYGDYWKQMRKISVMELLNAK  141

Query  477   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  656
              V+SF S R +E+ +L+ SIR SS +G P N +E+V WF SS++ + AFG++  +DQ  F
Sbjct  142   NVRSFSSIRHDEVVHLIDSIRSSSSSGEPVNFSERVLWFASSMLCRSAFGKL-PKDQDIF  200

Query  657   IALLKQVLSLAG-GFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE---  824
             I L++QVL L+  GFD+ D+FPS K++H   G+K K+L +H+++D I + +I +HK+   
Sbjct  201   IKLVRQVLRLSNQGFDMADIFPSYKFLHGLGGLKKKILDVHYKIDSIVEDVINEHKKSFA  260

Query  825   NHLANSTNSS--GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  998
             NH   S + +  G DED++DVLLR+ +   LQFPI    IKA+I D+F+ GT+T++  I+
Sbjct  261   NHKRTSDDDALGGGDEDLIDVLLRLMKDKSLQFPINNHTIKAIIVDIFAGGTDTTSIIIV  320

Query  999   WAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihp  1178
             WAM+EM++ PS++AKAQAEVR+A KG   FD  D+E L YLKLV+KETLRLHP +PL  P
Sbjct  321   WAMAEMMRNPSILAKAQAEVREAFKGKVKFDKYDVEELKYLKLVVKETLRLHPSVPLSVP  380

Query  1179  rESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFI  1358
             RE  EE  I  Y IP KT+++IN WAL  +PE W+DPE F PERFE  SVDF+GN++EF+
Sbjct  381   RECREETDINGYTIPLKTKILINVWALGRDPEYWDDPESFKPERFEQCSVDFIGNNFEFL  440

Query  1359  PFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLC  1538
             PFG+GRR+CPGISF   +I  SLA  LYHF+W+LP+G+ P DLD+TE+ G     K DL 
Sbjct  441   PFGSGRRVCPGISFGLANIYSSLAQSLYHFDWKLPNGMDPTDLDLTESDGGSTGMKNDLY  500

Query  1539  LIARPF  1556
             LIA P+
Sbjct  501   LIATPY  506



>ref|XP_009765039.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=501

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/479 (55%), Positives = 356/479 (74%), Gaps = 5/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ +  ++LPPGPWKLPL+G++ HL+GG  PH  L +L++KYGP+MHLQLGE+S V ++
Sbjct  23    KNSNSHTKRLPPGPWKLPLLGNMFHLLGGP-PHHVLGDLAKKYGPLMHLQLGEVSVVAVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP ++A  IV Y  TD+ FSPYGDYWRQMRKIC+LELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  ++   R SS  G P N+T+++S FTSS+  + AFG+   E Q +F 
Sbjct  142   VRSFSSVRRDEVFRMIEFFRSSS--GKPVNVTKRISVFTSSMTCRSAFGQEYKE-QDEFA  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V SL  GFD+ D+FPS K++H  SGMK K++  HHELD I + II +HK+     
Sbjct  199   RLVKKVSSLMEGFDIADIFPSLKFLHVLSGMKAKVMDAHHELDAILEKIINEHKKIATGK  258

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
             + +  G  E ++DVLLR+ + G LQFPIT DNIKA+I DMF  GTETS+TTI WAM EM+
Sbjct  259   NNDELG-GEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFGAGTETSSTTIDWAMVEMM  317

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K P+V AKAQAEVR+A +G +TFD+ D+E L YLKLVIKET RLHPP PL+ PRES EE 
Sbjct  318   KNPTVFAKAQAEVRKAFRGKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRESREET  377

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y I  KT++++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+GRR
Sbjct  378   DINGYTISLKTKLMVNVWAIGRDPKYWDDVESFKPERFEHNSMDFIGNNFEYLPFGSGRR  437

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             MCPGISF   ++ L LA LLYHF+W+LP G++P DLDM E+ G   S+K DL L A P+
Sbjct  438   MCPGISFGLANVYLPLAQLLYHFDWKLPTGINPCDLDMIESSGATCSRKSDLYLTATPY  496



>ref|XP_004228511.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=493

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/501 (52%), Positives = 360/501 (72%), Gaps = 11/501 (2%)
 Frame = +3

Query  54    LFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
              FN  S+ +F+SF+F +    + SN   R+KLPPGPWKLPL+G++ HL+GG  PHR LR+
Sbjct  3     FFNIFSLFIFVSFLFLLIKYWKNSNDQIRKKLPPGPWKLPLLGNIFHLLGGP-PHRVLRD  61

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L++KYG IMHLQLGE+S VV++ P +A+ + KTHD+ FASRP ++A +IV Y  +D+ FS
Sbjct  62    LAKKYGSIMHLQLGEVSLVVVTSPDMAKQVLKTHDIAFASRPMLIAAEIVCYNGSDIVFS  121

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYGDYWRQMRKIC++ELLS K VKSF S RQ+E+  ++   R SS  G   N T ++  F
Sbjct  122   PYGDYWRQMRKICIMELLSAKNVKSFSSIRQDEVLRMIEFFRSSS--GETVNATRRIFQF  179

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
              SS+  + AFG+V  E Q + I L+K+V  L  GFD+ D+FPS K++H   GMK K++ +
Sbjct  180   ASSMTCRSAFGKVFKE-QDELIQLVKKVSRLTEGFDVADIFPSLKFLHVLCGMKSKIMDV  238

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
             HHELD I + II +HK        N     E +V  LLR+ + G LQFPIT DNIKA+I 
Sbjct  239   HHELDAILENIINEHK-------NNGELGGEGLVSTLLRLMKEGGLQFPITNDNIKAIIF  291

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D+F+ GTETS+ TI W M EM++ P+V++KAQ EVR A KG +TFD+ D+E L YLKLV+
Sbjct  292   DIFAAGTETSSATIDWIMVEMMRNPNVLSKAQEEVRNAFKGKETFDENDVEELKYLKLVV  351

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KE+ RLHPP PL+ PRE  EE +I  Y IP KT+V++NAWA+  +P+ W+D E F PERF
Sbjct  352   KESFRLHPPFPLLLPRECREEVEINGYTIPLKTKVMVNAWAIGRDPKYWDDAESFKPERF  411

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
             E++S+DF+GN++E++PFG+GRR CPGISF   ++   LA LLYHF+W+LP+G++  +LD+
Sbjct  412   EDNSMDFIGNNFEYLPFGSGRRNCPGISFGLANVYFPLAQLLYHFDWKLPNGINSSELDL  471

Query  1494  TEAVGVIASKKKDLCLIARPF  1556
             TE+ G   ++K +L LIA P+
Sbjct  472   TESAGSTCARKNNLYLIATPY  492



>ref|XP_009611155.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/479 (54%), Positives = 359/479 (75%), Gaps = 7/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLP++GS+ HL+GG  PH  LR+L++KYGP+MHLQLGE+S VV++
Sbjct  23    KNSSSQTKRLPPGPWKLPILGSMLHLLGGH-PHHVLRDLAKKYGPLMHLQLGEVSLVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP ++A  IV Y  TD+ FSPYG+YWRQMRKIC+LELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPLLLAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF S RQ+E+  ++   R  S  G P N+T++ + FTSS+  + AFG+   E + +F+
Sbjct  142   VKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRFALFTSSMTCRSAFGQEHKE-KDEFV  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V +   GFD+ D+FPS K++H  +G+K K++  HHELD+IF+ II + K+     
Sbjct  199   RLVKKVSNYMEGFDVADIFPSLKFLHVVTGLKAKVMDAHHELDEIFENIISERKK---VA  255

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN   + E IVDVLLR+ + G LQFPIT DNIKA++ DMF+ GTETS+TTI WAM EM+
Sbjct  256   KTNCESRGEGIVDVLLRLMKEGGLQFPITNDNIKAIVFDMFAAGTETSSTTINWAMVEMM  315

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K+PSV AKAQAEVR+ L+G +TFD+ D+E   YLK+VIKET RLHPPLPL+ PRE  EE 
Sbjct  316   KKPSVFAKAQAEVRKILRGKETFDEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREET  375

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              +  Y IP KT+V++N WA+  +P+ W+D E F PERFEN+ +D++GN++E++PFG GRR
Sbjct  376   DLNGYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERFENNPMDYIGNNFEYLPFGGGRR  435

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++   LA +LYHF+W+LP G++P +LD+TEA G   ++K DL LIA P+
Sbjct  436   ICPGISFGLANVYFPLAQMLYHFDWKLPTGINPSELDLTEAAGAACARKNDLHLIATPY  494



>emb|CDP18841.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/500 (54%), Positives = 361/500 (72%), Gaps = 6/500 (1%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPAR-RQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             FN ++  +FL+F+  +     +S      QKLPPGP K+P IG+LH+L+G SLPH  L  
Sbjct  5     FNWIASFIFLAFILTLGKKWMKSKTVNATQKLPPGPKKIPFIGNLHNLLG-SLPHHALAK  63

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L++K+G +MHLQLGE+SAVV+S P  A+ I KTHD VF  RP I+   I+ Y S+ +AFS
Sbjct  64    LAKKHGDLMHLQLGEVSAVVVSSPHSAKEILKTHDHVFVDRPEILVGKIICYDSSSIAFS  123

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
              YGDYWRQMRKIC +E+LS K V+SF S RQ+E+ +L+SSIR S+  G P NLTE++S F
Sbjct  124   QYGDYWRQMRKICAMEVLSAKSVRSFGSIRQDEVLHLISSIRGSTIGGQPINLTEEISSF  183

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
             TSS+I + A G+V  E +   I L+K+VLS   GFD+ DLFPSKK +H+ S MKP L KL
Sbjct  184   TSSMICRAACGKVFRE-RITLIELMKEVLSRTSGFDISDLFPSKKILHHLSSMKPTLQKL  242

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAV  947
             HH++D I + +I +H EN LA S   +G+   ED++DVLLR+KE G+LQFPIT   IKA+
Sbjct  243   HHKIDVILESVINEHIEN-LARSKTVNGEFGQEDLIDVLLRIKESGDLQFPITNKTIKAI  301

Query  948   INDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKL  1127
             + DMF+ GTETSAT + WAMSEMI+ P+VM+KAQ E+R+A  G +  ++ D+E L YLKL
Sbjct  302   MFDMFTGGTETSATLVEWAMSEMIRNPNVMSKAQNEIRKAFLGKEKIEEMDIEGLRYLKL  361

Query  1128  VIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPE  1307
             VIKETLRLHPPLPL+ P E  ++ +I  YIIP KTRV +NAWA+  +P+ W+DPE F PE
Sbjct  362   VIKETLRLHPPLPLLVPMECRKQCEIDGYIIPSKTRVFVNAWAIQRDPKYWDDPESFKPE  421

Query  1308  RFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDL  1487
             RF N+ VDF G  +E++PFG GRR+CPGISF   ++   LA LLY+F+W+LP G++   L
Sbjct  422   RFHNNPVDFTGTQFEYLPFGGGRRICPGISFGLANVEFPLAQLLYNFDWKLPGGINSNGL  481

Query  1488  DMTEAVGVIASKKKDLCLIA  1547
             DMTE  G+ A +K  LCL+A
Sbjct  482   DMTETCGITAPRKNKLCLVA  501



>ref|XP_009801864.1| PREDICTED: LOW QUALITY PROTEIN: 5-epiaristolochene 1,3-dihydroxylase-like 
[Nicotiana sylvestris]
Length=504

 Score =   530 bits (1365),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 260/479 (54%), Positives = 358/479 (75%), Gaps = 2/479 (0%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWK+P++GS+ H++GG  PH  LR+L++KYGP+MHLQLGEISAVV++
Sbjct  23    KNSNSQSKKLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
                +A+ + KTHD+VFASRP I+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82    SRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  F 
Sbjct  142   VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDIFA  200

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
               +++V+ LA GFD+ D+FP+ K++H  SGMK KLL  H ++D I + +I +HK+N  A 
Sbjct  201   KKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAG  260

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              +N +   ED++DVLLR+     LQFPIT DNIKAV+ DMF+ GTETS+TT +WAM+EM+
Sbjct  261   KSNGALGGEDLIDVLLRLMNDTSLQFPITNDNIKAVVVDMFAAGTETSSTTTVWAMAEMM  320

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV  KAQAEVR+A +   +FD+ D+E L YLKLVIKETLRLHPP PL+ PRE  E+ 
Sbjct  321   KNPSVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECREDT  380

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG GRR
Sbjct  381   DINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGGRR  440

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPG+SF   ++ L LA LLYHF+W+LP G+ P+DLD+TE  G+  ++K DL L A P+
Sbjct  441   ICPGMSFGLANLYLPLAQLLYHFDWKLPTGIKPRDLDLTELSGITIARKGDLYLNATPY  499



>sp|P93530.1|C71D6_SOLCH RecName: Full=Cytochrome P450 71D6 [Solanum chacoense]
 gb|AAB61964.1| putative cytochrome P450 [Solanum chacoense]
Length=501

 Score =   529 bits (1362),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 259/482 (54%), Positives = 353/482 (73%), Gaps = 3/482 (1%)
 Frame = +3

Query  114   RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             ++ S  ++ +KLPPGPWKLP IGS+HHL GG  PHR LR+L++KYGP+MHLQLGE+SAVV
Sbjct  20    KKYSKNSQTKKLPPGPWKLPFIGSMHHLAGGR-PHRVLRDLAKKYGPLMHLQLGEVSAVV  78

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
             ++ P +A+ + KTHD+ FASRP ++A+DI+ Y   D+AFSPYG+YW+QMRKICV E+LS 
Sbjct  79    VTSPDMAKEVLKTHDIAFASRPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVTEVLSA  138

Query  474   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  653
             K V+SF S R +E+  L+ SI+ SS +G   N  E+V WFTSS+  + AFG++  E Q  
Sbjct  139   KSVRSFSSIRCDEVVRLIDSIQSSSSSGELVNFKERVIWFTSSMTCRSAFGQLPKE-QDM  197

Query  654   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  833
             FI L+++V+ LA GFD+ D+FPS K++H     K KLL +H ++D I + +I +HK+N  
Sbjct  198   FIKLIREVIRLAEGFDVADIFPSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNFA  257

Query  834   ANSTNSSG-KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1010
                 +      E+++DVLL++     LQFPI  DNIKA+I DMF+ GTETS+TT +WAM 
Sbjct  258   TRKNDDHALGGENLIDVLLKLMNDKSLQFPINNDNIKAIIIDMFAAGTETSSTTTVWAMV  317

Query  1011  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             EM+K P V+AKAQAEVR+A +   TFD+ D+E+L YLKLVIKET+RLH P+PL+ PRE  
Sbjct  318   EMLKNPRVLAKAQAEVREAFRNKVTFDENDVEDLKYLKLVIKETMRLHAPIPLLVPRECR  377

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             +E +I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  S+DF+GN++E++PFG 
Sbjct  378   KETEINGYTIPVKTKVMVNVWALGRDPKYWDDVECFKPERFEQCSIDFIGNNFEYLPFGG  437

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRR+CPG SF   +  L LA LL HF+W+LP G+ PKDLD+TE  G+ A+ K DL LIA 
Sbjct  438   GRRICPGTSFGLANDYLPLAQLLCHFDWKLPTGMEPKDLDLTELAGMSAASKDDLYLIAT  497

Query  1551  PF  1556
             P+
Sbjct  498   PY  499



>gb|KHN42275.1| Cytochrome P450 71D8 [Glycine soja]
Length=511

 Score =   529 bits (1362),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 266/473 (56%), Positives = 345/473 (73%), Gaps = 7/473 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
              KLPPGPWKLPLIG+LH L G G+LPH TL+NLSRKYGP+MHLQLGEISAVV+S   +A+
Sbjct  35    HKLPPGPWKLPLIGNLHQLAGAGTLPHHTLQNLSRKYGPLMHLQLGEISAVVVSSSDMAK  94

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              I KTHDL F  RP ++   I+ Y STD+AF+PYGDYWRQMRKIC LELLS K V+SF  
Sbjct  95    EIMKTHDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSF  154

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R+EE++ L+ SI+L +  G P N+++ V +  S+LI++ AFG+  SE + K +ALLK+ 
Sbjct  155   IREEEVAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKK-SEYEDKLLALLKKA  213

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
             + L GGFDL DLFPS K IH  + MK KL  +  ELDKI + II  H+ NH         
Sbjct  214   VELTGGFDLADLFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQSNH-----GKGE  268

Query  858   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
              +E++VDVLLRV++ G L+  +T +NIKAVI D+F  GT+TSAT + WAMSE++K P VM
Sbjct  269   AEENLVDVLLRVQKSGSLEIQVTINNIKAVIWDIFGAGTDTSATVLEWAMSELMKNPRVM  328

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
              KAQAE+R+A +G KT  + D+  L+YLK VIKET+RLHPP+PL+ PRE  E  KIG Y 
Sbjct  329   KKAQAEIREAFRGKKTIRESDVYELSYLKSVIKETMRLHPPVPLLLPRECREPCKIGGYE  388

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             IP KT+VI+NAWAL  +P+ W D E+F+PERF+ +S DF G+++E+IPFGAGRRMCPGI 
Sbjct  389   IPIKTKVIVNAWALGRDPKHWYDAEKFIPERFDGTSNDFKGSNFEYIPFGAGRRMCPGIL  448

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
                 ++ L L  LLYHF+WELP+G+ P+DLDMTE  G    +K +L L+  P+
Sbjct  449   LGIANVELPLVALLYHFDWELPNGMKPEDLDMTEGFGAAVGRKNNLYLMPSPY  501



>ref|XP_003529672.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=522

 Score =   529 bits (1362),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 266/473 (56%), Positives = 345/473 (73%), Gaps = 7/473 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
              KLPPGPWKLPLIG+LH L G G+LPH TL+NLSRKYGP+MHLQLGEISAVV+S   +A+
Sbjct  46    HKLPPGPWKLPLIGNLHQLAGAGTLPHHTLQNLSRKYGPLMHLQLGEISAVVVSSSDMAK  105

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              I KTHDL F  RP ++   I+ Y STD+AF+PYGDYWRQMRKIC LELLS K V+SF  
Sbjct  106   EIMKTHDLNFVQRPELLCPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSF  165

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R+EE++ L+ SI+L +  G P N+++ V +  S+LI++ AFG+  SE + K +ALLK+ 
Sbjct  166   IREEEVAKLIQSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKK-SEYEDKLLALLKKA  224

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
             + L GGFDL DLFPS K IH  + MK KL  +  ELDKI + II  H+ NH         
Sbjct  225   VELTGGFDLADLFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQSNH-----GKGE  279

Query  858   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
              +E++VDVLLRV++ G L+  +T +NIKAVI D+F  GT+TSAT + WAMSE++K P VM
Sbjct  280   AEENLVDVLLRVQKSGSLEIQVTINNIKAVIWDIFGAGTDTSATVLEWAMSELMKNPRVM  339

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
              KAQAE+R+A +G KT  + D+  L+YLK VIKET+RLHPP+PL+ PRE  E  KIG Y 
Sbjct  340   KKAQAEIREAFRGKKTIRESDVYELSYLKSVIKETMRLHPPVPLLLPRECREPCKIGGYE  399

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             IP KT+VI+NAWAL  +P+ W D E+F+PERF+ +S DF G+++E+IPFGAGRRMCPGI 
Sbjct  400   IPIKTKVIVNAWALGRDPKHWYDAEKFIPERFDGTSNDFKGSNFEYIPFGAGRRMCPGIL  459

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
                 ++ L L  LLYHF+WELP+G+ P+DLDMTE  G    +K +L L+  P+
Sbjct  460   LGIANVELPLVALLYHFDWELPNGMKPEDLDMTEGFGAAVGRKNNLYLMPSPY  512



>sp|Q94FM7.2|C71DK_TOBAC RecName: Full=5-epiaristolochene 1,3-dihydroxylase; Short=NtEAH; 
AltName: Full=Cytochrome P450 71D20 [Nicotiana tabacum]
 gb|AAK62342.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=504

 Score =   527 bits (1357),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 260/479 (54%), Positives = 357/479 (75%), Gaps = 2/479 (0%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWK+P++GS+ H++GG  PH  LR+L++KYGP+MHLQLGEISAVV++
Sbjct  23    KNSNSQSKKLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
                +A+ + KTHD+VFASRP I+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82    SRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  F 
Sbjct  142   VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDIFA  200

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
               +++V+ LA GFD+ D+FP+ K++H  SGMK KLL  H ++D I + +I +HK+N  A 
Sbjct  201   KKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAG  260

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              +N +   ED++DVLLR+     LQFPIT DNIKAVI DMF+ GTETS+TT +WAM+EM+
Sbjct  261   KSNGALGGEDLIDVLLRLMNDTSLQFPITNDNIKAVIVDMFAAGTETSSTTTVWAMAEMM  320

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV  KAQAEVR+A +   +FD+ D+E L YLKLVIKETLRLHPP PL+ PRE  E+ 
Sbjct  321   KNPSVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECREDT  380

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG GRR
Sbjct  381   DINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGGRR  440

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPG+SF   ++ L LA LLYHF+W+LP G+ P+DLD+TE  G+  ++K  L L A P+
Sbjct  441   ICPGMSFGLANLYLPLAQLLYHFDWKLPTGIMPRDLDLTELSGITIARKGGLYLNATPY  499



>ref|XP_009771988.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Nicotiana 
sylvestris]
Length=504

 Score =   526 bits (1354),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 260/479 (54%), Positives = 354/479 (74%), Gaps = 2/479 (0%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWK+P++GS+ H++GG  PH  LR+L++KYGPIMHLQ GEISAVV++
Sbjct  23    KNSNSQTKQLPPGPWKIPILGSMLHMLGGE-PHHILRDLAKKYGPIMHLQFGEISAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
               ++A+ + KTHD+VFASRP I+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82    SREMAKEVLKTHDVVFASRPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  F 
Sbjct  142   VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDVFA  200

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
               +++V+ LA GFD+ D+FPS K++H  SGMK KLL  H ++D I + +I +HK+N    
Sbjct  201   KKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATG  260

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +   ED++DVLLR+     LQFPIT D IKAVI DMF+ GTETS+TT +WAM+EM+
Sbjct  261   KTNGALGGEDLIDVLLRLMNDTSLQFPITNDKIKAVIVDMFAAGTETSSTTTVWAMAEMM  320

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K P+V  KAQAEVR+  K   TFD+ D E L YLKLVIKETLRLHPP PL+ PRE  E+ 
Sbjct  321   KNPNVFNKAQAEVRETFKDKVTFDEIDAEELEYLKLVIKETLRLHPPSPLLVPRECREDT  380

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG GRR
Sbjct  381   DINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGGRR  440

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPG+SF   ++ L LA LLYHF+W+LP G+ P DLD+TE  G+  ++K DL L+A P+
Sbjct  441   ICPGMSFGLANLYLPLAQLLYHFDWKLPSGMMPGDLDLTELAGITIARKGDLYLMATPY  499



>ref|XP_004249519.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=510

 Score =   526 bits (1354),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 267/475 (56%), Positives = 355/475 (75%), Gaps = 6/475 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
             +KLPPGPWKLP+IGS+HHL +   LPH  L  L +K+GP+MHLQLGEIS +V+S  ++AR
Sbjct  34    KKLPPGPWKLPIIGSIHHLALEDGLPHHALTKLGKKHGPLMHLQLGEISTIVVSSMEMAR  93

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              + K HDL FASRP +++LDI+ YKSTD+AF  YGDYWRQMRKICVLEL + K V+SF S
Sbjct  94    EVMKIHDLAFASRPKLVSLDIILYKSTDIAFCSYGDYWRQMRKICVLELFTAKNVRSFSS  153

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R+EE SNLV  IR SS  G P N+T+++SW+ SS+  K AFG +  +DQ KFI +++++
Sbjct  154   IRREEGSNLVQFIR-SSTRGEPINVTKQISWYESSITCKAAFGELL-KDQEKFIGIVREL  211

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
               L GGF + ++FPS K +H  SG++ ++LK+H  +D I + II DHK N +A+    +G
Sbjct  212   AELTGGFSVANIFPSIKILHVLSGVRSRILKVHENVDAIVEDIISDHKRN-IASGKRGNG  270

Query  858   K--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1031
                 ED+VDVLLR+ E G L+ PIT DNIKA++ D+FS GTETS TT IWAM+EMI+ PS
Sbjct  271   AFGGEDLVDVLLRLMESGALKIPITNDNIKAIMIDLFSAGTETSTTTTIWAMTEMIRNPS  330

Query  1032  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1211
             V+AKAQ EVR+A KG +T ++  +E L YLK V+KET RLHPPLPL+ PRE  EE  I  
Sbjct  331   VLAKAQTEVREAFKGKETSNEDVIERLKYLKQVVKETFRLHPPLPLLIPRECREETNING  390

Query  1212  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1391
             Y IP KTRV++N +++  +P+ WED E F+PERFE SSVDFMGN++E++PFGAGRR+CPG
Sbjct  391   YTIPLKTRVVVNVYSMGRDPKYWEDAESFIPERFEGSSVDFMGNNFEYLPFGAGRRICPG  450

Query  1392  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             I+F   ++ L LA LLYHF+W+LP GV  +D+DM E  G+ A++K +L LIA P+
Sbjct  451   ITFGLINVYLPLANLLYHFDWKLPHGVKLEDVDMNEFSGITAARKSELYLIATPY  505



>gb|ABC69421.1| CYP71D20v2 [Nicotiana tabacum]
Length=504

 Score =   525 bits (1353),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 259/479 (54%), Positives = 357/479 (75%), Gaps = 2/479 (0%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ +KLPPGPWK+P++GS+ H++GG  PH  LR+L++K GP+MHLQLGEISAVV++
Sbjct  23    KNSNSQSKKLPPGPWKIPILGSMLHMIGGE-PHHVLRDLAKKDGPLMHLQLGEISAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
                +A+ + KTHD+VFASRP I+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82    SRDMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  F 
Sbjct  142   VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDIFA  200

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
               +++V+ LA GFD+ D+FP+ K++H  SGMK KLL  H ++D I + +I +HK+N  A 
Sbjct  201   KKIREVIGLAEGFDVVDIFPTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAG  260

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              +N +   ED++DVLLR+     LQFPIT DNIKAV+ DMF+ GTETS+TT +WAM+EM+
Sbjct  261   KSNGALGGEDLIDVLLRLMNDTSLQFPITNDNIKAVVVDMFAAGTETSSTTTVWAMAEMM  320

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV AKAQAEVR+A +   +FD+ D+E L YLKLVIKETLRLHPP PL+ PRE  E+ 
Sbjct  321   KNPSVFAKAQAEVREAFRDKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECREDT  380

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVD  GN++EF+PFG GRR
Sbjct  381   DINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDIFGNNFEFLPFGGGRR  440

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPG+SF   ++ L LA LLYHF+W+LP G+ P+DLD+TE  G+  ++K DL L A P+
Sbjct  441   ICPGMSFGLANLYLPLAQLLYHFDWKLPTGIKPRDLDLTELSGITIARKGDLYLNATPY  499



>ref|XP_009803037.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=512

 Score =   524 bits (1350),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 262/483 (54%), Positives = 352/483 (73%), Gaps = 13/483 (3%)
 Frame = +3

Query  114   RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             R     +++Q+LPPGPW+LPLIGSLHHL+G   PHR  R+L+RKYGP+M+L+LGE+  V+
Sbjct  30    RNSETSSQKQRLPPGPWRLPLIGSLHHLIGAH-PHRIFRDLARKYGPVMYLELGEVPTVI  88

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
             IS P  A+   KTHDL F++RP   +  IV Y + D+AF+ YGDYW+QMRKIC++ELLS 
Sbjct  89    ISSPSAAKETLKTHDLAFSNRPQFTSTYIVMYNNKDIAFAEYGDYWKQMRKICIMELLSA  148

Query  474   KMVKSFCSFRQEELSNL---VSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSED  644
             +MVKSF S R++ELS+L   V S++ +SE     N+TEK+  F SS+  ++ FG++ S+D
Sbjct  149   RMVKSFSSIRKDELSSLLSSVQSVKGTSEV----NMTEKIVRFASSVTCRLVFGKL-SKD  203

Query  645   QGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDH-K  821
             +   I L+K+ L LAGG D+GDLFPS K ++  SG K +L+K+H E+D + D I+ +H +
Sbjct  204   RELLIELMKKTLLLAGG-DVGDLFPSWKLLYKMSGAKSRLVKMHQEVDSVLDNIVNEHIR  262

Query  822   ENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIW  1001
                  N  N     ED+VDV LR++E  +LQFPIT D+IKAVI DMF+ GTETS+T IIW
Sbjct  263   SRADGNKGNGEYGGEDLVDVFLRIQENDQLQFPITNDHIKAVILDMFTAGTETSSTAIIW  322

Query  1002  AMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihpr  1181
             AMSE++K P+VMAKAQ+EVRQA KG  +FD++DL+NL YL LV+KETLRLH P  L    
Sbjct  323   AMSELMKNPNVMAKAQSEVRQAFKGKSSFDEEDLDNLPYLMLVVKETLRLHAPSILHR--  380

Query  1182  ESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIP  1361
             E  E+  I  Y IP K  V++N WA+  +PE W +PE F+PERFENS +D++GNH+EFIP
Sbjct  381   ECREQTCIDGYTIPSKATVLVNTWAIGRDPEVWNNPESFIPERFENSFIDYLGNHFEFIP  440

Query  1362  FGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCL  1541
             FG+G+R+CPG+ F   +    LA LLYHFNWELP G SPKDLDM+E  G+ A+K+KDL +
Sbjct  441   FGSGKRICPGMQFGLANFRYPLARLLYHFNWELPYGTSPKDLDMSEKPGMSAAKEKDLYV  500

Query  1542  IAR  1550
             IA+
Sbjct  501   IAK  503



>emb|CDP20259.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   522 bits (1345),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 272/503 (54%), Positives = 363/503 (72%), Gaps = 13/503 (3%)
 Frame = +3

Query  63    PVSVIVFLSFVFCIYTLRRRSNPARR----QKLPPGPWKLPLIGSLHHLVGGSLPHRTLR  230
             P + I F  F+  I TL +R    R+    QKLPPGP KLP IG+LH+L+G SLPH+ L 
Sbjct  4     PFNFITFFIFLALILTLWKRWKKPRKVNATQKLPPGPRKLPFIGNLHNLLG-SLPHQALT  62

Query  231   NLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAF  410
             NL++K+G +MHLQLGE+SA+V+S P+ A+ I KTHDL FA RP ++   I+ Y  + +AF
Sbjct  63    NLAKKHGDLMHLQLGEVSAIVVSSPRSAKEILKTHDLAFADRPEVLVGKIICYDYSSIAF  122

Query  411   SPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSW  590
              PYG+YWRQMRKIC LELLS KMV+SF S RQ+E+ +L+SSIR S+  G P NLTE+VS 
Sbjct  123   CPYGEYWRQMRKICTLELLSAKMVRSFGSIRQDEVLHLLSSIRASTGGGKPINLTEEVSS  182

Query  591   FTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLK  770
             FTSS++ + AFG++  E     I L+K+VLS   GFD+ DLFPS+K +H+ S MKP LLK
Sbjct  183   FTSSMVCRSAFGKMFGEKNTILIQLVKEVLSRTSGFDISDLFPSQKILHHLSWMKPTLLK  242

Query  771   LHHELDKIFDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKE-GGELQFPITEDNIK  941
             +HH++D I D II +H  N LA     +G+   ED++D+LLR+KE GG+L+FPIT   +K
Sbjct  243   VHHKIDVILDNIINEHIRN-LARGKGGNGESGQEDLIDILLRIKESGGDLRFPITNKIVK  301

Query  942   AVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYL  1121
             A++ DMF+  TETSAT + WAMSEMI+ P VM+KAQ E+R+A  G    ++ D+E L YL
Sbjct  302   AIMFDMFTAATETSATVVEWAMSEMIRNPDVMSKAQNEIRKAFMGKAKIEEMDIEGLIYL  361

Query  1122  KLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFL  1301
             K VIKETLRLHPPLPL+ P E  E+  +  Y+IP KTRV++NAWA+  +P+ W+ PE F 
Sbjct  362   KSVIKETLRLHPPLPLLVPMECREQRVLDGYVIPIKTRVLVNAWAIHRDPKYWDYPESFK  421

Query  1302  PERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPK  1481
             PERF+N+ VDF G H+ ++PFG GRR+CPGISF   ++ L LA LLY+F+W+LP G   K
Sbjct  422   PERFDNNPVDFTGTHFHYLPFGGGRRICPGISFGLANVELPLAQLLYNFDWKLPPG---K  478

Query  1482  D-LDMTEAVGVIASKKKDLCLIA  1547
             D LDMTEA G+  ++K +L L+A
Sbjct  479   DGLDMTEAFGITVARKSNLHLVA  501



>ref|XP_009587552.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   522 bits (1345),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 254/480 (53%), Positives = 348/480 (73%), Gaps = 7/480 (1%)
 Frame = +3

Query  114   RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             R+    +++Q+LPPGPW+LPLIGSLHHL+G   PHR  R+L+RKYGP+M+L+LGE+  V+
Sbjct  30    RKSETSSQKQRLPPGPWRLPLIGSLHHLIGAH-PHRIFRDLARKYGPVMYLELGEVPTVI  88

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
             IS P  A+   KTHDL FA+RP   +  IV Y + D+AFS YGDYW+QMRKIC++ELLS 
Sbjct  89    ISSPSAAKETLKTHDLAFANRPQFTSTYIVMYNNKDIAFSEYGDYWKQMRKICIMELLSA  148

Query  474   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  653
             +MVKSF S R++E+SNL+SS+     T    N+TEK+  +   +  ++ FG++  +D+  
Sbjct  149   RMVKSFSSIRKDEISNLLSSVHSVKGTS-EVNMTEKIVRYACFVTCRLVFGKL-GKDREV  206

Query  654   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  833
              I L+K++L LAGG D+ DLFPS K ++  +G K +L+K+H  +D + + I+ +H  +  
Sbjct  207   LIDLMKKMLLLAGG-DVCDLFPSWKLLYKMTGAKSRLVKMHQVVDSVLENIVNEHIRSRA  265

Query  834   A-NSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1010
             A N  N     ED+VDV LR++E  +LQFPIT D+IKAVI DMF+ GTETS+T I+WA+S
Sbjct  266   AGNKGNGEYGGEDLVDVFLRIQENDQLQFPITNDHIKAVIFDMFTAGTETSSTAIVWALS  325

Query  1011  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             E++K P+VMAKAQ+EVRQA KG  +FD++DL+NL YL LV+KETLRLH P  L    +  
Sbjct  326   ELMKNPNVMAKAQSEVRQAFKGKSSFDEEDLDNLPYLMLVVKETLRLHAPGILHR--QCR  383

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             E+  I  Y IP +  V++N WA+  +PE W DPE F+PERFENSS+D+MGNH+EFIPFG+
Sbjct  384   EQTCIDGYTIPSRATVLVNTWAIGRDPEVWHDPESFIPERFENSSIDYMGNHFEFIPFGS  443

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             G+R+CPG+ F   +    LA LLYHFNWELP G SPKDLDM++  G+  +K+KDL LIA+
Sbjct  444   GKRICPGMQFGLANFRYPLARLLYHFNWELPYGTSPKDLDMSQIPGMSVAKEKDLYLIAK  503



>emb|CDP07879.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   522 bits (1344),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 260/482 (54%), Positives = 357/482 (74%), Gaps = 6/482 (1%)
 Frame = +3

Query  117   RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVI  296
             +RS  A  QKLPP PWKLP+IG +HHL+G S PH  LR L++KYGP+M++QLG+++A+V+
Sbjct  25    KRSKTA--QKLPPSPWKLPIIGHMHHLLG-SPPHHALRKLAQKYGPLMNIQLGQMTAIVV  81

Query  297   SYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  476
             + P+LA+ I KTHDL FA R   ++  I+ Y  +D+A   YGDYWRQMRKIC LELLS K
Sbjct  82    TSPRLAKEIMKTHDLAFADRAEFLSGKIMCYDCSDIACCRYGDYWRQMRKICTLELLSAK  141

Query  477   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  656
              V+SF S RQ+E  +L+SSI++ +    P +LTEKVS +TSS++ + AFG+V  +D   F
Sbjct  142   SVRSFVSVRQDEALHLISSIKVLAGAREPIDLTEKVSSYTSSVVCRAAFGKVSKDDHAAF  201

Query  657   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  836
             + L+K+ L +A  FD+ DL PS K +H    ++ KLLK+H + D+I + II  H +N  A
Sbjct  202   LQLMKEALPIASAFDISDLLPSFKILHPLLSVESKLLKMHDKEDEILEKIIDQHIDNQ-A  260

Query  837   NSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1010
                 S+G+   ED++DVLLRVKE GELQFPIT++NIKAVI+D+F  GTETS++ + WAMS
Sbjct  261   RRNISTGEYGQEDLIDVLLRVKESGELQFPITKNNIKAVIHDVFGAGTETSSSIVDWAMS  320

Query  1011  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             EMI+ P VMAKAQ+E+R A +G  T ++ D++ L YL+ VIKETLRLHPP+PL+ PRE  
Sbjct  321   EMIRNPGVMAKAQSEIRNAFRGKNTIEETDIQQLQYLRSVIKETLRLHPPIPLLIPRECR  380

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             EE +I  YIIP KT++++NAWA+  +PE W+DPE F PERFE S +DF G+ +EF+PFGA
Sbjct  381   EECEIDGYIIPVKTKILVNAWAIGRDPEYWDDPECFKPERFEESPIDFTGSRFEFLPFGA  440

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRR+CPGISF   ++ ++LA LLYHF+W+LP+G+  KDLDM E VG+ AS+  +L L+A 
Sbjct  441   GRRICPGISFGLANVEVALALLLYHFDWKLPNGLDTKDLDMKETVGITASRTNNLRLLAT  500

Query  1551  PF  1556
              +
Sbjct  501   SY  502



>ref|XP_004249812.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
 ref|XP_010312277.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=511

 Score =   521 bits (1342),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 269/476 (57%), Positives = 351/476 (74%), Gaps = 7/476 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
             +KLPPGPWKLP IGS+HHL + G LPH  L NL +KYGP MHLQ+GEIS VV+S   +AR
Sbjct  34    KKLPPGPWKLPFIGSVHHLALEGGLPHHALTNLGKKYGPFMHLQVGEISTVVVSSMDMAR  93

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              + KTHDL FASR  I+A DI+ YKSTD+ F  YGDYWRQMRK+CVLELL+ K V+SF S
Sbjct  94    EVLKTHDLAFASRHKILAFDIILYKSTDIGFCSYGDYWRQMRKVCVLELLTTKNVRSFSS  153

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R++E S LV  IR SS  G P N+TE++SW+ SS+  K AFG +  +DQ KF+ +L++ 
Sbjct  154   IRRDEASRLVQFIR-SSTCGEPINVTERISWYQSSITCKTAFGELL-KDQEKFLGILREF  211

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
               +AGGF   D+FPS K +   SG+K ++LK H  +D I + +I +HK+N LA+    +G
Sbjct  212   TEVAGGFSTADIFPSIKILQVLSGLKSRILKFHKNVDVIVEDVINEHKKN-LASGKKGNG  270

Query  858   K--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1031
                 E++VDVLLR+KE GEL+ PIT DNIKA+I D+F  GTET+ TT IWAM+EMI+ PS
Sbjct  271   AFGGENLVDVLLRLKESGELKIPITNDNIKAIIIDLFIAGTETTTTTTIWAMTEMIRNPS  330

Query  1032  VMAKAQAEVRQALKGNK-TFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIG  1208
             V+AKAQ EVR+A KG +  F++  +E L YLK V+KETLRLHPPLPL+ PRE  EE  I 
Sbjct  331   VLAKAQTEVREAFKGKEEIFNEDVIEELKYLKQVVKETLRLHPPLPLLIPRECREETNIN  390

Query  1209  EYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCP  1388
              Y IP KTRV++N +++  +P+ WED E F+PERFE SSVDFMGN++E++PFG+GRRMCP
Sbjct  391   GYTIPLKTRVVVNVYSMGRDPKYWEDAESFIPERFEGSSVDFMGNNFEYLPFGSGRRMCP  450

Query  1389  GISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
              +SF   ++ L LA LLYHF+W+LPD V  +D+DM E  G+ A++K +L LIA P+
Sbjct  451   ALSFGLINVYLPLANLLYHFDWKLPDCVKLEDMDMNEFSGIAAARKSELYLIATPY  506



>ref|XP_009794009.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   521 bits (1341),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 258/482 (54%), Positives = 358/482 (74%), Gaps = 15/482 (3%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLPLIGS+ H++GG LPH  LRNL++K+GP+MHLQLGE+S VV++
Sbjct  23    KNSNSQTKRLPPGPWKLPLIGSMFHILGG-LPHHVLRNLAKKFGPLMHLQLGEMSVVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP ++A +IV Y  +D+AFSPYGDYWRQMRKIC++ELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPKLLAAEIVIYNCSDIAFSPYGDYWRQMRKICMIELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  ++   R  S TG   N+T+++  F SS+  + AFG+V  E Q + I
Sbjct  142   VRSFSSIRRDEVHRMIEFFR--SSTGKQVNVTKRIYQFASSMTCRSAFGKVFKE-QDELI  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE---NH  830
              L+K+  +L  GFD+ D+FPS K++H  SGMK K++ +HH+LD I + II + K+   + 
Sbjct  199   LLVKRNTALVEGFDVADIFPSLKFLHVLSGMKTKVMDVHHKLDAILENIINERKKIATDE  258

Query  831   LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1010
             LA        DE ++DVLLR+ + G LQFPIT DNIKA+I D+FS GT+TS+ T+ WAM 
Sbjct  259   LA--------DEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDIFSAGTDTSSATVDWAMV  310

Query  1011  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             EM+K  S++AKAQAEVR+  +G +TFD+ ++E L YLKLVIKETLRLHPPLPL+ PRE  
Sbjct  311   EMMKNQSILAKAQAEVRKTFRGKETFDENNVEELKYLKLVIKETLRLHPPLPLLLPRECR  370

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             EE  I  Y IP KT+V+IN WA+  +P+ W+D E F PERFE++S+DF GN++E++PFG+
Sbjct  371   EETNINGYTIPLKTKVMINVWAIGRDPKYWDDAEIFKPERFEHNSMDFTGNNFEYLPFGS  430

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRR CPGISF   ++   LA LLYHF+W+LP   +P DLD+TE+ G   S+K +L LIA 
Sbjct  431   GRRNCPGISFGLANVYFPLAQLLYHFDWKLPTETNPSDLDLTESAGATCSRKSNLYLIAT  490

Query  1551  PF  1556
             P+
Sbjct  491   PY  492



>ref|XP_009619866.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   520 bits (1338),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 259/479 (54%), Positives = 359/479 (75%), Gaps = 7/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             R++ ++ ++LPPGPWKLP++GS+ HL+GG  PH  LR+L++KYGP+MHLQLGE+S VV++
Sbjct  23    RNSSSQTKRLPPGPWKLPILGSMLHLLGGH-PHHVLRDLAKKYGPLMHLQLGEVSLVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP ++A  IV Y  TD+ FSPYG+YWRQMRKIC+LELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPLLVAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF S RQ+E+  ++   R  S  G P N+T++ + FTSS+  + AFG+   E Q +F+
Sbjct  142   VKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRFALFTSSMTCRSAFGQEHKE-QDEFV  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V +L  GFD+ ++FPS  ++H  +GMK K++ +HHELD+I + II +HK+  +A 
Sbjct  199   RLVKKVSNLMEGFDVANIFPSLNFLHVLTGMKAKVMNVHHELDEILENIITEHKK--VAK  256

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
             +   SG  E IVDVLLR+ + G LQFPIT DNIKA++ DMF+ GTETS+TTI WAM EM+
Sbjct  257   TICESG-GEGIVDVLLRLMKEGGLQFPITNDNIKAIVFDMFAAGTETSSTTINWAMVEMM  315

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K+PSV AKAQAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PR+  EE 
Sbjct  316   KKPSVFAKAQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLIPRKCREET  375

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              +  Y IP KT V++N WA+  +P+ W+D E F PERFEN+S+D++GN++E++PFG+GRR
Sbjct  376   DLNGYTIPLKTTVVVNVWAMGRDPKYWDDVESFKPERFENNSMDYIGNNFEYLPFGSGRR  435

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             + PGISF   ++   LA LLYHF+ +LP G++P  LD+TEA G   ++K DL LIA P+
Sbjct  436   IYPGISFGLANVYFPLAQLLYHFDGKLPSGINPSALDLTEATGAACARKNDLHLIATPY  494



>ref|XP_009612418.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   518 bits (1335),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 257/479 (54%), Positives = 355/479 (74%), Gaps = 9/479 (2%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++  + ++LPPGPWKLPL+GS+ H++GG LPH  L NL++KYGP+MHLQLGE+S VV++
Sbjct  23    KNSNNQTKRLPPGPWKLPLLGSMFHILGG-LPHHVLTNLAKKYGPLMHLQLGEMSVVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP ++A +IV Y  +D+AF PYGDYWRQMRKIC++ELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPKLLAAEIVIYNCSDIAFCPYGDYWRQMRKICMIELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF S R++E+  ++   R  S TG   N+T+++  F SS+  + AFG+V  E Q + I
Sbjct  142   VKSFSSIRRDEVHGMIEFFR--SSTGKQVNITKRIYQFASSMTCRSAFGKVFKE-QDELI  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+  +L  GFD+ D+FPS K++H  SGMK K++ +HH+LD I + II + K+     
Sbjct  199   LLVKRNTALVEGFDVADIFPSLKFLHVLSGMKAKVMDVHHKLDVILENIINERKKI----  254

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
             +T+  G DE ++DVLLR+ + G LQFPIT DNIKA+I D+FS GTETS+ T+ WAM EM+
Sbjct  255   ATDELG-DEGLIDVLLRLMKEGGLQFPITNDNIKAIIFDIFSAGTETSSATVDWAMVEMM  313

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K  S++AKAQAEVR+  +G +TFD+ D+E L YLKLVIKETLRLHPP PL+ PRE  EE 
Sbjct  314   KNQSILAKAQAEVRKTFRGKETFDENDVEELKYLKLVIKETLRLHPPFPLLLPRECREET  373

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V+IN WA+  +P+ W D E F PERFE++S+DF+GN++E++PFG+GRR
Sbjct  374   DINGYTIPFKTKVMINVWAIGRDPKYWNDAEIFKPERFEHNSMDFVGNNFEYLPFGSGRR  433

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
              CPGISF   ++   LA LLYHF+W+LP G++  +LD TE+ G   S+K +L LIA P+
Sbjct  434   NCPGISFGLANVYFPLAQLLYHFDWKLPTGINSSELDFTESAGATCSRKSNLYLIATPY  492



>ref|XP_009780029.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   517 bits (1332),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 257/482 (53%), Positives = 363/482 (75%), Gaps = 7/482 (1%)
 Frame = +3

Query  111   LRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAV  290
             ++ +++ ++ ++LPPGPWKLP++GS+ H++GG LPH  LR+L++KYGPIMHLQLGE+S V
Sbjct  20    MKWKNSNSQTKRLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLV  78

Query  291   VISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  470
             VIS P++A+ + KTHDL FA+RP ++A  IV Y  TD+AFSPYG+YWRQMRKIC+LELLS
Sbjct  79    VISSPEMAKEVLKTHDLAFANRPLLVAAKIVCYNGTDIAFSPYGNYWRQMRKICLLELLS  138

Query  471   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  650
              K VKSF S RQ+E+  ++   R SS  G P N+T++++ FT+S+  + AFG+   + Q 
Sbjct  139   AKTVKSFNSIRQDEVHRMIEFFRSSS--GKPVNVTKRIALFTNSMTCRSAFGQE-YKKQD  195

Query  651   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  830
             +F+ L+K+V  L  GFD+ D+FPS K++H  +GMK K++ +H+E+D I + II +HK+  
Sbjct  196   EFVELVKKVSHLIEGFDVADIFPSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHKK--  253

Query  831   LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1010
               + ++     E I+ VLLR+ + G LQFPIT DNIKA+I D+F  GTETS+TTI WAM+
Sbjct  254   -TSKSDGESGGEGIIGVLLRLMKEGGLQFPITNDNIKAIIFDIFGGGTETSSTTINWAMA  312

Query  1011  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             EM+K P V +KAQAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PRE  
Sbjct  313   EMMKNPCVFSKAQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECR  372

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             EE  +  Y IP KT+V++NAWA+  +P+ W+D E F PERFE++S+D++GN+YE++PFG+
Sbjct  373   EEIDLNGYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGS  432

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRR+CPGISF   ++   LA LL HF+W+LP G++P +LD+TEA GV  + K DL LIA 
Sbjct  433   GRRICPGISFGLANVYFPLAQLLNHFDWKLPTGINPSELDLTEAAGVACATKNDLHLIAT  492

Query  1551  PF  1556
             P+
Sbjct  493   PY  494



>emb|CDP07882.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   519 bits (1336),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 261/499 (52%), Positives = 361/499 (72%), Gaps = 3/499 (1%)
 Frame = +3

Query  60    NPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLS  239
             N ++  +FL+FV  ++   RRS  A+  KLPP P KLP+IG++HHL+G S PH+ L  L+
Sbjct  6     NLIAFFLFLAFVLALFKEWRRSQAAK--KLPPSPSKLPIIGNMHHLIG-SQPHQALTKLA  62

Query  240   RKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPY  419
             +K+G +MHLQLGEIS++++S   LA+ I KTHDL FA+R  I+   I+ Y S+D+ F PY
Sbjct  63    QKHGALMHLQLGEISSIIVSSSHLAKEIMKTHDLSFANRSEILLSKIIMYNSSDIGFCPY  122

Query  420   GDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTS  599
             GDY RQ+RKIC LELLS K V+SF S RQ+E  +LV SIR  ++ G   + T+KV  +T 
Sbjct  123   GDYLRQVRKICALELLSAKKVQSFGSIRQDEALHLVKSIRNLADAGEVIHFTDKVHSYTC  182

Query  600   SLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHH  779
             S + + AFG+V  +   KF+ L+ +++ L+  FD+ DL PS K +H    +K +L+K+H 
Sbjct  183   STVCRAAFGKVSKDVHSKFLQLMCEIVPLSSTFDISDLLPSFKMLHPLLSVKRQLVKIHL  242

Query  780   ELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDM  959
             ++D++   II  H  N   N +     +ED++DVLLRVK  G+LQ PIT DNIKA++ D+
Sbjct  243   KMDRLLVNIIDQHTNNLQRNMSTGEYGNEDLIDVLLRVKHSGDLQIPITNDNIKAIVIDV  302

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKE  1139
             FS GTETS+TT+ WAMSEMI+ PSVMAKAQ+E+R A KG + F++ D++ L YLKLVI+E
Sbjct  303   FSAGTETSSTTVDWAMSEMIRNPSVMAKAQSEIRTAFKGKQMFEEDDVQELKYLKLVIRE  362

Query  1140  TlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFEN  1319
             TLRLHPPLPL+ PRE  EE +I  Y+IP +TRV++NAWA+  +P+ W+DPE F PERFEN
Sbjct  363   TLRLHPPLPLLVPRECREECEIDGYVIPVQTRVLVNAWAMGRDPQYWDDPESFKPERFEN  422

Query  1320  SSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTE  1499
             + VDF G H+E++PFGAGRRMCPGI F   ++ + LA LLYHFNW+LP+G+ P DLDM+E
Sbjct  423   NPVDFAGTHFEYLPFGAGRRMCPGIQFGLANVYVPLAFLLYHFNWKLPNGLDPNDLDMSE  482

Query  1500  AVGVIASKKKDLCLIARPF  1556
             + G+ AS+K  L L+A P+
Sbjct  483   STGITASRKDKLRLLATPY  501



>ref|XP_006357930.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=498

 Score =   514 bits (1325),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 266/476 (56%), Positives = 352/476 (74%), Gaps = 8/476 (2%)
 Frame = +3

Query  135   RRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLA  314
             ++ +LPPGPW+LP IGSLHHL+G    H  LRNL+++YGP+M+LQLGEI  V+IS   +A
Sbjct  27    KQTRLPPGPWRLPFIGSLHHLIGRGHLHPNLRNLAQRYGPLMYLQLGEIPVVIISSSTIA  86

Query  315   RAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFC  494
             + +  THDL FA RP   +  I+FY + D+ FSPY +Y +QMRKIC ++L S KMVKSF 
Sbjct  87    KELLTTHDLAFADRPQSTSTTIIFYNNKDIVFSPYDNYCKQMRKICKVQLFSAKMVKSFS  146

Query  495   SFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQ  674
             + R++E+S+L+SSIR + ++  P N+TEK+ WFT+S+    AFG++  +D+ +FI LLK 
Sbjct  147   TIRKDEISSLISSIRSTRDS--PINMTEKIFWFTNSVTCSAAFGKMF-KDRDEFIKLLKD  203

Query  675   VLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSS  854
             +L LA GF + DLFPS K +H  SG + +L+  H ++D+I + I+ +H EN  AN     
Sbjct  204   ILILASGFCVTDLFPSWKLLHKLSGAESRLMNAHKKVDEIMEDILKEHLENK-ANRNKGI  262

Query  855   GKD---EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1025
             G     ED+VDVLL+V E  EL+ PIT D+IKAVI D+F  G+ETS+T  IW +SEM+K 
Sbjct  263   GDQFGGEDLVDVLLKVMEDAELECPITNDHIKAVILDIFIAGSETSSTITIWVLSEMMKN  322

Query  1026  PSVMAKAQAEVRQALKGNKTFD-DKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1202
              ++MAKAQ EVRQ L+G K +D ++DLE LTYLKLVIKETLRLH P PL+ PRE  E+  
Sbjct  323   STIMAKAQKEVRQVLRGKKNYDNEEDLEKLTYLKLVIKETLRLHTPAPLLGPRECREQTN  382

Query  1203  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1382
             I  Y IP KT++++NAWALA +PESW DPE F+PERFENSS+DF+GNH+EFIPFGAGRRM
Sbjct  383   IDGYTIPLKTKILVNAWALARDPESWHDPECFIPERFENSSIDFLGNHFEFIPFGAGRRM  442

Query  1383  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             CPG+ F  T++ LSLA LLYHF WELP G+ PKDLDMTE  G+   K++DL L+AR
Sbjct  443   CPGVLFGLTNVELSLAQLLYHFEWELPYGMKPKDLDMTETYGLSGGKQRDLYLVAR  498



>ref|XP_002522721.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39572.1| cytochrome P450, putative [Ricinus communis]
Length=499

 Score =   513 bits (1322),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 259/496 (52%), Positives = 354/496 (71%), Gaps = 6/496 (1%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARR--QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             +I+ L F++ +  L +RSN      + LPPGP KLPLIG++H L+G SLPH  LR+L++K
Sbjct  6     LILSLIFIYMVLKLWKRSNSKHSTLKNLPPGPTKLPLIGNMHQLLG-SLPHHRLRDLAKK  64

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YG IMHLQLGE+  VV+S P+ A+ + KTHD+VFA RP ++A  ++ Y  TD+AFSPY D
Sbjct  65    YGSIMHLQLGEVPHVVVSSPEAAKEVMKTHDIVFAQRPFLLAASVITYNFTDIAFSPYSD  124

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKICVLELLS K V+SF S R+EE+SNL+++  L+S +G P N + K+   T  +
Sbjct  125   YWRQLRKICVLELLSAKRVQSFRSIREEEVSNLINT--LTSFSGKPFNFSRKLFSSTYGI  182

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
              A+ +FG+   +DQ +FI + +Q+  +AGGF L DLFPS  ++H  SGMK +LL+L  + 
Sbjct  183   AARASFGKKY-KDQEEFIKVAQQMTEVAGGFSLADLFPSIAFLHVISGMKSRLLRLRDDG  241

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFS  965
             D I + II DH+  ++   T+  G+D+D+VDVLLR ++GG+L+FP+T +NIKAVI D+F 
Sbjct  242   DNILENIIDDHRARNMTGKTSGEGEDDDLVDVLLRFQKGGQLEFPLTTNNIKAVILDIFI  301

Query  966   TGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETl  1145
              G+ETS+TT+ WAMSEM++ P VM KAQ EVR+        D+ +L  L YLKLVIKETL
Sbjct  302   AGSETSSTTVEWAMSEMLRNPRVMEKAQEEVRRVFGKKGNVDEAELHELNYLKLVIKETL  361

Query  1146  rlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSS  1325
             RLHPP PL+ PRES E  +I  Y IP  ++VI+NAWA+  +P +W + E F PERF +S+
Sbjct  362   RLHPPAPLLLPRESRESCEINGYYIPVNSKVIVNAWAIGRDPNNWTEAETFYPERFLDSA  421

Query  1326  VDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAV  1505
             +D+ GN++EFIPFGAGRRMCPGI F   ++ L LA  LYHF+W+LPDG+  + LDM E  
Sbjct  422   IDYKGNYFEFIPFGAGRRMCPGILFGMANVELPLAQFLYHFDWKLPDGLEAESLDMMEGF  481

Query  1506  GVIASKKKDLCLIARP  1553
             G    +K DL LIA P
Sbjct  482   GATVRRKNDLHLIAIP  497



>ref|XP_009793271.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   513 bits (1321),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 256/479 (53%), Positives = 359/479 (75%), Gaps = 7/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLP++GS+ H++GG LPH  LR+L++KYGPIMHLQLGE+S VVIS
Sbjct  23    KNSNSQTKRLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIS  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FA+RP ++A  IV Y   D+AFSPYG+YWRQMRKIC+LELLS K 
Sbjct  82    SPEMAKEVLKTHDLAFANRPLLVAAKIVSYNCMDIAFSPYGNYWRQMRKICLLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF S RQ+E+  ++   R  S  G P N+T+++S FT+S+  + AFG+   + Q +F+
Sbjct  142   VKSFNSIRQDEVHRMIEFFR--SSPGKPVNVTKRISLFTNSMTCRSAFGQE-YKKQDEFV  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V  L  GFD+ D+FPS K++H  +GMK K++ +H+E+D I + II +HK+    +
Sbjct  199   ELVKKVSHLIEGFDVADIFPSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHKK---TS  255

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              ++     E I+ VLLR+ + G LQFPIT DNIKA+I D+F  GTETS+TTI WAM+EM+
Sbjct  256   KSDGESGGEGIIGVLLRLMKEGGLQFPITNDNIKAIIFDIFGGGTETSSTTINWAMAEMM  315

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K P V +KAQAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PRE  EE 
Sbjct  316   KNPCVFSKAQAEVRKILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEI  375

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              +  Y IP KT+V++NAWA+  +P+ W+D E F PERFE++S+D++GN+YE++PFG+GRR
Sbjct  376   DLNGYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSGRR  435

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++   LA LL HF+W+LP G++P +LD+TEA GV  + K DL LIA P+
Sbjct  436   ICPGISFGLANVYFPLAQLLNHFDWKLPTGINPSELDLTEAAGVACATKNDLHLIATPY  494



>ref|XP_009612417.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   512 bits (1318),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 249/470 (53%), Positives = 350/470 (74%), Gaps = 9/470 (2%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAIT  326
             LPPGPWKLPL+GS+ H++GG  PH  L NL++KYGP++HLQLGE+S VV++ P++A+ + 
Sbjct  32    LPPGPWKLPLLGSMFHMLGGH-PHHVLTNLAKKYGPLVHLQLGEMSVVVVTSPEMAKEVL  90

Query  327   KTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  506
             KTHDL FASRP  +A +IVFY  +D+AF PYGDYWRQMRKIC++ELL+ K V+SF S R+
Sbjct  91    KTHDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTAKNVRSFSSIRR  150

Query  507   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  686
             +E+  ++   R S +     N+T+++  FTSS+  + AFG+V  E Q +FI L+K+  +L
Sbjct  151   DEVHRMIEFFRSSIDQ--QVNVTKRIYQFTSSMTCRSAFGKVFKE-QDEFILLVKRNTAL  207

Query  687   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  866
               GFD+ D+FPSKK++H  SG K +++ +HH++D I + II + K+     +T   G  +
Sbjct  208   MEGFDVADIFPSKKFLHVLSGKKARVMDVHHKIDAILENIINERKKI----ATGEVG-GK  262

Query  867   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1046
              ++DVLLR+ + G LQFPIT DNIKA+I DMF+ GTETS+ TI WAM EM+K PSV+AKA
Sbjct  263   GLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSSVTIDWAMVEMMKNPSVLAKA  322

Query  1047  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1226
             QAEVR+A +G +TFD+ D+E L YLKLVIKE  RLHPP PL+ PRE  EE  I  Y IP 
Sbjct  323   QAEVRKAFRGKETFDENDVEELNYLKLVIKEAFRLHPPFPLLLPRECREETDINGYTIPL  382

Query  1227  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1406
             K +V++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+GRR CPGISF  
Sbjct  383   KAKVMVNVWAIGRDPKYWDDAESFKPERFEHNSMDFVGNNFEYLPFGSGRRNCPGISFGL  442

Query  1407  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
              ++   LA LLYHF+W+LP+G++P +LD+TE+ G   +++ +L LIA P+
Sbjct  443   ANVYYPLAQLLYHFDWKLPNGINPNELDLTESAGATCARESNLHLIATPY  492



>gb|AHH25653.1| cytochrome P450 CYP71D [Nicotiana tabacum]
Length=497

 Score =   512 bits (1318),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/479 (52%), Positives = 356/479 (74%), Gaps = 9/479 (2%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLPL+GS+ H++GG  PH  L NL++KYGP++HLQLGE+S VV++
Sbjct  23    KNSNSKIKRLPPGPWKLPLLGSMFHMLGGH-PHHVLTNLAKKYGPLVHLQLGEMSVVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP  +A +IVFY  +D+AF PYGDYWRQMRKIC++ELL+ K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  ++   R S +     N+T+++  FTSS+  + AFG+V  E Q +FI
Sbjct  142   VRSFSSIRRDEVHRMIEFFRSSIDQ--QVNVTKRIYQFTSSMTCRSAFGKVFKE-QDEFI  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+  +L  GFD+ D+FPSKK++H  SG K +++ +HH++D I + II + K+     
Sbjct  199   LLVKRNTALMEGFDVADIFPSKKFLHVLSGKKARVMDVHHKIDAILENIINERKKI----  254

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
             +T   G  + ++DVLLR+ + G LQFPIT DNIKA+I D F+ GTETS+ TI WAM EM+
Sbjct  255   ATGEVG-GKGLIDVLLRLMKEGGLQFPITNDNIKAIIFDTFAAGTETSSVTIDWAMVEMM  313

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV+AKAQAEVR+A +G +TFD+ D+E L YLKLVIKE  RLHPP PL+ PRE  EE 
Sbjct  314   KNPSVLAKAQAEVRKAFRGKETFDENDVEELNYLKLVIKEAFRLHPPFPLLLPRECREET  373

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP K +V++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+GRR
Sbjct  374   DINGYTIPLKAKVMVNVWAIGRDPKYWDDVESFKPERFEHNSMDFVGNNFEYLPFGSGRR  433

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
              CPGISF   ++   LA LLYHF+W+LP+G++P +LD+TE+ G   ++K +L LIA P+
Sbjct  434   NCPGISFGLANVYYPLAQLLYHFDWKLPNGINPNELDLTESAGATCARKSNLHLIATPY  492



>ref|XP_009794007.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   511 bits (1317),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 249/479 (52%), Positives = 352/479 (73%), Gaps = 9/479 (2%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLPLIGS+ H++GG  PH  L NL++KYGP+MHLQLGE+  VV++
Sbjct  23    KNSNSQIKRLPPGPWKLPLIGSMFHMLGGH-PHHVLTNLAKKYGPLMHLQLGEMPVVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P++A+ + KTHDL FASRP  +A +IVFY  +D+AF PYGDYWRQMRKICV+ELL+ K 
Sbjct  82    SPEMAKEVLKTHDLAFASRPKFLATEIVFYNCSDIAFCPYGDYWRQMRKICVIELLTAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF + RQ+E+  ++   R S++     N+T+++  FTSS+  + AFG+V  E Q +FI
Sbjct  142   VRSFSAIRQDEVHRMIEFFRSSTDQQI--NVTKRICQFTSSMTCRSAFGKVIKE-QDEFI  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+  +L  GFD+ D+FPS K++H  SG K +++ +HH++D I + II + KE     
Sbjct  199   LLVKRNTALVEGFDVADIFPSLKFLHVLSGKKARVMDVHHKIDAILENIINERKEI----  254

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
             +T   G  + ++DVLLR+ + G LQFPIT DNIKA+I DMF+ GTETS+  I WAM EM+
Sbjct  255   ATGELG-GKGLIDVLLRLMKEGGLQFPITNDNIKAIIFDMFAAGTETSSVAIDWAMVEMM  313

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K P+V+AKAQ EVR+A +G +TFD+ D+E L YLKLVIKET RLHPP PL+ PRE  EE 
Sbjct  314   KNPNVLAKAQTEVRKAFRGKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRECREET  373

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP K +V++N WA+  +P+ W+D E F PERFE++S+DF+GN++E++PFG+GRR
Sbjct  374   DINGYTIPLKAKVMVNVWAIGRDPKYWDDAEIFKPERFEHNSMDFVGNNFEYLPFGSGRR  433

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
              CPGISF   ++   LA LLYHFNW+LP G++P +LD+TE+ G   ++K +L L   P+
Sbjct  434   NCPGISFGLANVYFPLAQLLYHFNWKLPTGINPSELDLTESAGASCARKSNLYLFPTPY  492



>ref|XP_011081964.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=513

 Score =   511 bits (1317),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 257/481 (53%), Positives = 352/481 (73%), Gaps = 15/481 (3%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQL  311
              R +KLPPGPWKLP+IG LHH+  G+LPHR+ + L++KYGP+MH +LGE++AVV+S P L
Sbjct  31    TRSRKLPPGPWKLPVIGHLHHI--GTLPHRSFQELAKKYGPLMHFKLGEVTAVVVSSPTL  88

Query  312   ARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSF  491
             ++ + K HD  FA RP  +A +I++Y S++++FS YGDYWRQMRKIC+LELLS K VKSF
Sbjct  89    SKEVLKVHDPTFADRPENIAGEILWYNSSNISFSQYGDYWRQMRKICILELLSAKNVKSF  148

Query  492   CSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLK  671
              S R +E+S+LV SI  SS  G P +LTEK+   TSS+  + AFG+VC  D+ + I + K
Sbjct  149   GSIRNDEVSHLVDSIGASS--GAPVDLTEKIFMLTSSITCRAAFGKVC-RDKDQLIEMFK  205

Query  672   QVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN--------  827
             + ++L  GFD+ DL+PS K +   S  + KLL++  +LD I D IIG+H+ N        
Sbjct  206   EGITLVSGFDVSDLYPSSKILRAISCNRRKLLRMRRKLDLILDDIIGEHRRNLAKIAADK  265

Query  828   -HLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWA  1004
              +L    N    +ED+VDVLLRV++ GEL+FPIT+DNIKAVI D+F+ GTETS+TT+ W 
Sbjct  266   DNLERRGNGEFGNEDLVDVLLRVQQSGELEFPITDDNIKAVIYDIFAAGTETSSTTVDWI  325

Query  1005  MSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprE  1184
             M+E+I+ P VM K Q E+RQ  KGNKT +D D++NL YLKLVIKE LRLH P+PLI    
Sbjct  326   MAELIRNPHVMGKVQNEIRQTFKGNKTIEDADVQNLKYLKLVIKEGLRLHAPIPLIPRV-  384

Query  1185  SMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPF  1364
             S E+ +I  Y+IP + +V++NAW +  +PE W +PE F PERF+N+S DF GNH+E+IPF
Sbjct  385   SREDTEIAGYLIPARAKVLVNAWGMGRDPEIWSNPESFEPERFDNNSTDFTGNHFEYIPF  444

Query  1365  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             GAGRRMCPG++F   S+ L LA LLY+F+W+LPDG+SP DLDM E   + A+++++L L+
Sbjct  445   GAGRRMCPGMTFGLASVELPLAHLLYNFDWKLPDGMSPNDLDMVERPAITAARRQNLELV  504

Query  1545  A  1547
             A
Sbjct  505   A  505



>ref|XP_007154033.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
 gb|ESW26027.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
Length=511

 Score =   511 bits (1316),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 262/502 (52%), Positives = 353/502 (70%), Gaps = 13/502 (3%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRR-----SNPARRQKLPPGPWKLPLIGSLHHLV-GGSLPH  218
             F P S++VF  F+  ++   R      +  +   KLPPGPWKLP+IG+LH L    +LPH
Sbjct  3     FQP-SLLVFAPFLLLLFWFTRIYKNKITVKSVVHKLPPGPWKLPVIGNLHQLARADTLPH  61

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
              TL++LS KYGP+MHLQLGEISAV++S P +A+ I KTHDL F  RP ++   I+ Y ST
Sbjct  62    HTLQSLSHKYGPLMHLQLGEISAVIVSSPDMAKEIMKTHDLNFVQRPQLLCPKILAYGST  121

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             D+AF+PYG+YWRQMRKIC LELLS K V SF   R+EE++ L+ SI+L +  G   N++E
Sbjct  122   DIAFAPYGEYWRQMRKICTLELLSAKRVHSFSFIREEEVAKLIRSIQLCACAGSQVNVSE  181

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
              V  F S+L+++ AFG+  SE   + + LLK+   LAGGFDL DLFPS K +H+ + MK 
Sbjct  182   NVFSFLSTLVSRTAFGKK-SEKGNELLCLLKKGAELAGGFDLADLFPSLKAVHFLTRMKT  240

Query  759   KLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNI  938
             KL  +H ELDKI + II +H+  H      +   +E++VDVLLRV++   L+ P+T +NI
Sbjct  241   KLENMHKELDKILESIISEHQSKH-----RNGDAEENLVDVLLRVQQSATLEVPLTINNI  295

Query  939   KAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTY  1118
             KAVI D+F  GT+TSAT + W MSE++K P VM KAQ E+R+A +G K   + ++  L+Y
Sbjct  296   KAVIWDIFGAGTDTSATVLEWGMSELLKNPRVMKKAQVEIREAFRGKKRIGESEVYELSY  355

Query  1119  LKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERF  1298
             LKLVIKETLRLHPP+PL+ PRE  +  KIG Y IP KT+VIINAWAL  +P+ W D ++F
Sbjct  356   LKLVIKETLRLHPPVPLLLPRECRDSCKIGGYDIPRKTKVIINAWALGRDPKHWYDAQKF  415

Query  1299  LPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSP  1478
             +PERF+ +  DF GN++E+IPFGAGRR+CPGI     ++ L LA LLYHF+W+LP+G+ P
Sbjct  416   IPERFDGTGFDFKGNNFEYIPFGAGRRICPGILLGLANVELPLAALLYHFDWKLPNGMKP  475

Query  1479  KDLDMTEAVGVIASKKKDLCLI  1544
             +DLDMTEA G    +K +L LI
Sbjct  476   QDLDMTEAFGATVGRKNNLYLI  497



>ref|XP_009624011.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=458

 Score =   508 bits (1307),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 249/455 (55%), Positives = 341/455 (75%), Gaps = 4/455 (1%)
 Frame = +3

Query  192   HLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMA  371
             H+VGG LPHR LR+L++KYGP+MHL+LGE+S VV++ P++A+ + KTHDL FASRP ++A
Sbjct  3     HMVGG-LPHRVLRDLAKKYGPLMHLKLGEVSVVVVTSPEIAKEVLKTHDLAFASRPKLLA  61

Query  372   LDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSE  551
              +IV Y S+D+AF+PYGDYWRQMRKICVLE+L+ K V+SF S R++E+  L+   R SS 
Sbjct  62    AEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVRSFSSIRRDEVFRLIEFFRSSS-  120

Query  552   TGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKW  731
              G P N T+++S FTS +I + AFG V  E Q +FI ++K V +L  G D+ D+FPS K+
Sbjct  121   -GKPVNFTKRISLFTSFIICRSAFGTVFKE-QDEFIQVMKNVTALLEGLDVADIFPSLKF  178

Query  732   IHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGEL  911
             +H  +G + K++ LHH++D I D +I +HK+N      N     ED++DVLLR+ + G+L
Sbjct  179   LHVLTGKRAKVMNLHHKVDSIVDNVINEHKKNLATGKFNGQLGGEDLIDVLLRLMKDGDL  238

Query  912   QFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFD  1091
             QFPIT DNIKA+I DMF+ GTET++TTI WAM E+I+  SV AKAQAEVR+  +  +TFD
Sbjct  239   QFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVELIRNASVFAKAQAEVREVFRRIETFD  298

Query  1092  DKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNP  1271
             + D+E L YLKLVIKETLRLHPPLPL+ PRE  EE  I  + IP K++V++N WA+  +P
Sbjct  299   ENDVEELKYLKLVIKETLRLHPPLPLMLPRECREETNINGFTIPLKSKVMVNVWAIGRDP  358

Query  1272  ESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFN  1451
             + W+D E F PERFE SSVDF GN++E++PFG+GRR+CPGI F   +I L LA LLY+F+
Sbjct  359   KYWDDAENFKPERFEQSSVDFTGNNFEYLPFGSGRRICPGILFGLANIYLPLAQLLYYFD  418

Query  1452  WELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             W+LP G++P DLD+TE+ G   ++K +L LIA P+
Sbjct  419   WKLPTGINPSDLDLTESDGASCARKSNLYLIASPY  453



>ref|XP_010644547.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   509 bits (1312),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 265/506 (52%), Positives = 359/506 (71%), Gaps = 12/506 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQ----KLPPGPWKLPLIGSLHHLVGG  206
             ME +F F P+      +F+  IY L+R   P+R       LPPGPWKLP+IG++H LVG 
Sbjct  1     MELQFSFFPI----LCTFLLFIYLLKRLGKPSRTTHPAPNLPPGPWKLPIIGNMHQLVG-  55

Query  207   SLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVF  386
             SLPH +LRNL++K+GP+MHLQLGE+SA+V+S  ++A+ + KTHD++F+ RP I+A  IV 
Sbjct  56    SLPHHSLRNLAKKHGPLMHLQLGEVSAIVVSSREMAKEVMKTHDIIFSQRPCILAASIVS  115

Query  387   YKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPT  566
             Y  TD+AF+PYGDYWRQ+RKI +LELLS K V+SF S R+EE+ NLV SI  SS+ G   
Sbjct  116   YDCTDIAFAPYGDYWRQIRKISILELLSAKRVQSFRSVREEEVLNLVRSI--SSQEGVSI  173

Query  567   NLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTS  746
             NLTE +   T S+I++ AFG+ C +DQ  F   L++     GGF + D+FPS K +H  S
Sbjct  174   NLTESIFSLTFSIISRAAFGKKC-KDQEAFSVTLEKFAGSGGGFTIADVFPSIKLLHVVS  232

Query  747   GMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPIT  926
             G++ KL K+H +LD I + II +HK    A+  + +  DED+VDVLL+V++ G+L+FP+T
Sbjct  233   GIRHKLEKIHKKLDTILENIINEHKARSEASEISEAEVDEDLVDVLLKVQKQGDLEFPLT  292

Query  927   EDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLE  1106
              DNIKA++ D+F  G+ETS+T + WAM+EM+K P VMAKAQAEVR         D+  + 
Sbjct  293   TDNIKAILLDLFIAGSETSSTAVEWAMAEMLKNPGVMAKAQAEVRDIFSRKGNADETMIH  352

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              L +LKLVIKETLRLHPP+PL+ PRES E  +I  Y IP KTRVIINAWA+A +PE W D
Sbjct  353   ELKFLKLVIKETLRLHPPVPLLIPRESRESCEINGYEIPVKTRVIINAWAVARDPEHWND  412

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
              E F PERF +SS+D+ G ++E+IPFGAGRRMCPGI F   ++ ++LA LLY+F+W+LP+
Sbjct  413   AESFNPERFLDSSIDYQGTNFEYIPFGAGRRMCPGILFGMANVEIALAQLLYYFDWKLPN  472

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLI  1544
             G   ++LDMTE       +K +L LI
Sbjct  473   GTQHEELDMTEDFRTSLRRKLNLHLI  498



>gb|AAD47832.1| cytochrome P450 [Nicotiana tabacum]
Length=499

 Score =   508 bits (1309),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 254/479 (53%), Positives = 356/479 (74%), Gaps = 7/479 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLP++GS+ H++GG LPH  LR+L++KYGPIMHLQLGE+S VVIS
Sbjct  23    KNSNSQTKRLPPGPWKLPILGSMLHMLGG-LPHHVLRDLAKKYGPIMHLQLGEVSLVVIS  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P +A+ + KTHDL FA+RP ++A  I  Y   D+A SPYG+YWRQMRKIC+LELLS K 
Sbjct  82    SPGMAKEVLKTHDLAFANRPLLVAAKIFSYNCMDIALSPYGNYWRQMRKICLLELLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF S RQ+E+  ++   R  S  G P N+T+++S FT+S+  + AFG+   E Q +F+
Sbjct  142   VKSFNSIRQDEVHRMIKFFR--SSPGKPVNVTKRISLFTNSMTCRSAFGQEYKE-QDEFV  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L+K+V +L  GFD+ D+FPS K++H  +GMK K++  H+ELD I + II +HK+    +
Sbjct  199   QLVKKVSNLIEGFDVADIFPSLKFLHVLTGMKAKVMNTHNELDAILENIINEHKK---TS  255

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              ++     E I+ VLLR+ + G LQFPIT DNIKA+I+D+F  GTETS+TTI WAM EM+
Sbjct  256   KSDGESGGEGIIGVLLRLMKEGGLQFPITNDNIKAIISDIFGGGTETSSTTINWAMVEMM  315

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV +KAQAEVR+ L+G +TF + D+E   YLK+VIKET RLHPPLPL+ PRE  EE 
Sbjct  316   KNPSVFSKAQAEVREILRGKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEI  375

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              +  Y IP KT+V++NAWA+  +P+ W+D E F PERFE++S+D++GN+YE++PFG+GRR
Sbjct  376   DLNGYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERFEHNSMDYIGNNYEYLPFGSGRR  435

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPGISF   ++   LA LL HF+W+LP G++P++ D+TEA G   ++K DL LIA  +
Sbjct  436   ICPGISFGLANVYFPLAQLLNHFDWKLPTGINPRNCDLTEAAGAACARKNDLHLIATAY  494



>ref|XP_009617877.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   508 bits (1308),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 253/478 (53%), Positives = 351/478 (73%), Gaps = 10/478 (2%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAIT  326
             LPPGPWKLPL+GS+HHL+   LPH TLR+L++K+GP+MHLQLGEIS +VIS PQ A+ + 
Sbjct  36    LPPGPWKLPLLGSIHHLIS-ILPHHTLRDLAKKHGPLMHLQLGEISTIVISTPQAAKEVL  94

Query  327   KTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  506
             K  D+ F +RP ++++ I+ Y  +D+AF+PYG+YWRQMRK+C LELLS K V+SF S R+
Sbjct  95    KVQDIAFTNRPELLSVKILCYNYSDIAFAPYGNYWRQMRKLCTLELLSAKNVQSFASIRE  154

Query  507   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  686
             EE  +LV  ++  S++G   NLTEK+   T+++I + AFG+   E+   F++L+K+V  +
Sbjct  155   EEAFDLVEYVK--SKSGSTINLTEKLYALTNAVICRAAFGKRRKEESAYFMSLIKEVSLM  212

Query  687   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  866
               G D+ ++FPS K++H  +G K KL+KLH +LDK+ D+II +HKEN    S   +G++E
Sbjct  213   VTGLDISEVFPSLKFLHAITGTKAKLVKLHKKLDKVLDMIIEEHKENLQLVSLKKNGEEE  272

Query  867   -----DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1031
                  D+V++LLR++E G L+FP T DNIKAVI+DMF  GTETSAT + WAM EM++ P 
Sbjct  273   SIRKEDLVNLLLRLQESGTLEFPFTADNIKAVISDMFVAGTETSATVLDWAMVEMMRNPK  332

Query  1032  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1211
             VM KAQ E+RQ LKG +   + DL+ + YLKLVIKETLRLHPPLPL+ PRE  E+  I  
Sbjct  333   VMEKAQIELRQILKGKRRVKENDLKEVRYLKLVIKETLRLHPPLPLLLPRECREQCAING  392

Query  1212  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENS--SVDFMGNHYEFIPFGAGRRMC  1385
             Y IP KT+VI+NAWA+  + E WED ERF+PERF +S  +++F+G  +E++PFG GRRMC
Sbjct  393   YDIPIKTKVIVNAWAINRDVEFWEDAERFVPERFNDSRNNMEFIGQEFEYLPFGGGRRMC  452

Query  1386  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
             PGISF   +I L+LA LLY+FNW+LP+ + P+DLD+TE  G    +K +L +IA P +
Sbjct  453   PGISFGLANIELTLAQLLYYFNWKLPNEMKPEDLDVTETPGSSCRRKCNLYVIATPVI  510



>ref|XP_009357363.1| PREDICTED: premnaspirodiene oxygenase-like [Pyrus x bretschneideri]
Length=506

 Score =   508 bits (1307),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 257/497 (52%), Positives = 354/497 (71%), Gaps = 10/497 (2%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
             V+ FL F+  I  + +R+    +  LPPGPWKLP IG+LH LVG S+PH  LR+L++ YG
Sbjct  11    VVTFLLFLIMILKIGKRA----KINLPPGPWKLPFIGNLHQLVG-SIPHHGLRDLAKNYG  65

Query  252   PIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYW  431
             P+MHL+LGE+S +V+S  + A+ + KTHD++FASRP+I+A  I+ Y  T++ F+PYGDYW
Sbjct  66    PLMHLKLGEVSTIVVSSAEFAKEVMKTHDVIFASRPHILANSILTYGDTNIGFAPYGDYW  125

Query  432   RQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIA  611
             RQ+RKIC LELLSMK V+SF S R+EE+ NL++ IRL +ET  P N+TE++  FT    +
Sbjct  126   RQLRKICTLELLSMKRVQSFRSLREEEVLNLINLIRLRAET--PINITEQIYSFTYGFTS  183

Query  612   KVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDK  791
             + AFG + S+DQ KFI ++KQ + +AGGFD+ D+FPS   +H  SGM+PKL +LH E D+
Sbjct  184   RAAFG-IKSKDQDKFIDIVKQAMKVAGGFDVADIFPSVSLLHLISGMRPKLERLHKEADR  242

Query  792   IFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRV-KEGGELQFPITEDNIKAVINDMFST  968
             I + II +HK++   + ++     ED++DVLL+  +E   L+F +T DN+KA+I + F  
Sbjct  243   IMENIIKEHKKDMATSESHDIEAREDLIDVLLKFHEEESGLEFSLTADNVKAIILETFGA  302

Query  969   GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1148
             G ET+ATT+ WA+SEMIK P +M KAQAEVR+        D+  ++ + +L LVIKETLR
Sbjct  303   GGETAATTVNWAISEMIKNPRIMQKAQAEVREVFNTKGQVDETGIKEMIFLNLVIKETLR  362

Query  1149  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSV  1328
             LHPP PL+ PR   E  KIG Y IP KT+V+INAWA+  +P  W +PE F PERF +SS+
Sbjct  363   LHPPFPLLLPRXCRESCKIGGYEIPVKTKVVINAWAIGRDPNYWTNPESFYPERFLDSSI  422

Query  1329  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS-PKDLDMTEAV  1505
             D  G ++EFIPFGAGRRMCPG+SF   S+   LA LLYHF+W+L +G+   +DLDMTEA 
Sbjct  423   DLKGKNFEFIPFGAGRRMCPGMSFGLASVEFPLASLLYHFDWKLSNGMKHDEDLDMTEAF  482

Query  1506  GVIASKKKDLCLIARPF  1556
             GV   +K+DL LI  P+
Sbjct  483   GVSVRRKQDLHLIPIPY  499



>gb|KDP39257.1| hypothetical protein JCGZ_01014 [Jatropha curcas]
Length=485

 Score =   507 bits (1305),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 252/482 (52%), Positives = 341/482 (71%), Gaps = 4/482 (1%)
 Frame = +3

Query  114   RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             R+       + LPPGP KLP+IG++H L+G SLPH  LR+L++K+G IMHLQLGE+S +V
Sbjct  3     RKSKTKEATKNLPPGPRKLPIIGNIHQLIG-SLPHHCLRDLAKKHGGIMHLQLGEVSNIV  61

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
             IS P+ A+ + KTHD+VFA RP ++A  I+ Y  TD+AFSPY DYWRQ+RKIC+LELLS 
Sbjct  62    ISSPEAAKEVMKTHDIVFAQRPFLLAASIISYNFTDIAFSPYADYWRQLRKICILELLSA  121

Query  474   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  653
             K V+SF   R+EE+SNL+++I  SS +G   N + K+   T  + A+  FG  C EDQ +
Sbjct  122   KRVQSFRFIREEEVSNLITAI--SSSSGKAFNFSRKLFSLTYGIAARATFGEKC-EDQEE  178

Query  654   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  833
             FI +++++  +AGGF L DLFPS K++H  SGM+ +L++L  E D++   II DH+  + 
Sbjct  179   FIPIVEEITEVAGGFSLADLFPSVKFLHSISGMRSRLIRLQKEADRVIGNIIDDHRAKNK  238

Query  834   ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1013
                    G+D+D+VDVLLR++E G L+FP+T DNIKAVI D+F  G+ETS+TT+ WAMSE
Sbjct  239   TGKVGGEGQDDDLVDVLLRLQEHGNLEFPLTTDNIKAVILDIFVAGSETSSTTVEWAMSE  298

Query  1014  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1193
             M++ P VM KAQ EVR+        ++ DL+   YLKLVIKETLRLHPP PL+ PRES E
Sbjct  299   MLRNPRVMYKAQEEVRKLFDKKGNVEETDLQESKYLKLVIKETLRLHPPAPLLLPRESTE  358

Query  1194  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1373
             + +I  Y IP K++VI+NAWA+  +P  W + E F PERF +SS+D+ GN++EFIPFGAG
Sbjct  359   KCEINGYDIPEKSKVIVNAWAIGRDPNHWTEAETFYPERFLDSSIDYKGNNFEFIPFGAG  418

Query  1374  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             RRMCPGI F   ++ L LA LLYHF+WELP G+  + LDM E+ G    +K DL LI  P
Sbjct  419   RRMCPGILFGIANVELPLAQLLYHFDWELPSGLKAETLDMIESFGATVRRKNDLHLIPNP  478

Query  1554  FV  1559
             + 
Sbjct  479   YT  480



>ref|XP_007020549.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY12074.1| Cytochrome P450 [Theobroma cacao]
Length=504

 Score =   506 bits (1304),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 253/507 (50%), Positives = 351/507 (69%), Gaps = 8/507 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
             M+H F   P   ++F S +F    L+          LPPGPWKLP+IG++H L  GSLPH
Sbjct  1     MDHPFFSFP---MLFTSIIFLFMLLKLGKRFRTNNLLPPGPWKLPVIGNMHQL-AGSLPH  56

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
              +L +L++KYGP+MHLQLGE+S +++S P+ A  + KTHD++FA+RP ++  +IV Y +T
Sbjct  57    HSLSDLAKKYGPLMHLQLGEVSNIIVSSPETAAEVMKTHDILFANRPYLLCANIVSYNAT  116

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             D+AFSPYG YWRQ+RKIC LE+L+ K V+SF   R+EE+S LV +I  SS+ G P NL++
Sbjct  117   DIAFSPYGAYWRQLRKICTLEMLTSKRVQSFSPIREEEVSKLVRAI--SSKAGSPVNLSK  174

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
              +   T  ++++ AFG  C +D+G+F  L ++ + L  GF + DLFPS K + + +G++P
Sbjct  175   MLYSLTYEIVSRTAFGGKC-KDKGEFTLLFREAIKLGAGFTVSDLFPSVKLLQFLNGLRP  233

Query  759   KLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNI  938
             KL +LH ++DKI + +I +HK +    + +  G+ +D+VDVLL ++E G L+FP+T DNI
Sbjct  234   KLERLHQKVDKILENVINEHKASK-GMAKSGEGESDDLVDVLLTLQEHGNLEFPLTTDNI  292

Query  939   KAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTY  1118
             KAV+ D+F  G++TS T + WAMSEM+K P V+ KAQAEVRQ        D + L  L Y
Sbjct  293   KAVLLDIFIAGSDTSFTAVEWAMSEMLKNPRVLQKAQAEVRQVFNRKGDVDGEGLHELEY  352

Query  1119  LKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERF  1298
             LKLVI ETLRLHPP+PL+ PRE  E  KI  Y IP K++VIINAWA+  NP+ W + ERF
Sbjct  353   LKLVINETLRLHPPIPLLLPRECSERCKINGYDIPVKSKVIINAWAIGRNPDYWTEAERF  412

Query  1299  LPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSP  1478
              PERF NSS+D+ G H+EFIPFGAGRRMCPG+ +   ++ L LA LLYHF+WELP G   
Sbjct  413   YPERFLNSSIDYKGAHFEFIPFGAGRRMCPGMLYGIANVELPLAQLLYHFDWELPGGRKI  472

Query  1479  KDLDMTEAVGVIASKKKDLCLIARPFV  1559
             +DLDM E  G +  +K DLCL+  P+ 
Sbjct  473   EDLDMDEVFGAVVRRKNDLCLVPIPYC  499



>ref|XP_011081934.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=501

 Score =   506 bits (1302),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 262/503 (52%), Positives = 359/503 (71%), Gaps = 11/503 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFC-IYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
             ME +   +  ++++F SF+F  I    +  +P + +KLPP P +LP+IG LHHLVGG LP
Sbjct  1     MEIQLPVSFTTLLLFSSFIFLLIRAWMKPKSPRKYEKLPPSPPQLPVIGHLHHLVGG-LP  59

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H  LR +++KYGP+++L+LGE+SAVVIS  +  + + K  D   A RP  +   I++Y  
Sbjct  60    HHALRRVAQKYGPVLYLKLGEVSAVVISSREATKEVVKVQDPACADRPESIGSKIMWYDY  119

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             TD+AFS Y +YWRQMRKIC+LELLS K VKSF S RQ+E+S L+ S  L S +G   NLT
Sbjct  120   TDIAFSAYNEYWRQMRKICILELLSAKNVKSFGSIRQDEVSRLMKS--LQSSSGQAINLT  177

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             EKV  FTSS+  + AFG+V   D+   IA+LK+ +++AGGF+L DLFPS K +H  S  K
Sbjct  178   EKVFAFTSSITCRAAFGKVM-RDRDVLIAMLKKAVTMAGGFELADLFPSSKLLHVLSWNK  236

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDN  935
              KLL++  +LD I D I+ +HK   L  S    G  EDIVDVLLR+++ GELQFPIT DN
Sbjct  237   YKLLRMRRKLDTILDAILEEHK---LKQSGEFGG--EDIVDVLLRMQKTGELQFPITNDN  291

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             +KAVI DMFS GTETS+TTI WAM+E+++ P VMAK QAEVR+A KG  T ++ D++ L 
Sbjct  292   VKAVIFDMFSAGTETSSTTIDWAMAELMRNPRVMAKVQAEVREAFKGKTTVEESDVQALK  351

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             YLKLVIKET RLHPP+PL+      +E K+  Y IP K++V+IN WA+  +P  W+ P+ 
Sbjct  352   YLKLVIKETFRLHPPIPLLPRA-CRDECKVNGYTIPLKSKVMINIWAMGRDPAYWDQPDT  410

Query  1296  FLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS  1475
             F PERF+N+S+DF+GN++E+IPFGAGRR+CPG++F   ++ L LA LLYHF+W++P G++
Sbjct  411   FQPERFDNNSIDFLGNNFEYIPFGAGRRICPGMNFGLANVELPLAQLLYHFDWKMPKGMT  470

Query  1476  PKDLDMTEAVGVIASKKKDLCLI  1544
             P D+DMTEA G+  S++  L L+
Sbjct  471   PDDIDMTEAEGIAVSRRNALLLV  493



>ref|XP_004231934.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   506 bits (1302),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 260/508 (51%), Positives = 362/508 (71%), Gaps = 9/508 (2%)
 Frame = +3

Query  36    EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
             E++H    N   +I FL FV     L ++S    + KLPPGP KLP IG+LH L   SLP
Sbjct  2     EIQHS---NFAMLIAFLLFVAIALKLWKKSK--IQYKLPPGPRKLPFIGNLHQL-SSSLP  55

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H T +NLS KYGP+MHLQLGE+SAV++S PQ+A+ + KTHDL+FA+RP ++++ I+   S
Sbjct  56    HHTFKNLSNKYGPMMHLQLGEVSAVIVSSPQVAKEVLKTHDLIFANRPQLLSVQILSNNS  115

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
               ++FSPYG  WRQ+RK+CVLELLS K V+SF S R+EE+ NL+ +I L  +   P +++
Sbjct  116   PTLSFSPYGANWRQLRKVCVLELLSAKRVQSFESIREEEVDNLIEAISLI-QPQVPIDIS  174

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             E +   T+++ A+ AFG+ C + + +FI  +K +  L+GGFD+ DLFPS K  H  SG+K
Sbjct  175   EMIFSMTNNITARAAFGKKC-KHKDEFIKAMKTITELSGGFDIPDLFPSLKIFHSLSGVK  233

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDN  935
             P L K+H ++DKIF+ II +HKEN    S+N   K ED+VDVLLRV+E G+L+ PI+ + 
Sbjct  234   PALEKVHQKVDKIFEDIIQEHKENKRDMSSNMLYK-EDLVDVLLRVQESGDLEIPISRNT  292

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             +K+VI +MF  GT+TS+T + WA+SEM+K P VM KAQAEVR+  KG     + +++ L 
Sbjct  293   LKSVILEMFIGGTDTSSTVLEWAISEMMKNPQVMEKAQAEVREVFKGKSKITESEIQKLD  352

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             Y+K+VIKETLR+HPPLPL+ PRE++E+ +IG Y IP KT+VIINAWA+  +P+ WE+ E 
Sbjct  353   YIKMVIKETLRMHPPLPLLLPREAIEKCEIGGYDIPAKTKVIINAWAIGRHPQHWENAEC  412

Query  1296  FLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS  1475
             F PERF++  +DF+G + E+IPFG GRRMCPG  F   ++ L LA LL+HF+WELPDG+ 
Sbjct  413   FEPERFQDLDLDFVGTNLEYIPFGGGRRMCPGSLFGIANVELPLAKLLFHFDWELPDGIE  472

Query  1476  PKDLDMTEAVGVIASKKKDLCLIARPFV  1559
               DLDMTE  G    +K DL L+A+P +
Sbjct  473   ASDLDMTETFGATVGRKNDLYLVAKPHI  500



>emb|CDP07881.1| unnamed protein product [Coffea canephora]
Length=844

 Score =   517 bits (1332),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 264/475 (56%), Positives = 347/475 (73%), Gaps = 5/475 (1%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             +LPP PWKLPLIG++H L+G S P   LR L++K+G +MHLQLGEIS++VIS P+LA  +
Sbjct  371   ELPPSPWKLPLIGNMHRLIG-SPPQHALRRLAQKHGSLMHLQLGEISSIVISSPRLAEEV  429

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              K HDL FASR  I+   I  Y  +DV  SPYG+YWRQMRKIC LELLS K V+SF S R
Sbjct  430   MKNHDLAFASRAEILVTKIGRYNCSDVVSSPYGEYWRQMRKICTLELLSAKRVRSFGSVR  489

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             ++E  +L+SSI+    TG   NL+E VS +TSS++ + AFG+V  +DQ  F+ L+K+ L 
Sbjct  490   KDEAFHLISSIKALVGTGEQINLSELVSLYTSSVLCRAAFGKVSKDDQNAFLQLIKESLL  549

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  860
             L+  FD  DLFPS K +H    +K K++ +HH +D + D II  H ++       +SG+ 
Sbjct  550   LSSAFDFSDLFPSLKILHPLLSVKSKMVHVHHMIDMMLDGIIDQHIDDQ-GRPKLASGES  608

Query  861   -DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
               ED++DVLLRVK+G  LQ PIT+DNIKAV+ DMF+ GTETS+TT+ WAM+EMI+ P VM
Sbjct  609   YQEDLIDVLLRVKDGDNLQVPITKDNIKAVLIDMFAGGTETSSTTVEWAMAEMIRSPDVM  668

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
             AKAQ E+R+ALKG K  ++ D++   YLKLVIKETLRLHPPLPL+ PRE  EE ++  Y+
Sbjct  669   AKAQNEIRKALKGKKAVEETDIQQARYLKLVIKETLRLHPPLPLLVPRECREECELHGYV  728

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             IP KTRV+INAWA+  +PE W+D + F PERFENS+ DF G H+E++PFGAGRRMCPGIS
Sbjct  729   IPVKTRVMINAWAIGRDPEYWDDADGFKPERFENSAADFSGTHFEYLPFGAGRRMCPGIS  788

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVD  1562
             F   ++ L LA LLYHF+W+LP+ ++  DLDMTE +G+ AS+K +L L AR F D
Sbjct  789   FGLANVELPLALLLYHFDWQLPNDLNSNDLDMTETIGITASRKNNLWLQAR-FAD  842


 Score =   326 bits (835),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 254/380 (67%), Gaps = 15/380 (4%)
 Frame = +3

Query  192   HLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMA  371
             H + GS PH  LR L++K+GP+MHLQLGEIS +V+S P+LA+ I KTHDL FA+R   +A
Sbjct  2     HQLTGSRPHYALRKLAQKHGPLMHLQLGEISTIVVSSPRLAKEIMKTHDLDFANRAEFLA  61

Query  372   LDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSE  551
               IV Y  +D+  +PYG+YWRQMRKIC LELLS K V+SF   R +E  +L+SSI+  + 
Sbjct  62    CKIVCYNCSDIVCAPYGEYWRQMRKICTLELLSTKNVRSFGCIRLDEAKHLISSIQAHAA  121

Query  552   TGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKW  731
              G   NLT+ +S +TSS++   AF +V    Q  F+ LL  V  L     + DLFPS + 
Sbjct  122   AGELINLTDHLSTYTSSMVLTAAFRKVSKVHQMTFLRLLNMVRRLGRAVTVSDLFPSYRI  181

Query  732   IHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKEGG  905
             +H  S +KPKL+K+H  +DKIFD II +H EN L  +    G+  +ED+VDVLLRVKE G
Sbjct  182   LHPLSRVKPKLMKVHQRIDKIFDTIIAEHVEN-LKRTKRGMGESGNEDLVDVLLRVKESG  240

Query  906   ELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKT  1085
             +L FP+T +NIKAV+ D+F+ GTETS+TT+ WAMSEMI+ P+VMA AQ E+R+A  G KT
Sbjct  241   DLTFPVTNNNIKAVLTDIFTGGTETSSTTVEWAMSEMIRNPNVMATAQNEIRKAFMGMKT  300

Query  1086  FDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRV---------  1238
              ++ D+E L YLKLVIKETLRLHPP+PL+ PR   E+ +I  YI+P   R+         
Sbjct  301   IEETDVEKLPYLKLVIKETLRLHPPIPLLVPRGCREQCEIDGYIVPQLIRLANELFNIQL  360

Query  1239  ---IINAWALATNPESWEDP  1289
                II   +L   P  W+ P
Sbjct  361   KIGIILETSLELPPSPWKLP  380



>gb|EYU21978.1| hypothetical protein MIMGU_mgv1a004623mg [Erythranthe guttata]
Length=517

 Score =   506 bits (1302),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 258/517 (50%), Positives = 357/517 (69%), Gaps = 17/517 (3%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
             ME +F F   + I+ LSF+F       R +     KLPP PWKLPLIG LHH+  G LPH
Sbjct  1     MEIQFPFTFTNAILLLSFIFFFIYKGYRKSRNTTAKLPPSPWKLPLIGHLHHI--GKLPH  58

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
             R+ + LS K+GP+MH+ LGE++A+V+S P LA+ + K HD  FA RP  +A +I++Y S+
Sbjct  59    RSFQKLSEKHGPLMHVMLGEVTAIVVSSPALAKQVLKAHDPTFADRPVTIAGEILWYNSS  118

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             +++FS YGDYWRQMRKIC+LELLS K VKSF S R +E+S L+ SI++SS T    +LTE
Sbjct  119   NISFSQYGDYWRQMRKICILELLSAKNVKSFSSIRNDEVSQLIESIKISSST---VDLTE  175

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
             K+   TSS+  + AFG+VC +D+ + I + K+ ++L  GFD+ DL+PS K +   S  + 
Sbjct  176   KIFGMTSSITCRAAFGKVC-KDKDQLIGMFKEGITLVSGFDVSDLYPSSKMLKALSCNRM  234

Query  759   KLLKLHHELDKIFDIIIGDHKENH----LANSTNSSGK------DEDIVDVLLRVKEGGE  908
             +L+K+  +LD I D +I +H+ N      A+  NS  +      +ED+VDVLLRVKE GE
Sbjct  235   RLMKMRLKLDLILDDVIDEHRRNLEKIVFADEENSERRGNGEFGNEDLVDVLLRVKESGE  294

Query  909   LQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTF  1088
             L+FPI++DNIKAVI D+F+ GTETS+TTI W M+E+I+ P VM+K Q E+R+  K N  F
Sbjct  295   LEFPISDDNIKAVIYDIFAAGTETSSTTIDWIMAELIRNPRVMSKLQTEIRETFKDNPNF  354

Query  1089  DDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATN  1268
              + D++ L YLKLVIKE  RLH P+PLI    S  + +I  Y+IP   +V++NAWA+  +
Sbjct  355   GESDVQKLKYLKLVIKEGFRLHAPIPLIPRV-SRADTEIEGYVIPIGAKVLVNAWAMGRD  413

Query  1269  PESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHF  1448
             P  W DPERF PERFEN   DF GN +E+IPFGAGRRMCPG++F   S+ L LA LLY F
Sbjct  414   PGLWSDPERFEPERFENDPRDFTGNDFEYIPFGAGRRMCPGMTFGLASVELPLAHLLYSF  473

Query  1449  NWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
             +W+LP G+S  DLDMTE   + A+++++L L+A P++
Sbjct  474   DWKLPAGMSSGDLDMTERPAITAARRQNLELVATPYI  510



>ref|XP_004228509.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=495

 Score =   504 bits (1299),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 255/478 (53%), Positives = 343/478 (72%), Gaps = 11/478 (2%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWKLPLIGS+ HL+GG LPH   R+L++KYGPIMHLQLGE+S VV++
Sbjct  23    KNSNSKSKRLPPGPWKLPLIGSMFHLLGG-LPHHVFRDLAKKYGPIMHLQLGEVSLVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
                +A+ + KTHDL FA RP ++  +I+FYK TD+ FSPYGDYWRQMRKIC+LE LS K 
Sbjct  82    SADMAKQVLKTHDLAFAFRPKLLVGEILFYKGTDIVFSPYGDYWRQMRKICLLEFLSAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VKSF S RQ+E+ +++   R SS  G   N+T+++  F+SS+  +  FG+V  E Q K +
Sbjct  142   VKSFNSIRQDEVHHMIEFFRSSS--GETINVTKRIYQFSSSMTCRSVFGKVFKE-QNKLM  198

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
              L K+      GFD+ D+FPS K++H   GMK K++  HHELD I + II +HK N    
Sbjct  199   ELAKEASRFLKGFDVADIFPSLKFLHVLCGMKGKIMDAHHELDAILENIINEHKNN----  254

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
                  G +  +V +L  +KEGG LQFPIT DNIKA+I DMF+ GT+TS+T I WAM EM+
Sbjct  255   --GELGGEGLLVALLSLMKEGG-LQFPITNDNIKAIIFDMFAGGTDTSSTLIDWAMVEMM  311

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K PSV+ KAQ E+R A  G +TF++ D+E L YLKLV+KET RLHPP PL+  RE  EE 
Sbjct  312   KNPSVLLKAQDEIRNAFTGKETFNENDVEELKYLKLVVKETFRLHPPAPLLVARECREEV  371

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++NA+A+  +P+ W D E F PERFE  SVDF+GN++EF+PFG+GRR
Sbjct  372   DIDGYNIPLKTKVLVNAYAIGRDPKYWIDAECFKPERFEQISVDFIGNNFEFLPFGSGRR  431

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             +CPGISF   +I   LA LLYHF+W+LP G++P DLD+TE+ G+  ++K +L LIA P
Sbjct  432   ICPGISFGLANIFFPLAKLLYHFDWKLPIGINPSDLDLTESAGIACARKSNLYLIATP  489



>ref|XP_004511998.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   505 bits (1300),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 269/511 (53%), Positives = 353/511 (69%), Gaps = 11/511 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARR-QKLPPGPWKLPLIGSLHHL-VGGSL  212
             ME  F F    VI F+  +F ++ L +   P     KLPPGP KLPLIG+LH L +   L
Sbjct  1     MEAPFSF---YVIPFI-LLFLLHRLAKYYKPKTSLNKLPPGPRKLPLIGNLHQLAMSKKL  56

Query  213   PHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYK  392
             PH  L+ LS KYGP+MHLQLGEIS V++S P+LA+ + KTHD+ FA+RP +++ +I+ Y 
Sbjct  57    PHYALKELSHKYGPLMHLQLGEISTVIVSSPKLAKEVMKTHDVAFANRPKLLSPEIMAYG  116

Query  393   STDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNL  572
             S D+ FSPYGDYWRQMRKICVLELL+ K V+SF   R++E +  + SI+ S +T    NL
Sbjct  117   SKDIVFSPYGDYWRQMRKICVLELLNAKRVQSFSYIREDETNKFIKSIQSSIDTTI--NL  174

Query  573   TEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGM  752
             T ++    SS I++ AFG   S+DQ +F+ L+++V+ L+GGFD+ DLFPS K++H  +GM
Sbjct  175   TSRILSMVSSTISRAAFGD-KSKDQDEFVDLVRKVVELSGGFDVDDLFPSMKFLHVITGM  233

Query  753   KPKLLKLHHELDKIFDIIIGDHKENH--LANSTNSSGKDEDIVDVLLRVKEGGELQFPIT  926
             +PKL K+H   D I   I+  H+EN        N   ++ED+VDVLLRV++ G L   IT
Sbjct  234   RPKLEKIHKRADTIMGNIVRQHEENRGRPKEDNNIDVQNEDLVDVLLRVQQSGSLDVQIT  293

Query  927   EDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLE  1106
              +NIKAVI D+F  GT+T+AT I W MSE++K PSV  KAQAE+R+ L+G +   + DL 
Sbjct  294   TNNIKAVIWDVFVAGTDTTATIIEWTMSELMKNPSVREKAQAELRKVLRGKEKISEIDLH  353

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              LTYL LVIKET+RLHPP PL+ PRE  E   IG Y IP  T+V+INAWALA +PE W D
Sbjct  354   ELTYLNLVIKETMRLHPPSPLLVPRECSESTIIGGYEIPKNTKVMINAWALARDPEYWSD  413

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
              ERF+PERF+ S +DF GN++E+IPFGAGRRMCPG+SF   SI L LA LLYHFNWELP+
Sbjct  414   AERFIPERFDGSFIDFKGNNFEYIPFGAGRRMCPGMSFGLASIMLPLALLLYHFNWELPN  473

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
              + P D DM E  G+   +K +L LI   +V
Sbjct  474   HMKPHDFDMIEHFGLAVGRKNELSLIPTNYV  504



>gb|KDP26294.1| hypothetical protein JCGZ_22279 [Jatropha curcas]
Length=528

 Score =   505 bits (1301),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 255/473 (54%), Positives = 346/473 (73%), Gaps = 7/473 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARA  320
             +KLPPGP KLP IG+LH+L GGSLPH  L++L+ +YGP+MHLQLGE+ A+VIS  ++A+ 
Sbjct  45    KKLPPGPKKLPFIGNLHNL-GGSLPHHVLKDLANQYGPLMHLQLGEVPAIVISSSKMAQE  103

Query  321   ITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  500
             + +T D VFA RP ++A  I+ Y STD+ F+  G+YW+QMRK C  ELL  K VKS    
Sbjct  104   VLRTQDHVFAQRPELLASKILSYDSTDLVFA-KGEYWKQMRKFCFNELLGAKKVKSLAPL  162

Query  501   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  680
             R++E+SNL+ SIR  S  G P NLTEK+ W TS +  + AFG    EDQ   I++ ++ L
Sbjct  163   REDEVSNLLESIR--SAGGSPVNLTEKIFWMTSVIAVRAAFGNKW-EDQKTIISIARESL  219

Query  681   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK  860
             SLAGGFDL DL+P ++++H  + MKP+L K+  +LD + D I+ +HKE  L+  T     
Sbjct  220   SLAGGFDLADLYPEREFLHIITNMKPRLEKMRVKLDGVLDRIVNEHKEKLLSGQTQPD--  277

Query  861   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1040
             +E +VDVLLR +E G L+ P+T DN+KAVI DMF  GT+TS+TT  WA+SEMI+ P VM 
Sbjct  278   NEVLVDVLLRFQETGNLRCPVTIDNVKAVIWDMFVAGTDTSSTTTEWALSEMIRNPKVMK  337

Query  1041  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1220
             KAQ EVRQA KG  T D++D+++L YLK VIKETLRLHPP+PL+ PRES ++++I  Y I
Sbjct  338   KAQEEVRQAAKGKTTIDEEDIQDLPYLKQVIKETLRLHPPVPLLLPRESNQDSEIEGYYI  397

Query  1221  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1400
             P +T+VI+NAWA+  +P  WEDPE F+PERF +SS+DF GN++ +IPFGAGRR+CPG++F
Sbjct  398   PERTKVIVNAWAIGRDPAYWEDPESFIPERFSDSSIDFKGNNFTYIPFGAGRRICPGMTF  457

Query  1401  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
                ++ L LA LLYHF+++LPDG+  +DLDMTEA G    +K  L +IA P+V
Sbjct  458   GLANVELPLAKLLYHFDFKLPDGIRGEDLDMTEAFGATVGRKNQLTVIATPYV  510



>ref|XP_003611883.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94841.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   504 bits (1298),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 257/473 (54%), Positives = 334/473 (71%), Gaps = 9/473 (2%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARA  320
             KLPPGP KLPLIG+LH +   GSLPHR  + L+ KYGPI+HL+LGE SAVVIS P+LA+ 
Sbjct  33    KLPPGPMKLPLIGNLHQIAALGSLPHRAFKQLAHKYGPIVHLKLGETSAVVISSPKLAKE  92

Query  321   ITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  500
             I KTHD++FA+RP++ A  I+ Y S D+AFSPYGDYWRQMRKIC+LELLS K V+SF   
Sbjct  93    ILKTHDVIFANRPHLQASHIMTYGSKDIAFSPYGDYWRQMRKICMLELLSNKRVQSFSYI  152

Query  501   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  680
             R++E  N + SI+  S  G   NLT ++    SS +++ AFG   +EDQ +F++++++ +
Sbjct  153   REDETRNFIKSIQ--SSEGSSVNLTNRIFSLVSSTVSRSAFGDK-TEDQDEFVSVIRKAI  209

Query  681   SLAGGFDLGDLFPS-KKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
                GG +  DLFPS K  I   +G K K+LK+H + DKI +II+  H+E           
Sbjct  210   ESVGGLEPADLFPSMKSIIQMLTGTKSKVLKMHKKADKILEIIVRKHQEKQRRAKEGKVS  269

Query  858   KDE----DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1025
              DE    D+VDVLLR++E G L+ PIT  NIKAVI D F+ GT+T+ +TI+WAMSE++K 
Sbjct  270   SDEVEQEDLVDVLLRIQESGSLEIPITTSNIKAVIFDAFAAGTDTTTSTIVWAMSELMKN  329

Query  1026  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1205
             PSVM KAQAE+R+A KG +   + D++ L YLKLVIKETLRLH P PL+ PRE  E   I
Sbjct  330   PSVMNKAQAEIREACKGKEIISENDIQELPYLKLVIKETLRLHSPTPLLLPRECTELTNI  389

Query  1206  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1385
               Y IP KT+V+IN WA+A +P+ W D E F PERFE SS+DF GN++E++PFGAGRR+C
Sbjct  390   DGYDIPKKTKVMINVWAMARDPQYWTDAEMFNPERFEGSSIDFRGNNFEYLPFGAGRRIC  449

Query  1386  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             PG+ F    I L +A LLYHFNWELP+ + P DLDMTE  G+   KK DLCLI
Sbjct  450   PGLQFGIAGIMLPVALLLYHFNWELPNKMKPMDLDMTEHYGLAIGKKSDLCLI  502



>gb|KEH34024.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   503 bits (1296),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 251/503 (50%), Positives = 358/503 (71%), Gaps = 13/503 (3%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQK------LPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             ++++L ++F    L       R++K      +PPGP KLP+IG++H+L+  S PH+ LR+
Sbjct  4     LVLYLPYIFFFILLTLIVQKIRKKKSYSAYNIPPGPRKLPIIGNIHNLLS-SQPHQKLRD  62

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L++KYGP+MHLQLGE+SA+VIS P+ A  + KTHD+ F+SRP I+A +I+ Y ST +AF+
Sbjct  63    LAKKYGPVMHLQLGEVSAMVISSPECASEVMKTHDIHFSSRPQILATEIMSYNSTSIAFA  122

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYG+YWRQ+RKIC LELLS+K V S+   R+E   NL   I  +S+ G P N+TE V   
Sbjct  123   PYGNYWRQLRKICTLELLSLKRVNSYQPIREEVFFNLAKWI--ASQVGIPINITEAVRSS  180

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
               +++++ AFG  C +DQ KFI+++KQ + +AGGFDLGDLFPS KW+   +GM+PKL + 
Sbjct  181   IYTIVSRAAFGNEC-KDQDKFISVVKQSIKVAGGFDLGDLFPSAKWLQLVTGMRPKLERF  239

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGK-DEDIVDVLLRVKEGGELQFPITEDNIKAVI  950
             H + D+IF+ II +HKE     + +  GK +ED++DVLL+ ++G   +F +T++NIKA+I
Sbjct  240   HRQTDQIFENIINEHKEEKYTKAKDDQGKVEEDLIDVLLKYEDGSNQEFTLTKNNIKAII  299

Query  951   NDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLV  1130
              D+F+ G ETSA+TI WAM E++K P +M KAQ EVR+  K     D+  +  L YLKLV
Sbjct  300   LDIFAAGGETSASTIDWAMVELVKDPRIMKKAQDEVREVFKMKGRVDENCINELNYLKLV  359

Query  1131  IKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPER  1310
             +KETLRLHPP PL+ PRE  +E  I  Y IP KT+V++NAWA+A +P  W +PERF PER
Sbjct  360   VKETLRLHPPAPLLLPRECSQECDINGYHIPIKTKVLVNAWAVARDPNYWTEPERFYPER  419

Query  1311  FENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLD  1490
             F +S +D+ G+++E+IPFGAGRR+CPG +F  T+I L LA LLYHF+W+LP G++ +++D
Sbjct  420   FIDSDIDYKGSNFEYIPFGAGRRICPGSTFGLTNIELVLAMLLYHFDWKLPSGITGEEMD  479

Query  1491  MTEAVGVIASKKKDLCLIARPFV  1559
             MTE  G+   +K DL L   PFV
Sbjct  480   MTEEFGLTVRRKDDLLLC--PFV  500



>ref|XP_011082374.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=517

 Score =   503 bits (1295),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 258/523 (49%), Positives = 356/523 (68%), Gaps = 21/523 (4%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
             M   F  N  +V + +  +F +    ++S P    KLPPGP KLP+IG LH +   +LP 
Sbjct  1     MGFVFPLNLTAVALLVPVIFLLIKKWKKSKPVS-VKLPPGPKKLPIIGDLHLI--SALPF  57

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
             R+ R+L+++YGPIMHL+LGE+  +V+S P++A+ + + HD  FA RP  +A+ I++Y   
Sbjct  58    RSFRDLAKQYGPIMHLKLGEVPTIVVSSPEIAKEVLREHDPNFADRPEAIAMKIMWYNYI  117

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             D+AFSPYGDYWRQMRKIC++ELL+ K V+SF S R +E+S L+ SIRLSS  G P NLTE
Sbjct  118   DIAFSPYGDYWRQMRKICIIELLNAKNVRSFSSIRNDEVSRLIKSIRLSS--GEPVNLTE  175

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
             K+   TSS+  + AFG+VC +D    I LLK+ + +AGGF++ DLFPS K I+  S  K 
Sbjct  176   KIFSLTSSITCRAAFGKVC-KDSDALIKLLKEGIQMAGGFEIADLFPSSKIINALSWSKL  234

Query  759   KLLKLHHELDKIFDIIIGDHKEN--------------HLANSTNSSGKDEDIVDVLLRVK  896
             +L+ +  +LD I D II +HKEN                A   N    +ED+VDV LR++
Sbjct  235   RLVMMRRKLDVILDDIIKEHKENLAKMARENGDGEGKESARRGNGEFGNEDLVDVFLRIQ  294

Query  897   EGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKG  1076
             E GEL+FPI  DNIKAVI DMFS GTETS+T I W M+E+++ P VMAKAQAEVR+   G
Sbjct  295   ESGELEFPIGNDNIKAVIYDMFSAGTETSSTAIDWTMAELVRNPRVMAKAQAEVREFFNG  354

Query  1077  NKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWA  1256
             ++   + D++ L YLKLVI+E+LRLHPP+P++    S EE +I  Y IP K +V++N WA
Sbjct  355   SEIIQENDVQKLKYLKLVIRESLRLHPPVPILPRA-SREEREISGYTIPAKVKVLVNNWA  413

Query  1257  LATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGL  1436
             +  +P+ W +PE F PERFEN S+DF+G  ++++PFG GRRMCPG++F   S+ L LA L
Sbjct  414   MQRDPKYWTNPETFEPERFENQSLDFLGADFQYLPFGTGRRMCPGMTFGLASVELPLAQL  473

Query  1437  LYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVDL  1565
             LY FNW+LPDGV  +DLDM E  G+ AS+K +L ++A P+  L
Sbjct  474   LYSFNWKLPDGVKAEDLDMIENPGITASRKDNLFVVATPYESL  516



>ref|XP_008385924.1| PREDICTED: premnaspirodiene oxygenase-like [Malus domestica]
Length=506

 Score =   503 bits (1294),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 257/497 (52%), Positives = 350/497 (70%), Gaps = 10/497 (2%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
             V  FL F+  I  + +R+    +  LPPGPWKLP IG+LH LVG S+PH  LR+L++KYG
Sbjct  11    VATFLLFLIMILKIGKRA----KINLPPGPWKLPFIGNLHQLVG-SIPHHGLRDLAKKYG  65

Query  252   PIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYW  431
              +MHL+LGE+S +V+S  + A+ + KTHD+ FASRP+I+A  I+ Y  T++ F+PYGDYW
Sbjct  66    XLMHLKLGEVSTIVVSSAEFAKEVMKTHDVXFASRPHILANSILTYGDTNIGFAPYGDYW  125

Query  432   RQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIA  611
             RQ+RKIC LELLSMK V+SF S R+EE+ NL+  IRL +ET  P N+TE++  FT    +
Sbjct  126   RQLRKICTLELLSMKRVQSFRSLREEEVFNLIKLIRLRAET--PINITEQIYSFTYGFTS  183

Query  612   KVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDK  791
             + AFG + S+DQ KFI ++KQ + +AGGFD+ D+FPS   +H  SGM+PKL +LH E D+
Sbjct  184   RAAFG-IKSKDQDKFIDIVKQAMKVAGGFDVADVFPSVSLLHLISGMRPKLERLHKEADR  242

Query  792   IFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRV-KEGGELQFPITEDNIKAVINDMFST  968
             I + II +HK++   + +      ED++DVLL+  +E   L+F +T DN+KA+I + F  
Sbjct  243   IMENIIKEHKKDMATSKSQDVEAREDLIDVLLKFHEEESGLEFSLTADNVKAIILETFGA  302

Query  969   GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1148
             G ET+ATT+ WA+SEMIK P +M KAQAEVR+        D+ +++ + YL LVIKETLR
Sbjct  303   GGETAATTVNWAISEMIKNPRIMQKAQAEVREIFNXKXQVDETEIKEMMYLNLVIKETLR  362

Query  1149  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSV  1328
             LHPP PL+ PRE  E  KI  Y IP KT+V+INAWA+  +P  W +P+ F PERF +SS+
Sbjct  363   LHPPFPLLLPRECRESCKIDGYEIPVKTKVVINAWAIGRDPNYWTNPDSFYPERFLDSSI  422

Query  1329  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS-PKDLDMTEAV  1505
             D  G ++EFIPFGAGRRMCPG+SF   S+   LA LLYHF+W+L  G+   +DLDMTEA 
Sbjct  423   DLKGKNFEFIPFGAGRRMCPGMSFGLASVEFPLASLLYHFDWKLSXGMKHDEDLDMTEAF  482

Query  1506  GVIASKKKDLCLIARPF  1556
             GV   +K+DL LI  P+
Sbjct  483   GVSVRRKQDLHLIPIPY  499



>ref|XP_006339045.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   502 bits (1293),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 264/475 (56%), Positives = 355/475 (75%), Gaps = 6/475 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
             +KLPPGPWKLP +GS+HHL + G LPH  L  L +K+GP MHLQLGEIS +V+S  ++AR
Sbjct  34    KKLPPGPWKLPFLGSIHHLALEGGLPHHALTKLGKKHGPFMHLQLGEISTIVVSSLEMAR  93

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              + K HDL FASRP +++LD++ Y STD+ FSPYGDYWRQMRKIC LEL S K V+SF S
Sbjct  94    EVMKIHDLAFASRPKLVSLDVICYNSTDIVFSPYGDYWRQMRKICFLELFSAKNVRSFSS  153

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R+EE S+LV  I  SS  G   N+TE++SW+ SS   K AFG +  +DQ KFI +++++
Sbjct  154   IRREEASSLVQFIG-SSPRGETINVTERISWYESSNTCKAAFGELL-KDQEKFIGIVREL  211

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
               L GGF + ++FPS K +H  SG++ +++K+H  +D I + II +HK+N +A+    +G
Sbjct  212   AELTGGFSVANIFPSIKILHVLSGLRSRIMKVHKNVDVIVEDIINEHKKN-IASGKKGNG  270

Query  858   K--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1031
                 ED+VDVLLR++E GEL+ PIT DNIKA++ D+F+ GTETS TT IW M+EM++ PS
Sbjct  271   AFGGEDLVDVLLRLRESGELKTPITNDNIKAIMIDLFAAGTETSTTTTIWTMTEMMRNPS  330

Query  1032  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1211
             V+AKAQ EVR+A KG +TF++  +E+L YLK V+KE+LRLHPP PL+ PRE  EE  I  
Sbjct  331   VLAKAQVEVREAFKGKETFNEDIIEDLKYLKQVVKESLRLHPPAPLLVPRECREETNING  390

Query  1212  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1391
             Y IP KTRV++N  A+  +P+ WED E F+PERFE SSVDFMGN++E++PFGAGRRMCP 
Sbjct  391   YTIPLKTRVLVNVSAIMRDPQYWEDAESFIPERFEQSSVDFMGNNFEYLPFGAGRRMCPA  450

Query  1392  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             I+F   ++ L LA LLYHF+W+LPDG+ P++LDMTE  G+ AS+K +L LIA P+
Sbjct  451   ITFGLINVYLPLAKLLYHFDWKLPDGLKPENLDMTECDGINASRKSELYLIATPY  505



>gb|KEH34017.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=504

 Score =   502 bits (1292),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 253/499 (51%), Positives = 352/499 (71%), Gaps = 11/499 (2%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQK------LPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             +I++L ++F    L         +K      +PPGP KLP+IG++H+L+  S PHR LR+
Sbjct  4     LILYLPYIFSFILLTLVVQKIGNKKSYSTYNIPPGPIKLPIIGNIHNLLT-SQPHRKLRD  62

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L++KYGP+MHLQLGE+SA+VIS P+ A  + KTHD+ FASRP I+A +I+ Y ST++AF+
Sbjct  63    LAKKYGPLMHLQLGEVSAMVISSPECAGEVMKTHDIHFASRPQILATEIMSYNSTNIAFA  122

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYG+YWRQ+RKIC LELLS+K V S+   R+E  SNLV  I  +S  G P N+TE V   
Sbjct  123   PYGNYWRQLRKICTLELLSLKRVNSYQPIREEVFSNLVKWI--ASRDGIPINITEAVRSS  180

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
               +++++ AFG  C +DQ KFI+++KQ + +AGGFDLGDLFPS KW+   +GM+PKL + 
Sbjct  181   IYTIVSRAAFGNEC-KDQDKFISVVKQSIKVAGGFDLGDLFPSAKWLQLVTGMRPKLERF  239

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGK-DEDIVDVLLRVKEGGELQFPITEDNIKAVI  950
             H + D+I + II +HKE     + +  GK +ED+VDVLL+ ++G   +F +T++NIKA+I
Sbjct  240   HRQTDQILENIINEHKEEKYTKAKDDQGKVEEDLVDVLLKYEDGSNQEFTLTKNNIKAII  299

Query  951   NDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLV  1130
              D+F  G ETSA+TI WAM EMI+ P +M KAQ EVR+  K     D+  +  L YLK V
Sbjct  300   LDVFGAGGETSASTIDWAMVEMIRDPRIMKKAQDEVREVFKMKGRVDENCINELNYLKSV  359

Query  1131  IKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPER  1310
             +KETLRLHPP PL+ PRE  +  +I  Y IP K++VI+NAWA+A +P  W +PERF PER
Sbjct  360   VKETLRLHPPTPLLLPRECRQTCEINGYHIPIKSKVIVNAWAIARDPNYWTEPERFYPER  419

Query  1311  FENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLD  1490
             F +S++D+ G++YE+IPFGAGRR+CPG +F   SI L+LA LLYHF+W+LP G+  +DLD
Sbjct  420   FLDSAIDYKGSNYEYIPFGAGRRICPGSTFGLRSIELALAMLLYHFDWKLPSGIRSEDLD  479

Query  1491  MTEAVGVIASKKKDLCLIA  1547
             MT+  G    +K DL L +
Sbjct  480   MTDEFGATMRRKDDLLLFS  498



>emb|CDP10756.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   501 bits (1289),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 262/504 (52%), Positives = 351/504 (70%), Gaps = 15/504 (3%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSN----PARRQKLP---PGPWKLPLIGSLHHLVGGSLPHRT  224
             ++    L  V C + L + +      + R   P   PGPWKLPLIGS+HHL  GSLPH  
Sbjct  3     ITFPALLVSVLCFFVLWKLTGLFIKSSERTDSPRKLPGPWKLPLIGSMHHL-AGSLPHHA  61

Query  225   LRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDV  404
             LR+L+ K+GPIMHLQ+GEIS VVIS PQ A+ + K HD++FA RP  +A  I+ Y + D+
Sbjct  62    LRDLAEKFGPIMHLQMGEISTVVISAPQEAKEVLKVHDIIFADRPEFLASKILGYDNLDI  121

Query  405   AFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKV  584
             AFSPYGDYW+QMRKIC+LELLS K V+SF + R++E   ++ SI+ S+    P N+T+K 
Sbjct  122   AFSPYGDYWKQMRKICLLELLSPKSVRSFGTLREDEALKVIRSIKSSNS---PVNITDKA  178

Query  585   SWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKL  764
               FT+ ++ + AFG+  +  Q + I L+   +S +GGFD+ DLFPS K++H  SG+KPKL
Sbjct  179   FTFTNDIVCRAAFGKSFAH-QDRLITLINGAISASGGFDIADLFPSLKFLHSLSGLKPKL  237

Query  765   LKLHHELDKIFDIIIGDHKENHLANST--NSSGKDEDIVDVLLRVKEGGELQFPITEDNI  938
             +KLH+E+D++ + II + K+     ST   S  + ED+VDVLLR+KE G+   PI+ D++
Sbjct  238   IKLHNEIDQMLETIISERKQKRANQSTPVGSQSEVEDLVDVLLRLKESGDFNIPISTDSV  297

Query  939   KAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTY  1118
             KAVI D+F+ GTETSA TI +AM+E+I+ P  M K QAE+RQ LKG +T  + DL+ L Y
Sbjct  298   KAVIWDIFAAGTETSAATIDYAMAELIRNPGAMEKVQAELRQVLKGKETVQETDLKELNY  357

Query  1119  LKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERF  1298
             LK VIKETLRLHPPLPLI PRE  E  KIG Y IP KT+V+INAWA+  +PE W +PE+F
Sbjct  358   LKAVIKETLRLHPPLPLILPREGREPCKIGGYDIPAKTKVMINAWAIHRHPEVWPNPEKF  417

Query  1299  LPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDG-VS  1475
              PERF +S  D +G ++E+IPFG GRR+CPG+SF    + L LA LLYHF+W LP+G VS
Sbjct  418   KPERFLDSGSDSIGMNFEYIPFGGGRRICPGVSFGSAGVELLLAKLLYHFDWSLPNGTVS  477

Query  1476  PKDLDMTEAVGVIASKKKDLCLIA  1547
             P+  DMTE  G  A +K  L L+A
Sbjct  478   PETPDMTEVFGATARRKSSLILVA  501



>ref|XP_011082249.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=530

 Score =   501 bits (1291),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 250/473 (53%), Positives = 347/473 (73%), Gaps = 8/473 (2%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAIT  326
             LPPGPWKLPLIG L H+VG SLPH +LR+LS KYGP+MHL+ GE+S +V+S P++A+ + 
Sbjct  61    LPPGPWKLPLIGHLLHVVG-SLPHHSLRDLSNKYGPLMHLKFGEVSTIVVSSPKVAKEVL  119

Query  327   KTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  506
             KT D   A RP  +A  I++Y   D+AFSPYG+YWRQMRKIC+LELLS+K V+SF   R+
Sbjct  120   KTVDPACADRPQSLASQIMWYNYIDIAFSPYGEYWRQMRKICILELLSVKNVRSFDYIRK  179

Query  507   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  686
             +E S LV SIR SS  G P NLT+K   FTS++  + AFG+V  +D+   I+LLK+ + L
Sbjct  180   DEASRLVESIRASS--GRPINLTDKTFLFTSAITCRAAFGKVL-KDRETLISLLKEAVVL  236

Query  687   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK--  860
             AGGFD+ DLFPS K ++  +  K KLLK+  ++D I D +I +HK+N LA S   +G+  
Sbjct  237   AGGFDMADLFPSLKILNIINWNKYKLLKMRSKMDAILDRLIDEHKDN-LATSKKGNGEMG  295

Query  861   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1040
              ED+VDVLLR+K+ GE +FPI  +NIKAV+ DMFS GTETS+TT+ WAM+E+++ P V+A
Sbjct  296   SEDLVDVLLRLKQSGEFEFPIANNNIKAVLFDMFSAGTETSSTTVDWAMAELMRNPHVLA  355

Query  1041  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1220
             KAQAEVR+  KG +T ++ D+  L YLKLVIKETLR+HPP+PL+      EE ++  Y I
Sbjct  356   KAQAEVRETFKGKETIEECDVHALKYLKLVIKETLRMHPPIPLLPRA-CREECEVEGYTI  414

Query  1221  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1400
             P K +V++N WA+  +P  W  PE F PERFE +S+D++G HY+++PFG+GRR+CPG++F
Sbjct  415   PLKAKVMVNTWAMGRDPNYWPQPENFKPERFEENSIDYLGAHYQYLPFGSGRRICPGMTF  474

Query  1401  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
                ++ L LA LLYHF+W+LP+G+ P D+DM +A G+   +K +L +I  P++
Sbjct  475   GLANVELPLAQLLYHFDWKLPNGMKPSDMDMADAEGIAVGRKHNLLVIPTPYI  527



>ref|XP_003516583.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   499 bits (1286),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 253/473 (53%), Positives = 339/473 (72%), Gaps = 11/473 (2%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
              KLPPGP KLPLIG+LH L + GSLPHRTLR+L+ KYGP+MHLQLGEIS+VV+S P +A+
Sbjct  34    HKLPPGPKKLPLIGNLHQLAMAGSLPHRTLRDLALKYGPLMHLQLGEISSVVVSSPNMAK  93

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              I KTHDL F  RP  +   I+ Y  +D+AF+PYGDYWRQM+KICV ELLS K V+SF  
Sbjct  94    EIMKTHDLAFVQRPQFLPAQILTYGQSDIAFAPYGDYWRQMKKICVSELLSAKRVQSFSD  153

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R++E +  + S+R S   G P NLT K+    SS I++VAFG  C +DQ +F++L+K++
Sbjct  154   IREDETAKFIESVRTSE--GSPVNLTNKIYSLVSSAISRVAFGNKC-KDQEEFVSLVKEL  210

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
             + +  GF+L DLFPS K +H  +G K KL K+  ++DKI D I+ +H+E          G
Sbjct  211   VVVGAGFELDDLFPSMK-LHLINGRKAKLEKMQEQVDKIVDNILKEHQEKR--ERARREG  267

Query  858   K----DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1025
             +    +ED+VDVLLR+++   L+  IT  NIKA+I D+F+ GT+TSA+T+ WAM+EM++ 
Sbjct  268   RVDLEEEDLVDVLLRIQQSDNLEIKITTTNIKAIILDVFTAGTDTSASTLEWAMAEMMRN  327

Query  1026  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1205
             P V  KAQAEVRQA +  K  ++ D+E L YLKLVIKETLRLH P PL+ PRE  +   I
Sbjct  328   PRVREKAQAEVRQAFRELKIINETDVEELIYLKLVIKETLRLHTPSPLLLPRECSKRTII  387

Query  1206  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1385
               Y IP KT+V+INAWA+A +P+ W D ERF+PERF+ SS+DF GN++E++PFGAGRRMC
Sbjct  388   DGYEIPVKTKVMINAWAIARDPQYWTDAERFVPERFDGSSIDFKGNNFEYLPFGAGRRMC  447

Query  1386  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             PG++    +I L LA LLYHFNWELP+ + P+ +DM E  G+   +K +LCLI
Sbjct  448   PGMTLGLANIMLPLALLLYHFNWELPNEMKPEYMDMVENFGLTVGRKNELCLI  500



>ref|XP_004506715.1| PREDICTED: cytochrome P450 71D9-like [Cicer arietinum]
Length=507

 Score =   499 bits (1285),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/502 (49%), Positives = 359/502 (72%), Gaps = 13/502 (3%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQK------LPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             ++++LS++F    L       R++K      LPPGP KLP+IG++H+L+  S PH+ LR+
Sbjct  4     LVLYLSYIFSFVLLTLIVQKIRKKKSYSTYNLPPGPIKLPIIGNIHNLLS-SQPHKKLRD  62

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L++KYGP+MHLQLGE+S ++IS P+ A  + KTHD+ FASRP I+A +I+ Y +T++AF+
Sbjct  63    LAKKYGPLMHLQLGEVSTIIISSPECASEVMKTHDINFASRPQILATEIMSYNTTNIAFA  122

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYG+YWRQ+RKIC LELLS+K V S+ S R+E   NLV   R+ SE G   NLT+ V   
Sbjct  123   PYGNYWRQLRKICTLELLSLKRVNSYKSIREEVFFNLVE--RIGSENGSVVNLTQAVISS  180

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
               +++++ AFG  C +DQ KFI++LKQ + +A GF+LGDLFPS KWI + +G++PKL + 
Sbjct  181   IYTIVSRTAFGNEC-KDQEKFISILKQSIKVASGFNLGDLFPSSKWIQHVTGLRPKLEEF  239

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGK-DEDIVDVLLRVKEGGELQFPITEDNIKAVI  950
             H + D+I + II +H+E     + +  G+ +ED+VDVLL+ ++G   +F +T+ NIKA+I
Sbjct  240   HRQTDQIVENIINEHREAKYTKAKDDQGEVEEDLVDVLLKYEDGSNQEFSLTKSNIKAII  299

Query  951   NDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLV  1130
              D+F  G ETSA+TI WAM+EM++ P +M KA+ EVR+     +  D+  +  L YLKLV
Sbjct  300   MDIFGAGGETSASTIDWAMAEMVRDPRIMQKAKTEVREVFNMKEKVDENCINELNYLKLV  359

Query  1131  IKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPER  1310
             IKETLRLHPP PL+ PRE  +  +I  Y IP K++V+INAWA+A +P  W +PERF PER
Sbjct  360   IKETLRLHPPAPLLLPRECSKGCEIHGYHIPSKSKVLINAWAIARDPNYWIEPERFYPER  419

Query  1311  FENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLD  1490
             F +S+VD+ GN++E+IPFGAGRRMCPG +F   ++ ++LA LLYHF+W+LP G++ +++D
Sbjct  420   FIDSTVDYKGNNFEYIPFGAGRRMCPGSTFGLRNVEVALAMLLYHFDWKLPCGITSEEMD  479

Query  1491  MTEAVGVIASKKKDLCLIARPF  1556
             MTE  GV   +K DL L+  PF
Sbjct  480   MTEEFGVTVRRKDDLLLL--PF  499



>emb|CDP07887.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   498 bits (1281),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 246/501 (49%), Positives = 342/501 (68%), Gaps = 29/501 (6%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
             FN ++  +FL+FV C+    +RS  A  QKLPP P KLP+IG++HHLVG S PH  LR L
Sbjct  5     FNFIAFFLFLAFVLCLIKEWKRSKAA--QKLPPSPSKLPVIGNMHHLVG-SPPHHALRKL  61

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             +R++G +M+LQLGEIS++V+S P LA+ I KTHDL FA+R   +   I+ Y S+D+A  P
Sbjct  62    ARQHGALMYLQLGEISSIVVSSPHLAKEIMKTHDLAFANRAEFLTSKILMYNSSDIACCP  121

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YGDYWRQMRKIC LELLS K V+SF S RQ+E S+L++S++  +  G   N++EK+  +T
Sbjct  122   YGDYWRQMRKICTLELLSAKNVRSFGSIRQDEASHLLASVQALAAAGKLINISEKLYSYT  181

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
             SS++ + AFG+V  +   +F+ L  +   L+  FD+ DLFPS K +H    +K +L+K+H
Sbjct  182   SSMVCRAAFGKVSKDLHREFLQLTSESAPLSSTFDISDLFPSFKILHPLLSVKSQLVKIH  241

Query  777   HELDKIFDIIIGDHKENHL-ANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
              ++DK+   II  H +N    N       +ED++DVLLRVKE G+LQFPIT +NIKA++ 
Sbjct  242   LKMDKLLGNIIDQHVDNRARTNMATGESGNEDLIDVLLRVKESGDLQFPITNNNIKAIVI  301

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D+FS GTETS+TT+ WAMSEM++ P+VMAKAQ+E+R A KG K  ++ D++ L       
Sbjct  302   DVFSAGTETSSTTVEWAMSEMVRNPNVMAKAQSEIRTAFKGKKKIEETDIQELK------  355

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
                                E+ +I  Y IP KTRV++NAWA+  +PE W+DPE F P+RF
Sbjct  356   -------------------EQCEIEGYTIPVKTRVLVNAWAIGRDPEYWDDPESFKPDRF  396

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
             + + VDF G H+E++PFGAGRRMCPGISF   ++ L LA LLYHFNW+LP+G+ P DLDM
Sbjct  397   KTNPVDFTGTHFEYLPFGAGRRMCPGISFGLANVDLPLALLLYHFNWKLPNGLDPCDLDM  456

Query  1494  TEAVGVIASKKKDLCLIARPF  1556
             +E VG+ AS+K  L L+A  +
Sbjct  457   SETVGITASRKDSLRLLATSY  477



>gb|AFK45297.1| unknown [Lotus japonicus]
Length=489

 Score =   497 bits (1280),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 255/489 (52%), Positives = 344/489 (70%), Gaps = 11/489 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVF-LSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVG-GSL  212
             ME +  F  ++ ++F L ++  IY  + +       KLPPGPWKLPLIG+LH +   GSL
Sbjct  1     MESQSYFLVITSLIFTLLWLAQIYKQKIKVTSTAVHKLPPGPWKLPLIGNLHQMAAAGSL  60

Query  213   PHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYK  392
             PH +LR L+ KYGP+MHLQLGE S VV+S P +A+ I KTH L FA RP +++  I+ Y 
Sbjct  61    PHHSLRELANKYGPLMHLQLGESSTVVVSSPDMAKEIMKTHGLAFAQRPELLSPKILAYG  120

Query  393   STDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNL  572
             STD+AF+PYGDYWRQMRKIC LELLS K V+SF   R++E++ L+ SI LS+  G P NL
Sbjct  121   STDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSFIREDEVAKLIQSIHLSASAGSPFNL  180

Query  573   TEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGM  752
             ++ V    ++ +++V FG+  SE + + ++L+K+ + L  GFD+ +LFPS K +H  + M
Sbjct  181   SKSVFSLVNTFLSRVVFGKK-SECEDELLSLIKKAVELTAGFDVAELFPSFKPLHLITRM  239

Query  753   KPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITED  932
             + KL  +H +LDKIFD I+ +H+ +H        GK E++VDVLLR++  G L  PIT +
Sbjct  240   EAKLENMHKKLDKIFDSIVNEHQSDH--------GKGENLVDVLLRMQHSGNLYIPITVN  291

Query  933   NIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENL  1112
             NIKAVI D+ + GT+TSAT + WAM+E++K P V  KAQAE+R+A KG KT ++ DL  L
Sbjct  292   NIKAVIWDIIAAGTDTSATALEWAMAELMKNPRVREKAQAELREAFKGKKTINETDLCKL  351

Query  1113  TYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPE  1292
             +YLK VIKETLRLHPP PL+ PRE  E  KIG Y IP KT+VI+NAWAL  +P  W D E
Sbjct  352   SYLKSVIKETLRLHPPAPLLVPRECREACKIGGYEIPVKTKVIVNAWALGRDPNHWYDAE  411

Query  1293  RFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGV  1472
             +F+PERF  +SVDF GN++E+IPFGAGRR+CPGI     +I L LA  LYHF+W LP+G+
Sbjct  412   KFIPERFHETSVDFKGNNFEYIPFGAGRRICPGILLGLANIELPLAAFLYHFDWALPNGM  471

Query  1473  SPKDLDMTE  1499
               +DLDM E
Sbjct  472   KSEDLDMIE  480



>ref|XP_003516584.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN36163.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   498 bits (1281),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 265/510 (52%), Positives = 352/510 (69%), Gaps = 9/510 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
             ME +  F  +++ +F+   +    L+ + N A   KLPPGP KLPLIG++H L V GSLP
Sbjct  1     MEAQTYFLVIALSLFILLNWLAKYLKLKPNVA--HKLPPGPKKLPLIGNMHQLAVAGSLP  58

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             HR L+ L+  YGP+MHLQLGEISAVV+S P +A+ ITKTHD+ F  RP I++  I+ Y  
Sbjct  59    HRALQKLAHIYGPLMHLQLGEISAVVVSSPNMAKEITKTHDVAFVQRPQIISAQILSYGG  118

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
              DV F+PYGDYWRQMRK+ V ELLS K V+SF   R++E +  + SIR S   G P NLT
Sbjct  119   LDVVFAPYGDYWRQMRKVFVSELLSAKRVQSFSFIREDETAKFIDSIRASE--GSPINLT  176

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
              KV    S+ +++ A G   S+DQ +F+  L++V+   GGFDL DLFPS K IH+ +G K
Sbjct  177   RKVFSLVSASVSRAAIGN-KSKDQDEFMYWLQKVIGSVGGFDLADLFPSMKSIHFITGSK  235

Query  756   PKLLKLHHELDKIFDIIIGDHKENHL-ANSTNSSGKDEDIVDVLLRVKEGGELQFPITED  932
              KL KL + +DK+ + I+ +H E  + A       +DED+VDVLLR+++   L   +T  
Sbjct  236   AKLEKLLNRVDKVLENIVREHLERQIRAKDGRVEVEDEDLVDVLLRIQQADTLDIKMTTR  295

Query  933   NIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENL  1112
             ++KA+I D+F+ G +TSA+T+ WAM+EM+K   V  KAQAE+R+     K   + D+E L
Sbjct  296   HVKALILDVFAAGIDTSASTLEWAMTEMMKNSRVREKAQAELRKVFGEKKIIHESDIEQL  355

Query  1113  TYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPE  1292
             TYLKLVIKETLRLHPP PL+ PRE  EE  IG Y IP KT+V+IN WA+  +P+ W D E
Sbjct  356   TYLKLVIKETLRLHPPTPLLIPRECSEETIIGGYEIPVKTKVMINVWAICRDPKYWTDAE  415

Query  1293  RFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGV  1472
             RF+PERFE+SS+DF GN++E++PFGAGRR+CPGI+F   SI L LA LL HFNWELPDG+
Sbjct  416   RFVPERFEDSSIDFKGNNFEYLPFGAGRRICPGITFGLASIMLPLAQLLLHFNWELPDGM  475

Query  1473  SPKDLDMTEAVGVIASKKKDLCLIARPFVD  1562
              P+ +DMTE  G+   +K DLCLI  PFVD
Sbjct  476   KPESIDMTERFGLAIGRKHDLCLI--PFVD  503



>ref|XP_010644548.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   496 bits (1278),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 269/506 (53%), Positives = 358/506 (71%), Gaps = 12/506 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQ----KLPPGPWKLPLIGSLHHLVGG  206
             ME +F F P+      +F+  IY L+R   P+R      KLPPGPWKLP+IG++H LVG 
Sbjct  1     MELQFSFFPI----LCTFLLFIYLLKRLGKPSRTNHPAPKLPPGPWKLPIIGNMHQLVG-  55

Query  207   SLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVF  386
             SLPHR+LR+L++K+GP+MHLQLGE+SA+V+S  ++A+ + KTHD++F+ RP I+A  IV 
Sbjct  56    SLPHRSLRSLAKKHGPLMHLQLGEVSAIVVSSREMAKEVMKTHDIIFSQRPCILAASIVS  115

Query  387   YKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPT  566
             Y  TD+AF+PYG YWRQ+RKI VLELLS K V+SF S R+EE+ NLV S+ L  + G   
Sbjct  116   YDCTDIAFAPYGGYWRQIRKISVLELLSAKRVQSFRSVREEEVLNLVRSVSL--QEGVLI  173

Query  567   NLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTS  746
             NLT+ +   T S+I++ AFG+ C +DQ  F   L +    AGGF + D+FPS K +H  S
Sbjct  174   NLTKSIFSLTFSIISRTAFGKKC-KDQEAFSVTLDKFADSAGGFTIADVFPSIKLLHVVS  232

Query  747   GMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPIT  926
             GM+ KL K+H +LD+I   II +HK    A  T  +  D+D+VDVLL+V++ G+L+FP+T
Sbjct  233   GMRRKLEKVHKKLDRILGNIINEHKARSAAKETCEAEVDDDLVDVLLKVQKQGDLEFPLT  292

Query  927   EDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLE  1106
              DNIKAV+ D+F  GTETS+T + WAM+EM+K P VMAKAQAEVR         D+  + 
Sbjct  293   MDNIKAVLLDLFVAGTETSSTAVEWAMAEMLKNPRVMAKAQAEVRDIFSRKGNADETVVR  352

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              L +LKLVIKETLRLHPP+PL+ PRES E   I  Y IP KTRVIINAWA+A +P+ W D
Sbjct  353   ELKFLKLVIKETLRLHPPVPLLIPRESRERCAINGYEIPVKTRVIINAWAIARDPKYWTD  412

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
              E F PERF +SS+D+ G ++E+IPFGAGRRMCPGI F   ++ L+LA LLYHF+W+LP+
Sbjct  413   AESFNPERFLDSSIDYQGTNFEYIPFGAGRRMCPGILFGMANVELALAQLLYHFDWKLPN  472

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLI  1544
             G   ++LDMTE       +K+DL LI
Sbjct  473   GARHEELDMTEGFRTSTKRKQDLYLI  498



>ref|XP_004511997.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=506

 Score =   496 bits (1278),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 251/500 (50%), Positives = 347/500 (69%), Gaps = 10/500 (2%)
 Frame = +3

Query  63    PVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLS  239
             P  V + L F    Y L++  +     KLPPGP KLP IG+LH +   GSLPHR  + L+
Sbjct  11    PFFVFLMLRFFAKYYMLKKFGH-----KLPPGPMKLPFIGNLHQIASLGSLPHRAFQQLA  65

Query  240   RKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPY  419
              KYGPIMHL+LG+IS +VI+ P+LA+ I KTHD+VFA+RP++ +  I+ Y S D+AFSPY
Sbjct  66    HKYGPIMHLKLGQISTIVITSPKLAKEILKTHDIVFANRPHLESAHIMSYGSKDIAFSPY  125

Query  420   GDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTS  599
             GDY+RQMRKIC+LELLS K V+SF   R++E +  +  I+  S  G   NLT ++    S
Sbjct  126   GDYYRQMRKICMLELLSAKRVQSFSYIREDETNIFIELIK--SSAGSEVNLTNRIFSLVS  183

Query  600   SLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWI-HYTSGMKPKLLKLH  776
             S++++ AFG   +EDQ +F+ ++++ +   GG +  DLFPS K+I H  +G K KL K+ 
Sbjct  184   SIVSRSAFGD-KTEDQDEFVRVIRKTIESVGGLEPADLFPSMKYIIHVLTGNKSKLEKMQ  242

Query  777   HELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIND  956
              + DKI +II+G H+E        S  + ED+VDVLLRV++ G L  PIT  NIKA+I D
Sbjct  243   KQSDKILEIIVGKHQEKQRRAKEGSDEEQEDLVDVLLRVQQSGTLDIPITTSNIKAIIFD  302

Query  957   MFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIK  1136
              F+ GT+T+ +TI+WAM+E++K P VM K Q+E+R A KG +   + D+++L YLKLVIK
Sbjct  303   TFAAGTDTTTSTIVWAMAELMKNPRVMEKLQSELRDACKGKEIITEVDVQDLPYLKLVIK  362

Query  1137  ETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE  1316
             ETLRLH P PL+ PRES +   IG Y IP KT+V++N WA+A +P  W D E F+PERF+
Sbjct  363   ETLRLHSPTPLLLPRESTQLTNIGGYDIPKKTKVMVNVWAMARDPYYWNDAEMFIPERFD  422

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
              +S+D+ GNH+E++PFGAGRR+CPG+SF    I L LA LLYHF+W+LP+ + P+DLDMT
Sbjct  423   ANSIDYKGNHFEYLPFGAGRRICPGMSFGIAGIMLPLALLLYHFDWKLPNQMKPQDLDMT  482

Query  1497  EAVGVIASKKKDLCLIARPF  1556
             E  G+   +K DLCLI R +
Sbjct  483   EHYGLAIGRKTDLCLIPRVY  502



>ref|XP_003611886.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94844.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   496 bits (1276),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 263/500 (53%), Positives = 346/500 (69%), Gaps = 8/500 (2%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQ-KLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRK  245
             VI F   +F ++ L + S   +   KLPPGP K PLIG+L  L +    PH  L  LS K
Sbjct  9     VIPFF-LLFVLHWLAKYSKTKKSHSKLPPGPMKFPLIGNLPQLAMSKKRPHHALHELSHK  67

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MH+QLGEIS V++S P+LA+ I KTHD  FA+RP +++ +I+ Y S D+ FSPYGD
Sbjct  68    YGPLMHIQLGEISTVIVSSPKLAKEIMKTHDAAFANRPKLLSPEIMAYGSKDIVFSPYGD  127

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             +WRQMRKICV ELLS K V+SF   R++E   L+ SI+  S TG   NLT ++    SS 
Sbjct  128   FWRQMRKICVFELLSAKRVQSFSYIREDETKKLIQSIQ--SSTGSTINLTSRIFSMVSSN  185

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
             I++ AFG   S+DQ +F+ L+++V+ ++ GF + DLFPS K +H  SGMKPKL K+H  +
Sbjct  186   ISRAAFGD-KSKDQDEFVDLVRKVVEMSSGFGVDDLFPSIKPLHILSGMKPKLEKIHKRV  244

Query  786   DKIFDIIIGDHKENH--LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDM  959
             DKI + II  H+E         N+   +ED++DVLLRV++   L   IT +NIKAVI D+
Sbjct  245   DKIIENIIRQHQEKRERAKEDDNNEVDNEDLLDVLLRVQQSDNLDIKITTNNIKAVIWDV  304

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKE  1139
             F  GT+T++TTI WAMSEM+K PSV  KAQAE+R+A KG K   + DL  LTY KLVIKE
Sbjct  305   FVAGTDTTSTTIEWAMSEMMKNPSVREKAQAELREAFKGKKIISESDLNELTYFKLVIKE  364

Query  1140  TlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFEN  1319
             T+RLHPP PL+ PRE  E   I  Y IP  T+V+INAWA+A +P+ W D E F+PERF+ 
Sbjct  365   TMRLHPPSPLLVPRECTELTIIDGYEIPKNTKVMINAWAVARDPQYWTDAEMFIPERFDG  424

Query  1320  SSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTE  1499
             S +DF GN++E+IPFGAGRRMCPG+SF   S+ L LA LLYHFNWELP+ + P+DLDMTE
Sbjct  425   SLIDFKGNNFEYIPFGAGRRMCPGMSFGIASVMLPLALLLYHFNWELPNQMKPEDLDMTE  484

Query  1500  AVGVIASKKKDLCLIARPFV  1559
              VG+   ++ +LCLI   +V
Sbjct  485   NVGLAVGRENELCLIPNVYV  504



>ref|XP_004506686.1| PREDICTED: cytochrome P450 71D9-like [Cicer arietinum]
Length=495

 Score =   495 bits (1275),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 256/505 (51%), Positives = 353/505 (70%), Gaps = 19/505 (4%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFC---IYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGS  209
             M+ +FL+   S++    FVF    I T + +S P     LPPGPWKLP+IG++H+LVG S
Sbjct  1     MDSQFLYF-ASILTLFIFVFMSHKILTKKSKSTP----NLPPGPWKLPIIGNIHNLVG-S  54

Query  210   LPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFY  389
             LPH  LR LS KYGP+MHL+LGEIS +++S  + A+ + KTHDL+F+SRP I A  I+ Y
Sbjct  55    LPHHRLRELSTKYGPLMHLKLGEISTIIVSSAECAKQVMKTHDLIFSSRPPIQASTIMSY  114

Query  390   KSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTN  569
              +  +AF+PYGDYWRQ+RKIC LELLS K V+SF   R EE++NL+  I  +S+ G   N
Sbjct  115   NNVGIAFAPYGDYWRQLRKICTLELLSSKSVQSFQPIRDEEVTNLIKWI--TSKEGSSIN  172

Query  570   LTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSG  749
             LT++V    S++ ++ AFG+ C E+  KFI+L+++ + +AGGF+LGDL+PS KW+   SG
Sbjct  173   LTKEVFSTISTITSRTAFGKKCEENT-KFISLVREAVKVAGGFNLGDLYPSYKWLQNISG  231

Query  750   MKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITE  929
             +KPKL KLH + D I   II +H+E +   +      +ED+VDVLL+       Q  +++
Sbjct  232   LKPKLEKLHQQADIIMQKIINEHREVNKLRANEDQEVEEDLVDVLLK-------QNCLSD  284

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLEN  1109
             D++KAVI D++  G+ETSATTI WAM+EMIK P +M K QAEVR+     K  + +D+E 
Sbjct  285   DSVKAVILDVYGGGSETSATTIAWAMAEMIKNPRIMEKVQAEVREVFDKEKNLNGRDIEK  344

Query  1110  LTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDP  1289
             LTYLK V+KETLRLHPP PL+ PRE  ++ +I  Y IP K+++I+NAWA+  +P  W DP
Sbjct  345   LTYLKYVVKETLRLHPPAPLLLPRECGQDCEINGYNIPFKSKIIVNAWAIGRDPNYWVDP  404

Query  1290  ERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDG  1469
             E F PERF  S VD+ GN++EFIPFGAGRRMCPG++F   ++   LA LLYHF+W+LP+G
Sbjct  405   EIFYPERFVESCVDYKGNNFEFIPFGAGRRMCPGLTFGLINVEFPLAMLLYHFDWKLPNG  464

Query  1470  VSPKDLDMTEAVGVIASKKKDLCLI  1544
             V  +DLDM+E  G   ++K DL LI
Sbjct  465   VKNEDLDMSETFGSAVTRKDDLYLI  489



>ref|XP_006345633.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   496 bits (1276),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 261/490 (53%), Positives = 341/490 (70%), Gaps = 11/490 (2%)
 Frame = +3

Query  90    FVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQ  269
              V  I    + SNP   QKL PGPWKLP+IG+L  +  GSLPH +L NL+ K+GP+MHL+
Sbjct  20    LVILIIKYYKISNP--YQKLAPGPWKLPIIGNLLQM--GSLPHISLANLATKHGPLMHLK  75

Query  270   LGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKI  449
             LG++SA+VIS PQLA+ + KTHDL FA+RP +    I+FY   D+AFSPYGDYW+Q+RKI
Sbjct  76    LGQLSAIVISSPQLAKEMMKTHDLTFANRPQLSVAKIMFYDCQDIAFSPYGDYWKQIRKI  135

Query  450   CVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGR  629
             CV+ELLS K + SF     +E   LV+SI+  SE   P N++EK+   TS++I + + GR
Sbjct  136   CVMELLSTKNITSFFPMMVDETYLLVNSIKAMSER--PINISEKMYLLTSAIICRASIGR  193

Query  630   VCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIII  809
              C +DQ   I L+KQV S AG F++ DLFPS K +H+ SG   KLL+LH ++D + + II
Sbjct  194   TC-KDQESVIMLMKQVASFAGVFNVVDLFPSLKILHFISGTNRKLLQLHRKVDPVLERII  252

Query  810   GDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSAT  989
              +H+   LA  T   G  ED+VDVLLR++   E Q PIT +NIKA+I DMF  G+ TS+T
Sbjct  253   NEHETEQLA--TEHVG--EDLVDVLLRLQNNNEFQIPITRNNIKAIILDMFVAGSATSST  308

Query  990   TIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplpl  1169
              + WAMSE++K PS+M KAQAEVR+A  G  T D  DL+ L YLK+VIKETLR HPP PL
Sbjct  309   VLEWAMSELLKNPSMMEKAQAEVREAFNGKTTIDQTDLKKLKYLKMVIKETLRFHPPGPL  368

Query  1170  ihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHY  1349
               PRES ++  I  Y IP KT  I+N WAL  + E WE+ E+F PERF  + +D  GNH+
Sbjct  369   SIPRESRQQCHINGYTIPNKTIGIVNMWALGRDSEYWEEAEKFEPERFNENPLDVSGNHF  428

Query  1350  EFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKK  1529
             +FIPFGAGRR+CPGI+F+  S+ L LA LL HF+W+L +GVSP+ LDMT   G +AS+K 
Sbjct  429   QFIPFGAGRRICPGINFSMASMELCLAQLLCHFDWKLVNGVSPQQLDMTVNFGNVASRKN  488

Query  1530  DLCLIARPFV  1559
              L L+A PFV
Sbjct  489   SLYLLASPFV  498



>ref|XP_011087047.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=498

 Score =   493 bits (1268),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 251/473 (53%), Positives = 337/473 (71%), Gaps = 6/473 (1%)
 Frame = +3

Query  138   RQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
             R KLPPGPWKLPLIGSLHHL GGS PH  LRNL+RKYGPIMHLQLGEISAVVIS P++A+
Sbjct  30    RPKLPPGPWKLPLIGSLHHLSGGSGPHYALRNLARKYGPIMHLQLGEISAVVISAPRVAK  89

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              +  THDL F+SR  + +L I+ Y   D+  +PYGDYW+QMR+IC  ELLS K V+SF +
Sbjct  90    ELLTTHDLAFSSRARLPSLAIITYNYQDMVMAPYGDYWKQMRRICFSELLSSKNVRSFST  149

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R EE  NLV SIR S  +  P +L +KV  +T+ ++ + AFG+     + +F+ L+ + 
Sbjct  150   IRDEEAVNLVESIR-SHPSLMPMDLAQKVLSYTNDVLCRAAFGK-SRGGKDEFLPLIIEF  207

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
              + +GGFD+ DLFPS  ++   +G++ KL+KLHH+LD++ ++II +H E           
Sbjct  208   GTSSGGFDVADLFPSITFLPAVTGLRTKLMKLHHKLDQVLNVIIDEHMER----LRFGQH  263

Query  858   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
              +EDIVDVLLR KE G L+FPIT DNIKA+  DMF  GT T+A T+ +AM +MIK  +VM
Sbjct  264   AEEDIVDVLLRFKEKGNLEFPITLDNIKAITLDMFIAGTHTTAATVEFAMVQMIKHANVM  323

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
              KAQ+E+R   +G +   + DLE ++YLK+VIKETLRL+PP+PL+ PR+  +  K+  Y 
Sbjct  324   EKAQSELRHVFRGKERILESDLEKVSYLKMVIKETLRLNPPVPLLLPRDCKDWQKVYGYD  383

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             IPPKT+V++N  A+  +PE W + E F PERF  SS++F+G ++EFIPFG GRRMCPGIS
Sbjct  384   IPPKTKVVLNVLAINRDPEYWVNAEAFEPERFAESSIEFIGTNFEFIPFGGGRRMCPGIS  443

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             F   S+ L LA LLYHFNW+LPDG+ P+DLDMTE +G+ A  K +L L+   +
Sbjct  444   FGLASVELLLAQLLYHFNWKLPDGLMPQDLDMTEILGLAAKMKNNLSLLVTSY  496



>emb|CDP07886.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   492 bits (1267),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 254/499 (51%), Positives = 349/499 (70%), Gaps = 25/499 (5%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
             FN +++ + ++F+  +  +++R+     QKLPP PWKLPLIG+LHHL+G S PH  LRNL
Sbjct  5     FNFIALFLLVAFISTL--IKQRNGSKAAQKLPPSPWKLPLIGNLHHLIG-SPPHHALRNL  61

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             S+K+GP+MH QLGE+S++V+S  +LA+ + KTHDL F +R   +A  I+ Y   D+A +P
Sbjct  62    SKKHGPLMHFQLGEVSSIVVSSSRLAKEVLKTHDLEFGNRAEFLATKILCYDYGDIASAP  121

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YGDYWRQMRKI                    E   L+SSI+  +  G   NL EK++ +T
Sbjct  122   YGDYWRQMRKIY-------------------EALKLMSSIKTLAGAGKIVNLKEKLASYT  162

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
             SS++ + AFG+V  +D   F+ L+ + L L+  F++ DLFPS K +H     K KL+K+H
Sbjct  163   SSMVCRAAFGKVSKDDHKAFLQLVMEALPLSSAFEISDLFPSLKILHPLFSAKTKLMKVH  222

Query  777   HELDKIFDIIIGDHKENHLANSTNSSGKD--EDIVDVLLRVKEGGELQFPITEDNIKAVI  950
             H++D I D II  H +N LA +  + G+   ED+ DVLLRVKE G+LQFPIT++N+KAV+
Sbjct  223   HKMDVILDKIIDQHIDN-LARTRMAMGESGHEDLTDVLLRVKESGDLQFPITKNNVKAVL  281

Query  951   NDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLV  1130
              DMF  GTETS+TT+ WAMSE+IK P+VM K Q EVR+A  G KT ++ +++ L YLKLV
Sbjct  282   FDMFLGGTETSSTTLEWAMSELIKNPNVMTKVQNEVRKAFTGKKTIEENEIQQLQYLKLV  341

Query  1131  IKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPER  1310
             IKETLRLHPP PL  P++  E+ +I  Y IP KTR+ +N WA+A +PE W+DPE F PER
Sbjct  342   IKETLRLHPPAPLSVPKQCREQCEIDGYSIPVKTRLFVNTWAIARDPEYWDDPESFKPER  401

Query  1311  FENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLD  1490
             FENSS+DF GNH+E +PFG+GRR+CPGISF   ++ L L  LLYHF+W LP+G+SP DLD
Sbjct  402   FENSSIDFTGNHFELLPFGSGRRICPGISFGIANVELPLTLLLYHFDWRLPNGLSPDDLD  461

Query  1491  MTEAVGVIASKKKDLCLIA  1547
             M E+VG+  ++K DLCL+A
Sbjct  462   MIESVGIATTRKNDLCLLA  480



>ref|XP_003537457.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42026.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   492 bits (1267),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 249/506 (49%), Positives = 343/506 (68%), Gaps = 12/506 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLP  215
             MEH  L    S+++       +  L +   P    KLPPGPWKLP+IG+LH + +  SLP
Sbjct  1     MEHSQL----SIVITFFVFLLLLRLVKNHKPKSSHKLPPGPWKLPIIGNLHQVALAASLP  56

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H  L+ L+RKYGP+MHLQLGEIS +V+S P++A  I KTHDL F  RP ++A   + Y +
Sbjct  57    HHALQKLARKYGPLMHLQLGEISTLVVSSPKMAMEIMKTHDLAFVQRPQLLAPQYMAYGA  116

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             TD+AF+PYG+YWRQMRKIC LELLS K V+SF   RQ+E   L+ SI+  S  G P +L+
Sbjct  117   TDIAFAPYGEYWRQMRKICTLELLSAKRVQSFSHIRQDENRKLIQSIQ--SSAGSPIDLS  174

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
              K+     + +++ AFG   ++DQ +F++L+++ +++ GGF+L D+FPS K +H  +G K
Sbjct  175   SKLFSLLGTTVSRAAFGNK-NDDQDEFMSLVRKAVAMTGGFELDDMFPSLKPLHLLTGQK  233

Query  756   PKLLKLHHELDKIFDIIIGDHKENHL---ANSTNSSGKDEDIVDVLLRVKEGGELQFPIT  926
              K+ ++H   D+I + I+  H E          NS  + ED+VDVLLR+++ G L+  +T
Sbjct  234   AKVEEIHKRADRILEDILRKHVEKRTRAKEEGNNSEAQQEDLVDVLLRIQQSGSLEVQMT  293

Query  927   EDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLE  1106
               ++KAVI D+F+ GT+TSA+T+ WAM+EM+K P V  KAQA +RQA KG +T  + DLE
Sbjct  294   TGHVKAVIWDIFAAGTDTSASTLEWAMAEMMKNPRVREKAQAVIRQAFKGKETIRETDLE  353

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              L+YLK VIKETLRLHPP  LI   E ++   I  Y IP K++V+IN WA+  +P+ W D
Sbjct  354   ELSYLKSVIKETLRLHPPSQLIPR-ECIKSTNIDGYEIPIKSKVMINTWAIGRDPQYWSD  412

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
              ERF+PERF+ S +DF GN YE+IPFGAGRRMCPG++F   SI L LA LLYHFNWELP+
Sbjct  413   AERFIPERFDGSYIDFKGNSYEYIPFGAGRRMCPGMTFGLASITLPLALLLYHFNWELPN  472

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLI  1544
              + P+DLDM E  G+   +K  LCLI
Sbjct  473   KMKPEDLDMNEHFGMTVGRKNKLCLI  498



>ref|XP_006475119.1| PREDICTED: premnaspirodiene oxygenase-like [Citrus sinensis]
Length=507

 Score =   492 bits (1266),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 256/506 (51%), Positives = 347/506 (69%), Gaps = 7/506 (1%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
             MEH+F   P+ ++ FL F F I+  + ++N +    LPPGPW+LP+IG+LH LVG SLPH
Sbjct  1     MEHQFPPFPI-ILSFLLFAFMIWK-KSKNNHSTLLNLPPGPWRLPVIGNLHQLVG-SLPH  57

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
               L +L++KYGP+MHLQLG++S +VIS P+ A+ + +THD+ FASRP ++A     Y  T
Sbjct  58    HCLSDLAKKYGPLMHLQLGQVSHIVISSPEAAKEVMRTHDMSFASRPFLLAASFFTYNFT  117

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             ++AF+P+GDYWRQ+RKIC LEL S K V+SF S R+EE+SNL++SI  SS +G P NL++
Sbjct  118   NIAFAPHGDYWRQLRKICTLELFSAKRVQSFRSIREEEVSNLITSI--SSNSGLPVNLSK  175

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
              V    + +  + AFG  C +DQ + + +  + + L GGF+L D+FPS K +   +G++P
Sbjct  176   MVFSLINGITTRAAFGVRC-QDQEELMTVFHKAIELGGGFNLADVFPSIKLLGKLTGIEP  234

Query  759   KLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNI  938
             +L +LH  LD+I   II +HKE      T   G+ +D+V VLL  +E GEL F +T DNI
Sbjct  235   ELERLHQALDRILGNIINEHKEGKALGKT-VEGEADDLVHVLLNCQENGELGFILTTDNI  293

Query  939   KAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTY  1118
             KA I D+F  GT++S T I WAMSEM+K P VM KAQAEVRQA + N   D+  L  L Y
Sbjct  294   KAAITDIFIAGTDSSVTVIEWAMSEMMKNPRVMEKAQAEVRQAFEKNGNVDEIGLHELQY  353

Query  1119  LKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERF  1298
             LKLV+KETLRLH PLPL+ PRE  E  KI  Y IP  ++VI+NAWA+A +P  W D E F
Sbjct  354   LKLVVKETLRLHTPLPLLLPRECGERCKILGYDIPKGSKVIVNAWAIARDPWYWNDAESF  413

Query  1299  LPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSP  1478
              PERF +SS+D+ GN++E+IPFGAGRR+CPG+ F   +I L LA LL+H NW+LP+G   
Sbjct  414   YPERFLDSSIDYKGNYFEYIPFGAGRRICPGMLFGMANIELPLAQLLFHLNWKLPNGEQN  473

Query  1479  KDLDMTEAVGVIASKKKDLCLIARPF  1556
              DLDM E  G    +K DL L+  P+
Sbjct  474   NDLDMAENFGGSVRRKNDLFLVPTPY  499



>emb|CDP10758.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   492 bits (1266),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 254/468 (54%), Positives = 334/468 (71%), Gaps = 8/468 (2%)
 Frame = +3

Query  153   PGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKT  332
             PGPWKLPLIGS+HHL  GSLPH  LR+L+ K+GPIMHLQ+GEIS VVIS PQ A+ + K 
Sbjct  39    PGPWKLPLIGSMHHL-AGSLPHHALRDLAEKFGPIMHLQMGEISTVVISAPQEAKEVLKV  97

Query  333   HDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEE  512
             HD+ FA RP  ++  I+ Y + D+AFSPYGDYW+QMRKIC+LELLS K V+SF + R++E
Sbjct  98    HDISFADRPEFLSSKILGYDNLDIAFSPYGDYWKQMRKICLLELLSPKSVRSFGTLREDE  157

Query  513   LSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAG  692
              S ++ SI+ S+    P N+T+K   FT+ ++ + AFG+  +  Q + I L+   +  +G
Sbjct  158   ASKVIRSIKSSNS---PVNITDKAFTFTNDIVCRAAFGKSFAH-QDRLITLINGAILASG  213

Query  693   GFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS--TNSSGKDE  866
             GFD+ DLFPS K++H  SG+KP LLKLHHE+D++ + II + K+     S    S  + E
Sbjct  214   GFDIADLFPSLKFLHSLSGLKPTLLKLHHEIDQMLENIISERKQKRANQSIPVGSQSEVE  273

Query  867   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1046
             D+VDVLLR+KE G+   PI+ D++KAVI D+F+ GTETSA TI +AM+E+I+   VM   
Sbjct  274   DLVDVLLRLKESGDFNIPISTDSVKAVIWDIFAAGTETSAATIDYAMAELIRNAGVMENV  333

Query  1047  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1226
             QAE+RQ LKG +T  + DL+ L YLK VIKETLRLHPPLPLI PRE  E  KI  Y IP 
Sbjct  334   QAELRQVLKGRETVQETDLKELNYLKAVIKETLRLHPPLPLILPRECREPCKIAGYDIPV  393

Query  1227  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1406
             KT+V+INAWA+  +PE W  PERF PERF +S  D +G ++E+IPFG GRR+CPG+SF  
Sbjct  394   KTKVMINAWAIHRHPEVWPSPERFKPERFLDSGSDSIGMNFEYIPFGGGRRICPGVSFGS  453

Query  1407  TSIALSLAGLLYHFNWELPDG-VSPKDLDMTEAVGVIASKKKDLCLIA  1547
               + L LA LLYHF+W LP+G +SP+  DMTEA G  A +K  L L+A
Sbjct  454   AGVELLLAKLLYHFDWSLPNGTISPQMPDMTEAFGATARRKSSLILVA  501



>ref|XP_003550472.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=559

 Score =   493 bits (1270),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/473 (52%), Positives = 336/473 (71%), Gaps = 12/473 (3%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHLVGGS-LPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
              KLPPGPWKLP+IG+L  L   S LPH  +R L++KYGP+MHLQLGEISAV++S P +A+
Sbjct  84    HKLPPGPWKLPIIGNLLQLAAASSLPHHAIRELAKKYGPLMHLQLGEISAVIVSSPNMAK  143

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              I KTHDL FA RP  +A DI+ Y S D+AF+PYGDYWRQMRKIC LELLS K V+SF +
Sbjct  144   EIMKTHDLAFAQRPKFLASDIMGYGSVDIAFAPYGDYWRQMRKICTLELLSAKKVQSFSN  203

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R++E++ L+  I+  S  G P NLT  ++ F S+ +++  FG + ++D  +F+ + ++ 
Sbjct  204   IREQEIAKLIEKIQ--SSAGAPINLTSMINSFISTFVSRTTFGNI-TDDHEEFLLITREA  260

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
             + +A GFDL D+FPS K +H  +G+K K+ K+H ++DKI D II   KEN  AN      
Sbjct  261   IEVADGFDLADMFPSFKPMHLITGLKAKMDKMHKKVDKILDKII---KENQ-ANKGMGEE  316

Query  858   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
             K+E++V+VLLRV+  G L  PIT +NIKAVI D+F+ GT+TSA  I WAMSEM++ P V 
Sbjct  317   KNENLVEVLLRVQHSGNLDTPITTNNIKAVIWDIFAAGTDTSAKVIDWAMSEMMRNPRVR  376

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
              KAQAE+R    G +T  + +L  L+YLK VIKET+RLHPPLPL+ PRE +E  +I  Y 
Sbjct  377   EKAQAEMR----GKETIHESNLGELSYLKAVIKETMRLHPPLPLLLPRECIEACRIDGYD  432

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             +P KT+VI+NAWA+  +PE+W D + F+PERF  +S+DF G  +E+IPFGAGRRMCPGIS
Sbjct  433   LPTKTKVIVNAWAIGRDPENWHDADSFIPERFHGASIDFKGIDFEYIPFGAGRRMCPGIS  492

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             F   ++  +LA LLYHFNWEL  G  P++ DM E+ G +  +K +L LI  P+
Sbjct  493   FGIANVEFALAKLLYHFNWELQQGTKPEEFDMDESFGAVVGRKNNLHLIPIPY  545



>ref|XP_007214747.1| hypothetical protein PRUPE_ppa025066mg [Prunus persica]
 gb|EMJ15946.1| hypothetical protein PRUPE_ppa025066mg [Prunus persica]
Length=514

 Score =   492 bits (1266),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 252/498 (51%), Positives = 349/498 (70%), Gaps = 6/498 (1%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             ++ ++F+  V  I  +R ++N +    LPPGPWKLP+IG+LH L  GSLPH  LR+L++K
Sbjct  12    LAFLLFMIMVLKIGKIRGKTNYSA-SNLPPGPWKLPVIGNLHRL-AGSLPHHRLRDLAKK  69

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHL+LGE+SAVV+S  + A+ + KTHDL+FASRP I+A +I+ Y STD+ F+PYG+
Sbjct  70    YGPLMHLKLGEVSAVVVSSAEFAKEVMKTHDLIFASRPTILAANILSYGSTDIGFAPYGE  129

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKIC LELLS K V+SF   R+EE+ NL+  I  +S  G P NLT+++   T ++
Sbjct  130   YWRQLRKICTLELLSTKRVQSFRPIREEEVVNLIQWI--ASRAGSPINLTQEIYSSTYTI  187

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
              ++ AFG+  + DQ KFI ++K+ +  A GF L D+FPS   +H  S M+PKL +LH E 
Sbjct  188   TSRTAFGKK-TRDQEKFIYIVKEFVKAASGFALADIFPSVSLLHLLSRMRPKLERLHKEA  246

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMF  962
             DKI   II +H+ N +   +     DED+VDVLL+  + G EL+F +T +NIKAVI D+F
Sbjct  247   DKIMGNIIKEHQRNVVNTKSGEGEADEDLVDVLLKFHDHGNELEFSLTTENIKAVIFDIF  306

Query  963   STGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKET  1142
             + G+ETS+T + WA++EMIK P VM  AQ EVR+        D+  +  + YL LVIKET
Sbjct  307   AAGSETSSTAVDWAIAEMIKNPRVMNMAQNEVRELFNRKGQVDETCIREMKYLNLVIKET  366

Query  1143  lrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENS  1322
             LRLHPP PL+ PRE  E+ +I  Y IP K++VI+NAWA+  +P  W +PE F P RF ++
Sbjct  367   LRLHPPGPLLLPRECGEKCEIDGYEIPVKSKVIVNAWAIGRDPNYWNEPESFNPNRFLDN  426

Query  1323  SVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEA  1502
             S+D+ G ++E+IPFGAGRRMCPG+SF   S+ L LA LLYHF+W+LP+G+  +DLDMTEA
Sbjct  427   SIDYKGTNFEYIPFGAGRRMCPGVSFGLASVELPLALLLYHFDWKLPNGMKHEDLDMTEA  486

Query  1503  VGVIASKKKDLCLIARPF  1556
              G    +K DL LI  P+
Sbjct  487   FGATVKRKHDLHLIPIPY  504



>ref|XP_004512032.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=508

 Score =   491 bits (1263),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 257/506 (51%), Positives = 347/506 (69%), Gaps = 11/506 (2%)
 Frame = +3

Query  36    EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGS-L  212
             E++  F+  P  V++ L ++   Y  +  +      KLPPGP KLPLIG+LH L   S L
Sbjct  5     EVQLSFVLIPFFVLLLLHWLTKHYKPKTIA-----YKLPPGPRKLPLIGNLHQLAFASKL  59

Query  213   PHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYK  392
             PH  L+ LS KYGP+MHLQLGEIS V++S P+ A+ + KTHD+VFA+RP +++  I+ Y 
Sbjct  60    PHHALKILSHKYGPLMHLQLGEISTVIVSSPKFAKEVMKTHDVVFANRPKLLSPQILAYG  119

Query  393   STDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNL  572
               D+ FSPYGDYWRQMRKICVLE+LS+K V+SF   R++E +  + SI+  S +G   NL
Sbjct  120   FKDIVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYIREDETTKFIKSIK--SFSGSTINL  177

Query  573   TEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGM  752
             T ++    +S+I++ AFG   SEDQ +F++L+++ ++L+GG +L DLFPS K IH  +GM
Sbjct  178   TSRIFSVINSIISRAAFGD-KSEDQDEFVSLIRKAIALSGGLELDDLFPSMKPIHILTGM  236

Query  753   KPKLLKLHHELDKIFDIIIGDHKENH--LANSTNSSGKDEDIVDVLLRVKEGGELQFPIT  926
             K K  K+H  +DKI D ++  H+E      +      + ED+VDVLLRV++ G L   +T
Sbjct  237   KSKFEKIHKRVDKILDNVVRKHEEKRAITKDEKKIEAEKEDLVDVLLRVQQSGSLDIQMT  296

Query  927   EDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLE  1106
              +NIKAVI D+F  GT+TS+TTI W+MSEM+K P V  KAQAE+R+A +G     + D+ 
Sbjct  297   INNIKAVIWDIFVAGTDTSSTTIEWSMSEMMKNPRVRDKAQAELREAFRGKDKICETDMH  356

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              LTYL LVIKETLRLHPP PL+ PRE  E   I  Y IP KT ++INAWA+  +PE W D
Sbjct  357   QLTYLNLVIKETLRLHPPSPLLVPRECYELTNIDGYDIPKKTTILINAWAMGRDPEHWSD  416

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
              ERF+PERF+ S +DF GN++E+IPFGAGRRMCPG+SF   S+   LA LLYHFNWELP+
Sbjct  417   AERFIPERFDGSFIDFKGNNFEYIPFGAGRRMCPGMSFGLASVMFPLALLLYHFNWELPN  476

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLI  1544
              + P D DM E  G+   +K +LCLI
Sbjct  477   HMKPHDFDMIEHFGMTVGRKNELCLI  502



>ref|XP_010653207.1| PREDICTED: cytochrome P450 71D9-like [Vitis vinifera]
Length=504

 Score =   490 bits (1262),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 249/474 (53%), Positives = 336/474 (71%), Gaps = 5/474 (1%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             K PPGPWKLPLIG+LH LVG SLPH +LR+L++KYGP+MHLQLG++S +V+S P++A+ +
Sbjct  33    KRPPGPWKLPLIGNLHQLVG-SLPHHSLRDLAKKYGPLMHLQLGQVSMLVVSSPEIAKEV  91

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              KTHD+ FA RP+++A  IV Y STDVAFSPYGDYWRQ+RKICV+ELLS K VKSF   R
Sbjct  92    MKTHDINFAQRPHLLATRIVSYDSTDVAFSPYGDYWRQLRKICVVELLSAKRVKSFQVIR  151

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             +EE+S L+  I  SS   FP NL +++S FT S I++ A G+ C +D     A   +   
Sbjct  152   KEEVSKLIRIINSSSR--FPINLRDRISAFTYSAISRAALGKEC-KDHDPLTAAFGESTK  208

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD  863
             LA GF L DL+PS KWI   SG++ KL K+   +D I  I++ +H+E  +  +T    ++
Sbjct  209   LASGFCLADLYPSVKWIPLVSGVRHKLEKVQQRIDGILQIVVDEHRER-MKTTTGKLEEE  267

Query  864   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1043
             +D+VDVLL++++ G+L+ P+T+DNIKAVI D+F  G +T +T + W M+EM+K P VM K
Sbjct  268   KDLVDVLLKLQQDGDLELPLTDDNIKAVILDIFGGGGDTVSTAVEWTMAEMMKNPEVMKK  327

Query  1044  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1223
             AQAEVR+   G    D+  ++ L +LK VI ETLRLHPP PL+ PRE  E+ KI  Y +P
Sbjct  328   AQAEVRRVFDGKGNVDEAGIDELKFLKAVISETLRLHPPFPLLLPRECREKCKINGYEVP  387

Query  1224  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1403
              KTRV+INAWA+   P+ W + ERF PERF +SS+D+ G  + FIPFG+GRR+CPGI F 
Sbjct  388   VKTRVVINAWAIGRYPDCWSEAERFYPERFLDSSIDYKGADFGFIPFGSGRRICPGILFG  447

Query  1404  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVDL  1565
                I L LA LL+HF+W+LP+G+ P+DLDMTE  G+   KK +L LI  P+  L
Sbjct  448   IPVIELPLAQLLFHFDWKLPNGMRPEDLDMTEVHGLAVRKKHNLHLIPIPYSPL  501



>gb|KDP39256.1| hypothetical protein JCGZ_01013 [Jatropha curcas]
Length=488

 Score =   489 bits (1258),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 241/482 (50%), Positives = 352/482 (73%), Gaps = 4/482 (1%)
 Frame = +3

Query  111   LRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAV  290
             +R+ S   +   LPPGP KLP+IG++H+LVG SLPH  L+NL++KYGP+MHLQLGE++ +
Sbjct  5     IRKISESKKLLNLPPGPLKLPIIGNIHNLVG-SLPHHRLQNLAKKYGPLMHLQLGEVTTI  63

Query  291   VISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  470
             V++  ++A+ + + HD+VF++RP+I+A +I+ Y +T + FSPYG+YWRQ+RKICVLELLS
Sbjct  64    VVTSAEIAKEVMRAHDIVFSNRPSILAANIISYNATSIVFSPYGEYWRQLRKICVLELLS  123

Query  471   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  650
              K V+SF S R+EE+SN+V   R+SS +    NL+  +   T S+ ++ AFG++  E Q 
Sbjct  124   AKRVQSFKSIREEEVSNIVR--RISSSSDSLINLSRMLFSLTYSITSRAAFGKIRKE-QE  180

Query  651   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  830
              FI L+++++ + GGF + DLFPS K ++  +GMK ++ +LH E DKI + II +H+ + 
Sbjct  181   AFIPLVEEIIEVGGGFSIADLFPSIKLLNRINGMKSRVERLHQEADKILENIINEHRASK  240

Query  831   LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1010
                   S G+ +D+VDVLL ++E G+L F +T +NIKAVI D+F  G+ETS+TT+ WAMS
Sbjct  241   ARAKPGSKGEADDLVDVLLNIQEQGDLGFALTTNNIKAVILDLFIAGSETSSTTVEWAMS  300

Query  1011  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             E++K  SVM KAQAE+RQ  K     D++ +  L YLKL++KETLRLHPP+PL+ PRE+ 
Sbjct  301   ELLKNTSVMKKAQAELRQVFKNKGYVDEEGVCELNYLKLIVKETLRLHPPVPLLVPRENS  360

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             E  +I  Y IP K+RV+IN WA+  +P  W++PERF PERF ++S+D+ G+++EFIPFGA
Sbjct  361   ELCEINGYFIPVKSRVLINVWAIGRDPNYWKEPERFNPERFLDNSIDYKGSNFEFIPFGA  420

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRR+CPGI F   ++ L LA LLYHF+W+LP  ++P++L+MTEA G+   +K DL LI  
Sbjct  421   GRRICPGILFGIANVELPLANLLYHFDWKLPGEINPENLEMTEASGIAVRRKNDLNLIPI  480

Query  1551  PF  1556
              F
Sbjct  481   TF  482



>ref|XP_010655870.1| PREDICTED: cytochrome P450 71D10-like [Vitis vinifera]
 emb|CBI39021.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   489 bits (1259),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 255/499 (51%), Positives = 354/499 (71%), Gaps = 11/499 (2%)
 Frame = +3

Query  69    SVIVFLS--FVFCIYTLRRR-SNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLS  239
             S I+F S  F++ +Y + +R       QKLPPGPWKLPLIG++H L+ GSLPH +L  L+
Sbjct  6     SSILFASLLFLYMLYKIGKRWRGNISSQKLPPGPWKLPLIGNMHQLIDGSLPHHSLSRLA  65

Query  240   RKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPY  419
             ++YGP+M LQLGEIS ++IS P++A+ I KTHD+ FA R + +A + V Y STD+ FSPY
Sbjct  66    KQYGPLMSLQLGEISTLIISSPEMAKQILKTHDINFAQRASFLATNTVSYHSTDIVFSPY  125

Query  420   GDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTS  599
             GDYWRQ+RKICV+ELL+ K VKSF   R+EELSNL+++  L+S +  P NLT+K+S  T 
Sbjct  126   GDYWRQLRKICVVELLTSKRVKSFQLIREEELSNLITT--LASCSRLPINLTDKLSSCTF  183

Query  600   SLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHH  779
             ++IA+ AFG  C E Q  FI++LK+ L L  G  + D++PS KW+   SGM+ K+ K+  
Sbjct  184   AIIARAAFGEKCKE-QDAFISVLKETLELVSGPCVADMYPSVKWLDLISGMRHKIEKVFK  242

Query  780   ELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDM  959
               D+I   I+ +H+E     +    G +ED+VDVLL++++ G+L+FP+T++NIKAVI D+
Sbjct  243   RTDRILQNIVDEHREKMKTEAGKLQG-EEDLVDVLLKLQQHGDLEFPLTDNNIKAVILDI  301

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKE  1139
             F+ G ET++ ++ WAMSEM+K P VM KAQAEVR+   G    D    E L +LK+V+KE
Sbjct  302   FAGGGETTSISVEWAMSEMLKNPRVMDKAQAEVRRVFDGKGNAD----EELKFLKVVVKE  357

Query  1140  TlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFEN  1319
             TLRLHPP PL+ PRE  E  +I  Y IP KT +I+NAWA+  + + W + ERF PERF +
Sbjct  358   TLRLHPPFPLLIPRECREMCEINGYEIPKKTLIIVNAWAIGRDSDHWVEAERFYPERFLD  417

Query  1320  SSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTE  1499
             SS+D+ G  + +IPFGAGRRMCPGI F+   I LSLA LLY+F+W+LP+G+   DLDMTE
Sbjct  418   SSIDYKGTDFGYIPFGAGRRMCPGILFSLPIIELSLAHLLYNFDWKLPNGMKADDLDMTE  477

Query  1500  AVGVIASKKKDLCLIARPF  1556
             A+G+   +K+DL LI  P+
Sbjct  478   ALGIAVRRKQDLHLIPIPY  496



>ref|XP_006363816.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363817.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=503

 Score =   489 bits (1258),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 250/496 (50%), Positives = 354/496 (71%), Gaps = 10/496 (2%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
             +I FL FV     L ++S    + KLPPGP KLPLIG+LH L   SLPH TL+NLS KYG
Sbjct  13    LIAFLLFVAIALKLWKKSK--IQYKLPPGPRKLPLIGNLHQL-SNSLPHHTLKNLSNKYG  69

Query  252   PIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYW  431
             P+MHLQLGE+SAV++S PQ+A+ + KTHD++FA+RP ++++ I+   S  ++FSPYG  W
Sbjct  70    PMMHLQLGEVSAVIVSSPQVAKEVLKTHDIIFANRPQLLSVQILSNNSPTLSFSPYGANW  129

Query  432   RQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIA  611
             RQ+RK+CVLELLS K V+SF S R+EE+ NL+ +I    +   P +++E +   T+++ A
Sbjct  130   RQLRKVCVLELLSAKRVQSFESIREEEVENLIEAISFI-QPQVPIDISEMLFSMTNNITA  188

Query  612   KVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDK  791
             + AFG+ C + + +FI  +K +  L+GGFD+ DLFPS K  H  SG++  L K+H  +DK
Sbjct  189   RAAFGKKC-KHKDEFIKAMKTITELSGGFDIPDLFPSLKIFHSLSGVRSALEKVHQNVDK  247

Query  792   IFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTG  971
             IF+ II +HK    AN  +   K ED+VDVLLRV+E G+L+ PI+ + +K+VI ++F  G
Sbjct  248   IFEDIIQEHK----ANKRDMLYK-EDLVDVLLRVQESGDLEIPISRNTLKSVILEIFIGG  302

Query  972   TETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrl  1151
             T+TS+T + WA+SEM+K P VM KAQAEVR+  KG     + +++ L Y+KLVIKETLR+
Sbjct  303   TDTSSTVLEWAISEMMKNPQVMEKAQAEVRRVFKGKSKITESEIQKLDYMKLVIKETLRM  362

Query  1152  hpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVD  1331
             HPP PL+ PRE++E+  IG Y IP KT+VIINAWA+  +PE W++ E F PERF++S +D
Sbjct  363   HPPAPLLLPREAIEKCDIGGYEIPAKTKVIINAWAIGRHPEHWKNAECFEPERFQDSDLD  422

Query  1332  FMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGV  1511
             F+G + E+IPFG GRR+CPG  F   ++ L LA LL+HF+W+LPDG+   +LDMTE  G 
Sbjct  423   FIGTNLEYIPFGGGRRICPGTLFGIANVELPLAKLLFHFDWKLPDGIEASNLDMTETFGA  482

Query  1512  IASKKKDLCLIARPFV  1559
                +K DL L+A+P++
Sbjct  483   TVGRKNDLYLVAKPYI  498



>ref|XP_003610580.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92777.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=503

 Score =   488 bits (1256),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 255/513 (50%), Positives = 344/513 (67%), Gaps = 19/513 (4%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQ--KLPPGPWKLPLIGSLHHL-VGGS  209
             ME KF F  +S  +FL  + C+  + ++    + +  KLPPGPWKLPLIG+LH L +GGS
Sbjct  1     MEFKFSFLIISSFIFL--ILCLTKIYKQKIKVKNEVHKLPPGPWKLPLIGNLHQLALGGS  58

Query  210   LPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFY  389
             LPH TLR+LS KYGP+M+LQLGEISAVV+S P LA+ I KTHDL F  RP ++A  I+ Y
Sbjct  59    LPHHTLRDLSNKYGPLMYLQLGEISAVVVSSPDLAKEIMKTHDLSFVQRPELLAPKILSY  118

Query  390   KSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTN  569
              STD+ ++PYGDYWRQMRKIC  +LLS K V  F S R+EE+  L+ SI++S     P N
Sbjct  119   DSTDIVYAPYGDYWRQMRKICTSQLLSAKRVHYFSSIREEEVQKLIQSIQVS--LSLPLN  176

Query  570   LTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSG  749
             +T+      S+ +++ AFG+  S+ + + ++LLKQ + +A GFD  DLFPS K IH  + 
Sbjct  177   VTKTAFSLVSTFVSRAAFGKK-SKYEDELLSLLKQTVEMASGFDPADLFPSFKPIHLITR  235

Query  750   MKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITE  929
              K KL  +  +LDKI + II +H+ N +        + E++VDVLLRV++      PIT+
Sbjct  236   TKAKLQNMQKKLDKILESIIKEHQSNSIHGK-----QGENLVDVLLRVQQSDNFDIPITD  290

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLEN  1109
             DN+KAV+ DMF+ G++TSAT I WAMSE++K   VM KAQ+E+R+A+KG K   + DL  
Sbjct  291   DNVKAVLWDMFAAGSDTSATVIEWAMSELMKNSRVMKKAQSEIREAVKGKKRIYESDLHE  350

Query  1110  LTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDP  1289
             L+YLK VIKET     P   + PRE  E   I  Y IP KT VI+NAWA+  +P+ W D 
Sbjct  351   LSYLKSVIKET-MRLHPPFTLLPRECREACNIDGYEIPIKTSVIVNAWAIGRDPKHWYDA  409

Query  1290  ERFLPERFENSS-VDF----MGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNW  1454
             ++F+PERF +S+  DF      N ++++PFG GRRMCPGIS    +I L LA LLYHFNW
Sbjct  410   KKFIPERFNDSTGFDFNKLNNNNSFDYMPFGGGRRMCPGISLGLANIELPLAALLYHFNW  469

Query  1455  ELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             ELP+G+ P+DLDMTEA G  A+++  L LI  P
Sbjct  470   ELPNGMKPEDLDMTEAFGAAAARRNGLYLIPTP  502



>ref|XP_007147597.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
 gb|ESW19591.1| hypothetical protein PHAVU_006G138100g [Phaseolus vulgaris]
Length=506

 Score =   488 bits (1256),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 248/473 (52%), Positives = 334/473 (71%), Gaps = 8/473 (2%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
             ++LPPGPWKLP+IG+LH L V  +LPHR L  L++KYGP+MHLQLG+ISAV++S P +A+
Sbjct  30    RRLPPGPWKLPIIGNLHQLAVASTLPHRALGELAQKYGPLMHLQLGQISAVIVSSPSIAK  89

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              I KTHDL FA RP  +A DI+ Y S D+AF+PYGDYWRQMRK+C LELLS K V+SF  
Sbjct  90    EIMKTHDLAFAQRPKFLASDIMGYGSGDIAFAPYGDYWRQMRKLCTLELLSAKKVQSFFH  149

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R+EE++ L+ +I+  S  G P +L+ +   F S+ +++  FG++ +ED  +F+  +K+ 
Sbjct  150   IREEEVAKLIKTIQ--SSAGEPIDLSSRFGSFISTFVSRATFGKI-NEDHEEFVLTVKEA  206

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
             + +A GFDL D FPS K IH  +G+K KL K+H + DKI + II   +EN  AN      
Sbjct  207   IEVADGFDLADAFPSFKPIHLITGLKAKLDKMHKKSDKILEKII---RENQ-ANEGMGEE  262

Query  858   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
              +E++V+VLLR +  G L  PIT +NIKAVI D+FS GT+TS   + WAMSEM++ P V 
Sbjct  263   NNENLVEVLLRFQHRGNLDTPITNNNIKAVIWDIFSAGTDTSTKVLEWAMSEMMRNPRVR  322

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
              KAQ E+RQ     +T  + +L  LTYLK VI+ETLRLHPPLPL+ PRE +E   I  Y 
Sbjct  323   EKAQYEIRQKFSLKETTHESNLGELTYLKAVIRETLRLHPPLPLLLPRECIETCSIDGYD  382

Query  1218  IPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGIS  1397
             IP KT+VI+NAWA+  + + W D E F+PERF ++ +DF G  +E+IPFGAGRRMCPGIS
Sbjct  383   IPIKTKVIVNAWAIGRDADHWHDSESFIPERFHDTCIDFKGTDFEYIPFGAGRRMCPGIS  442

Query  1398  FAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             F   ++ L+LA LLYHFNWELP+G+ P +LDM EA G +  +K +L LI  P+
Sbjct  443   FGIANVELALAKLLYHFNWELPEGMKPGELDMDEAFGAVVGRKNNLHLIPIPY  495



>ref|XP_011081935.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=506

 Score =   487 bits (1254),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 264/503 (52%), Positives = 359/503 (71%), Gaps = 11/503 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFC-IYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
             ME +  F+  ++++F SF+F  I    + ++P + +KLPP P KLP+IG LHHLVGG LP
Sbjct  6     MEIQLPFSFTTLLLFSSFIFLLIRAWEKLNSPKKYEKLPPSPPKLPVIGHLHHLVGG-LP  64

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H  LR +++KYGP+++L+LGE+SAVVIS  +  + + K  D   A RP  +   I++Y  
Sbjct  65    HHALRRVAQKYGPVLYLKLGEVSAVVISSREATKEVVKLQDPACADRPESIGSKIMWYDY  124

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             TD+AFS Y +YWRQMRKIC+LELLS K VKSF S RQ+E+S L+ S  L S +G   NLT
Sbjct  125   TDIAFSAYNEYWRQMRKICILELLSAKNVKSFGSIRQDEVSRLMKS--LQSSSGQAINLT  182

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             EKV  FTSS+  + AFG+V   D+   IA+LK+ +++AGGF+L DLFPS K +H  S  K
Sbjct  183   EKVFAFTSSITCRAAFGKVM-RDRDVLIAMLKKAVTMAGGFELADLFPSSKLLHVLSWNK  241

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDN  935
              KLL++  +LD I D I+ +HK   L  S    G  EDIVDVLLR+++ GELQFPIT DN
Sbjct  242   YKLLRMRRKLDTILDAILEEHK---LKQSGEFGG--EDIVDVLLRMQKTGELQFPITNDN  296

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             IKAVI DMFS GTETS+TTI WAM+E+++ P VMAK QAE ++A KG  T ++ D++ L 
Sbjct  297   IKAVIFDMFSAGTETSSTTIDWAMAELMRNPRVMAKVQAEQKEAFKGKTTVEESDVQALK  356

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             YLKLVIKET RLHPP+PL+      +E K+  Y IP K++V+IN W +  +PE W  PE 
Sbjct  357   YLKLVIKETFRLHPPIPLLPRA-CRDECKVNGYTIPLKSKVMINIWGMGRDPEYWHQPET  415

Query  1296  FLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS  1475
             F PERF+N+S+DF+GN++E+IPFGAGRR+CPG++F   ++ L LA LLYHF+W++P G++
Sbjct  416   FQPERFDNNSIDFLGNNFEYIPFGAGRRICPGMNFGLANVELPLAKLLYHFDWKMPKGMT  475

Query  1476  PKDLDMTEAVGVIASKKKDLCLI  1544
             P D+DMTEA G+  S++  L L+
Sbjct  476   PDDIDMTEAEGIAVSRRNGLVLV  498



>gb|EYU21988.1| hypothetical protein MIMGU_mgv1a004711mg [Erythranthe guttata]
Length=513

 Score =   488 bits (1255),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 247/517 (48%), Positives = 358/517 (69%), Gaps = 15/517 (3%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
             M+  F +N  ++ +F+  +  +    R+S     + LPPGP  LP+IG LHHL   +LP 
Sbjct  1     MDFGFSWNFTTLALFVPVILLLIRKWRKSKSDSVKNLPPGPTPLPIIGDLHHLT--ALPF  58

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
             R+ R LS+KYGP+MHL+LG++S +V+S P++A+ + K HD  FA RP  + ++I++Y  T
Sbjct  59    RSFRELSKKYGPLMHLKLGQVSTIVVSSPEIAKQMLKEHDPSFADRPRSVGIEIMWYDYT  118

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             ++AFSPYG+YWRQMRKICV+ELLS K V+SF S R++E+S LV S+R  + +G P NLT+
Sbjct  119   NIAFSPYGNYWRQMRKICVIELLSPKSVRSFASIRKDEVSGLVDSLRRCAASGEPINLTD  178

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
             K+    SS+  + AFG+V S+D    I LLK+ + +A GF++ DLFP  K I+  S  + 
Sbjct  179   KIFSLMSSITCRAAFGKV-SKDNEALIKLLKEGIEMASGFEISDLFPGSKIINALSKGRF  237

Query  759   KLLKLHHELDKIFDIIIGDHKENHLANST----------NSSGKDEDIVDVLLRVKEGGE  908
             KLLK+  +LD+I D II +HK N    +T          N    +ED+VDV LR++E GE
Sbjct  238   KLLKMRRKLDEILDSIIDEHKANLAKMATENAESAVKRGNGDDGNEDLVDVFLRIQENGE  297

Query  909   LQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTF  1088
             L+FPI  +NIKAV+ DMFS GT+TS+T I W M+E+++ P VMAKAQAEVR+A K  +  
Sbjct  298   LEFPIGNNNIKAVLQDMFSAGTDTSSTAIEWTMTELMRNPRVMAKAQAEVREAFKETEPI  357

Query  1089  DDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATN  1268
             D+ + ++L YLK+VIKE+LRLHPP+PL+    S EE  +  Y IP   +V++N WA+  +
Sbjct  358   DEGNTQHLKYLKMVIKESLRLHPPVPLLPRA-SREETVVNGYTIPANVKVLVNNWAIQRD  416

Query  1269  PESWEDPERFLPERFE-NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYH  1445
             P+ WE+P+ F PERFE  +S DF+G  +E++PFG+G+RMCPGI+F+  S+ L LA LLY 
Sbjct  417   PKHWENPDSFEPERFEKKNSRDFLGGDFEYLPFGSGKRMCPGITFSLASVELFLAQLLYS  476

Query  1446  FNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             FNW+LPDGV+P ++D+TE  G+ A +K++L ++A P 
Sbjct  477   FNWKLPDGVNPGNMDLTENPGITAQRKENLYVVALPL  513



>ref|XP_003530791.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
Length=510

 Score =   487 bits (1253),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 247/509 (49%), Positives = 355/509 (70%), Gaps = 16/509 (3%)
 Frame = +3

Query  51    FLFNPVSVIVFLSFVFCIYTLRRRSNPARR-------QKLPPGPWKLPLIGSLHHLVGGS  209
             FLF     +  +SF+F I  +++    +++         +P GP KLP+IG++++L+  S
Sbjct  5     FLF----FVALISFLFTILIVQKLGKKSKKTDDTTCDMHMPHGPRKLPIIGNIYNLIC-S  59

Query  210   LPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFY  389
              PHR LR+L+ KYGP+MHLQLGE+S +VIS P  A+ +  THD+ FA+RP I+A +I+ Y
Sbjct  60    QPHRKLRDLAIKYGPVMHLQLGEVSTIVISSPDCAKEVMTTHDINFATRPQILATEIMSY  119

Query  390   KSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTN  569
              ST +AFSPYG+YWRQ+RKIC+LELLS+K V S+   R+EEL NLV  I  +SE G P N
Sbjct  120   NSTSIAFSPYGNYWRQLRKICILELLSLKRVNSYQPVREEELFNLVKWI--ASEKGSPIN  177

Query  570   LTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSG  749
             LT+ V     ++ ++  FG+ C +DQ KFI++L + + ++ GF++GDLFPS  W+ + +G
Sbjct  178   LTQAVLSSVYTISSRATFGKKC-KDQEKFISVLTKSIKVSAGFNMGDLFPSSTWLQHLTG  236

Query  750   MKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITE  929
             ++PKL +LH + D+I + II DHKE   + +     + +D+VDVL++ ++G +  F +T+
Sbjct  237   LRPKLERLHQQADQILENIINDHKEAK-SKAKGDDSEAQDLVDVLIQYEDGSKQDFSLTK  295

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLEN  1109
             +NIKA+I D+F+ G ETSATTI WAM+EMIK P VM KAQAEVR+    N   D+  +  
Sbjct  296   NNIKAIIQDIFAAGGETSATTIDWAMAEMIKDPRVMKKAQAEVREVFGMNGRVDENCINE  355

Query  1110  LTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDP  1289
             L YLKL++KETLRLHPP PL+ PRE  +  +I  Y IP KT+VI+NAWA+  +P+ W + 
Sbjct  356   LQYLKLIVKETLRLHPPAPLLLPRECGQTCEIHGYHIPAKTKVIVNAWAIGRDPKYWTES  415

Query  1290  ERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDG  1469
             ERF PERF +S++D+ GN +EFIPFGAGRR+CPG + A  +I L+LA LLYHF+W LP+G
Sbjct  416   ERFYPERFIDSTIDYKGNSFEFIPFGAGRRICPGSTSALRTIDLALAMLLYHFDWNLPNG  475

Query  1470  VSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +   +LDM+E  GV   +K DL L+  P+
Sbjct  476   MRSGELDMSEEFGVTVRRKDDLILVPFPY  504



>ref|XP_009347232.1| PREDICTED: cytochrome P450 71D11-like [Pyrus x bretschneideri]
Length=512

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 256/508 (50%), Positives = 345/508 (68%), Gaps = 7/508 (1%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQ-KLPPGPWKLPLIGSLHHLVGGSLP  215
             ME ++ F  V +  FL  V  +  + +RS        LPPGPWKLP IG++H LVG S P
Sbjct  1     MELQWPFFQV-LFAFLLVVITVLKIAKRSKTKESAVNLPPGPWKLPFIGNIHQLVG-SQP  58

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H  LRNL++KYGPIMHLQLGE+S VV+S  + A+ + KTHD+V +SRP ++A  I+ Y++
Sbjct  59    HHGLRNLAKKYGPIMHLQLGEVSTVVVSSAEYAKEVMKTHDVVLSSRPYLLASRIMSYEA  118

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             T++AF+P GDYWRQ+RKIC LELLS K V+ F   R+EE+ NL++ I   S  G P NLT
Sbjct  119   TNIAFAPCGDYWRQLRKICTLELLSTKRVQGFRPLREEEVGNLITWI--GSNAGLPINLT  176

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             EK+   T +  ++ AFG+  SED  KFI  +K+ +++A GFDL D+FPS K ++   G++
Sbjct  177   EKIYSSTYTFTSRAAFGKK-SEDHEKFIDAVKESITVAAGFDLADVFPSAKLLNLIGGIR  235

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKE-GGELQFPITED  932
             P L +L    D+I + II +HK+      +      ED+VDVLL+  E G  L+F +T D
Sbjct  236   PTLERLKKVTDRIMENIINEHKKKRSTTKSGEGEAGEDLVDVLLKFHERGNGLEFSLTTD  295

Query  933   NIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENL  1112
             NIKAVI D+F  G+ETSATT+ WAMSEMIK P ++   Q EVR+    N   D+  +  +
Sbjct  296   NIKAVILDIFGAGSETSATTVDWAMSEMIKNPRILKMTQDEVREVYNRNGKADETGIREM  355

Query  1113  TYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPE  1292
              YL LVIKETLRLHPP PL+ PRES E  KI  Y IP KT+VI+N WA+  +P  W +PE
Sbjct  356   KYLSLVIKETLRLHPPAPLLLPRESSECCKINGYDIPVKTKVIVNGWAIGRDPNYWTEPE  415

Query  1293  RFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGV  1472
              F PERF +SS+D+ G ++E+IPFGAGRR+CPGIS+   ++ L LA LLYHF+W+LP+G+
Sbjct  416   SFYPERFLDSSIDYKGTNFEYIPFGAGRRICPGISYGLANVELPLALLLYHFDWKLPNGM  475

Query  1473  SPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             S +DLDMTE  GV   +K+DL LI  P+
Sbjct  476   SQEDLDMTELFGVTVRRKEDLRLIPIPY  503



>ref|XP_007146610.1| hypothetical protein PHAVU_006G054700g [Phaseolus vulgaris]
 gb|ESW18604.1| hypothetical protein PHAVU_006G054700g [Phaseolus vulgaris]
Length=508

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 245/504 (49%), Positives = 357/504 (71%), Gaps = 12/504 (2%)
 Frame = +3

Query  69    SVIVFLSFVFCIYTLRRRSNPARRQ-----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             S ++F  F+F    +++  N  R++     K+P GP KLP+IG++H+L+  S PHR LR+
Sbjct  9     SALIF--FIFLALIVQKIGNKPRKRDETTSKIPHGPTKLPIIGNIHNLLS-SQPHRKLRD  65

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L+ KYGP+MHLQLGE+S +VIS P+ A+ + KTHD+ FASRP + A+D++ Y  TD+AF+
Sbjct  66    LALKYGPLMHLQLGEVSTIVISSPECAKEVMKTHDINFASRPKVPAMDLMTYNCTDIAFA  125

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYG+YWRQ+RKIC LELLS+K V S+   R+EELSNLV  I   SE G P NLT+ +   
Sbjct  126   PYGNYWRQLRKICTLELLSLKRVNSYQPIREEELSNLVKWI--YSEKGSPINLTQALLSS  183

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
               ++ ++ AFG+ C +DQ  FI+++K+ + L GGF +GDLFPS  W+ + +G +PKL + 
Sbjct  184   IYTIASRSAFGKKC-KDQENFISVVKKTIKLVGGFHIGDLFPSATWLQHVTGTRPKLERF  242

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
             + + D+I + II +HKE   + + +   + ED+VDVL++ ++G +  F +T +NIKA+I 
Sbjct  243   YQQTDQIIENIINEHKEAK-SKAKDYEREAEDLVDVLIQYEDGSKQDFALTRNNIKAIIV  301

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D+F+ G ETSATTI+WAM+E++K   VM KAQAEVR+     +  D+  +  L YLKLV+
Sbjct  302   DIFAAGGETSATTIVWAMAEIMKDSRVMRKAQAEVREVFNMKRRVDENCITELKYLKLVV  361

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KETLRLHPP PL+ PRE  +  +I  Y IP K++VI+NAWA+  +P  W +PERF PERF
Sbjct  362   KETLRLHPPAPLLLPRECGKTCEIHGYNIPAKSKVIVNAWAIGRDPNYWTEPERFYPERF  421

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
              +S+VD+ GN++E+IPFGAGRR+CPGI FA   + ++LA LLYHF+W+LP G+  ++LDM
Sbjct  422   IDSTVDYKGNNFEYIPFGAGRRICPGIIFASRVVEVTLAMLLYHFDWKLPSGMISEELDM  481

Query  1494  TEAVGVIASKKKDLCLIARPFVDL  1565
             +E  G+   +K DL L+  P++ L
Sbjct  482   SEEFGITVRRKHDLFLVPFPYLPL  505



>ref|XP_004247352.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=502

 Score =   486 bits (1251),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 239/480 (50%), Positives = 338/480 (70%), Gaps = 13/480 (3%)
 Frame = +3

Query  138   RQKLPPGPWKLPLIGSLHHLVGGS----LPHRTLRNLSRKYGPIMHLQLGEISAVVISYP  305
             ++KLPPGPWKLPLIG+LHHL+       LPHRTL  L+ K+G +MH++LGE  A+V+S P
Sbjct  28    KKKLPPGPWKLPLIGNLHHLIDWQSSELLPHRTLAKLASKHGDLMHMKLGEREAIVVSSP  87

Query  306   QLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  485
             Q+ R + + HDL+F++RP ++    +FY   D+ F  YGD+WRQMRKIC+ ELLS K ++
Sbjct  88    QMVREVMRKHDLIFSNRPTLLVGTEMFYDHADMGFCNYGDFWRQMRKICIQELLSHKNIQ  147

Query  486   SFCSFRQEELSNLVSSIRLS-SETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  662
             SF      E++NLVS I+ S SE G   N+TE +S +T+S+I K + GR C ++QG  I 
Sbjct  148   SFYPNMMNEITNLVSCIKSSASEGGSSINMTETLSLYTNSIICKASVGRAC-KNQGSLIE  206

Query  663   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  842
             +++ V + AG FDL DLFPS K IH+ SG+K KL K+H E+D + + II +H+      S
Sbjct  207   IMRTVAASAGVFDLADLFPSMKMIHFISGLKYKLRKMHDEVDVVLEEIINEHE------S  260

Query  843   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
              NS   +EDIVDVLLR+++  +   PIT DNIKA+I D+F+ G+ TSA+T+ WA SE++K
Sbjct  261   QNSETSEEDIVDVLLRLQKSQDFSIPITRDNIKAIIIDLFAGGSTTSASTMEWAFSELMK  320

Query  1023  RPSVMAKAQAEVRQALKGNKT-FDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
              P +M KAQ EVRQ  KG +T  D  D++ L Y+K+++KET+R HP  PL+ PRES EE 
Sbjct  321   NPEIMKKAQDEVRQVFKGKETTIDQADIQKLKYIKMIVKETVRFHPLAPLLAPRESREEC  380

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
             +I  Y+IP  T  ++N WA++ +P  W++PE F PERF +S +DF+G H+EF PFG GRR
Sbjct  381   EINGYVIPKGTMALVNFWAISRDPNYWQNPEIFDPERFNDSHLDFIGAHFEFTPFGTGRR  440

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
             +CPG+SF+  ++ LS+A LLYHF+W+LP+G++P +LDMTE  G    +K +L LI  P+V
Sbjct  441   ICPGLSFSMATVELSIALLLYHFDWKLPNGMNPHELDMTEKFGNALERKNNLFLIPLPYV  500



>ref|XP_006367128.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=434

 Score =   483 bits (1244),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 245/437 (56%), Positives = 317/437 (73%), Gaps = 6/437 (1%)
 Frame = +3

Query  258   MHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQ  437
             M+LQLGE+  +V+S P +A+ I KTHDL FASR   M   I  Y  TD+AFSPYG+YWR 
Sbjct  1     MYLQLGEVPTIVVSSPHMAQKIMKTHDLAFASRSQTMLGKIFCYDCTDIAFSPYGEYWRH  60

Query  438   MRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKV  617
             MRK+C++ELLS KMVKSF   R +ELS+LVSSI+    T  P N++EK+ WF +S+  + 
Sbjct  61    MRKLCIMELLSGKMVKSFSPIRLDELSSLVSSIKSMENT--PINVSEKLFWFMNSVTCRS  118

Query  618   AFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIF  797
             +FG+ C +     I+L+  VLSLAGGF+L DL+PSKK++   SGM  KL++  +++D + 
Sbjct  119   SFGKACKDQNEAMISLIHGVLSLAGGFELADLYPSKKFLSGISGMGSKLIEARNKVDTVL  178

Query  798   DIIIGDHKENHLANSTNSS---GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFST  968
             D +I  H+ENH AN    +   G +ED++DV  RV   GEL F +T +NIKAVI DMF  
Sbjct  179   DKVIDVHRENH-ANGKKCNAECGSNEDLIDVFFRVMGTGELPFTLTNNNIKAVILDMFVA  237

Query  969   GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1148
             G++TS++T+ WA+SEM+K PSVMAKAQAEVR+  KG KTFDD DLE + YLKLVIKETLR
Sbjct  238   GSDTSSSTVTWALSEMMKSPSVMAKAQAEVREVFKGKKTFDDDDLEKVDYLKLVIKETLR  297

Query  1149  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSV  1328
             LHPP PL+ PRE  EE +I  YIIP K++V++N WA+  +PESWED E F+PERFENSSV
Sbjct  298   LHPPTPLLVPRECREETEIDGYIIPVKSKVLVNVWAIGRDPESWEDSESFIPERFENSSV  357

Query  1329  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVG  1508
             DF G H++F+PFGAGRR CPG  F    + L LA LLY+FNW LP+G+ P+DLDM EA G
Sbjct  358   DFSGTHFQFLPFGAGRRTCPGRLFGLALVTLPLAHLLYNFNWTLPNGMDPRDLDMNEANG  417

Query  1509  VIASKKKDLCLIARPFV  1559
             + A + KDL LIA P+ 
Sbjct  418   MTARRDKDLYLIATPYT  434



>gb|KHM99473.1| Cytochrome P450 71D11 [Glycine soja]
Length=473

 Score =   484 bits (1246),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 241/470 (51%), Positives = 340/470 (72%), Gaps = 5/470 (1%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAIT  326
             +P GP KLP+IG++++L+  S PHR LR+L+ KYGP+MHLQLGE+S +VIS P  A+ + 
Sbjct  3     MPHGPRKLPIIGNIYNLIC-SQPHRKLRDLAIKYGPVMHLQLGEVSTIVISSPDCAKEVM  61

Query  327   KTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  506
              THD+ FA+RP I+A +I+ Y ST +AFSPYG+YWRQ+RKIC+LELLS+K V S+   R+
Sbjct  62    TTHDINFATRPQILATEIMSYNSTSIAFSPYGNYWRQLRKICILELLSLKRVNSYQPVRE  121

Query  507   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  686
             EELSNLV  I  +SE G P NLT+ V     ++ ++  FG+ C +DQ KFI++L + + +
Sbjct  122   EELSNLVKWI--ASEKGSPINLTQAVLSSVYTISSRATFGKKC-KDQEKFISVLTKSIKV  178

Query  687   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDE  866
             + GF++GDLFPS  W+ + +G++PKL +LH + D+I + II DHKE   + +     + +
Sbjct  179   SAGFNMGDLFPSSTWLQHLTGLRPKLERLHQKADQILENIINDHKEAK-SKAKGDDSEAQ  237

Query  867   DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKA  1046
             D+VDVL++ ++G +  F +T++NIKA+I D+F+ G ETSATTI WAM+EMIK P VM KA
Sbjct  238   DLVDVLIQYEDGSKQDFSLTKNNIKAIIQDIFAAGGETSATTIDWAMAEMIKDPRVMKKA  297

Query  1047  QAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPP  1226
             QAEVR+    N   D+  +  L YLKL++KETLRLHPP PL+ PRE  +  +I  Y IP 
Sbjct  298   QAEVREVFGTNGRVDENCINELQYLKLIVKETLRLHPPAPLLLPRECGQTCEIHGYHIPA  357

Query  1227  KTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAY  1406
             KT+VI+NAWA+  +P+ W + ERF PERF +S++D+ GN +EFIPFGAGRR+CPG + A 
Sbjct  358   KTKVIVNAWAIGRDPKYWTESERFYPERFIDSTIDYKGNSFEFIPFGAGRRICPGSTSAL  417

Query  1407  TSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
              +I L+LA LLYHF+W LP+G+   +LDM+E  GV   +K DL L+  P+
Sbjct  418   RTIDLALAMLLYHFDWNLPNGMRSGELDMSEEFGVTVRRKDDLILVPFPY  467



>gb|KDO38617.1| hypothetical protein CISIN_1g045050mg [Citrus sinensis]
Length=507

 Score =   485 bits (1249),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 254/506 (50%), Positives = 343/506 (68%), Gaps = 7/506 (1%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
             MEH+F   P+ ++ FL F F I+  + ++N +    LPPGPW+LP+IG+LH  VG  LPH
Sbjct  1     MEHQFPPFPI-ILSFLLFAFMIWK-KSKNNHSTLLNLPPGPWRLPVIGNLHQFVG-PLPH  57

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
                 +L++KYGP+MHLQLG++S +VIS P+ A+ + +THD+ FASRP ++A     Y  T
Sbjct  58    HCFGDLAKKYGPLMHLQLGQVSHIVISSPEAAKEVMRTHDMSFASRPFLLAASFFTYNFT  117

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             ++AF+P+GDYWRQ+RKIC LEL S K V+SF S R+EE SNL++SI  SS  G P NL++
Sbjct  118   NIAFAPHGDYWRQVRKICTLELFSAKRVQSFRSIREEEASNLITSI--SSNLGLPVNLSK  175

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
              +    + +  + AFG V  +DQ + + +  + + L+GGF L D+FPS K +   +G+KP
Sbjct  176   MIFSLINGITTRAAFG-VRWQDQEELMTVFHKSIELSGGFSLADVFPSIKLLARLTGIKP  234

Query  759   KLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNI  938
             +  +LH ELDKI   II +HKE      T   G+ +D+V VLLR +E GEL F +T +NI
Sbjct  235   ESERLHQELDKILGNIINEHKEGKALGKT-VEGEADDLVHVLLRCQENGELGFNLTTENI  293

Query  939   KAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTY  1118
             KA I D+F  GT++S T I WAMSEM+K P VM KAQAEVRQA   N   D+  +  L Y
Sbjct  294   KAAITDIFIAGTDSSVTVIEWAMSEMMKNPRVMEKAQAEVRQAFDKNGNVDEIGVHELQY  353

Query  1119  LKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERF  1298
             LKLV+KETLRLH PLPL+ PRE  E  KI  Y IP  ++VI+NAWA+A +P  W D E F
Sbjct  354   LKLVVKETLRLHTPLPLLLPRECGERCKILGYDIPKGSKVIVNAWAIARDPRYWNDAESF  413

Query  1299  LPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSP  1478
              PERF +SS+D+ GN++E+IPFGAGRR+CPG+ F   +I L LA LL+HFNW+LP+G   
Sbjct  414   YPERFLDSSIDYKGNYFEYIPFGAGRRICPGMLFGMANIELPLAQLLFHFNWKLPNGEQN  473

Query  1479  KDLDMTEAVGVIASKKKDLCLIARPF  1556
              DLDM E  G    +K DL L+  P+
Sbjct  474   NDLDMAETFGGSVRRKNDLFLVPTPY  499



>gb|AIZ01224.1| epi-aristolochene dihydroxylase, partial [Nicotiana benthamiana]
Length=438

 Score =   483 bits (1242),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 240/436 (55%), Positives = 325/436 (75%), Gaps = 2/436 (0%)
 Frame = +3

Query  192   HLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMA  371
             H++GG  PH  LR+L++KYGP+MHLQLGEISAVV++   +A+ + KTHD+VFASRP I+A
Sbjct  3     HMIGGE-PHHVLRDLAKKYGPLMHLQLGEISAVVVTSRDMAKEVLKTHDVVFASRPKIVA  61

Query  372   LDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSE  551
             +DI+ Y  +D+AFSP+GD+WRQMRKICV+ELL+ K V+SF S R++E+  L+ SIR  S 
Sbjct  62    MDIICYNQSDIAFSPHGDHWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDSIRSDSS  121

Query  552   TGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKW  731
             +G   N T+++ WF SS+  + AFG+V  + Q  F   +++V+ LA GFD+ D+FP+ K+
Sbjct  122   SGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDIFAKKIREVIGLAEGFDVVDIFPTYKF  180

Query  732   IHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGEL  911
             +H  SGMK KLL  H ++D I + +I +HK+N  A  +N +   ED++DVLLR+     L
Sbjct  181   LHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLAAGKSNGALGGEDLIDVLLRLMNDTSL  240

Query  912   QFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFD  1091
             QFPIT DNIKAVI DMF+ GTETS+TT +WAM+EM+K P V  KAQAEVR+A +   +FD
Sbjct  241   QFPITNDNIKAVIVDMFAAGTETSSTTTVWAMAEMMKNPRVFTKAQAEVREAFRDKVSFD  300

Query  1092  DKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNP  1271
             + D+E L YLKLVIKETLRLHPP PL+ PRE  E+  I  Y IP KT+V++N WAL  +P
Sbjct  301   ENDVEELKYLKLVIKETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDP  360

Query  1272  ESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFN  1451
             + W+D E F PERFE  S+DF GN++EF+PFG GRR+CPG+SF   ++ L LA LLYHF+
Sbjct  361   KYWDDAESFKPERFEQCSLDFYGNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFD  420

Query  1452  WELPDGVSPKDLDMTE  1499
             W+LP G+ P+DLD+TE
Sbjct  421   WKLPTGMKPRDLDLTE  436



>ref|XP_003517257.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   485 bits (1249),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 255/473 (54%), Positives = 338/473 (71%), Gaps = 11/473 (2%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLAR  317
              KLPPGP KLPLIG+LH L + GSLPHRTLR+L+ KYGP+MHLQLGEIS+VV+S P +A+
Sbjct  34    HKLPPGPKKLPLIGNLHQLAMAGSLPHRTLRDLALKYGPLMHLQLGEISSVVVSSPNMAK  93

Query  318   AITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCS  497
              I KTHDL F  RP  +   I+ Y   D+ F+PYGDYWRQM+KICV ELLS K V+SF  
Sbjct  94    EIMKTHDLAFVQRPQFLPAQILTYGQNDIVFAPYGDYWRQMKKICVSELLSAKRVQSFSH  153

Query  498   FRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQV  677
              R++E S  + SIR+S   G P NLT K+    SS +++VAFG   S+DQ +F+ +L+++
Sbjct  154   IREDETSKFIESIRISE--GSPINLTSKIYSLVSSSVSRVAFGDK-SKDQEEFLCVLEKM  210

Query  678   LSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG  857
             +   GGF+  DLFPS K +H  +G K KL K+H ++DKI D I+ +H+E          G
Sbjct  211   ILAGGGFEPDDLFPSMK-LHLINGRKAKLEKMHEQVDKIADNILREHQEKR--QRALREG  267

Query  858   K----DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1025
             K    +ED+VDVLLR+++   L+  I+  NIKAVI D+F+ GT+TSA+T+ WAM+EM++ 
Sbjct  268   KVDLEEEDLVDVLLRIQQSDNLEIKISTTNIKAVILDVFTAGTDTSASTLEWAMAEMMRN  327

Query  1026  PSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKI  1205
             P V  KAQAEVRQA +  K   + D+  LTYLKLVIKETLRLH P PL+ PRE  E   I
Sbjct  328   PRVREKAQAEVRQAFRELKIIHETDVGKLTYLKLVIKETLRLHAPSPLLVPRECSELTII  387

Query  1206  GEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMC  1385
               Y IP KT+V+IN WA+  +P+ W D ERF+PERF+ SS+DF GN++E++PFGAGRRMC
Sbjct  388   DGYEIPVKTKVMINVWAIGRDPQYWTDAERFVPERFDGSSIDFKGNNFEYLPFGAGRRMC  447

Query  1386  PGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             PG++F   +I L LA LLYHFNWELP+ + P+D+DM+E  G+  ++K +LCLI
Sbjct  448   PGMTFGLANIMLPLALLLYHFNWELPNEMKPEDMDMSENFGLTVTRKSELCLI  500



>ref|XP_003551489.1| PREDICTED: cytochrome P450 71D9-like [Glycine max]
 gb|AGB55872.1| flavonoid 6-hydroxylase 2 [Glycine max]
 gb|AGB55873.1| flavonoid 6-hydroxylase 2 [Glycine max]
Length=498

 Score =   485 bits (1248),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 250/500 (50%), Positives = 350/500 (70%), Gaps = 18/500 (4%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             +S+ +F+     I T +    PA    LPPGPWK+P+IG++H++VG SLPH  LR+LS K
Sbjct  12    LSIFIFMFLGHKIITKK----PASTPNLPPGPWKIPIIGNIHNVVG-SLPHHRLRDLSAK  66

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHL+LGE+S +V+S P+ A+ +  THDL+F+SRP I+A  I+ Y S  ++F+PYGD
Sbjct  67    YGPLMHLKLGEVSTIVVSSPEYAKEVLSTHDLIFSSRPPILASKIMSYDSMGMSFAPYGD  126

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWR++RKIC  ELLS K V+SF   R EEL+N +   R++S+ G P NLT++V    S++
Sbjct  127   YWRRLRKICASELLSSKRVQSFQPIRGEELTNFIK--RIASKEGSPINLTKEVLLTVSTI  184

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
             +++ A G  C  D  KFI+ +++    AGGFDLGDL+PS +W+ + SG+KPKL K H + 
Sbjct  185   VSRTALGNKC-RDHKKFISAVREATEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQA  243

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDM  959
             D+I   I+ +H+E   A S+ + G+ E++ D L+ V  KE    +F +++++IKAVI DM
Sbjct  244   DRIMQNIVNEHRE---AKSSATHGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDM  296

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIK  1136
             F  GT+TS+TTI WAM+EMIK P VM K  AEVR+   G     D+ D+ENL YLK V+K
Sbjct  297   FGGGTQTSSTTITWAMAEMIKNPRVMKKVHAEVREVFGGKVGHPDESDMENLKYLKSVVK  356

Query  1137  ETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE  1316
             ETLRLHPP PL+ PR+  +  +I  Y IP K++VIINAWA+  +P  W + ERF PERF 
Sbjct  357   ETLRLHPPGPLLLPRQCGQACEINGYYIPIKSKVIINAWAIGRDPNHWSEAERFYPERFI  416

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
              SSVD+ GN +E+IPFGAGRR+CPG++F  T++   LA L+Y+F+W+LP+ +  +DLDMT
Sbjct  417   GSSVDYQGNSFEYIPFGAGRRICPGLTFGLTNVEFPLALLMYYFDWKLPNEMKNEDLDMT  476

Query  1497  EAVGVIASKKKDLCLIARPF  1556
             EA GV A +K DLCLI   F
Sbjct  477   EAFGVSARRKDDLCLIPITF  496



>gb|KDP39287.1| hypothetical protein JCGZ_01044 [Jatropha curcas]
Length=510

 Score =   485 bits (1249),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 243/506 (48%), Positives = 336/506 (66%), Gaps = 6/506 (1%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
             ME++F   P  +  FL F+F +  L + S       LPPGPWKLP+IGS+HHL G  LPH
Sbjct  1     MENQFPSFPF-IFTFLVFLFMVLRLWKNSKKNSAPNLPPGPWKLPVIGSMHHLSGSLLPH  59

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
               LRNL+ +YGP+MHL+LGE++ +V+S P+ A+AI KTHD +FA RP ++A +I+ Y ST
Sbjct  60    VRLRNLANEYGPLMHLKLGEVTNIVVSSPETAKAIMKTHDHIFAQRPFLLAANIMAYNST  119

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             D+AF+PYGDYWRQMRKIC  E+LS K V SF   R+EE+S  +    LSS  G   N + 
Sbjct  120   DLAFAPYGDYWRQMRKICTQEILSAKRVLSFGLIREEEVSKFIRD--LSSRAGSTVNFSR  177

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
               +  T ++I +VA G++   ++   I   K+++  AGGF L DL+PS K +H  S  K 
Sbjct  178   MFNSVTYNIIQRVAIGKLWKGEE-IVIPAFKKLIEAAGGFSLSDLYPSIKLLHKISTTKF  236

Query  759   KLLKLHHELDKIFDIIIGDHKENHLANS-TNSSGKDEDIVDVLLRVKEGGELQFPITEDN  935
             KLL+ H E DK+F  II +H+    + + + +  ++EDI+DVLL+ +   EL++PIT+DN
Sbjct  237   KLLRAHKETDKLFQNIIDEHRARKASRAKSGAKNEEEDIIDVLLQAQSEEELEYPITDDN  296

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             IKAVI D+ S GT+TSATT++WAMSE++K P VM + Q EVRQ        D++ +  L 
Sbjct  297   IKAVIMDVLSGGTDTSATTVVWAMSELLKNPDVMKRVQTEVRQVFSKKGYVDEESIGELH  356

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             YLK V+KET     P   +  RE  E+  I  Y IP K+R+IINAWAL  +P+ W + ER
Sbjct  357   YLKAVVKET-MRLHPTGAVLTRECREDCVINGYDIPYKSRIIINAWALGRDPDYWPEAER  415

Query  1296  FLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS  1475
             F P+RF NSS+D+ G H+EF+PFGAGRR+CPGI F  +++   LA LLYHF+W+LP+G+ 
Sbjct  416   FNPDRFLNSSIDYKGKHFEFLPFGAGRRICPGILFGISNVQFPLARLLYHFDWKLPNGMR  475

Query  1476  PKDLDMTEAVGVIASKKKDLCLIARP  1553
             P+DLDM E  G+   +  DL LI  P
Sbjct  476   PEDLDMNEKYGIAVRRANDLQLIPIP  501



>ref|XP_003537455.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42025.1| Cytochrome P450 71D8 [Glycine soja]
Length=504

 Score =   485 bits (1248),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 247/503 (49%), Positives = 348/503 (69%), Gaps = 15/503 (3%)
 Frame = +3

Query  57    FNPVSVI----VFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLPHR  221
             ++P+S++    VFL   + + T +++S+     KLPPGPW+LP+IG+LH L +  SLP +
Sbjct  3     YSPLSIVITFFVFLLLHWLVKTYKQKSS----HKLPPGPWRLPIIGNLHQLALAASLPDQ  58

Query  222   TLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTD  401
              L+ L RKYGP+MHLQLGEIS +V+S P++A  + KTHD+ F  RP ++A   + Y +TD
Sbjct  59    ALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATD  118

Query  402   VAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEK  581
             +AF+PYGDYWRQ+RKIC LELLS K V+SF   RQ+E   L+ SI   S  G P +L+ K
Sbjct  119   IAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIH--SSAGSPIDLSGK  176

Query  582   VSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPK  761
             +     + +++ AFG+  ++DQ +F++L+++ +++ GGF++ D+FPS K +H  +  K K
Sbjct  177   LFSLLGTTVSRAAFGKE-NDDQDEFMSLVRKAITMTGGFEVDDMFPSLKPLHLLTRQKAK  235

Query  762   LLKLHHELDKIFDIIIGDH--KENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDN  935
             +  +H   DKI + I+  H  K   +     S  + ED+VDVLLR+KE G L+ P+T +N
Sbjct  236   VEHVHQRADKILEDILRKHMEKRTRVKEGNGSEAEQEDLVDVLLRLKESGSLEVPMTMEN  295

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             IKAVI ++F+ GT+TSA+T+ WAMSEM+K P V  KAQAE+RQ  KG +   + DLE L+
Sbjct  296   IKAVIWNIFAAGTDTSASTLEWAMSEMMKNPKVKEKAQAELRQIFKGKEIIRETDLEELS  355

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             YLK VIKETLRLHPP  LI   E ++   I  Y IP KT+V+IN WA+  +P+ W D +R
Sbjct  356   YLKSVIKETLRLHPPSQLIPR-ECIKSTNIDGYEIPIKTKVMINTWAIGRDPQYWSDADR  414

Query  1296  FLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS  1475
             F+PERF +SS+DF GN +E+IPFGAGRRMCPG++F   SI L LA LLYHFNWELP+ + 
Sbjct  415   FIPERFNDSSIDFKGNSFEYIPFGAGRRMCPGMTFGLASITLPLALLLYHFNWELPNKMK  474

Query  1476  PKDLDMTEAVGVIASKKKDLCLI  1544
             P+DLDM E  G+  ++K  L LI
Sbjct  475   PEDLDMDEHFGMTVARKNKLFLI  497



>gb|AAO32822.1| cytochrome P450 71D1, partial [Catharanthus roseus]
Length=495

 Score =   484 bits (1247),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 247/479 (52%), Positives = 347/479 (72%), Gaps = 8/479 (2%)
 Frame = +3

Query  114   RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             RR+S   +   LPPGPWKLP++G+LH+++ GS+PHR LR+L++K+G +M L+LGE +A+V
Sbjct  15    RRKSTRTKTINLPPGPWKLPILGNLHNMMMGSVPHRLLRDLAKKHGDLMLLKLGEFNAIV  74

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
             +S P++A+ + KTHDL F +RP I A  I+ Y ++D+ FS YGD WR+MRKI VLELLS 
Sbjct  75    VSSPRMAKEVLKTHDLSFLNRPIIQAPKILCYDNSDLVFSQYGDSWREMRKIFVLELLST  134

Query  474   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG-  650
             K V+SF   RQ+E S LVS I+ S   G   +L+EK++ +T+S++A+ AFG+V   D G 
Sbjct  135   KRVRSFQPIRQDEGSRLVSLIKES--VGKSIDLSEKINSYTTSMVARAAFGKV--NDAGV  190

Query  651   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  830
              F+ L+K+   +AGGFD  D+FPS K+++     + KLLK+H + D I + +I +H +NH
Sbjct  191   TFLKLVKEASEVAGGFDPADIFPSYKFLNVFFNSRSKLLKIHGKTDMILEEMIDEHIKNH  250

Query  831   -LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1007
              +    N     ED++D+LL +K+ GELQFP   +N+KA+I DMF+ GTETS++T+ WAM
Sbjct  251   EMGKKANGENGKEDVIDILLSIKDSGELQFPFQMNNVKALIFDMFAAGTETSSSTVEWAM  310

Query  1008  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1187
             SE+I+ P VMAKAQ EVRQ LKG +  D+  L+ L YLKL++KE LRLHP  PL+ PRE 
Sbjct  311   SELIRNPDVMAKAQNEVRQVLKGKQIVDESVLQELEYLKLIVKEVLRLHPSSPLLIPREC  370

Query  1188  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1367
              E+ +I  Y IP KTRV +N WA+A + + W+DPE F+PERFEN+  DF GN++E++PFG
Sbjct  371   GEDCQIDGYDIPVKTRVFVNIWAIARDDKYWKDPESFIPERFENTCFDFTGNNFEYLPFG  430

Query  1368  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             +GRRMCPG++F   ++ L LA LLYHFNW+LP GV+  D+DMTE VG+ A+KK  L LI
Sbjct  431   SGRRMCPGMTFGLANVDLVLALLLYHFNWKLPPGVN--DIDMTERVGLGATKKHSLVLI  487



>gb|AGB55871.1| flavonoid 6-hydroxylase 2 [Glycine max]
Length=498

 Score =   484 bits (1247),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 250/500 (50%), Positives = 350/500 (70%), Gaps = 18/500 (4%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             +S+ +F+     I T +  S P     LPPGPWK+P+IG++H++VG SLPH  LR+LS K
Sbjct  12    LSIFIFMFLGHKIITKKPTSTP----NLPPGPWKIPIIGNIHNVVG-SLPHHRLRDLSAK  66

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHL+LGE+S +V+S P+ A+ +  THDL+F+SRP I+A  I+ Y S  ++F+PYGD
Sbjct  67    YGPLMHLKLGEVSTIVVSSPEYAKEVLSTHDLIFSSRPPILASKIMSYDSMGMSFAPYGD  126

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWR++RKIC  ELLS K V+SF   R EEL+N +   R++S+ G P NLT++V    S++
Sbjct  127   YWRRLRKICASELLSSKRVQSFQPIRGEELTNFIK--RIASKEGSPINLTKEVLLTVSTI  184

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
             +++ A G  C  D  KFI+ +++    AGGFDLGDL+PS +W+ + SG+KPKL K H + 
Sbjct  185   VSRTALGNKC-RDHKKFISAVREATEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQA  243

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDM  959
             D+I   I+ +H+E   A S+ + G+ E++ D L+ V  KE    +F +++++IKAVI DM
Sbjct  244   DRIMQNIVNEHRE---AKSSATHGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDM  296

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIK  1136
             F  GT+TS+TTI WAM+EMIK P VM K  AEVR+   G     D+ D+ENL YLK V+K
Sbjct  297   FGGGTQTSSTTITWAMAEMIKNPRVMKKVHAEVREVFGGKVGHPDESDMENLKYLKSVVK  356

Query  1137  ETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE  1316
             ETLRLHPP PL+ PR+  +  +I  Y IP K++VIINAWA+  +P  W + ERF PERF 
Sbjct  357   ETLRLHPPGPLLLPRQCGQACEINGYYIPIKSKVIINAWAIGRDPNHWSEAERFYPERFI  416

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
              SSVD+ GN +E+IPFGAGRR+CPG++F  T++   LA L+Y+F+W+LP+ +  +DLDMT
Sbjct  417   GSSVDYQGNSFEYIPFGAGRRICPGLTFGLTNVEFPLALLMYYFDWKLPNEMKNEDLDMT  476

Query  1497  EAVGVIASKKKDLCLIARPF  1556
             EA GV A +K DLCLI   F
Sbjct  477   EAFGVSARRKDDLCLIPITF  496



>gb|KHN43612.1| Cytochrome P450 71D9 [Glycine soja]
Length=481

 Score =   484 bits (1245),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 246/479 (51%), Positives = 341/479 (71%), Gaps = 14/479 (3%)
 Frame = +3

Query  129   PARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQ  308
             PA    LPPGPWK+P+IG++H++VG SLPH  LR+LS KYGP+MHL+LGE+S +V+S P+
Sbjct  12    PASTPNLPPGPWKIPIIGNIHNVVG-SLPHHRLRDLSAKYGPLMHLKLGEVSTIVVSSPE  70

Query  309   LARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKS  488
              A+ +  THDL+F+SRP I+A  I+ Y S  ++F+PYGDYWR++RKIC  ELLS K V+S
Sbjct  71    YAKEVLSTHDLIFSSRPPILASKIMSYDSMGMSFAPYGDYWRRLRKICASELLSSKRVQS  130

Query  489   FCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALL  668
             F   R EEL+N +   R++S+ G P NLT++V    S+++++ A G  C  D  KFI+ +
Sbjct  131   FQPIRGEELTNFIK--RIASKEGSPINLTKEVLLTVSTIVSRTALGNKC-RDHKKFISAV  187

Query  669   KQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTN  848
             ++    AGGFDLGDL+PS +W+ + SG+KPKL K H + D+I   I+ +H+E   A S+ 
Sbjct  188   REATEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADRIMQNIVNEHRE---AKSSA  244

Query  849   SSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
             + G+ E++ D L+ V  KE    +F +++++IKAVI DMF  GT+TS+TTI WAM+EMIK
Sbjct  245   THGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDMFGGGTQTSSTTITWAMAEMIK  300

Query  1023  RPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
              P VM K  AEVR+   G     D+ D+ENL YLK V+KETLRLHPP PL+ PR+  +  
Sbjct  301   NPRVMKKVHAEVREVFGGKVGHPDESDMENLKYLKSVVKETLRLHPPGPLLLPRQCGQAC  360

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
             +I  Y IP K++VIINAWA+  +P  W + ERF PERF  SSVD+ GN +E+IPFGAGRR
Sbjct  361   EINGYYIPIKSKVIINAWAIGRDPNHWSEAERFYPERFIGSSVDYQGNSFEYIPFGAGRR  420

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPG++F  T++   LA L+Y+F+W+LP+ +  +DLDMTEA GV A +K DLCLI   F
Sbjct  421   ICPGLTFGLTNVEFPLALLMYYFDWKLPNEMKNEDLDMTEAFGVSARRKDDLCLIPITF  479



>gb|ACD42776.1| cytochrome P450 71D1 [Catharanthus roseus]
Length=507

 Score =   484 bits (1247),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 247/479 (52%), Positives = 345/479 (72%), Gaps = 8/479 (2%)
 Frame = +3

Query  114   RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             RR+S   +   LPPGPWKLP++G+LH+++ GS+PHR LR+L++K+G +M L+LGE +A+V
Sbjct  27    RRKSTRTKTINLPPGPWKLPILGNLHNMMMGSVPHRLLRDLAKKHGDLMLLKLGEFNAIV  86

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
             +S P++A+ + KTHDL F +RP I A  I+ Y ++D+ FS YGD WRQMRKI VLELLS 
Sbjct  87    VSSPRMAKEVLKTHDLSFLNRPIIQAPKILCYDNSDLVFSQYGDSWRQMRKIFVLELLST  146

Query  474   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG-  650
             K V+SF   RQ+E S LV  I+ S   G   +L+EK++ +T+S++A+ AFG+V   D G 
Sbjct  147   KRVRSFQPIRQDEGSRLVXLIKES--VGKSIDLSEKINSYTTSMVARAAFGKV--NDAGV  202

Query  651   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  830
              F+ L+K+   +AGGFD  D+FPS K+++     + KLLK+H + D I + +I +H +NH
Sbjct  203   TFLKLVKEASEVAGGFDPADIFPSYKFLNVFFNSRSKLLKIHGKTDMILEEMIDEHIKNH  262

Query  831   -LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAM  1007
              +    N     ED++D+LL +K+ GELQFP   +N+KA I DMF+ GTETS++T+ WAM
Sbjct  263   EMGKKANGENGKEDVIDILLSIKDSGELQFPFQMNNVKAFIFDMFAAGTETSSSTVEWAM  322

Query  1008  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1187
             SE+I+ P VMAKAQ EVRQ LKG +  D+  L+ L YLKL++KE LRLHP  PL+ PRE 
Sbjct  323   SELIRNPDVMAKAQNEVRQVLKGKQIVDESVLQELEYLKLIVKEVLRLHPSSPLLIPREC  382

Query  1188  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1367
              E+ +I  Y IP KTRV +N WA+A + + W+DPE F+PERFEN+  DF GN++E++PFG
Sbjct  383   REDCQIDGYDIPVKTRVFVNIWAIARDDKYWKDPESFIPERFENTCFDFTGNNFEYLPFG  442

Query  1368  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             +GRRMCPG++F   ++ L LA LLYHFNW+LP GV+  D+DMTE VG+ A+KK  L LI
Sbjct  443   SGRRMCPGMTFGLANVDLVLALLLYHFNWKLPPGVN--DIDMTERVGLGATKKHSLVLI  499



>ref|XP_010655881.1| PREDICTED: cytochrome P450 71D10-like [Vitis vinifera]
Length=505

 Score =   484 bits (1245),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 246/488 (50%), Positives = 346/488 (71%), Gaps = 6/488 (1%)
 Frame = +3

Query  96    FCIYTLRRRSNP-ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQL  272
             + +Y + +RS      QKLPPGPWKLPLIG++H LVG SLPHR+L  L++KYGP+M LQL
Sbjct  17    YMLYKIGKRSKANISTQKLPPGPWKLPLIGNVHQLVG-SLPHRSLTLLAKKYGPLMRLQL  75

Query  273   GEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKIC  452
             GE+S +++S P++A+ + KTHD  FA RP ++A  I+ Y  + VAF+PYGDYWRQ+RKIC
Sbjct  76    GEVSTLIVSSPEMAKQVMKTHDTNFAQRPILLATRILSYDCSGVAFAPYGDYWRQLRKIC  135

Query  453   VLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRV  632
             V+ELL+ K VKSF S R+EE+SNL++ +  +S +    N TEK+S  T S+IA+ AFG+ 
Sbjct  136   VVELLTAKRVKSFQSVREEEISNLITMV--TSCSRLQINFTEKISSLTFSIIARAAFGKK  193

Query  633   CSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIG  812
              SEDQ  F++++K+++  A GF + D++PS KW+   SGM+ K+ K+    D+I   I+ 
Sbjct  194   -SEDQDAFLSVMKELVETASGFCVADMYPSVKWLDLISGMRYKIDKVFRMTDRILQNIVD  252

Query  813   DHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATT  992
             +H+E     S    G + D+VDVLL++++  +LQFP+T++NIKAVI D+F    E+++T+
Sbjct  253   EHREKLKTQSGKLEG-EADLVDVLLKLQQNDDLQFPLTDNNIKAVILDIFGGAGESTSTS  311

Query  993   IIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplpli  1172
             + WAMSEM+K P V+ KAQAEVR    G    D+  ++ L +LK V+ ETLRLHPP PL+
Sbjct  312   VEWAMSEMLKAPIVIEKAQAEVRSVFDGKGHVDETAIDELKFLKAVVNETLRLHPPFPLL  371

Query  1173  hprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYE  1352
              PRE  E  KI  Y IP KTR+I+NAWA+  + + W + ERF PERF +SS+D+ G  + 
Sbjct  372   LPRECREMCKINGYEIPEKTRIIVNAWAIGRDSDYWVEAERFYPERFLDSSIDYKGTDFG  431

Query  1353  FIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKD  1532
             +IPFGAGRR+CPGI FA   I L LA LLYHF+W+LP+G+  +DLDMTEA G+   +K+D
Sbjct  432   YIPFGAGRRICPGILFAMPGIELPLANLLYHFDWKLPNGMKAEDLDMTEAFGLAVRRKQD  491

Query  1533  LCLIARPF  1556
             L LI  P+
Sbjct  492   LHLIPIPY  499



>ref|XP_002522762.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF39613.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   483 bits (1244),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 251/510 (49%), Positives = 351/510 (69%), Gaps = 11/510 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRS---NPARRQKLPPGPWKLPLIGSLHHLVGGS  209
             ME++F F P+ +  FL F+F ++ + ++S   +PA    LPPGPWKLPLIGS+HHLVG S
Sbjct  1     MEYQFPFFPI-LFTFLLFIFMVFRIWKKSKTNHPA--PHLPPGPWKLPLIGSMHHLVG-S  56

Query  210   LPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFY  389
              PH  L++L++KYGP+MHLQLGE++ +VIS P++A+ + KTHD+VFA RP+++A  +  Y
Sbjct  57    QPHHRLKDLAKKYGPLMHLQLGELTNIVISSPEIAKEVMKTHDVVFAQRPHLLAASVTSY  116

Query  390   KSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTN  569
               TD+AF+PYGDYWRQMRK+C LELL+ K V+SF S R+EE+S L+ S+  S+  G P N
Sbjct  117   NYTDIAFAPYGDYWRQMRKLCTLELLTAKRVQSFRSIREEEVSRLMRSLSSSA--GSPIN  174

Query  570   LTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSG  749
              +   +  T S+I++ +FG++   ++  FI ++K+++  AGGF L D++PS K +H+ SG
Sbjct  175   FSRMFNSLTYSIISRASFGKIWKGEE-IFIPIVKKLIVAAGGFTLADVYPSVKLLHWISG  233

Query  750   MKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITE  929
             M P+L ++HH +D IF  II DH+    A +++  G+  D+VDVLL  +   +L  PIT 
Sbjct  234   MAPRLKRIHHIVDNIFQNIIDDHRTKRAAANSSVEGEG-DLVDVLLNFQAQEDLAVPITN  292

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLEN  1109
             DNIK +I D F  G+ETS+TT  WAMSE++K P VM KAQ EVR+         +  L  
Sbjct  293   DNIKGIILDTFVAGSETSSTTAEWAMSELLKNPRVMEKAQEEVRRVFGEEGNVHEGRLHE  352

Query  1110  LTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDP  1289
             L YLK VI ETLRLHPP+PL+ PRE  E   I  Y IP K++VI+N WA+  +P  W D 
Sbjct  353   LNYLKWVINETLRLHPPIPLLLPRECRESCVINGYDIPVKSKVIVNVWAIGRDPNCWMDA  412

Query  1290  ERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDG  1469
             E+F PERF++  +D+ G H+EF+PFGAGRRMCPGI F   ++   LA LLYHF+W+LP G
Sbjct  413   EKFYPERFQDCPIDYKGTHFEFLPFGAGRRMCPGILFGIINVEFPLAQLLYHFDWKLPTG  472

Query  1470  VSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
             V P+  DMTE  G +  +K DL +I  PF+
Sbjct  473   VKPETFDMTEDFGAVVKRKSDLYVIPMPFL  502



>ref|XP_004511999.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   483 bits (1244),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 250/470 (53%), Positives = 330/470 (70%), Gaps = 6/470 (1%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHLVGGS-LPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARA  320
             KLPPGP KLPLIG+LH L   S LPH  L+ LS KYGP+MHLQLGEIS VV+S P+LA+ 
Sbjct  33    KLPPGPRKLPLIGNLHQLAFASKLPHHALKILSHKYGPLMHLQLGEISTVVVSSPKLAKE  92

Query  321   ITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  500
             + KTHD+VFA+RP +++  I+ Y   D+ FSPYGDYWRQMRKICVLE+LS+K V+SF   
Sbjct  93    VMKTHDVVFANRPKLLSPQILAYGFKDIVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYI  152

Query  501   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  680
             R++E +  + SI+  S +G   NLT ++    +S+I++ AFG   SEDQ +F++L+++ +
Sbjct  153   REDETTKFIKSIK--SFSGSTINLTSRIFSVINSIISRAAFGD-KSEDQDEFVSLIRKAI  209

Query  681   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL--ANSTNSS  854
             +++GG +L DLFPS K I+  +GMK K  K+H  +DKI D +I  H+E      +     
Sbjct  210   AMSGGLELDDLFPSMKPINILTGMKSKFEKIHKRIDKILDNVIRKHEEKRTITKDEKKIE  269

Query  855   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1034
              + ED+VDVLLRV++ G L   +T +NIKAVI D+F  GT+TS+TTI W+MSEM+K P V
Sbjct  270   AEKEDLVDVLLRVQQSGSLDIQMTINNIKAVIWDIFVAGTDTSSTTIEWSMSEMMKNPRV  329

Query  1035  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1214
               KAQAE+RQA +G     + D+  LTYL LVIKETLRLHPP PL+ PRE  E   I  Y
Sbjct  330   RDKAQAELRQAFRGKDKICESDMHQLTYLNLVIKETLRLHPPSPLLVPRECYELTNIDGY  389

Query  1215  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1394
              IP KT ++INAW    +P+ W D ERF+PERF+ S +DF GN++E+IPFGAGRRMCPG+
Sbjct  390   DIPKKTIILINAWTKGRDPQYWSDAERFIPERFDGSFIDFKGNNFEYIPFGAGRRMCPGM  449

Query  1395  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             SF   S+   LA LLYHFNWELP+ + P   DM E  G+   +K +LCLI
Sbjct  450   SFGLASVMFPLALLLYHFNWELPNHMKPDHFDMIEHFGMTVGRKNELCLI  499



>ref|XP_008337945.1| PREDICTED: cytochrome P450 71D9-like [Malus domestica]
Length=516

 Score =   483 bits (1244),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 260/505 (51%), Positives = 342/505 (68%), Gaps = 14/505 (3%)
 Frame = +3

Query  63    PVSVIVFLSFVFCIYTLR---RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             P   ++F  F+F I  L+   RR        LPPGPWKLP IG++H LVG S PH  LRN
Sbjct  6     PSFQVLFTFFLFVITVLKIANRRKTKESAVNLPPGPWKLPFIGNIHQLVG-SQPHHGLRN  64

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L++KYGP+MHLQLGE+S VV+S  + A+ + KTHD+VFASRP I+A  I+ Y+ST++AF+
Sbjct  65    LAKKYGPLMHLQLGEVSTVVVSSAEYAKEVMKTHDVVFASRPPILATRILSYESTNIAFA  124

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             P GDYWRQ+RKIC LELLS   V+     R+EEL NL++ I   S  G P NLTEKV   
Sbjct  125   PCGDYWRQLRKICTLELLSANRVQGHRPLREEELGNLITWI--GSNAGSPINLTEKVYSS  182

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
             T ++ ++ AFG+  SED  KFI  +KQ +++A GFDL D+FPS K +H   G++P L +L
Sbjct  183   TYTITSRAAFGK-KSEDHEKFIDAVKQSIAVAAGFDLADVFPSVKLLHLIGGIRPTLERL  241

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGKDE---DIVDVLLRVKEGGE-LQFPITEDNIK  941
             H   D+I + II +HK+     ST  SG+ E   D+VDVLL+  E G  L+F +T DNIK
Sbjct  242   HKVTDRIMENIINEHKKK---RSTTKSGEGEAEVDLVDVLLKFHEHGNGLEFSLTTDNIK  298

Query  942   AVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYL  1121
             AVI D+F  G+ETSATT+ WAMSEMIK   +M  AQ +VR+        D+  +  + YL
Sbjct  299   AVILDIFGAGSETSATTVDWAMSEMIKNXRIMKMAQDDVREVYNRIGKVDETGIREMKYL  358

Query  1122  KLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFL  1301
              LVIKETLRLHPP PL+ PRES E  KI  Y IP KT+VI+N WA+  +P  W + E F 
Sbjct  359   SLVIKETLRLHPPAPLLLPRESSESCKINGYEIPVKTKVIVNGWAIGRDPNHWTETESFY  418

Query  1302  PERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPK  1481
             PERF +SS+D+ G ++E+IPFGAGRR+C GI +   ++ L LA LLYHF+W+LPDG++ +
Sbjct  419   PERFLDSSIDYKGTNFEYIPFGAGRRICXGILYGLANVELPLALLLYHFDWKLPDGMTHE  478

Query  1482  DLDMTEAVGVIASKKKDLCLIARPF  1556
             DLDMTE  G+   +K DL LI  P+
Sbjct  479   DLDMTELFGITVXRKDDLRLIPIPY  503



>gb|KEH34016.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   482 bits (1240),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 235/468 (50%), Positives = 339/468 (72%), Gaps = 5/468 (1%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAIT  326
             +PPGP KLP+IG++H+L+  S PHR LR+L++KYGP+MHLQLGE+S +VIS P+ A  + 
Sbjct  1     MPPGPIKLPIIGNIHNLLS-SQPHRKLRDLAKKYGPVMHLQLGEVSNMVISSPECASEVM  59

Query  327   KTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  506
             KTHD+ F+SRP I+  +I+ Y ST +AF+PYG+YWRQ+RKIC LELLS+K V S+   R+
Sbjct  60    KTHDIHFSSRPQILVTEIISYNSTSIAFAPYGNYWRQIRKICTLELLSLKRVNSYQPIRE  119

Query  507   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  686
             E LSNLV  I  +S+ G P N++E V     +++++ AFG  C +DQ KFI+L++Q + +
Sbjct  120   EVLSNLVKWI--ASQKGTPINISEAVLSTMYTIVSRSAFGNEC-KDQEKFISLVRQTIKV  176

Query  687   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-D  863
             AGGF+LGDLFPS KW+   +G++PKL ++H + D+I + II +HKE     + +  G+ +
Sbjct  177   AGGFNLGDLFPSAKWLQRITGLRPKLERIHRQTDQILENIINEHKEEKYTKAKDDQGRVE  236

Query  864   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1043
             ED+VDVLL  ++G      +T++NIKA+I D+F  G ETSA+TI WAM+EM++ P +M K
Sbjct  237   EDLVDVLLNYEDGRNQDLSLTKNNIKAIIMDIFGAGGETSASTIDWAMAEMVRNPRIMKK  296

Query  1044  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1223
             AQAEVR+  K     ++  +  L YLK V+KETLRLHPP PL+ PRE ++   I  Y IP
Sbjct  297   AQAEVREVFKMKGRVEENCINELIYLKSVVKETLRLHPPTPLLLPRECVQACVINGYHIP  356

Query  1224  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1403
              K++V INAWA+A +P  W +PERF PERF +S++D+ G+++E+IPFGAGRR+CPG +F 
Sbjct  357   IKSKVTINAWAIARDPNYWTEPERFYPERFIDSAIDYKGSNFEYIPFGAGRRICPGSTFG  416

Query  1404  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIA  1547
               +I ++LA LLYHF+W+LP G+  ++LDMT+  G    +K +L L +
Sbjct  417   LRNIDMALAMLLYHFDWKLPSGIKSEELDMTDEFGATMRRKDELLLFS  464



>sp|O81974.1|C71D8_SOYBN RecName: Full=Cytochrome P450 71D8; AltName: Full=Cytochrome 
P450 CP7 [Glycine max]
 emb|CAA71517.1| putative cytochrome P450 [Glycine max]
Length=504

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 247/503 (49%), Positives = 347/503 (69%), Gaps = 15/503 (3%)
 Frame = +3

Query  57    FNPVSVI----VFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLPHR  221
             ++P+S++    VFL   + + T +++S+     KLPPGPW+LP+IG+LH L +  SLP +
Sbjct  3     YSPLSIVITFFVFLLLHWLVKTYKQKSS----HKLPPGPWRLPIIGNLHQLALAASLPDQ  58

Query  222   TLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTD  401
              L+ L RKYGP+MHLQLGEIS +V+S P++A  + KTHD+ F  RP ++A   + Y +TD
Sbjct  59    ALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATD  118

Query  402   VAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEK  581
             +AF+PYGDYWRQ+RKIC LELLS K V+SF   RQ+E   L+ SI   S  G P +L+ K
Sbjct  119   IAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSIH--SSAGSPIDLSGK  176

Query  582   VSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPK  761
             +     + +++ AFG+  ++DQ +F++L+++ +++ GGF++ D+FPS K +H  +  K K
Sbjct  177   LFSLLGTTVSRAAFGKE-NDDQDEFMSLVRKAITMTGGFEVDDMFPSLKPLHLLTRQKAK  235

Query  762   LLKLHHELDKIFDIIIGDH--KENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDN  935
             +  +H   DKI + I+  H  K   +     S  + ED+VDVLLR+KE G L+ P+T +N
Sbjct  236   VEHVHQRADKILEDILRKHMEKRTRVKEGNGSEAEQEDLVDVLLRLKESGSLEVPMTMEN  295

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             IKAVI ++F+ GT+TSA+T+ WAMSEM+K P V  KAQAE+RQ  KG +   + DLE L+
Sbjct  296   IKAVIWNIFAAGTDTSASTLEWAMSEMMKNPKVKEKAQAELRQIFKGKEIIRETDLEELS  355

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             YLK VIKETLRLHPP  LI   E +    I  Y IP KT+V+IN WA+  +P+ W D +R
Sbjct  356   YLKSVIKETLRLHPPSQLIPR-ECIISTNIDGYEIPIKTKVMINTWAIGRDPQYWSDADR  414

Query  1296  FLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS  1475
             F+PERF +SS+DF GN +E+IPFGAGRRMCPG++F   SI L LA LLYHFNWELP+ + 
Sbjct  415   FIPERFNDSSIDFKGNSFEYIPFGAGRRMCPGMTFGLASITLPLALLLYHFNWELPNKMK  474

Query  1476  PKDLDMTEAVGVIASKKKDLCLI  1544
             P+DLDM E  G+  ++K  L LI
Sbjct  475   PEDLDMDEHFGMTVARKNKLFLI  497



>ref|XP_003611884.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94842.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   483 bits (1243),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 259/506 (51%), Positives = 344/506 (68%), Gaps = 10/506 (2%)
 Frame = +3

Query  36    EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLV-GGSL  212
             E +  F+  P S+ + L ++   Y   +        KLPP P KLPLIG+LH L   G L
Sbjct  2     EFQLSFVIIPFSIFILLHWLATKYYKPK----TIFYKLPPSPRKLPLIGNLHQLAFAGKL  57

Query  213   PHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYK  392
             PH  L+ LS+KYGP+MHLQLGEI+AVV+S   LA+ + KTHD+VFA+RP + +L I+ Y 
Sbjct  58    PHHGLQKLSQKYGPLMHLQLGEINAVVVSSSNLAKEVMKTHDVVFANRPKLPSLKILAYG  117

Query  393   STDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNL  572
               D+ FSPYGDYWRQMRKICVLE+LS K V+SF   R++E    + SI+  S  G   NL
Sbjct  118   FKDIVFSPYGDYWRQMRKICVLEILSAKRVQSFSYIREDETKKFIESIK--SFAGSKINL  175

Query  573   TEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGM  752
             T ++    +S+I + A G   SEDQ +F++L+++ ++++ G +L DLFPS K IH  +GM
Sbjct  176   TTRIFSVINSIILRAALGD-KSEDQEEFVSLIRKAVAVSSGLELIDLFPSMKLIHVLTGM  234

Query  753   KPKLLKLHHELDKIFDIIIGDHKENHL-ANSTNSSG-KDEDIVDVLLRVKEGGELQFPIT  926
             K  + K+H  +DKI D ++  H+E     N  N S  + ED+VDVLLRV++ G L   +T
Sbjct  235   KKNVEKIHKRVDKILDNVVRKHQEKRARGNEGNKSEIEKEDLVDVLLRVQQSGSLDVQLT  294

Query  927   EDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLE  1106
              +NIKAVI D+F  GT+TS+TTI WAMSEM+K P V  KAQAE+RQA  G +   + D+E
Sbjct  295   INNIKAVIWDVFVAGTDTSSTTIEWAMSEMMKNPRVREKAQAELRQAFNGKELIYETDVE  354

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              L+YLKLVIKETLRLHPP PL+ PR S E  KI  Y IP  T V INAWA+  +P+ W D
Sbjct  355   KLSYLKLVIKETLRLHPPSPLLVPRLSTELTKIDGYDIPKNTTVFINAWAIGRDPKYWND  414

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
              ERF+PERF++S +DF GN++E+IPFGAGRRMCPG++F   S+   LA LLYHFNWELP+
Sbjct  415   AERFIPERFDDSLIDFKGNNFEYIPFGAGRRMCPGMTFGLASVIFPLALLLYHFNWELPN  474

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLI  1544
              +  +DLDM E  G+   +K +LCLI
Sbjct  475   QMKSQDLDMIEDFGLTVGRKNELCLI  500



>ref|XP_009345818.1| PREDICTED: cytochrome P450 71D9-like [Pyrus x bretschneideri]
Length=508

 Score =   483 bits (1242),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 252/509 (50%), Positives = 352/509 (69%), Gaps = 9/509 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPAR-RQKLPPGPWKLPLIGSLHHLVGGSLP  215
             MEH++   P+ +  FL F+  +  + R  N       LPPGPWKLP IG+LH L+G  LP
Sbjct  1     MEHQWPSFPI-MFAFLLFIIMVLKIGRSGNTNNYASNLPPGPWKLPFIGNLHQLIG-CLP  58

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H  LR+L+ KYGP+MHL+LGE+S +V+S  + A+ + KTHD++FASRP I+A  I+ Y S
Sbjct  59    HHGLRDLAEKYGPLMHLRLGEVSTIVVSSAEFAKEVMKTHDVIFASRPQILATRILSYGS  118

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             T++AF+PYGDYWRQ+RKIC LELLS K V+S+   R+EE+  L+ SI L S  G   NLT
Sbjct  119   TNIAFAPYGDYWRQLRKICTLELLSTKRVQSYRPVREEEVLKLIKSIALQS--GSAVNLT  176

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             +++   T S+ ++ A G+  + D  KFI + ++   +AGGF L DL+PS   +H  SG++
Sbjct  177   QEIYSLTYSITSRAASGKK-TRDHEKFIFVAEEAGKVAGGFALADLYPSVSLLHLVSGIR  235

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKD-EDIVDVLLRVKE-GGELQFPITE  929
             PKL +LH + D+I + II +H+++ L  + N  G+  ED+V VLL+  E GG L+F +T 
Sbjct  236   PKLERLHKQADRIMENIINEHQKD-LETTKNVEGESVEDLVHVLLKFHEHGGALEFSLTT  294

Query  930   DNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLEN  1109
             +NIKAVI D+FS G+E SATT+ WA+SEM+K P VM KAQ EVR+        D+  +  
Sbjct  295   NNIKAVIFDVFSAGSERSATTVDWAISEMMKNPRVMKKAQREVREVFNRKGKADETSIGE  354

Query  1110  LTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDP  1289
             + YL  VIKETLRLHP +PL+ PRE  E+ +IG Y IP K++VI+NAWA+  +P+ W +P
Sbjct  355   MKYLNTVIKETLRLHPSVPLLLPRECGEKCEIGGYGIPGKSKVIVNAWAIGRDPKYWTEP  414

Query  1290  ERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDG  1469
             ERF PERF +SS+D+ G ++E+IPFGAGRR+CPGI +   ++ L LA LLYHF+W+LPDG
Sbjct  415   ERFKPERFLDSSIDYKGTNFEYIPFGAGRRICPGILYGLANVELPLALLLYHFDWKLPDG  474

Query  1470  VSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
                +DLDMTE  G+   +K+DL LI  P+
Sbjct  475   TKHEDLDMTETFGIAVRRKQDLHLIPIPY  503



>ref|XP_008227138.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D9-like [Prunus 
mume]
Length=512

 Score =   483 bits (1243),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 246/498 (49%), Positives = 345/498 (69%), Gaps = 6/498 (1%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             ++ ++F+  V  I  +R ++  +    LPPGPWKLP+IG+LH L  GSLPH  LR+L++K
Sbjct  12    LAFLLFMIMVLKIGKIRGKTKYSA-SNLPPGPWKLPVIGNLHQL-AGSLPHHGLRDLAKK  69

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHL+LGE+SAVV+S  + A+ + KTHDL+FASRP ++A  I+ Y ST++AF+PYG+
Sbjct  70    YGPLMHLKLGEVSAVVVSSAEFAKEVMKTHDLIFASRPQVLAARILSYGSTNIAFAPYGE  129

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKIC +ELLS K V+S+   R+EE+ NL+ SI  +S  G P NLT+++     ++
Sbjct  130   YWRQLRKICTIELLSAKRVRSYRPIREEEIRNLIKSI--ASRAGSPINLTQEICSSAFTI  187

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
              ++ AFG+  + DQ KFI ++K+    A GF L D+FPS   +H  SGM+PKL +LH E 
Sbjct  188   TSRAAFGKK-TRDQEKFIYIMKEAAKAASGFALADVFPSVSLLHLLSGMRPKLERLHKEA  246

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMF  962
             D+I   II +H+ + +         +ED+VDVLL+  E G EL+  +T +NIKAVI D+F
Sbjct  247   DRIMGNIIKEHQRDMVTTXCVEGEAEEDLVDVLLKFHEHGNELELSLTTENIKAVIFDIF  306

Query  963   STGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKET  1142
               G+ETS+T + WA+ EMI+ P VM  AQ EVR+        D+  +  + YL LVIKET
Sbjct  307   GAGSETSSTAVDWAIVEMIRNPRVMNMAQNEVREVFNRKGQVDETCIREMKYLNLVIKET  366

Query  1143  lrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENS  1322
             LRLHPP+PL+ PRE  E+ +I  Y IP K++VI+NAWA+  +P  W +PE F P RF +S
Sbjct  367   LRLHPPVPLLLPRECGEKCEIDGYEIPVKSKVIVNAWAIGRDPNYWNEPESFNPNRFLDS  426

Query  1323  SVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEA  1502
             S+D+ G ++E+IPFGAGRRMCPG+SF   +I L LA LLYHF+W+LP+G+  +DLDMTEA
Sbjct  427   SIDYKGTNFEYIPFGAGRRMCPGVSFGLANIELPLALLLYHFDWKLPNGMKHEDLDMTEA  486

Query  1503  VGVIASKKKDLCLIARPF  1556
              G    +K DL LI  P+
Sbjct  487   FGAAVKRKDDLHLIPIPY  504



>ref|XP_008345750.1| PREDICTED: cytochrome P450 71D8-like [Malus domestica]
Length=519

 Score =   483 bits (1243),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 252/511 (49%), Positives = 334/511 (65%), Gaps = 22/511 (4%)
 Frame = +3

Query  75    IVFLSFVF-CIYTL--------RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTL  227
             I FL+ +F C+  L        +R +      +LPPGPWK+PLIG+LH +   SLPH  +
Sbjct  9     IFFLAVIFTCLVALVTPLVIYWKRHATSTTTVRLPPGPWKVPLIGNLHQMAASSLPHXCM  68

Query  228   RNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVA  407
              +L+ KYGPIMHL+LG++SAVVIS P+  + + KTHD+ F+ RP  +A +I+ Y S  + 
Sbjct  69    TDLANKYGPIMHLKLGQLSAVVISSPEFVQEMLKTHDVAFSQRPTFLAAEILSYNS-GII  127

Query  408   FSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVS  587
             FSPY D+WRQMRKIC+LELLS K V+SF S RQEE SNLV SI LS   G P NL+E + 
Sbjct  128   FSPYNDFWRQMRKICMLELLSAKRVESFASIRQEEASNLVESISLSD--GHPFNLSEMIF  185

Query  588   WFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLL  767
                S +IA+ AFG+ C   Q +F++ L+  + LA  FD+ DLFPS K++ Y   +KP + 
Sbjct  186   SXQSVIIARAAFGKKCKYQQ-EFLSQLQDAVRLAAEFDVPDLFPSLKFLRYVINLKPAVE  244

Query  768   KLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAV  947
             K+H ++DKI D II DH+      S       EDIVDVLLR++E GELQF +T   IKAV
Sbjct  245   KVHQKMDKILDEIISDHRVKRNEESAAGDDHQEDIVDVLLRLQESGELQFDLTTTQIKAV  304

Query  948   INDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKL  1127
               DMFS G+ETSATT  WAM+E+++ P  M KAQAEVRQ   G    ++ D++ L YL L
Sbjct  305   TLDMFSAGSETSATTTEWAMAELLRSPRAMKKAQAEVRQLXGGKGKIEESDIKKLDYLNL  364

Query  1128  VIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPE  1307
             VI+ET  L    P   PR++ E+  IG Y IP +  V INAW +  +P+ WE+ + FLPE
Sbjct  365   VIRET--LRLHPPPFIPRQASEKCTIGGYDIPTEATVFINAWGIGRDPKYWENADCFLPE  422

Query  1308  RFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSP---  1478
             RF+ SSVDF G ++E +P G GRRMCPGISFA  SI L+L+ LLYHF+W+LP+       
Sbjct  423   RFQGSSVDFRGTNFELVPXGGGRRMCPGISFATASIELALSHLLYHFDWKLPNANGSSXE  482

Query  1479  ----KDLDMTEAVGVIASKKKDLCLIARPFV  1559
                 ++LDMTE  G+   KK +L LIA PF+
Sbjct  483   XXLLEELDMTECKGLNVRKKNNLYLIAIPFI  513



>ref|XP_002523467.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF38926.1| cytochrome P450, putative [Ricinus communis]
Length=507

 Score =   483 bits (1242),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 241/488 (49%), Positives = 348/488 (71%), Gaps = 6/488 (1%)
 Frame = +3

Query  84    LSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMH  263
             L F+F ++ + ++SN   +  LPPGPWKLP+IG++H+++G SLPH +L NL++K+GPIMH
Sbjct  14    LLFIFTVFLIMKKSN-IHKLPLPPGPWKLPIIGNIHNVLG-SLPHHSLHNLAKKFGPIMH  71

Query  264   LQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMR  443
             LQLGE++A+++S P++A+ I KTHD++FASRP ++AL I+F  +TDVAF+PYG++WRQMR
Sbjct  72    LQLGEVNAIIVSSPEIAKEIMKTHDVIFASRPFVVALKIIFGNTTDVAFAPYGEFWRQMR  131

Query  444   KICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAF  623
             KICV+E+LS K V+SF   R+EE+ N +  I  S   G   N+++ +  +  ++I + AF
Sbjct  132   KICVVEILSAKRVQSFRPIREEEILNAIKEITCSE--GSMVNISKVLLSYAYNVILRAAF  189

Query  624   GRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDI  803
             G++ +E+Q   I L+K    ++ GF + DLFPS K IH   GM+ +  + + E DKI D 
Sbjct  190   GKI-TEEQEALIPLIKDAAEVSAGFSIADLFPSIKLIHNLDGMRSRTERAYQEADKIIDT  248

Query  804   IIGDHKENHLANSTNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTET  980
             +I  HK    A+S   S ++  D++DVLL ++E   L F +T +N+K VI D+F  GTET
Sbjct  249   VINYHKLRRKASSNKISDQESNDLIDVLLNIQEQENLDFTLTTENLKGVILDVFLGGTET  308

Query  981   SATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpp  1160
             S+T I WA+SEM+K P VM KAQ EVR+A    +  D++ L  L YLKLVIKETLRLHPP
Sbjct  309   SSTVIEWALSEMMKNPRVMEKAQVEVRRAFGKKEYVDEESLGELNYLKLVIKETLRLHPP  368

Query  1161  lplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMG  1340
             L L+ PRES EE +I  + IP K++VI+NAWA+  +P+ W + E F+PERF + +VD+ G
Sbjct  369   LALLLPRESREECEINGFPIPNKSKVIVNAWAIGRDPKYWSEAESFIPERFSDGTVDYRG  428

Query  1341  NHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIAS  1520
              ++EFIPFG+GRRMCPGI+F   +I + LA LLY+F+W+LPDG+ P+D+DMTEA G    
Sbjct  429   ANFEFIPFGSGRRMCPGITFGMVNIEVPLANLLYYFDWKLPDGMKPEDIDMTEAAGTSVR  488

Query  1521  KKKDLCLI  1544
             +K  L L+
Sbjct  489   RKNSLNLV  496



>ref|XP_008791005.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=506

 Score =   482 bits (1241),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 241/482 (50%), Positives = 348/482 (72%), Gaps = 7/482 (1%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             ++  +R +KLPP P KLP+IG LHHL G ++ HR LR+LSR++GP+M+L+LG++  VVIS
Sbjct  28    KAAKSRARKLPPSPRKLPIIGHLHHLRG-NVHHRALRDLSRRHGPVMYLKLGQVDHVVIS  86

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P+ AR I +THDL+FA+RP ++  +++ +  TD+AF+PYG+YWRQ+RKIC++ELLS K 
Sbjct  87    SPEAAREIMQTHDLIFATRPRLLIPEMLHH-CTDIAFAPYGNYWRQLRKICIVELLSAKR  145

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             VK+F + +QEE+SNLV +I + +++  P NL+EK+S  T+ +I++VA G+ C   Q + I
Sbjct  146   VKAFATPQQEEISNLVGNISMLNKS--PVNLSEKLSLLTNGVISRVACGKTCKHGQ-RII  202

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
             +  K++ +LA GF + DLFPS  +I   SG++        ELD+I + II +H+E   A 
Sbjct  203   SSCKKLTALASGFCVADLFPSFGFIDTLSGLRSASANARRELDEILEDIIKEHQEKRAAT  262

Query  840   STNSSG--KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1013
             ++N     ++ED+VDVLL +KE G L+FP+T  NIKAVI DMF  GT+TS+ T++WAM+E
Sbjct  263   NSNKGDDQREEDLVDVLLGLKENGGLEFPLTHTNIKAVIMDMFFAGTDTSSETMVWAMAE  322

Query  1014  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1193
             ++K+P VM KAQAEVR+ LKG    ++ D+    Y+KLVIKETLRLHPP PL+ PR   +
Sbjct  323   LLKQPEVMEKAQAEVRRVLKGKAKIEEGDMSEFHYMKLVIKETLRLHPPAPLLLPRVCTK  382

Query  1194  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1373
               ++  Y IP  +RV+INAWA+  +P  WEDPE F PERFE SSVDF+G+ +E +PFG G
Sbjct  383   SCQVDGYDIPVGSRVMINAWAIGRDPRYWEDPESFKPERFEGSSVDFVGSSFELVPFGGG  442

Query  1374  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             RR+CPG++F    + L L+ LLY+F+W+LP+G+ P D++MTE  G    +K  LCLIA P
Sbjct  443   RRICPGMNFGLAEMELFLSHLLYYFDWKLPNGMGPDDVEMTETFGSTVGRKSPLCLIATP  502

Query  1554  FV  1559
             +V
Sbjct  503   YV  504



>ref|XP_008779150.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=502

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 249/494 (50%), Positives = 337/494 (68%), Gaps = 10/494 (2%)
 Frame = +3

Query  78    VFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPI  257
              FL FV  +  L + +     +KLPP PWKLP+IG LHHL+G  LPHR LR LSR++GP+
Sbjct  13    AFLLFVLIVIKLIKSTA---TRKLPPSPWKLPIIGHLHHLLG-PLPHRALRELSRRHGPL  68

Query  258   MHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQ  437
             MHL+LG++  +++S P++AR I KTHDL+FASR  I+A    FY   D+ F+PYG YWR+
Sbjct  69    MHLRLGQVDHIIVSSPKMAREILKTHDLIFASRDKILA-SKAFYDGADIVFAPYGSYWRE  127

Query  438   MRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKV  617
             +RKICV+ELLS K VKSF + RQE +SNLV  I  S+    P NL+E     ++++ + V
Sbjct  128   LRKICVIELLSAKRVKSFSTIRQEVMSNLVGYI--STMNNSPVNLSEMFLLTSNTMTSMV  185

Query  618   AFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIF  797
              FG  C     +FI+ LK++L    GF + DLFPS  +I   SG    L K H E+D+I 
Sbjct  186   TFGTKCKHGP-RFISTLKKLLEFLSGFSVADLFPSLGFIDTLSGASSSLKKCHREVDEIL  244

Query  798   DIIIGDHKENHLA-NSTNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTG  971
               II +H+E     NS+N   +  ED+VDVLL +KE G L+FP+T  +IKAVI DMF+ G
Sbjct  245   GEIIKEHEEKRATKNSSNEEQQQGEDLVDVLLELKENGGLEFPLTLTSIKAVIMDMFAGG  304

Query  972   TETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrl  1151
             TETSATT+ W M+E+++ P +M K QAEVRQALKG    +++D+    Y+KLVIKE+LRL
Sbjct  305   TETSATTLEWTMAELMRHPEIMEKVQAEVRQALKGKARIEEEDINKFHYMKLVIKESLRL  364

Query  1152  hpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVD  1331
             H P PL+ PR   E  ++G Y IP  +R+I+NAWA AT+P  WEDPE F PERF+ SSVD
Sbjct  365   HQPGPLLLPRVCRETCQVGGYNIPAGSRIIVNAWAAATDPRYWEDPESFKPERFDGSSVD  424

Query  1332  FMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGV  1511
             + G ++E++PFGAGRR+CP ++F    + ++LA LLYHF+W+LP+G++P DLDMTE+   
Sbjct  425   YKGGNFEYMPFGAGRRICPAMTFGLAQVEVALANLLYHFDWKLPNGMAPNDLDMTESFAA  484

Query  1512  IASKKKDLCLIARP  1553
                 K  L LIA P
Sbjct  485   AVGLKSRLWLIATP  498



>ref|XP_008246006.1| PREDICTED: cytochrome P450 71D11-like [Prunus mume]
Length=514

 Score =   482 bits (1240),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 247/498 (50%), Positives = 346/498 (69%), Gaps = 6/498 (1%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             ++ ++F+  V  I  +R ++  +    LPPGPWKLP+IG+LH L  GSLPH  LR+L++K
Sbjct  12    LAFLLFMIMVLKIGKIRGKTKYSA-SNLPPGPWKLPVIGNLHQL-AGSLPHHRLRDLAKK  69

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHL+LGE+SAVV+S  + A+ + KTHDL+FASRP I+A  I+ Y STD+ ++PYG+
Sbjct  70    YGPLMHLKLGEVSAVVVSSAEFAKEVMKTHDLIFASRPTILAAKILSYGSTDIGYAPYGE  129

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKIC LELLS K V+SF   R+EE+ NL+  I  +S  G P N+T +V   T ++
Sbjct  130   YWRQLRKICTLELLSTKRVQSFRPIREEEVVNLIQWI--ASRAGSPINITREVYSSTYTI  187

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
              ++ AFG+  + DQ KFI ++K+ +  A GF L D+FPS   +H  SGM+ KL +LH E 
Sbjct  188   TSRTAFGKK-TRDQEKFIYIVKEFVKAASGFALTDIFPSVSLLHLLSGMRLKLERLHKEA  246

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMF  962
             D+I   II +H+ + +   +     +ED+VDVLL+  + G EL+F +T +NIKAVI D+F
Sbjct  247   DRILGNIIKEHQRDLVTTKSGEGEAEEDLVDVLLKFHDHGNELEFSLTIENIKAVIFDIF  306

Query  963   STGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKET  1142
             + G+ETS+T + WA++EMIK P VM  AQ EVR+        D+  +  + YL LVIKET
Sbjct  307   AAGSETSSTAVDWAIAEMIKNPRVMNMAQNEVREVFNRKGQVDETCIREMKYLNLVIKET  366

Query  1143  lrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENS  1322
             LRLHPP PL+ PRE  E+ +I  Y IP K++VI+NAWA+  +P  W +PE F P+RF +S
Sbjct  367   LRLHPPGPLLLPRECREKCEIDGYEIPVKSKVIVNAWAIGRDPNYWNEPESFNPDRFLDS  426

Query  1323  SVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEA  1502
             S+D+ G ++E+IPFGAGRRMCPG+SF   ++ L LA LLYHF+W+LP G+  +DLDMTEA
Sbjct  427   SIDYKGTNFEYIPFGAGRRMCPGVSFGLANVELPLALLLYHFDWKLPSGMKHEDLDMTEA  486

Query  1503  VGVIASKKKDLCLIARPF  1556
              G    +K DL LI  P+
Sbjct  487   FGATVKRKDDLHLIPIPY  504



>ref|XP_006341719.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=506

 Score =   481 bits (1239),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 253/496 (51%), Positives = 354/496 (71%), Gaps = 8/496 (2%)
 Frame = +3

Query  78    VFLSF-VFCIYTLRRRSNPARRQ--KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKY  248
             +FLSF VF +  ++  S   R +   LPPGP KLPLIG+LH L+G SLPH TLR+++ +Y
Sbjct  10    IFLSFLVFLVIAIKLISESMRGKGANLPPGPRKLPLIGNLHQLMG-SLPHHTLRDMANEY  68

Query  249   GPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDY  428
             GPIMHL+ GE+  V++S  + A+ + KTHDLVFA RP I+  DI+ Y ST + FSPYGD+
Sbjct  69    GPIMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFADRPKILVADIIGYNSTQITFSPYGDH  128

Query  429   WRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLI  608
             WRQ+RKICV ELL++K V+SF S RQEE+ +L+ +I L+   G   NL++ +   T+++I
Sbjct  129   WRQLRKICVAELLNVKRVQSFESLRQEEVKDLIKTISLNP-AGTTINLSQMIFTLTNNII  187

Query  609   AKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELD  788
             A+ AFGR   E+Q +FIA L++++ LAGGFDL D FPS K++H  +G K  + K+HH++D
Sbjct  188   ARAAFGRKL-ENQDEFIATLRKIVDLAGGFDLPDTFPSLKFLHPLTGAKAAMEKIHHQID  246

Query  789   KIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFST  968
             KI + ++ +HK      + N   K ED+VDVLLRV+E G+L+ PIT D IKAVI + F  
Sbjct  247   KILESVLQEHKAARKL-AINREDK-EDLVDVLLRVQESGDLEVPITTDTIKAVILETFIA  304

Query  969   GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1148
             GT+TS+T + WAM+E++K P VM +AQAEVRQA KG     + +++ L YL+LVIKETLR
Sbjct  305   GTDTSSTALEWAMAELMKNPQVMEQAQAEVRQAFKGKSMITEFEVQQLDYLRLVIKETLR  364

Query  1149  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSV  1328
             LH P+PL+ PR + +  ++G Y I   TR+++NAWA+  +P+ WE+ E F PER  NS++
Sbjct  365   LHAPVPLLVPRVARQRCELGGYEIQANTRLMVNAWAICRDPKYWENAECFEPERHRNSTL  424

Query  1329  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVG  1508
             DF GN++EFIPFGAGRR CPGI F  +++ L LA LL HF+W+LP+G+ P +LDMTEA G
Sbjct  425   DFKGNNFEFIPFGAGRRACPGILFGISNLELPLAQLLLHFDWKLPNGIEPNNLDMTEAFG  484

Query  1509  VIASKKKDLCLIARPF  1556
                 KK +L +I  P+
Sbjct  485   ETVRKKTNLHVIGIPY  500



>gb|KHM99028.1| Cytochrome P450 71D11 [Glycine soja]
Length=496

 Score =   481 bits (1237),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 243/493 (49%), Positives = 348/493 (71%), Gaps = 12/493 (2%)
 Frame = +3

Query  90    FVFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIM  260
             F+F I  L+  SN  + +    +PPGPWKLP+IG++HHLV  S PHR LR+L++ YGP+M
Sbjct  4     FLFMIVALKIGSNLKKTESSPNIPPGPWKLPIIGNIHHLVT-SAPHRKLRDLAKMYGPLM  62

Query  261   HLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQM  440
             HLQLGE+  +++S P+ A+ I KTHD++FASRP I+A DI+ Y+ST++ FSPYG+YWRQ+
Sbjct  63    HLQLGEVFTIIVSSPEYAKEIMKTHDVIFASRPKILASDILCYESTNIVFSPYGNYWRQL  122

Query  441   RKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVA  620
             RKIC LEL + K V SF   R++EL+NLV  +   S  G P N TE V     ++I++ A
Sbjct  123   RKICTLELFTQKRVNSFQPTREKELTNLVKMV--DSHKGSPMNFTEAVLLSIYNIISRAA  180

Query  621   FGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFD  800
             FG  C +DQ +FI+++K+ +++  GF++GDLFPS KW+   +G++PKL +LH ++D+I +
Sbjct  181   FGMEC-KDQEEFISVVKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHRQIDRILE  239

Query  801   IIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPI--TEDNIKAVINDMFSTGT  974
              II +HK+   ANS   S   ED+VDVLL+ ++G +    I  + +NIKA+I D+FS G 
Sbjct  240   GIINEHKQ---ANSKGYSEAKEDLVDVLLKFQDGNDSNQDICLSINNIKAIILDIFSAGG  296

Query  975   ETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlh  1154
             +T+A+TI WAM+EMI+   VM K Q EVR+        D+  ++ L YLK V+KETLRLH
Sbjct  297   DTAASTINWAMAEMIRDSRVMEKVQIEVREVFNMKGRVDEICIDELKYLKSVVKETLRLH  356

Query  1155  pplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDF  1334
             PP PL+ PRE  +  +I  Y IP K++VI+NAWA+  +P+ W + ERF PERF +SS+D+
Sbjct  357   PPAPLLLPRECGQACEINGYHIPVKSKVIVNAWAIGRDPKYWSEAERFYPERFIDSSIDY  416

Query  1335  MGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVI  1514
              G ++E+IPFGAGRR+CPG +F   ++ ++LA LLYHF+W+LP+G+  +DLDMTE  GV 
Sbjct  417   KGTNFEYIPFGAGRRICPGSTFGLINVEVALAFLLYHFDWKLPNGMKSEDLDMTEQFGVT  476

Query  1515  ASKKKDLCLIARP  1553
               +K DL LI  P
Sbjct  477   VRRKNDLYLIPVP  489



>ref|XP_003600328.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70579.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=498

 Score =   481 bits (1237),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 246/495 (50%), Positives = 342/495 (69%), Gaps = 13/495 (3%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
              S+   L FVF    +  + + +  Q LPPGP KLP+IG++H+L+G SLPH  LR+LS K
Sbjct  9     TSIFSLLMFVFIANKILTKKSESSAQNLPPGPLKLPIIGNIHNLIG-SLPHHRLRDLSTK  67

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHL+LGE+S +V+S  + A+ + K HDLVFASRP I A  I+ Y S  +AF+PYGD
Sbjct  68    YGPLMHLKLGEVSTIVVSSAEYAKEVMKNHDLVFASRPPIQASKIMSYDSLGLAFAPYGD  127

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWR +RKIC LELLS K V+SF   R EE++NL+  I  SS+ G   N T++V    S++
Sbjct  128   YWRNLRKICTLELLSSKRVQSFQPIRSEEVTNLIKWI--SSKEGSQINFTKEVFSTISTI  185

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
              ++ AFG+ C E+Q KFI++++  + +AGGFDLGDL+PS + +   SG+KPKL KLH + 
Sbjct  186   TSRTAFGKKCKENQ-KFISIVRDAIKIAGGFDLGDLYPSCRLLQNISGLKPKLEKLHKQA  244

Query  786   DKIFDIIIGDHKENHLANSTNSSGKD--EDIVDVLLRVKEGGELQFPITEDNIKAVINDM  959
             D I   II +H+E + +    + G++  ED+VDVLL+       Q  + ++++KAVI DM
Sbjct  245   DLIMQNIIDEHREVNKSRVNENQGEEVEEDLVDVLLK-------QDGLNDNSVKAVILDM  297

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKE  1139
             +  G+ETSATTI WAM+EMIK P +M K QAEVR+     +  ++ D+E LTYLK V+KE
Sbjct  298   YGGGSETSATTITWAMAEMIKNPKIMEKVQAEVREVFDKERNPNESDMEKLTYLKYVVKE  357

Query  1140  TlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFEN  1319
             TLRLHPP   + PRE  +  +I  Y IP K++VI+NAWA+  +P  W+DPERF PERF  
Sbjct  358   TLRLHPPAAFLLPRECGQACEINGYDIPFKSKVIVNAWAIGRDPNHWDDPERFYPERFIE  417

Query  1320  SSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTE  1499
             S VD+ GN++EFIPFGAGRRMCPG++F   ++   LA L+YHF+W+LP+ +  +DLDM+E
Sbjct  418   SCVDYKGNNFEFIPFGAGRRMCPGVTFGLVNVEYPLALLMYHFDWKLPNEMKNEDLDMSE  477

Query  1500  AVGVIASKKKDLCLI  1544
               G   ++K DL LI
Sbjct  478   TFGSAVTRKDDLYLI  492



>ref|XP_006605460.1| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=508

 Score =   481 bits (1237),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 243/493 (49%), Positives = 348/493 (71%), Gaps = 12/493 (2%)
 Frame = +3

Query  90    FVFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIM  260
             F+F I  L+  SN  + +    +PPGPWKLP+IG++HHLV  S PHR LR+L++ YGP+M
Sbjct  16    FLFMIVALKIGSNLKKTESSPNIPPGPWKLPIIGNIHHLVT-SAPHRKLRDLAKMYGPLM  74

Query  261   HLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQM  440
             HLQLGE+  +++S P+ A+ I KTHD++FASRP I+A DI+ Y+ST++ FSPYG+YWRQ+
Sbjct  75    HLQLGEVFTIIVSSPEYAKEIMKTHDVIFASRPKILASDILCYESTNIVFSPYGNYWRQL  134

Query  441   RKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVA  620
             RKIC LEL + K V SF   R++EL+NLV  +   S  G P N TE V     ++I++ A
Sbjct  135   RKICTLELFTQKRVNSFQPTREKELTNLVKMV--DSHKGSPMNFTEAVLLSIYNIISRAA  192

Query  621   FGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFD  800
             FG  C +DQ +FI+++K+ +++  GF++GDLFPS KW+   +G++PKL +LH ++D+I +
Sbjct  193   FGMEC-KDQEEFISVVKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHRQIDRILE  251

Query  801   IIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPI--TEDNIKAVINDMFSTGT  974
              II +HK+   ANS   S   ED+VDVLL+ ++G +    I  + +NIKA+I D+FS G 
Sbjct  252   GIINEHKQ---ANSKGYSEAKEDLVDVLLKFQDGNDSNQDICLSINNIKAIILDIFSAGG  308

Query  975   ETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlh  1154
             +T+A+TI WAM+EMI+   VM K Q EVR+        D+  ++ L YLK V+KETLRLH
Sbjct  309   DTAASTINWAMAEMIRDSRVMEKVQIEVREVFNMKGRVDEICIDELKYLKSVVKETLRLH  368

Query  1155  pplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDF  1334
             PP PL+ PRE  +  +I  Y IP K++VI+NAWA+  +P+ W + ERF PERF +SS+D+
Sbjct  369   PPAPLLLPRECGQACEINGYHIPVKSKVIVNAWAIGRDPKYWSEAERFYPERFIDSSIDY  428

Query  1335  MGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVI  1514
              G ++E+IPFGAGRR+CPG +F   ++ ++LA LLYHF+W+LP+G+  +DLDMTE  GV 
Sbjct  429   KGTNFEYIPFGAGRRICPGSTFGLINVEVALAFLLYHFDWKLPNGMKSEDLDMTEQFGVT  488

Query  1515  ASKKKDLCLIARP  1553
               +K DL LI  P
Sbjct  489   VRRKNDLYLIPVP  501



>gb|EYU31465.1| hypothetical protein MIMGU_mgv1a004885mg [Erythranthe guttata]
Length=506

 Score =   481 bits (1237),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 251/499 (50%), Positives = 342/499 (69%), Gaps = 12/499 (2%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIY-TLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             FN +S+++F S +F +   L++ + P + +KLPP P +LP+IG LHH+VG  L H  LR 
Sbjct  9     FNLISLLIFPSLIFLVMKALKKPNTPTKNEKLPPSPPELPVIGHLHHIVGRGLAHHALRR  68

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             ++ KYGP++HL+LG++S V+IS  + A+ + K  D   A RP  +AL I++Y  TD+AFS
Sbjct  69    VAEKYGPVLHLKLGQVSTVLISSAEAAKQVLKDQDPGCAGRPESIALKIMWYDYTDLAFS  128

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PY +YWRQMR+ICV+ELLS K VKSF S RQ+E+S L+ SI+     G P NLTEKV   
Sbjct  129   PYNEYWRQMRRICVVELLSAKNVKSFGSIRQDEVSILIKSIKKLC-GGEPINLTEKVFGM  187

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
              SS+  +  FG V  +D+   + L+K+ LS+AGGF L DLFPS K ++  S    KL ++
Sbjct  188   ISSITCRAVFGEVL-KDRDSLVYLMKEGLSMAGGFQLVDLFPSWKLLNILSWSNNKLWRM  246

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAV  947
               ++D + D ++ +H+        N SG+   EDIVDVL+RV+  GELQFPIT DNIKAV
Sbjct  247   RRKVDLVLDALLEEHR-------LNKSGEFGGEDIVDVLIRVQRNGELQFPITNDNIKAV  299

Query  948   INDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKL  1127
             I DMFS GTE+S++ I WAM+E+++ P VM K Q EVR+ LKG K  DD D+E L YLKL
Sbjct  300   IFDMFSAGTESSSSAIDWAMAELMRNPRVMEKVQREVREGLKGKKRVDDSDVEGLKYLKL  359

Query  1128  VIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPE  1307
             V+KETLRLHPP+PL+      E  K+  Y IP  +RV+I+ WA+  +P  W+DPE F PE
Sbjct  360   VVKETLRLHPPIPLLPRACREEGVKVNGYSIPINSRVMISIWAMGRDPLYWDDPETFQPE  419

Query  1308  RFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDL  1487
             RFENS +DF GN +E++PFGAGRR+CPG++F   S+ L LA +LYHFNW LP G+S   +
Sbjct  420   RFENSCIDFTGNSFEYLPFGAGRRICPGMNFGLASVELPLAQILYHFNWTLPTGISFDHV  479

Query  1488  DMTEAVGVIASKKKDLCLI  1544
             DMTE  G+  S+K  L L+
Sbjct  480   DMTEQEGITVSRKNRLFLV  498



>gb|KEH34013.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score =   481 bits (1237),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 240/472 (51%), Positives = 335/472 (71%), Gaps = 7/472 (1%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAIT  326
             LP GP KLP+IG++H+L+  S PHR L +L++KYGP+MHLQLGE+S +VIS  + A+ + 
Sbjct  37    LPKGPRKLPIIGNIHNLLS-SQPHRKLSDLAKKYGPLMHLQLGEVSTIVISSAEFAKEVM  95

Query  327   KTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  506
             KTHD+ FA+RP ++A+DI+ Y ST ++FSPYGDYWRQ RKIC LELLS+K V S+   R+
Sbjct  96    KTHDIHFATRPKVLAIDIMSYNSTSISFSPYGDYWRQARKICTLELLSLKRVNSYQPIRE  155

Query  507   EELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSL  686
             E  SNL+ SI  +SE G P N TE V     +++++ AFG  C +DQ KFI+++K+ + +
Sbjct  156   EVFSNLIKSI--ASENGSPINFTEAVLSSIYTIVSRAAFGNKC-KDQEKFISVVKESVKI  212

Query  687   AGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-D  863
             A GFDLGD FPS KW+ Y +G++PK+ K H + D+I + II +HK           G+  
Sbjct  213   AAGFDLGDSFPSSKWLQYVTGLRPKIEKFHQQTDEILENIIDEHKREKYTKVKGDQGEVA  272

Query  864   EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAK  1043
             ED+VD+LL+ ++G +  F +T+DNIKA+I D+F  G ETSA+T  WAM EMI+ P +M K
Sbjct  273   EDLVDILLKYEDGSDQDFSLTKDNIKAIILDIFGGGGETSASTTDWAMIEMIRNPRIMKK  332

Query  1044  AQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIP  1223
             AQ EVR  +K     D+K +  L+YLK V+KETLRLHP +PL+ PRE  +  +I  Y IP
Sbjct  333   AQDEVRDVIKMKGRVDEKCINELSYLKSVVKETLRLHPSVPLLLPRECGKACEIHGYHIP  392

Query  1224  PKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFA  1403
              KT+VIINAWA+A +P  W +PE+F PERF ++ +D+ G+++E+IPFG GRR+CPG +F 
Sbjct  393   VKTKVIINAWAIARDPNYWTEPEKFYPERFIDNGIDYKGSNFEYIPFGGGRRICPGSTFG  452

Query  1404  YTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
               ++ L+LA LLYHF+W+LP G+   +LDMTE  GV   +K DL L+  PFV
Sbjct  453   LRNVELALAMLLYHFDWKLPGGIKCDELDMTEQFGVTMRRKDDLLLL--PFV  502



>ref|XP_008777955.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=502

 Score =   480 bits (1236),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 248/496 (50%), Positives = 337/496 (68%), Gaps = 10/496 (2%)
 Frame = +3

Query  78    VFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPI  257
              FL FVF +  L + +     +KLPP PWKLP+IG LHHL+G +LPHR LR LSR++GP+
Sbjct  13    AFLLFVFIVIKLTKSTA---TRKLPPSPWKLPIIGHLHHLLG-ALPHRVLRELSRRHGPL  68

Query  258   MHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQ  437
             MHL+LG++  ++IS P++AR I KT DL+FASR  I+A    FY   D+ F+PYG YWR+
Sbjct  69    MHLKLGQVDHIIISSPEMAREILKTQDLIFASRDKILA-SKAFYDGADIVFAPYGCYWRE  127

Query  438   MRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKV  617
             +RKICV+ELLS K VKSF + RQEE+SNLV  I  S+    P NL+E     T++  ++V
Sbjct  128   LRKICVIELLSAKRVKSFSTLRQEEMSNLVGYI--STMNNSPVNLSEMFLLITNTTTSRV  185

Query  618   AFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIF  797
              FG  C     +FI+ +K+++    GF + DLFPS  +I   SG+  +L K H E+D+I 
Sbjct  186   VFGTKCKHGP-RFISAMKKLVEFLSGFAVADLFPSLSFIDTLSGVSSRLKKCHSEMDEIL  244

Query  798   DIIIGDHKEN-HLANSTNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTG  971
               II +H+E     NS+N   +  ED+VDVLL +KE G L+FP+T  +IKAVI DMF  G
Sbjct  245   GEIIKEHEEKRETKNSSNEERQQGEDLVDVLLELKENGGLEFPLTLTSIKAVIMDMFGAG  304

Query  972   TETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrl  1151
              ETS+TT+ W M+E+++ P  M K QAEVRQALKG     ++D     Y+KLVIKE+LRL
Sbjct  305   IETSSTTLDWTMAELMRHPKKMEKVQAEVRQALKGKAKIKEEDTNEFHYMKLVIKESLRL  364

Query  1152  hpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVD  1331
             HPP P+  PR   E  ++  Y IP  +R+I+NAWA+AT+   WEDPE F PERF+ SSVD
Sbjct  365   HPPAPVFLPRVCRERCQVDGYDIPAGSRIIVNAWAMATDSRYWEDPESFRPERFDGSSVD  424

Query  1332  FMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGV  1511
             + G +YE++PFGAG+RMCPG++F    + ++LA LLY+F+W+LP+G+ P DLDM E+ G 
Sbjct  425   YKGGNYEYMPFGAGKRMCPGMTFGMAQVEMALANLLYYFDWKLPNGMDPNDLDMNESFGA  484

Query  1512  IASKKKDLCLIARPFV  1559
                 K  L LIA P+V
Sbjct  485   AVGLKSPLWLIATPYV  500



>ref|XP_008385787.1| PREDICTED: cytochrome P450 71D11-like [Malus domestica]
Length=512

 Score =   481 bits (1237),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 251/501 (50%), Positives = 339/501 (68%), Gaps = 9/501 (2%)
 Frame = +3

Query  69    SVIVFLSFVFCIYTL----RRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
             S  V  +F+  + T+    +R         LPPGPWKLP IG++H LVG S PH  LR L
Sbjct  7     SFQVLFTFLLVVITVLKIAKRGETKDSAVNLPPGPWKLPFIGNIHQLVG-SQPHHGLRKL  65

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             ++KYGP+MHLQLGE+S VV+S  + A+ + KTHD+VFASRP+++A  I+ Y+ST++AF+ 
Sbjct  66    AKKYGPLMHLQLGEVSTVVVSSAEYAKEVMKTHDVVFASRPHLLASRIMSYESTNIAFAS  125

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
              GDYWRQ+RKIC LELLS K V+ F   R+EE+ NL++ I   S    P NLTEK+   T
Sbjct  126   CGDYWRQLRKICTLELLSTKRVQGFRPLREEEVGNLITWI--GSNASSPINLTEKIYSST  183

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
              +  ++ AFG+  SED  KFI  +K+ +++A GFDL D+FPS K ++   G++P L +L 
Sbjct  184   YTFTSRAAFGKK-SEDHEKFIDAVKESITVAAGFDLADVFPSAKLLNLIGGIRPTLERLK  242

Query  777   HELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVIN  953
                D+I + II +HK+      +      ED+VDVLL+  E G  L+F +T DNIKAVI 
Sbjct  243   KVTDRIMENIINEHKKXRSTTKSGEGEAGEDLVDVLLKFHEHGNGLEFSLTTDNIKAVIL  302

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D+F  G+ETSATT+ WAMSEMIK P ++   Q EVR+    N   D+  +  + YL LVI
Sbjct  303   DIFGAGSETSATTVDWAMSEMIKNPRILKMTQDEVREVYNRNGKVDEXSIGEMKYLSLVI  362

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KETLRLHPP PL+ PRES E  KI  Y IP KT+VI+N WA+  +P  W +PE F PERF
Sbjct  363   KETLRLHPPAPLLLPRESSESCKINGYDIPVKTKVIVNGWAIGRDPNYWTEPESFYPERF  422

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
              +SS+D+ G ++E+IPFGAGRR+CPGIS+   ++ L LA LLYHF+W+LP+G+S +DLDM
Sbjct  423   LDSSIDYKGTNFEYIPFGAGRRICPGISYGLANVELPLALLLYHFDWKLPNGMSHEDLDM  482

Query  1494  TEAVGVIASKKKDLCLIARPF  1556
             TE  GV   +K+DL LI  P+
Sbjct  483   TELFGVTVRRKEDLRLIPIPY  503



>gb|KDP39024.1| hypothetical protein JCGZ_00781 [Jatropha curcas]
Length=537

 Score =   481 bits (1238),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 243/495 (49%), Positives = 342/495 (69%), Gaps = 10/495 (2%)
 Frame = +3

Query  69    SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKY  248
             ++  FL F+F +    +R +     KL PGPWKLP+IG++H L+G S+PH  LR+LS +Y
Sbjct  12    ALFTFLLFIFIL----QRISTNYSAKLAPGPWKLPIIGNMHQLLG-SIPHHRLRHLSNQY  66

Query  249   GPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDY  428
             GP+MHL+LG+IS +VIS P+ A+ + KTHD++F+ RP ++A +I+FY   D+A +PYGD 
Sbjct  67    GPVMHLKLGQISNIVISSPEAAKKVMKTHDIIFSQRPFLLAGEIIFYNFKDIALAPYGDS  126

Query  429   WRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLI  608
             WRQMRKIC LELLS K V+SF + R+EE SN + SI   SE     N+++ V   ++++ 
Sbjct  127   WRQMRKICTLELLSTKRVRSFRAIREEETSNFIRSISSLSEV----NISKMVLSLSNAIT  182

Query  609   AKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELD  788
              + AFG+V SE    F+ L+++++ +  GF + D+FPS K++H   GM+ K+ KLH E D
Sbjct  183   LRSAFGKV-SERHEAFLPLVQKIVLVLEGFSVADIFPSVKFLHGIIGMRSKIEKLHQEAD  241

Query  789   KIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFST  968
              + + II +H+EN     +N+ GK++D+VDVLL ++ G  L+FP+  +NIKAV+ DMF  
Sbjct  242   IMLENIINEHRENKRLGRSNTQGKEDDLVDVLLNLQCGDSLEFPLRIENIKAVMLDMFLA  301

Query  969   GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1148
             GTETSAT I WAMSEM+K   VM KAQ E+RQ     +  D+   + L YLKLVIKETLR
Sbjct  302   GTETSATVIEWAMSEMVKDSRVMKKAQEEIRQVFNEKENIDETRFDELKYLKLVIKETLR  361

Query  1149  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSV  1328
             LHPP PL+ PRE +E  +I  Y +P  T+VIINAWA+  +   W + E+F PERF+N+S+
Sbjct  362   LHPPAPLLAPRECLEAVEIDGYEVPINTKVIINAWAIGRDSRHWNEAEKFYPERFQNNSI  421

Query  1329  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVG  1508
             DF GN +EFIPFGAGRRMCPG+++    + L LA LLYHF+W+LP+G+    LDM+E  G
Sbjct  422   DFKGNDFEFIPFGAGRRMCPGVTYGLAVVELVLANLLYHFDWKLPNGLEAHQLDMSETFG  481

Query  1509  VIASKKKDLCLIARP  1553
               A +K +L LI  P
Sbjct  482   ATARRKNELHLIPIP  496



>ref|XP_008778500.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=502

 Score =   480 bits (1235),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 244/497 (49%), Positives = 342/497 (69%), Gaps = 10/497 (2%)
 Frame = +3

Query  81    FLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIM  260
             FL FV  +  L + +     +KLPP PWKLP+IG LHHLVG ++PHR  R LSR++GP+M
Sbjct  14    FLLFVLLVIKLTKSTA---TRKLPPSPWKLPIIGHLHHLVG-AVPHRAFRELSRRHGPLM  69

Query  261   HLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQM  440
             HL+LG++  +++S P++AR I KTHDL+FASR N++A   VFY   D+ F+PYG YWR++
Sbjct  70    HLRLGQVDHIIVSSPEMAREILKTHDLIFASRDNVLA-SKVFYDGADLIFAPYGSYWREL  128

Query  441   RKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVA  620
             RKICV+ELLS K VKSF + RQE +SNLV  I  S+    P NL+E     ++++ ++V 
Sbjct  129   RKICVIELLSAKRVKSFSTLRQEVMSNLVGYI--STMNNSPVNLSEMFLLTSNTMTSRVT  186

Query  621   FGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFD  800
             FG  C     +FI+ +K+V  L  G+ + D+FPS  +I   SG+   L K H E+D+I  
Sbjct  187   FGTKCKHGP-RFISAMKRVNELLAGYTVADIFPSLSFIDTLSGVTSSLKKCHREMDEILG  245

Query  801   IIIGDHKENHLA-NSTNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGT  974
              II +H+E     NS+N   +  ED+VDVLL +KE G L+FP+T  +IKAVI DMF+ GT
Sbjct  246   EIIKEHEEKRATKNSSNEEQQQGEDLVDVLLELKENGGLEFPLTLTSIKAVIMDMFAGGT  305

Query  975   ETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlh  1154
             E+SATT+ W M+E+++ P +M K QAEVRQA KG    +++D+    Y+KLVIKE+LRLH
Sbjct  306   ESSATTLDWTMAELMRHPKIMEKVQAEVRQAFKGKARIEEEDINKFHYMKLVIKESLRLH  365

Query  1155  pplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDF  1334
              P PL+ PR   E  ++  Y IP  +R+IINAWA+A +P  WEDPE F PERF+ SSVD+
Sbjct  366   QPGPLLLPRVCRETCQVDGYNIPAGSRIIINAWAVARDPRYWEDPESFRPERFDGSSVDY  425

Query  1335  MGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVI  1514
              G ++E++PFGAGRR+CP ++F    + ++LA LLY+F+W+LP+G+ P D+DMTE+ G  
Sbjct  426   KGGNFEYLPFGAGRRICPAMTFGLAQVEMALANLLYYFDWKLPNGMGPNDVDMTESFGAA  485

Query  1515  ASKKKDLCLIARPFVDL  1565
                K  L LIA P+V +
Sbjct  486   VGLKSPLWLIATPYVPI  502



>gb|KDP29297.1| hypothetical protein JCGZ_19400 [Jatropha curcas]
Length=546

 Score =   481 bits (1238),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 243/475 (51%), Positives = 338/475 (71%), Gaps = 6/475 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARA  320
             ++LPPGP KLPLIG+LH+L G   PH  L  L+++YGP+MHLQLGEISA+V+S P++A+ 
Sbjct  60    KRLPPGPIKLPLIGNLHNLAGAQ-PHHALTELAKEYGPLMHLQLGEISAIVVSNPRIAQV  118

Query  321   ITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  500
             I KTHDLVFA RP I+A  I+ Y   D+AFS  G+YW+QM++I ++ELL  K V+SF S 
Sbjct  119   IMKTHDLVFADRPEILAAKIITYGGQDIAFSKLGEYWKQMKRISLMELLGPKTVQSFASL  178

Query  501   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  680
             R+ E+  L+ SI LS   G P N TEK+   T+ +  K AFG  C +DQ   IAL K+  
Sbjct  179   RENEVEKLIQSIHLSK--GKPINFTEKIFHLTNVITCKAAFGDEC-KDQDVVIALTKEAT  235

Query  681   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA--NSTNSS  854
             ++AGGF + D+FPS +++   +G+K KL KL  EL  +F  II +HK+  +    S +  
Sbjct  236   TIAGGFGIADVFPSMEFLQAITGVKGKLEKLRDELGDVFGNIIDEHKQKLMNRDGSDDVE  295

Query  855   GKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1034
              + ED+VDVLL+++  G  Q P+T +++KAV+ D+F+ GT+TS+TT+ WAMSEM+K P +
Sbjct  296   SEKEDLVDVLLKLQGSGRFQCPVTNNSLKAVVLDLFTAGTDTSSTTVEWAMSEMMKNPRI  355

Query  1035  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1214
             + KAQ EVR+A KG K   ++D++ L YL LVIKETLRLHPP PL+ PRES E  +I  Y
Sbjct  356   LKKAQEEVREAFKGKKIICEEDVKQLKYLPLVIKETLRLHPPAPLLLPRESREACEIDGY  415

Query  1215  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1394
              IP +++VI+NA+A+  +PE+W +P+ F PERF NSSVDF G ++EFIPFGAGRR+CPGI
Sbjct  416   EIPMRSKVIVNAYAIGRDPEAWPEPDNFKPERFINSSVDFKGMNFEFIPFGAGRRICPGI  475

Query  1395  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
             +F   +I L LA +LYHF+W+LP+G++ ++LDMTEA G    +K  L LI  P+ 
Sbjct  476   AFGLANIELPLARILYHFDWKLPEGITSENLDMTEAFGATVGRKNQLYLIPIPYT  530



>ref|XP_007020554.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12079.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=541

 Score =   481 bits (1237),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 243/481 (51%), Positives = 340/481 (71%), Gaps = 7/481 (1%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             +LPPGPWKLPLIG+LH LV  +LPH TL NL++KYGP+M L+LGE+  +V+S P++A+ +
Sbjct  36    RLPPGPWKLPLIGNLHQLVS-TLPHHTLSNLAKKYGPLMWLKLGEVPTLVVSSPEMAKEV  94

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              +THD+ F  RP ++A  I+ Y   D+ FSPYG+YWRQM+KIC+ ELLS   V+SF S R
Sbjct  95    MRTHDITFCQRPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELLSTNRVQSFQSIR  154

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             ++E+S L+  I  SS    P NL+EK+   T  + A+ AFG+  S D+ +FI +  +V  
Sbjct  155   EQEVSALMEII--SSNARSPVNLSEKIYSLTYGITARAAFGKK-SGDEEEFIRIAIEVSK  211

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE--NHLANSTNSSG  857
             LAGGF L D++PS + +   SG++ KL KLH   D+I + II  HKE  N +AN+   + 
Sbjct  212   LAGGFCLADMYPSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRNGMANTKTGNK  271

Query  858   KDE-DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1034
             KDE D+VD+LL++++ G+L FP+++DNIKAVI D+F  G+E S+ T+ WAMSEM++ P +
Sbjct  272   KDEEDLVDILLKLQQQGDLDFPLSKDNIKAVIQDIFGAGSEASSNTVEWAMSEMVRNPKL  331

Query  1035  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1214
             M +AQAEVR+   G    D+  LE L +LKL++KETLRL+P  PL+ PRE  E+  IG Y
Sbjct  332   MKEAQAEVRRVFHGKGKVDEVGLEELKFLKLIVKETLRLYPAGPLLIPRECSEDCVIGGY  391

Query  1215  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1394
              IP KT+VI+NAWA+  +P  W++ E+F PERF +  +DF G ++E+IPFGAGRRMCPGI
Sbjct  392   EIPAKTKVIVNAWAIGRDPSYWKEAEKFQPERFIDKPIDFRGTNFEYIPFGAGRRMCPGI  451

Query  1395  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVDL*AL  1574
             SFA  +I L LA LLYHF+W+LP+ +  +DLDMTE+ G+   +K DL LI  P+  L  +
Sbjct  452   SFALPNIELPLANLLYHFDWKLPNKMKCEDLDMTESFGLTIRRKNDLFLIPIPYRSLLKM  511

Query  1575  K  1577
             K
Sbjct  512   K  512



>ref|XP_008807779.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=513

 Score =   479 bits (1234),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 244/482 (51%), Positives = 340/482 (71%), Gaps = 6/482 (1%)
 Frame = +3

Query  117   RRSNPARRQKLPPGP-WKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             R S   R  KLPP P  KLP+IG +HHL+G ++PHR LR LS ++GP MHL+LG++  ++
Sbjct  15    RTSFQFRAGKLPPSPPEKLPVIGHIHHLLG-AMPHRALRELSSRHGPFMHLRLGQVDHII  73

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
              S  + AR I KTHDL FASRP ++A  ++FY   D+AFSP GDYWRQ+R+IC+ ELLS 
Sbjct  74    ASSTEAARDIMKTHDLAFASRPQLLAPFVMFYGGKDIAFSPMGDYWRQLRRICMQELLSP  133

Query  474   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  653
             K VKSF + RQEE+SNLV +I  S ++G P NL E +   ++S I++VAFG+ C     +
Sbjct  134   KRVKSFSTCRQEEMSNLVEAI--SKKSGSPVNLNEMLLLSSNSFISRVAFGKKCRHGL-R  190

Query  654   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  833
             FI ++K+ L +A GF + DLFPS  ++   +G+  ++ K   E+D+I + I+ +H+E   
Sbjct  191   FITIMKKALEVASGFSIADLFPSWSFVDALTGITSRIKKARQEIDEILEEILKEHEEKRE  250

Query  834   ANSTNSSG-KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1010
               S+     ++ED+VDVLL V E GEL+ P+T  ++K VI DMF  GTET++TT+ W M 
Sbjct  251   GISSKEDQLEEEDLVDVLLDVAENGELEIPLTRTHLKCVILDMFVGGTETASTTLEWVMV  310

Query  1011  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             E+++ P +M KAQAEVRQALK      ++D+  L YLKLVIKET+RLHP LPL+ PR + 
Sbjct  311   ELMRHPEMMQKAQAEVRQALKEKANIKEEDMSELHYLKLVIKETMRLHPALPLLLPRFNS  370

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             E  ++G+Y IP  TRVI+NAWA+A +P  WEDPE F PERF++S VD+MG+ +EF+PFGA
Sbjct  371   ENCQVGDYEIPAGTRVIVNAWAIARDPRYWEDPESFRPERFDDSMVDYMGSSFEFMPFGA  430

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRR+CPG +FA   + ++LA LL++F+WELP+G+ P+DLDMTE+ G     K  LCL+  
Sbjct  431   GRRICPGSTFAMAQMEIALAYLLFYFDWELPNGMEPQDLDMTESFGGTTGLKSPLCLVPV  490

Query  1551  PF  1556
             PF
Sbjct  491   PF  492



>gb|KEH26493.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score =   479 bits (1234),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 243/498 (49%), Positives = 348/498 (70%), Gaps = 11/498 (2%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQK------LPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             ++++L ++F    L       R++K      +PPGP KLP+IG++H+L+  S P+R LR+
Sbjct  4     LVLYLPYIFSSLLLILIVQKIRKKKSYSTYNIPPGPRKLPIIGNIHNLLS-SQPNRRLRD  62

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L++KYGP+MHLQLGE+S +VI+ P+ A+ + KT+D+ F SRP++++ +I+ Y  T++A+S
Sbjct  63    LAKKYGPVMHLQLGEVSTIVITSPECAKEVMKTNDINFGSRPHLLSSEIMTYNGTNIAWS  122

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYG+YW+Q+RKIC LELLS+K V S    R+E LSNLV  I   S+ G P NLT+ V+  
Sbjct  123   PYGNYWKQLRKICTLELLSLKRVNSHQPIREEVLSNLVRWI--VSQNGSPINLTQAVTSS  180

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
               +++++ AFG  C +DQ KFI+++KQ + ++ GF+LGDLFPS KWI + +G++PKL   
Sbjct  181   VYTIVSRSAFGNKC-KDQEKFISVIKQSIKVSAGFNLGDLFPSTKWIEHVTGLRPKLESF  239

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGK-DEDIVDVLLRVKEGGELQFPITEDNIKAVI  950
               + D+IF+ II DHKE          G+ +ED+VDVLL+ ++G  L F +T+DNIKA+I
Sbjct  240   QRQTDQIFENIIKDHKEAKHTKPKEDEGEVEEDLVDVLLKYEDGSNLDFSLTKDNIKAII  299

Query  951   NDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLV  1130
              DMF  G ETSA+TI WAM EM++ P +M KAQ EVR+  K     D+  +  L YLK V
Sbjct  300   MDMFGAGGETSASTIDWAMVEMVRDPRIMKKAQDEVREVFKMKGRVDENCINELNYLKSV  359

Query  1131  IKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPER  1310
             +KETLRLHPP PL+ PRE  +   I  Y IP KT+VIINAWA+A +P  W +PE F PER
Sbjct  360   VKETLRLHPPAPLLLPRECSQACDINGYHIPIKTKVIINAWAIARDPNYWTEPEMFYPER  419

Query  1311  FENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLD  1490
             F +S +DF G+++E+IPFGAGRR+CPG +F   +I  +LA LLYHF+W+LP G+  ++LD
Sbjct  420   FIDSDIDFKGSNFEYIPFGAGRRICPGSTFGLRNIETTLAMLLYHFDWKLPSGIKSEELD  479

Query  1491  MTEAVGVIASKKKDLCLI  1544
             MTE  GV   +K DL ++
Sbjct  480   MTEEFGVTMKRKNDLLVL  497



>ref|XP_008807778.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=500

 Score =   479 bits (1233),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 247/482 (51%), Positives = 336/482 (70%), Gaps = 6/482 (1%)
 Frame = +3

Query  117   RRSNPARRQKLPPGP-WKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVV  293
             R S   R  KLPP P  KLP+IG +HHL+G ++PHR LR LS ++GP MHL+LG+I  ++
Sbjct  2     RSSFQFRAGKLPPSPPEKLPVIGHIHHLLG-AMPHRALRELSSRHGPFMHLKLGQIDHII  60

Query  294   ISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSM  473
              S P+ AR I KTHDL FASRP ++A  ++FY   D+ FSP GDYWRQ+RKIC+ ELLS 
Sbjct  61    ASSPEAARDIMKTHDLAFASRPQLLAPFVLFYGGKDIVFSPVGDYWRQLRKICMQELLSP  120

Query  474   KMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGK  653
             K VKSF + RQEE+SNLV +I  S ++G P NL+E +   ++S I++VAFG+ C     +
Sbjct  121   KRVKSFSTCRQEEMSNLVEAI--SKKSGSPVNLSEMLLLSSNSFISRVAFGKKCKHGL-R  177

Query  654   FIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  833
             FI  +K+ + LA GF L DLFPS  ++   +GM  +  K   E+D+I + I+ +H+E   
Sbjct  178   FITGMKKAIELASGFSLADLFPSWSFVDALTGMTARTKKARQEIDEILEEILKEHEEKRE  237

Query  834   ANSTNSSG-KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMS  1010
               S      ++ED+VDVLL V E GEL+ P+T  ++K+V+ +MF  GTETS+TT+ W M 
Sbjct  238   GISGKEDQLEEEDLVDVLLDVAENGELEIPLTRTDLKSVVLEMFIGGTETSSTTLEWVMI  297

Query  1011  EMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             E+++ P +M KAQAEVRQALK      ++D+  L YLKLVIKET+RLHP LPL+ PR + 
Sbjct  298   ELMRHPEMMQKAQAEVRQALKEKANIKEEDMSELHYLKLVIKETMRLHPALPLLVPRFNS  357

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             E  ++G+Y IP  TRVI+NAWA+A +P  WEDPE F PERFE S VD+ G  +EF+PFGA
Sbjct  358   ENCQVGDYEIPAGTRVIVNAWAIARDPRYWEDPESFRPERFEGSMVDYKGTSFEFVPFGA  417

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRR+CPG++FA   + ++LA LL+HF+WELP+G+ P+DLDMTE+ G     K  L L+  
Sbjct  418   GRRICPGVTFAMAQMEMALAYLLFHFDWELPNGMEPQDLDMTESFGATTGLKSPLWLVPV  477

Query  1551  PF  1556
             PF
Sbjct  478   PF  479



>ref|XP_006351653.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   479 bits (1232),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 238/480 (50%), Positives = 336/480 (70%), Gaps = 13/480 (3%)
 Frame = +3

Query  138   RQKLPPGPWKLPLIGSLHHLVGGS----LPHRTLRNLSRKYGPIMHLQLGEISAVVISYP  305
             ++KLPPGPWKLP IG+LHHLV       LPHRTL  L+ KYG +MH++LGE  A+V+S P
Sbjct  28    KKKLPPGPWKLPFIGNLHHLVDWQSSELLPHRTLAKLASKYGDLMHMKLGEREAIVVSSP  87

Query  306   QLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  485
             Q+ R + + HDL F++RP ++    +FY   D+ F  YGD+WRQMRKIC+ ELLS K ++
Sbjct  88    QMVREVMRKHDLNFSNRPTLLVGTEMFYDHADMGFCNYGDFWRQMRKICIQELLSHKNIQ  147

Query  486   SFCSFRQEELSNLVSSIRLS-SETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  662
             SF      E++NLV+SI+ S SE G   N+T+ +S +T+S+I K + GR C + QG  I 
Sbjct  148   SFYPNMLNEITNLVTSIKSSASEGGSSINMTDTLSLYTNSIICKASVGRAC-KSQGSLIE  206

Query  663   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  842
             +++ V + AG FDL DLFPS K IH+ SG+K KL K+H E+D + + II +H+       
Sbjct  207   IMRTVAASAGVFDLADLFPSMKMIHFISGLKYKLRKMHDEVDVLLEEIINEHE------F  260

Query  843   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
              NS   +EDIVDVLLR+++  +   PIT DNIKA+I D+FS G+ TSA+T+ WA SE++K
Sbjct  261   QNSETSEEDIVDVLLRLQKSQDFSIPITRDNIKAIIIDLFSGGSTTSASTMEWAFSELMK  320

Query  1023  RPSVMAKAQAEVRQALKGNKT-FDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             +P +M KAQ EVR+  KG +T  D  D++ L Y+K+V+KET+R HP  PL+ PRES EE 
Sbjct  321   KPEIMKKAQDEVREVFKGKETTIDQADIQKLKYIKMVVKETVRFHPLAPLLAPRESREEC  380

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
             +I  Y+IP  T  ++N WA++ +P+ W++PE F PERF +S +DF+G H+EF PFG GRR
Sbjct  381   EINGYVIPKGTMALVNFWAISRDPKYWQNPEVFDPERFNDSHLDFIGAHFEFTPFGTGRR  440

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
             +CPG+SF+  ++ LS+A LLYHF+W+LP+G++P +LDMTE       +K +L LI  P+V
Sbjct  441   ICPGLSFSMATVELSIALLLYHFDWKLPNGMNPHELDMTEKFSNALERKNNLFLIPSPYV  500



>ref|XP_003529194.2| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=517

 Score =   479 bits (1233),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 243/495 (49%), Positives = 347/495 (70%), Gaps = 10/495 (2%)
 Frame = +3

Query  78    VFLSF-VFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             V +SF +F I  L+   N  + +    +PPGPWKLP+IG++HHLV  + PHR LR+L++ 
Sbjct  11    VIMSFSLFIIVALKIGRNLKKTESSPNIPPGPWKLPIIGNIHHLVTCT-PHRKLRDLAKT  69

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHLQLGE+  +++S P+ A+ I KTHD++FASRP I+A DI+ Y+ST++ FSPYG+
Sbjct  70    YGPLMHLQLGEVFTIIVSSPEYAKEIMKTHDVIFASRPKILASDILCYESTNIVFSPYGN  129

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKIC +ELL+ + V SF   R+EE +NLV  I   S  G P NLTE V     S+
Sbjct  130   YWRQLRKICTVELLTQRRVNSFKQIREEEFTNLVKMI--DSHKGSPINLTEAVFLSIYSI  187

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
             I++ AFG  C +DQ +FI+++K+ +++  GF++GDLFPS KW+   +G++PKL +LH + 
Sbjct  188   ISRAAFGTKC-KDQEEFISVVKEAVTIGSGFNIGDLFPSAKWLQLVTGLRPKLERLHGKT  246

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQ--FPITEDNIKAVINDM  959
             D+I   II +H+E       +    +ED+VDVLL+ ++G +      +T +NIKA+I D+
Sbjct  247   DRILKEIINEHREAKSKAKEDQGEAEEDLVDVLLKFQDGDDRNQDISLTINNIKAIILDV  306

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKE  1139
             F+ G ETSATTI WAM+E+IK P VM KAQ EVR+        D+  +  L YLK V+KE
Sbjct  307   FAAGGETSATTINWAMAEIIKDPRVMKKAQVEVREIFNMKGRVDEICINELKYLKSVVKE  366

Query  1140  TlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFEN  1319
             TLRLHPP PL+ PRE  +  +I  Y IP K++V +NAWA+  +P+ W +PERF PERF +
Sbjct  367   TLRLHPPAPLLIPRECGQTCEINGYHIPVKSKVFVNAWAIGRDPKYWTEPERFYPERFID  426

Query  1320  SSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTE  1499
             SS+D+ GN++EF PFG+GRR+CPGI+    ++ L+LA LLYHF+W+LP+G+  ++LDMTE
Sbjct  427   SSIDYKGNNFEFTPFGSGRRICPGITLGSVNVELALAFLLYHFHWKLPNGMKSEELDMTE  486

Query  1500  AVGVIASKKKDLCLI  1544
               G    +K+DL LI
Sbjct  487   KFGASVRRKEDLYLI  501



>ref|XP_009615716.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=508

 Score =   479 bits (1232),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 244/480 (51%), Positives = 333/480 (69%), Gaps = 9/480 (2%)
 Frame = +3

Query  138   RQKLPPGPWKLPLIGSLHHLVGGS----LPHRTLRNLSRKYGPIMHLQLGEISAVVISYP  305
             R+KLPPGP KLP IG++H LV       LPHRTL  L+ K+GP+MH++LGE SA+V+S P
Sbjct  30    RRKLPPGPMKLPFIGNIHQLVDWKSSELLPHRTLAKLASKHGPLMHMKLGERSAIVVSSP  89

Query  306   QLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  485
             Q+ R + + HDL F +RP ++    +FY   D+ F  YGD+WRQMRKIC+ ELLS K ++
Sbjct  90    QMVREVMRKHDLNFTNRPVLLVGKEMFYDHADMGFCNYGDFWRQMRKICIQELLSHKNIQ  149

Query  486   SFCSFRQEELSNLVSSIRLSSETG-FPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIA  662
             SF      E+SNLVSSI+  S TG  P NLTE +S +T+S+I K + GR C ++QG  I 
Sbjct  150   SFYPKMFNEISNLVSSIKADSATGGSPINLTETLSLYTNSVICKASVGRAC-KNQGSLID  208

Query  663   LLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANS  842
             +++ V   AG FDL DLFPS K IH+ SG+K KL K+H E+D + + II +H+ ++   S
Sbjct  209   IMRTVAGSAGVFDLADLFPSVKIIHFLSGLKYKLRKMHDEVDVLLEEIINEHESHN--GS  266

Query  843   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
             TN    +EDIVDVLLR+++  +   PIT DNIKA+I D+F+ G+ TSA+T+ WA SE++K
Sbjct  267   TNGDPTEEDIVDVLLRLQKSQDFSIPITRDNIKAIIIDLFAGGSTTSASTMEWAFSELMK  326

Query  1023  RPSVMAKAQAEVRQALKGN-KTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
              P +M KAQ EVR+  KG  +  D  D++ L YLK+V+KET+R HP  PL+ PRES EE 
Sbjct  327   NPKIMKKAQDEVREVFKGKLEGIDQTDIQKLKYLKMVVKETVRFHPLAPLLAPRESREEC  386

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
             +I  Y+IP  T  ++N WA++ +P  W +PE F PERF  S +DF G H+EF PFG GRR
Sbjct  387   EINGYVIPKGTMALVNFWAISRDPNYWPNPETFDPERFNESHLDFTGAHFEFTPFGTGRR  446

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
             +CPGISF+  ++ LSLA LLYHF+W+LP+G++P +LDMTE  G    +K +L LI  P+V
Sbjct  447   ICPGISFSMATVELSLALLLYHFDWKLPNGMNPHELDMTEKFGNALERKNNLYLIPLPYV  506



>ref|XP_007156881.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
 gb|ESW28875.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
Length=504

 Score =   479 bits (1232),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 248/470 (53%), Positives = 331/470 (70%), Gaps = 6/470 (1%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARA  320
             KLPPGP +LP+IG+LH L V GSLPHR L+ LS +YGP+MHLQLGEISAVV S P++ + 
Sbjct  34    KLPPGPKRLPIIGNLHQLAVAGSLPHRALQKLSHEYGPLMHLQLGEISAVVASSPEMVKE  93

Query  321   ITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  500
             ITKTHD+ F  RP  ++  I+ Y   DV F+PYGDYWRQMRKI V ELLS K V+SF   
Sbjct  94    ITKTHDVAFLQRPQFISGQILSYGGIDVVFAPYGDYWRQMRKIFVSELLSTKRVQSFSFI  153

Query  501   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  680
             R++E    + SIR S+  G P NL+ ++    S+ +++ AFG + S+D  +F+ L+K+V+
Sbjct  154   REDETEKFIDSIRTSA--GSPINLSSRIFSLVSTSVSRAAFGNI-SKDHIEFMLLIKKVM  210

Query  681   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL-ANSTNSSG  857
                GGFDL DLFPS K IH+ +G K KL KL +++D+  + I+ +H+E    A       
Sbjct  211   GSVGGFDLADLFPSMKSIHFITGKKAKLEKLLNQVDRFLESIVREHQEKQRRAKEGRVQI  270

Query  858   KDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1034
             KDED+VDVLL  ++    L   +T  N+KA+I D+F+ G +TS +TI WAM+EM++ P V
Sbjct  271   KDEDLVDVLLTFQQTDAALDIKMTTRNVKALILDIFAGGIDTSGSTIEWAMTEMMRSPRV  330

Query  1035  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1214
             M KAQAE+R+AL+  +   +KDLE L YLKLV+KETLRLHPP PL+ PRE  E   I  Y
Sbjct  331   MKKAQAELREALREKEIIHEKDLEQLPYLKLVVKETLRLHPPTPLLIPRECSERTIIDGY  390

Query  1215  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1394
              IP KT+V+IN WA+  +P+ W D E+F+PERFE SS+DF GN++E++PFGAGRR+CPGI
Sbjct  391   EIPVKTKVMINVWAICRDPKYWSDAEKFVPERFEGSSIDFKGNNFEYLPFGAGRRICPGI  450

Query  1395  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             SF   SI L LA LLYHFNWELP+ ++P+ +D  E  G+   +K DLCLI
Sbjct  451   SFGLASIMLPLARLLYHFNWELPNSMTPESIDTIERFGMAIGRKNDLCLI  500



>ref|XP_003517259.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=503

 Score =   478 bits (1231),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 242/498 (49%), Positives = 340/498 (68%), Gaps = 6/498 (1%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRN  233
             ++P+S+++       ++ L +      R KLPP PW+LP+IG+LH L +  SLP + L+ 
Sbjct  3     YSPLSIVITFFVFLLLHWLVKIYKQKSRYKLPPSPWRLPIIGNLHQLALAASLPDQALQK  62

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L RKYGP+MHLQLGEISA+V+S P++A  + KTHD+ F  RP ++A   + Y +TD+ F+
Sbjct  63    LVRKYGPLMHLQLGEISALVVSSPKMAMEVMKTHDVHFVQRPQLLAPQFMVYGATDIVFA  122

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYGDYWRQ+RKIC LELLS K V+SF   RQ+E   L+ SI   S  G   +L+ K+   
Sbjct  123   PYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENRKLIQSIH--SSAGSSIDLSGKLFSL  180

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
               + +++ AFG+  ++DQ + ++L+++ +++ GGF+L D+FPS K +H  +  K K+  +
Sbjct  181   LGTTVSRAAFGKE-NDDQDELMSLVRKAITMTGGFELDDMFPSLKPLHLLTRQKAKVEHV  239

Query  774   HHELDKIFDIIIGDHKENH-LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVI  950
             H   DKI + I+  H E   +    ++  + ED+VDVLLR+KE G L+ P+T +NIKAVI
Sbjct  240   HQRADKILEDILRKHMEKRTIGKEGSNEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVI  299

Query  951   NDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLV  1130
              ++F++GT+T A+T+ WAMSEM+K P V  KAQAE+RQ  KG +   + DLE L+YLK V
Sbjct  300   WNIFASGTDTPASTLEWAMSEMMKNPRVREKAQAELRQTFKGKEIIRETDLEELSYLKSV  359

Query  1131  IKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPER  1310
             IKETLRLHPP  LI   E ++   I  Y IP KT+V+IN WA+  +P+ W D ERF+PER
Sbjct  360   IKETLRLHPPSQLIPR-ECIKSTNIDGYDIPIKTKVMINTWAIGRDPQYWSDAERFIPER  418

Query  1311  FENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLD  1490
             F++SS+DF GN +E+IPFGAGRRMCPGI+F   SI L LA LLYHFNWELP+ + P DLD
Sbjct  419   FDDSSIDFKGNSFEYIPFGAGRRMCPGITFGLASITLPLALLLYHFNWELPNKMKPADLD  478

Query  1491  MTEAVGVIASKKKDLCLI  1544
             M E  G+   +K  L LI
Sbjct  479   MDELFGLTVVRKNKLFLI  496



>gb|KEH15784.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score =   478 bits (1231),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 247/494 (50%), Positives = 348/494 (70%), Gaps = 8/494 (2%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQ----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLS  239
             V +F SFV     +++     ++      LP GP KLP+IG++H+L+  S PHR L +L+
Sbjct  8     VSLFFSFVLLALLVQKVGKKLKKTDSTFNLPKGPRKLPIIGNIHNLLS-SQPHRKLSDLA  66

Query  240   RKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPY  419
             +KYGP+MHLQLGEIS +VIS P  AR + KTHD+ FA+RP I+A++I+ Y ST++ F+PY
Sbjct  67    KKYGPVMHLQLGEISTIVISSPDYAREVMKTHDINFATRPQILAVEIMTYNSTNIIFAPY  126

Query  420   GDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTS  599
             G+YWRQ+RKIC  ELLS+K V S+   R++ LS+LV  I  +SE G P NLT+ +     
Sbjct  127   GNYWRQVRKICTFELLSLKRVNSYQPIREDVLSDLVKWI--ASENGSPINLTKALISSIY  184

Query  600   SLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHH  779
             +++++ AFG  C +DQ KFI+++KQ + +AGGFDLGDLFPS KW+   +G++PKL  LH 
Sbjct  185   TIVSRAAFGNKC-KDQEKFISVVKQTIRIAGGFDLGDLFPSAKWLQQVTGLRPKLEMLHR  243

Query  780   ELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDM  959
             + D+I + II +HKE          G++ED++DVLL+ ++G   +F +T+DNIKA+I D+
Sbjct  244   QTDQILENIINEHKEARYGKLKEDEGEEEDLLDVLLKYEDGSNKEFSLTKDNIKAIIMDI  303

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKE  1139
             F  G +TSATTI WAM+EMI+ P +M KAQAEVR+    N   D+  +  L YLK V+KE
Sbjct  304   FGAGGDTSATTIDWAMAEMIREPRIMMKAQAEVREVFTLNGKVDENYISKLNYLKSVVKE  363

Query  1140  TlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFEN  1319
             TLRLHPP PL+ PRE  +  +I  Y IP +++VIINAWA+A +P  W +PERF PERF +
Sbjct  364   TLRLHPPAPLLLPRECGKACEINGYNIPFRSKVIINAWAIARDPNFWTEPERFYPERFTD  423

Query  1320  SSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTE  1499
             S++D+ G ++E+IPFGAGRR+CPG  F   ++ L+LA LLYHF+W+LP G+  ++LDMTE
Sbjct  424   STIDYKGGNFEYIPFGAGRRICPGSIFGLRNVELALAMLLYHFDWKLPCGIKSEELDMTE  483

Query  1500  AVGVIASKKKDLCL  1541
               GV   +K DL L
Sbjct  484   EFGVTMRRKDDLSL  497



>ref|XP_004232610.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   478 bits (1230),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 251/493 (51%), Positives = 349/493 (71%), Gaps = 9/493 (2%)
 Frame = +3

Query  81    FLSFVFCIYTLRRRSNPARRQ-KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPI  257
             F S +  I+T+   S   +    LPPGPWKLP IGS+HHL+   LPH TLR+L++K+GP+
Sbjct  10    FFSILLLIFTVNLLSKKRKSTLNLPPGPWKLPFIGSIHHLIASQLPHHTLRDLAKKHGPL  69

Query  258   MHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQ  437
             MHLQLGEI  +VIS P++A+ + KTHDL F +RP ++++ I+ Y  +D+AF+PYG+YWRQ
Sbjct  70    MHLQLGEIPTIVISSPRVAQEVLKTHDLAFTNRPGLLSVQILTYNYSDIAFAPYGNYWRQ  129

Query  438   MRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKV  617
             MRK+C LELLS K V SF S R+EE  +L+  +   S++G   NLTEK+   T+++I + 
Sbjct  130   MRKLCTLELLSAKNVVSFASIREEEAFDLLQDVE--SKSGSVINLTEKIYALTNAVICRA  187

Query  618   AFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIF  797
             AFG+   E+   F++L+K++  +  G D+ ++FPS K++   +G K KLLKLH + DK+ 
Sbjct  188   AFGKRRKEESTYFMSLIKELSLMITGLDISEVFPSLKFLQVITGTKEKLLKLHKKFDKVL  247

Query  798   DIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTE  977
             D+II +HK  +       S +  D+V++LL ++E G L F  T DNIKAVI DMF  GTE
Sbjct  248   DMIIEEHKHEY---DDEESSRKTDLVNLLLMLQESGTLDFSFTRDNIKAVILDMFLAGTE  304

Query  978   TSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhp  1157
             TSAT + WAM EM++ P+VM KAQ E+R+ LKG     + DL+ ++YLKLVIKETLRLHP
Sbjct  305   TSATVLDWAMVEMMRSPNVMEKAQTELRRILKGKNRVTENDLKEVSYLKLVIKETLRLHP  364

Query  1158  plplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSS---V  1328
             PLPL+ PRE  EE  I  Y IP KT+VI+NAWA+  + E WED E F PERF NS+   +
Sbjct  365   PLPLLLPRECREECVIDGYDIPIKTKVIVNAWAINRDAEFWEDSESFTPERFINSASNNL  424

Query  1329  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVG  1508
             +F+G +YE++PFG GRRMCPGISF  +++ L LA L+YHFNW+LP+G+ P+D+D+TE  G
Sbjct  425   EFIGQNYEYLPFGGGRRMCPGISFGLSNVELPLAQLIYHFNWKLPNGMKPEDVDVTETPG  484

Query  1509  VIASKKKDLCLIA  1547
                S+K +LC+IA
Sbjct  485   SSCSRKYNLCVIA  497



>ref|XP_007146612.1| hypothetical protein PHAVU_006G054900g [Phaseolus vulgaris]
 gb|ESW18606.1| hypothetical protein PHAVU_006G054900g [Phaseolus vulgaris]
Length=489

 Score =   477 bits (1228),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 244/486 (50%), Positives = 346/486 (71%), Gaps = 12/486 (2%)
 Frame = +3

Query  69    SVIVFLSFVFCIYTLRRRSNPARR-----QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRN  233
             S ++F  F+F    +++  N  R+      K+P GP KLP+IG++H+L+  S PHR LR+
Sbjct  9     SALIF--FIFLALIVQKIGNKPRKTYETASKIPHGPTKLPIIGNIHNLLS-SQPHRKLRD  65

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L+ KYGP+MHLQLGE+S +VIS P+ A+ + K HD+ FA+RP I+A +I+ Y STD+AF+
Sbjct  66    LALKYGPLMHLQLGEVSTIVISSPECAKEVMKIHDINFATRPKILASEIISYNSTDIAFA  125

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYG+YWRQ+RKIC LELLS+K VKSF   R+EELSNLV  I   SE G P NLT+ V   
Sbjct  126   PYGNYWRQLRKICTLELLSLKRVKSFQPIREEELSNLVKWI--DSEKGSPINLTQAVLSS  183

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
               S+ ++ AFG+   +DQ  FIA +K+++ L GGFD+GDLFPS  W+ + +G++PKL +L
Sbjct  184   IYSIASRSAFGKK-YKDQQNFIAAVKKLIKLEGGFDIGDLFPSATWLQHVNGIRPKLERL  242

Query  774   HHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
             H + D+I + II +HKE   + + +   + ED+VDVL++ ++G    F +T +NIKA+I 
Sbjct  243   HQQADQIMEGIINEHKEAR-SEAKDYERETEDLVDVLMQYEDGSNQDFTLTRNNIKAIIL  301

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D+F+ G ETSATTI WAM+E+IK   +M KAQAEVR+     +  D+  +  L YLKLV+
Sbjct  302   DIFAAGGETSATTIDWAMAEIIKDSRIMRKAQAEVREVFNMKRRVDENCINELKYLKLVV  361

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KETLR HPPLPL+ PRE  +  +I  Y IP K++VI+NAWA+  +   W +PERF PERF
Sbjct  362   KETLRFHPPLPLLLPRECGKTCEIHGYNIPAKSKVIVNAWAIGRDSNYWTEPERFYPERF  421

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
              +S+VD+ GN++EFIPFGAGRR+CPG +F+   + ++LA LLYHF+W+LP G+  ++LDM
Sbjct  422   IDSTVDYKGNNFEFIPFGAGRRICPGSTFSSRIVEVTLAMLLYHFDWKLPSGMISEELDM  481

Query  1494  TEAVGV  1511
             +E  G+
Sbjct  482   SEEFGI  487



>sp|E1B2Z9.1|C7AV8_CICIN RecName: Full=Cytochrome P450 71AV8; AltName: Full=(+)-Valencene 
oxidase [Cichorium intybus]
 gb|ADM86719.1| valencene oxidase [Cichorium intybus]
Length=496

 Score =   477 bits (1227),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 243/494 (49%), Positives = 344/494 (70%), Gaps = 13/494 (3%)
 Frame = +3

Query  90    FVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQ  269
              +F I+ L  R+    ++ L P PW+LP+IG +HHL+G ++PHR +  L+RK+G +MHLQ
Sbjct  14    IIFIIFKLLTRT--TSKKNLLPEPWRLPIIGHMHHLIG-TMPHRGVMELARKHGSLMHLQ  70

Query  270   LGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKI  449
             LGE+S +V+S P+ A+ +  T+D+ FA+RP  +  +IV Y +TD+  +PYG+YWRQ+RK+
Sbjct  71    LGEVSTIVVSSPRWAKEVLTTYDITFANRPETLTGEIVAYHNTDIVLAPYGEYWRQLRKL  130

Query  450   CVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGR  629
             C LELLS K VKSF S R+EE  NLV  IR S+  G P NL+E +    ++++++ AFG+
Sbjct  131   CTLELLSNKKVKSFQSLREEECWNLVKDIR-STGQGSPINLSENIFKMIATILSRAAFGK  189

Query  630   VCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIII  809
                +DQ KF  L+K++L L GGFD+ D+FPSKK +H+ SG + KL  +H++LD + + II
Sbjct  190   GI-KDQMKFTELVKEILRLTGGFDVADIFPSKKLLHHLSGKRAKLTNIHNKLDNLINNII  248

Query  810   GDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSAT  989
              +H  N       +S   E ++DVLLR+KE  E  FP+T DN+KAVI DMF  GT+TS+ 
Sbjct  249   AEHPGNR------TSSSQETLLDVLLRLKESAE--FPLTADNVKAVILDMFGAGTDTSSA  300

Query  990   TIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplpl  1169
             TI WA+SE+I+ P  M K Q E+RQAL G +   ++DL+ L YLKLVIKETLRLHPPLPL
Sbjct  301   TIEWAISELIRCPRAMEKVQTELRQALNGKERIQEEDLQELNYLKLVIKETLRLHPPLPL  360

Query  1170  ihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHY  1349
             + PRE  E   +G Y IP KT++I+N +A+  +PE W+D E F+PERFENS +  MG+ Y
Sbjct  361   VMPRECREPCVLGGYDIPSKTKLIVNVFAINRDPEYWKDAETFMPERFENSPITVMGSEY  420

Query  1350  EFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKK  1529
             E++PFGAGRRMCPG +    ++ L LA +LY+FNW+LP+G + +DLDMTE+ G    +K 
Sbjct  421   EYLPFGAGRRMCPGAALGLANVELPLAHILYYFNWKLPNGKTFEDLDMTESFGATVQRKT  480

Query  1530  DLCLIARPFVDL*A  1571
             +L L+   F  L A
Sbjct  481   ELLLVPTDFQTLTA  494



>gb|AJD25162.1| cytochrome P450 CYP71D374 [Salvia miltiorrhiza]
Length=502

 Score =   477 bits (1228),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 256/504 (51%), Positives = 347/504 (69%), Gaps = 12/504 (2%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLS--FVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSL  212
             ME    FN  + ++ LS    F +    +  +P   Q LPP P KLP+IG +H LVG  L
Sbjct  1     MEMDLPFNFTTTLLLLSSFIFFLLKAWTKPKSPKAHQNLPPSPPKLPVIGHIHLLVG-DL  59

Query  213   PHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYK  392
             PH+ L+  ++K+GP+MHLQLGE+ AVVIS  +  R + K  D   A RP  +A  I++Y 
Sbjct  60    PHKALQRQAQKHGPVMHLQLGEVPAVVISSREATREVLKVQDPACADRPESIASKILWYD  119

Query  393   STDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNL  572
              TD+AFS Y +YWRQMRKIC++ELLS K VKSF   R++E S L+ S+  SS  G   +L
Sbjct  120   YTDIAFSAYNEYWRQMRKICIVELLSSKNVKSFGHIRRDESSRLMKSLECSS--GNAIDL  177

Query  573   TEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGM  752
             T+K+  FTS++  + AFG+V ++  G  IAL K+ +++AGGF+L DLFPS K ++  S  
Sbjct  178   TDKIFTFTSTITCRAAFGKVMTDRDG-LIALFKEAVAMAGGFELADLFPSWKLLNVLSWS  236

Query  753   KPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITED  932
             K +L ++  +LD I D II +HK   L  S    G  EDIVDVL+R+++ GEL+FPIT D
Sbjct  237   KYRLWRMRGKLDAILDGIIDEHK---LKQSGEFGG--EDIVDVLIRMQQTGELKFPITTD  291

Query  933   NIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENL  1112
             NIKAVI DMF  GTETS+TT +WAMSEM++ P VM KAQAEVR ALKG    ++ D++ L
Sbjct  292   NIKAVIFDMFVAGTETSSTTTVWAMSEMMRNPRVMEKAQAEVRAALKGKAAVEESDVQEL  351

Query  1113  TYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPE  1292
              YLKLVIKET RLHPP+PL+   ++ EE K+  Y IP KT+V++N W++  +P+ WE PE
Sbjct  352   KYLKLVIKETFRLHPPIPLLPR-QTREECKVDGYSIPIKTKVMLNIWSMGRDPQYWEQPE  410

Query  1293  RFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGV  1472
             +F PERFENS  DF+GN +E+IPFGAGRR+CPG++F   +I L LA +LYHF+W+LP G+
Sbjct  411   KFQPERFENSPKDFIGNDFEYIPFGAGRRICPGLNFGLANIELPLAKILYHFDWKLPKGM  470

Query  1473  SPKDLDMTEAVGVIASKKKDLCLI  1544
             S + LDM+E  G+  S+KK L +I
Sbjct  471   SYERLDMSEGEGLTVSRKKPLIII  494



>gb|KEH34014.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   477 bits (1228),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 243/498 (49%), Positives = 346/498 (69%), Gaps = 11/498 (2%)
 Frame = +3

Query  72    VIVFLSFVF-------CIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLR  230
             ++++LS++F        +  + ++        LP GP KLP+IG++H+L+  S PHR LR
Sbjct  4     LVLYLSYIFFFILLAIVVQKVGKKLKNTDPFNLPNGPRKLPIIGNIHNLLS-SQPHRKLR  62

Query  231   NLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAF  410
             +L+R+YGP+MHLQLGEIS +VIS P  AR + KTHD+ FA+RP  ++ D++ Y ST +  
Sbjct  63    DLAREYGPLMHLQLGEISFIVISSPDCAREVMKTHDINFATRPQGLSSDLIAYNSTGIVS  122

Query  411   SPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSW  590
             SPYG+YWRQ+RKIC LELLS+K V S+   R+EE SNLV  I  +S+ G P NLT+ V  
Sbjct  123   SPYGNYWRQLRKICTLELLSLKRVNSYQPIREEEFSNLVKWI--ASKEGSPINLTQAVLS  180

Query  591   FTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLK  770
                ++++K AFG+   +DQ KFI+  K++L +A GFDL +LFPS  W+H+ +G++PKL +
Sbjct  181   SIYTIVSKSAFGKKF-KDQEKFISAEKEILKIAAGFDLAELFPSITWMHFFTGLRPKLER  239

Query  771   LHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVI  950
             +H  +D+I + II +HKE       +    DED+VDVLL+ ++G   +F +T DNIKA+I
Sbjct  240   VHRVVDQIMENIINEHKEAKSKGEFDQVESDEDLVDVLLKYQDGNNKEFFLTIDNIKAII  299

Query  951   NDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLV  1130
              D+F  G ETSA+TI WAM+EM+K P +M KAQAEVR+        ++  +  L YLK +
Sbjct  300   MDIFGAGGETSASTIDWAMAEMVKNPRIMKKAQAEVREIFNMKGRVEENCINELNYLKSI  359

Query  1131  IKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPER  1310
             +KETLRLHPP PL+ PRE  +  KI  Y IP KT+VI+NAWA+A +P  W +PERF PER
Sbjct  360   VKETLRLHPPAPLLIPRECAQSCKIDGYDIPTKTKVIVNAWAIARDPNYWTEPERFYPER  419

Query  1311  FENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLD  1490
             F +S +D+ G+++E+IPFGAGRR+CPG  F   S+ L+LA LLYHF+W+LP+G+  ++LD
Sbjct  420   FIDSDIDYKGSNFEYIPFGAGRRICPGSIFGLRSVELALAKLLYHFDWKLPNGIKSEELD  479

Query  1491  MTEAVGVIASKKKDLCLI  1544
             MTE  G+   +K DL L+
Sbjct  480   MTEKFGITVCRKDDLLLL  497



>ref|XP_004512033.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=510

 Score =   477 bits (1228),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 251/497 (51%), Positives = 344/497 (69%), Gaps = 10/497 (2%)
 Frame = +3

Query  63    PVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVG-GSLPHRTLRNLS  239
             P  V + L F    Y L+        + LPPGP KLP IG+LH +   GSLPHR  + L+
Sbjct  12    PFFVFLMLRFFAKFYKLKTFG----YKLLPPGPTKLPFIGNLHQIASLGSLPHRAFQQLA  67

Query  240   RKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPY  419
              KYGPIMHL+LG+ISAVVI+ P+LA+ I KTHD+ FA+RPN+ +  I+ Y S D+AFSPY
Sbjct  68    HKYGPIMHLKLGQISAVVITSPKLAKEILKTHDITFANRPNLESAHIMTYGSIDIAFSPY  127

Query  420   GDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTS  599
             GDY+RQMRKIC+LELLS K V+SF   R++E +  +  I+  S  G   NLT ++    S
Sbjct  128   GDYYRQMRKICMLELLSAKRVQSFSYIREDETNKFIELIK--SSEGSEVNLTNRIFSLVS  185

Query  600   SLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWI-HYTSGMKPKLLKLH  776
             S +++ AFG   +EDQ +F++++++ +   GG +  DLFPS K+I H  +G K KL K+H
Sbjct  186   STVSRSAFGDK-TEDQDEFVSVIRKAIESVGGLEPADLFPSFKYIIHVLTGNKSKLEKMH  244

Query  777   HELDKIFDIIIGDHKENHLANSTNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVIN  953
              + DKI +II+  H+E       + S ++ ED+VDVLLRV++ G L  PIT  NIKAVI 
Sbjct  245   KQADKILEIIVSKHQEKQRRKKLDGSDEEQEDLVDVLLRVQQSGTLDIPITTSNIKAVIF  304

Query  954   DMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVI  1133
             D F+ GT+T+ +TI WAM+E++K P VM K Q+E+R A KG +   + D+++L YLKLVI
Sbjct  305   DAFAAGTDTTTSTITWAMAELMKNPRVMEKLQSELRDACKGKEIITEVDVQDLPYLKLVI  364

Query  1134  KETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF  1313
             KETLRLH P PL+ PRES +   IG Y IP KT+V++N WA+A +P  W D E F+PERF
Sbjct  365   KETLRLHSPTPLLLPRESTQLTNIGGYDIPKKTKVMVNVWAMARDPYYWNDAEMFIPERF  424

Query  1314  ENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDM  1493
             +++S+D+ GNH+E++PFGAGRR+CPG+SF    I L LA L YHF+W+LP+ + P+DLDM
Sbjct  425   DSNSIDYKGNHFEYLPFGAGRRICPGMSFGIAGIMLPLALLFYHFDWKLPNQMKPQDLDM  484

Query  1494  TEAVGVIASKKKDLCLI  1544
             TE  G+   +K DLCLI
Sbjct  485   TEHYGLAIGRKIDLCLI  501



>ref|XP_006346274.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   478 bits (1229),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 246/477 (52%), Positives = 337/477 (71%), Gaps = 10/477 (2%)
 Frame = +3

Query  132   ARRQ-KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQ  308
             A++Q KLPPGPW+LP IGSLHHL+G    H TLRN +++YGP+M+LQLGEI  V+IS P 
Sbjct  47    AKKQIKLPPGPWRLPFIGSLHHLIGRGPLHCTLRNFAQRYGPLMYLQLGEIPVVIISSPT  106

Query  309   LARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKS  488
             +A+ +  THDL F+ RP  M+ +I FY + ++AF P+ +YW+QMRKIC ++LLS+KMVKS
Sbjct  107   IAKELLTTHDLAFSDRPQSMSTNITFYNNKNIAFCPHDNYWKQMRKICNVQLLSVKMVKS  166

Query  489   FCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALL  668
             F + R++E+S+ VSSIR  S  G P N+TEK+ WFT+S+     FG++  +++ +FI LL
Sbjct  167   FGAIRKDEISSPVSSIR--STKGSPINMTEKIFWFTNSVTCSAPFGKIF-KNRDEFIKLL  223

Query  669   KQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTN  848
             K ++ L  GFD+ D F    +    SG++ +L+ +H ++D+I + I+ +H EN  A    
Sbjct  224   KDMVILVSGFDVADFFLLGSY--KLSGVESRLMNVHKKVDEIMEDILKEHLENK-ATRNK  280

Query  849   SSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
               G+   ED+VDVLLRV E  EL+ P T D+IKAVI D+F  G+E S    IW + E++K
Sbjct  281   GIGEFGGEDLVDVLLRVTEDAELECPFTNDHIKAVILDIFVAGSEPSVAITIWVLLEILK  340

Query  1023  RPSVMAKAQAEVRQALKGNKTFDDKD-LENLTYLKLVIKETlrlhpplplihprESMEEA  1199
              P++MAK Q EVRQ  KG K +DD++ +E LTYL LVIKETL LH P PL+ PR+  E+ 
Sbjct  341   NPNIMAKTQKEVRQVFKGKKHYDDEENMEKLTYLNLVIKETLSLHTPTPLLPPRKCREQI  400

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I    IP KT++ +NAWAL ++ ESW DPE F+PERFENSS+DFMGNH+EFIPFG GRR
Sbjct  401   YIDGCTIPLKTKIFVNAWALVSDSESWHDPESFIPERFENSSIDFMGNHFEFIPFGYGRR  460

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             +CP I F   ++ L LA LLYHF WELP G++ K+LD  E  G+  +K+KDL L+AR
Sbjct  461   ICPRILFGLFNVKLHLAKLLYHFEWELPYGMNLKELDTAETHGLSGAKQKDLYLVAR  517



>gb|AAK62343.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=473

 Score =   476 bits (1224),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 241/479 (50%), Positives = 333/479 (70%), Gaps = 33/479 (7%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +++ ++ ++LPPGPWK+P++GS+ H++GG  PH  LR+L++KYGPIMHLQ GEISAVV++
Sbjct  23    KNSNSQTKQLPPGPWKIPILGSMLHMLGGE-PHHILRDLAKKYGPIMHLQFGEISAVVVT  81

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
               ++A+ + KTHD+VFASRP I+A+DI+ Y  +D+AFSPYGD+WRQMRKICV+ELL+ K 
Sbjct  82    SREMAKEVLKTHDVVFASRPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKN  141

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF S R++E+  L+ SIR  S +G   N T+++ WF SS+  + AFG+V  + Q  F 
Sbjct  142   VRSFSSIRRDEVVRLIDSIRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVL-KGQDVFA  200

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
               +++V+ LA GFD+ D+FPS K++H  SGMK KLL  H ++D I + +I +HK+N    
Sbjct  201   KKIREVIGLAEGFDVADIFPSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNLATG  260

Query  840   STNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMI  1019
              TN +                               + DMF+ GTETS+TT +WAM+EM+
Sbjct  261   KTNGA-------------------------------LGDMFAAGTETSSTTTVWAMAEMM  289

Query  1020  KRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEA  1199
             K P+V  KAQAEVR+  K   TFD+ D E L YLKLVIKETLRLHPP PL+ PRE  E+ 
Sbjct  290   KNPNVFNKAQAEVRETFKDKVTFDEIDAEELEYLKLVIKETLRLHPPSPLLVPRECREDT  349

Query  1200  KIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRR  1379
              I  Y IP KT+V++N WAL  +P+ W+D E F PERFE  SVDF GN++EF+PFG GRR
Sbjct  350   DINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERFEQCSVDFFGNNFEFLPFGGGRR  409

Query  1380  MCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             +CPG+SF   ++ L LA LLYHF+W+LP G+ P DLD+TE  G+  ++K DL L+A P+
Sbjct  410   ICPGMSFGLANLYLPLAQLLYHFDWKLPSGMMPGDLDLTELAGITIARKGDLYLMATPY  468



>ref|XP_007146605.1| hypothetical protein PHAVU_006G054200g [Phaseolus vulgaris]
 gb|ESW18599.1| hypothetical protein PHAVU_006G054200g [Phaseolus vulgaris]
Length=494

 Score =   476 bits (1224),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 244/498 (49%), Positives = 345/498 (69%), Gaps = 15/498 (3%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             +S+++F+     I T +     A    LPPGPWKLP+IG++H+LVG SLPHR LR+LS K
Sbjct  9     LSIVIFMFIAHKIITKK----CASTSNLPPGPWKLPIIGNIHNLVG-SLPHRRLRDLSAK  63

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHL+LGE+S +V+S  + A+ + KTHDL+FASRP I+A  I+ Y S  ++FSPYGD
Sbjct  64    YGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLIFASRPPILASKILSYDSVGISFSPYGD  123

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKIC LELLS+K V+SF   R+EEL+  + +I  +S+ G P NLT+++    S++
Sbjct  124   YWRQLRKICALELLSLKRVQSFQPIREEELTKFIKNI--ASKEGSPINLTKEILSTISTI  181

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
             +++ A G     D  KFI+ +++   +AGGFDLGDL+PS  W+ + SG+K KL + H + 
Sbjct  182   VSRTALGSKY-RDHKKFISAVREATEVAGGFDLGDLYPSAGWLQHISGLKGKLEQSHQQT  240

Query  786   DKIFDIIIGDHKE-NHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMF  962
             D+I   II DH+E    A        ++D+VDVL++       +F +++++IKAVI D++
Sbjct  241   DRIMQRIIDDHREAKSRAAQAQGEQVEDDLVDVLMKE------EFGLSDNSIKAVILDIY  294

Query  963   STGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKET  1142
               G+ETS+ TI WAM+EMIK P VM K Q+EVR+        ++ D+ENL YLK V+KET
Sbjct  295   GGGSETSSITITWAMAEMIKNPRVMKKVQSEVREVFGKEGGPNESDMENLKYLKSVVKET  354

Query  1143  lrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENS  1322
             LRLHPP PL+ PRES +  +I  Y IP K+++I+NAWA+  +P  W + ERF PERF  S
Sbjct  355   LRLHPPGPLLLPRESGQACEIKGYHIPIKSKIIVNAWAIGRDPNHWTEAERFYPERFIES  414

Query  1323  SVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEA  1502
               D+ GN++E+IPFGAGRRMCPG++F  T++   LA L+YHF+W+LP+G+  +DLDMTE 
Sbjct  415   DFDYKGNNFEYIPFGAGRRMCPGLTFGLTNVEFPLALLMYHFDWKLPNGMRNEDLDMTEV  474

Query  1503  VGVIASKKKDLCLIARPF  1556
              GV  S+K DL LI   F
Sbjct  475   FGVSVSRKHDLQLIPVTF  492



>ref|XP_010061478.1| PREDICTED: cytochrome P450 71D9-like [Eucalyptus grandis]
 gb|KCW68420.1| hypothetical protein EUGRSUZ_F02072 [Eucalyptus grandis]
Length=507

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 244/497 (49%), Positives = 337/497 (68%), Gaps = 9/497 (2%)
 Frame = +3

Query  81    FLSFVFCIYTLRRR--SNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
             FL F+F    + +R  ++     KLPPGPWKLP+IG++H L GG LPHRTL  L++KYGP
Sbjct  13    FLLFIFMALKIAKRKPNSEGSAPKLPPGPWKLPIIGNMHQL-GGPLPHRTLSELAKKYGP  71

Query  255   IMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWR  434
             +MHL++GE+S VV S  + A+ + KTHD++FASRP I+A  I+ Y  T + F+PYG+YWR
Sbjct  72    LMHLKMGEVSTVVFSSLETAKEVLKTHDVIFASRPPILASSIISYDCTSITFAPYGEYWR  131

Query  435   QMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAK  614
             Q+RKIC+LELLS K V S+ S R++E+ N+V  I  ++  G   NLTEK+      + ++
Sbjct  132   QLRKICILELLSSKRVLSYRSIREDEMLNMVRWI--AARAGMTINLTEKIYSSQYGMTSR  189

Query  615   VAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKI  794
              AFG+ C E Q +FI ++K+ +  AGGF + DLFPS K +H  SGM+PK+ KLH E D++
Sbjct  190   AAFGKKCKE-QDRFIGVVKEAIKFAGGFGIADLFPSVKLLHVMSGMRPKIEKLHQESDRM  248

Query  795   FDIIIGDHKENHLANSTNSSGK--DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFST  968
              + II +H+ N   N +    +  DED+VDVLL+ +  G+ +  +T +NIKAVI D+FS 
Sbjct  249   LEDIIREHRNNRSENKSGDQREDGDEDLVDVLLKFQNQGDQELSLTTENIKAVILDIFSA  308

Query  969   GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1148
             G+ET AT   W MSE++K P +MAKAQ EVRQ        D+  +  L YLK V+KE LR
Sbjct  309   GSETPATAADWIMSELVKNPKIMAKAQKEVRQVFGKRGKADEAGVAELKYLKSVVKEGLR  368

Query  1149  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERF-ENSS  1325
             LHPP+PL+ PRE  +  ++  Y IP KT+ IINAWAL  +P+ W DPE F P+RF ++SS
Sbjct  369   LHPPVPLLLPRECSQVCEVNGYTIPVKTKGIINAWALGRDPKYWRDPEVFDPDRFWDDSS  428

Query  1326  VDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAV  1505
             VD+ GN  E+IPFGAGRR+CPG++F    + L +A LLYHF+W LP G+  +DLDMTE  
Sbjct  429   VDYKGNCLEYIPFGAGRRICPGMTFGLAQVELQIAVLLYHFDWTLPGGMRNEDLDMTEGF  488

Query  1506  GVIASKKKDLCLIARPF  1556
              V   ++ DL LI  P+
Sbjct  489   AVTVKRRDDLFLIPTPY  505



>ref|XP_011082254.1| PREDICTED: premnaspirodiene oxygenase [Sesamum indicum]
Length=524

 Score =   476 bits (1226),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 242/510 (47%), Positives = 348/510 (68%), Gaps = 18/510 (4%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
             M+  F +N   + + +  +F +   +R+++     KLPPGP +LP+IG LH +   S+P 
Sbjct  1     MDSGFPWNFTILALLVPVIFLLLLKKRKNSKPSSAKLPPGPQELPIIGHLHLI--SSVPF  58

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
             R+ R+L++KYGPIMHL+ GE+  ++IS P++A+ + K  D VFA+RP  +A+ I+ Y   
Sbjct  59    RSFRDLAKKYGPIMHLKFGEVPGIIISSPEIAKKVLKEQDPVFANRPPAIAMQIMGYNYK  118

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             D+ FSPYGDYWRQMRKIC++ELLS K V+SF S R +E+S+LV  I+ S+  G P NLT+
Sbjct  119   DIGFSPYGDYWRQMRKICIMELLSSKSVRSFGSIRNDEVSSLVKFIQASA--GKPVNLTD  176

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
             K+ W  +S+  + +FG VC +D    I LL+  + +AGGF++ D+FPS K +   S  K 
Sbjct  177   KIFWMMNSITCRASFGTVC-KDNDALIKLLRDGMQMAGGFEIADVFPSSKIVSALSWTKW  235

Query  759   KLLKLHHELDKIFDIIIGDHKEN--HLANSTNSSGKDEDIVDVLLRVKEGGELQFPITED  932
             +L+ +  +LD I D II +HK N   LA         E++VDV LR+KE G+L+FPI  D
Sbjct  236   RLVMMGRKLDMILDDIINEHKVNLDKLAR--------ENLVDVFLRLKESGDLEFPIGND  287

Query  933   NIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKT--FDDKDLE  1106
             NIKA++ D+FS  TETSAT I W M+E+++ P VMAKAQAEVRQ   G++T   ++ ++ 
Sbjct  288   NIKAILFDVFSAATETSATAIDWIMTELMRNPGVMAKAQAEVRQVFNGSRTTSINEDNVR  347

Query  1107  NLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWED  1286
              L YLKLVI+ETLRLHP +P +    S EE  I  Y IP   +V++N+W +  +P+ W +
Sbjct  348   KLNYLKLVIRETLRLHPSVPFLPRA-SREECTINGYTIPANVKVLVNSWGMQRDPKYWTN  406

Query  1287  PERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
             PE F PERFEN+S+DF+G  +E++PFG+GRRMCPGI+FA  SI L LA LLY+FNW+LP+
Sbjct  407   PESFEPERFENNSMDFVGGDFEYLPFGSGRRMCPGITFALASIELPLAQLLYNFNWKLPE  466

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             GV P++LDM E  G+ AS+K  L ++  P+
Sbjct  467   GVKPENLDMIENPGLTASRKSKLYVVPTPY  496



>gb|KHN36164.1| Cytochrome P450 71D8 [Glycine soja]
Length=503

 Score =   476 bits (1224),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 240/498 (48%), Positives = 339/498 (68%), Gaps = 6/498 (1%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRN  233
             ++P+S+++       ++ L +      R KLPP PW+LP+IG+LH L +  SLP + L+ 
Sbjct  3     YSPLSIVITFFVFLLLHWLVKIYKQKSRYKLPPSPWRLPIIGNLHQLALAASLPDQALQK  62

Query  234   LSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFS  413
             L RKYGP+MHLQLGEIS +V+S P++A  + KTHD+ F  RP ++A   + Y +TD+ F+
Sbjct  63    LVRKYGPLMHLQLGEISTLVVSSPKMAMEVMKTHDVHFVQRPQLLAPQFMVYGATDIVFA  122

Query  414   PYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWF  593
             PYGDYWRQ+RKIC LELLS K V+SF   RQ+E   L+ SI   S  G   +L+ K+   
Sbjct  123   PYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENRKLIQSIH--SSAGSSIDLSGKLFSL  180

Query  594   TSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKL  773
               + +++ AFG+  ++DQ + ++L+++ +++ GGF+L D+FPS K +H  +  K K+  +
Sbjct  181   LGTTVSRAAFGKE-NDDQDELMSLVRKAITMTGGFELDDMFPSLKPLHLLTRQKAKVEHV  239

Query  774   HHELDKIFDIIIGDHKENH-LANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVI  950
             H   DKI + I+  H E   +    ++  + ED+VDVLLR+KE G L+ P+T +NIKAVI
Sbjct  240   HQRADKILEDILRKHMEKRTIGKEGSNEAEQEDLVDVLLRLKESGSLEVPMTMENIKAVI  299

Query  951   NDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLV  1130
              ++F++GT+T A+T+ WAMSEM+K P V  KAQAE+RQ  KG +   + DLE L+YLK V
Sbjct  300   WNIFASGTDTPASTLEWAMSEMMKNPRVREKAQAELRQTFKGKEIIRETDLEELSYLKSV  359

Query  1131  IKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPER  1310
             IKETLRLHPP  LI   E ++   I  Y IP KT+V+IN WA+  +P+ W D ERF+PER
Sbjct  360   IKETLRLHPPSQLIPR-ECIKSTNIDGYDIPIKTKVMINTWAIGRDPQYWSDAERFIPER  418

Query  1311  FENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLD  1490
             F++SS+DF GN +E+IPFGAGRRMCPGI+F   SI L LA +LYHFNWELP+ + P DLD
Sbjct  419   FDDSSIDFKGNSFEYIPFGAGRRMCPGITFGLASITLPLALILYHFNWELPNKMKPADLD  478

Query  1491  MTEAVGVIASKKKDLCLI  1544
             M E  G+   +K  L LI
Sbjct  479   MDELFGLTVVRKNKLFLI  496



>ref|XP_007020553.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12078.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=518

 Score =   476 bits (1225),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 242/474 (51%), Positives = 336/474 (71%), Gaps = 7/474 (1%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             KLPPGPWKLPLIG+LH LV  +LPH TLR+L++KYGP+M L+LGE+  +V+S  ++A+ +
Sbjct  42    KLPPGPWKLPLIGNLHQLVS-TLPHYTLRDLAKKYGPLMWLKLGEVPTLVVSSLEMAKEV  100

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              +THD+ F  RP ++A  I+ Y   D+ FSPYG+YWRQM+KIC+ ELLS   V+SF S R
Sbjct  101   MRTHDVTFCQRPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELLSTNRVQSFQSIR  160

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             ++E+S L+  I  SS    P NL+EK+   T  + A+ AFG+  S D+ +FI++  +V  
Sbjct  161   EQEVSALMEII--SSNARSPVNLSEKIYSMTYGITARAAFGKK-SGDEEEFISIAIEVSK  217

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKE--NHLANSTNSSG  857
             LAGGF L D++PS + +   SG++ KL KLH   D+I + II  HKE  N +AN+   + 
Sbjct  218   LAGGFCLADMYPSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRNGMANTKTGNK  277

Query  858   KDE-DIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSV  1034
             KDE D+VDVLL++++ G+L FP+ +DNIKAVI D+F  G+E S+ T+ WAMSEM++ P +
Sbjct  278   KDEEDLVDVLLKLQQQGDLDFPLLKDNIKAVIQDIFGAGSEASSNTVEWAMSEMVRNPKL  337

Query  1035  MAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEY  1214
             M +AQAEVR+   G    D+  LE L +LKL++KETLRL+P  PL+ PRE  E+  IG Y
Sbjct  338   MKEAQAEVRRVFHGKGKVDEVGLEELKFLKLIVKETLRLYPAGPLLIPRECSEDCVIGGY  397

Query  1215  IIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGI  1394
              IP KT+VI+NAWA+  +P  W++ E+F PERF +  +DF G ++E+IPFGAGRRMCPGI
Sbjct  398   EIPAKTKVIVNAWAIGRDPSYWKEAEKFQPERFIDKRIDFRGTNFEYIPFGAGRRMCPGI  457

Query  1395  SFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             SFA  +I L LA LLYHF+W+LP+ +   DLDMTE+ G+   +K DL LI  P+
Sbjct  458   SFALPNIELPLAKLLYHFDWKLPNEMKCDDLDMTESFGLTVRRKNDLFLIPIPY  511



>gb|KHN36162.1| Cytochrome P450 71D8 [Glycine soja]
Length=453

 Score =   473 bits (1218),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 240/459 (52%), Positives = 326/459 (71%), Gaps = 12/459 (3%)
 Frame = +3

Query  198   VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALD  377
             + GSLPHRTLR+L+ KYGP+MHLQLGEIS+VV+S P +A+ I KTHDL F  RP  +   
Sbjct  1     MAGSLPHRTLRDLALKYGPLMHLQLGEISSVVVSSPNMAKEIMKTHDLAFVQRPQFLPAQ  60

Query  378   IVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETG  557
             I+ Y  +D+AF+PYGDYWRQM+KICV ELLS K V+SF   R++E +  + S+R S   G
Sbjct  61    ILTYGQSDIAFAPYGDYWRQMKKICVSELLSAKRVQSFSDIREDETAKFIESVRTSE--G  118

Query  558   FPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIH  737
              P NLT K+    SS I++VAFG  C +DQ +F++L+K+++ +  GF+L DLFPS K +H
Sbjct  119   SPVNLTNKIYSLVSSAISRVAFGNKC-KDQEEFVSLVKELVVVGAGFELDDLFPSMK-LH  176

Query  738   YTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK----DEDIVDVLLRVKEGG  905
               +G K KL K+  ++DKI D I+ +H+E          G+    +ED+VDVLLR+++  
Sbjct  177   LINGRKAKLEKMQEQVDKIVDNILKEHQEKR--ERARREGRVDLEEEDLVDVLLRIQQSD  234

Query  906   ELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKT  1085
              L+  IT  NIKA+I D+F+ GT+TSA+T+ WAM+EM++ P V  KAQAEVRQA +  K 
Sbjct  235   NLEIKITTTNIKAIILDVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKI  294

Query  1086  FDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALAT  1265
              ++ D+E L YLKLVIKETLRLH P PL+ PRE  +   I  Y IP KT+V+INAWA+A 
Sbjct  295   INETDVEELIYLKLVIKETLRLHTPSPLLLPRECSKRTIIDGYEIPVKTKVMINAWAIAR  354

Query  1266  NPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYH  1445
             +P+ W D ERF+PERF+ SS+DF GN++E++PFGAGRRMCPG++    +I L LA LLYH
Sbjct  355   DPQYWTDAERFVPERFDGSSIDFKGNNFEYLPFGAGRRMCPGMTLGLANIMLPLALLLYH  414

Query  1446  FNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPFVD  1562
             FNWELP+ + P+ +DM E  G+   +K +LCLI  P V+
Sbjct  415   FNWELPNEMKPEYMDMVENFGLTVGRKNELCLI--PIVN  451



>ref|XP_007156884.1| hypothetical protein PHAVU_002G025300g [Phaseolus vulgaris]
 gb|ESW28878.1| hypothetical protein PHAVU_002G025300g [Phaseolus vulgaris]
Length=508

 Score =   475 bits (1223),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 245/474 (52%), Positives = 330/474 (70%), Gaps = 5/474 (1%)
 Frame = +3

Query  129   PARRQKLPPGPWKLPLIGSLHHL-VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYP  305
             P    KLPPGP KLP+IG+LH L V GSLPH  +R+L++KYGP+MHLQLG+ISAV+ S P
Sbjct  28    PKFSHKLPPGPRKLPIIGNLHQLAVAGSLPHVAIRDLAKKYGPLMHLQLGQISAVIASSP  87

Query  306   QLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVK  485
             ++A+ I KTHD+ FA RP I+   I  Y   D+AFSPYGDYWRQM+KI  LELLS K V+
Sbjct  88    EMAKEIMKTHDVAFAQRPKIVPAQIFTYGGLDIAFSPYGDYWRQMKKISKLELLSAKKVQ  147

Query  486   SFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIAL  665
             SF   R++  +  + +I   S  G   NLT ++S   S+ + K AFG + S DQ +F +L
Sbjct  148   SFSFIREQAAAKFIEAIE--SSAGSEINLTSRISNLISTSVFKAAFGNM-SGDQDEFESL  204

Query  666   LKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKEN-HLANS  842
              K +    GG D+ DLFPS ++IH  +G + KL KL   LD+I+D I+  H+E       
Sbjct  205   QKHLAIHLGGLDITDLFPSMEFIHVLTGKRSKLEKLQKRLDRIYDNIVTQHEEKLPRVQE  264

Query  843   TNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
                  ++ED+VDVLLRV++ G L   IT  +IKA+++D+F  G +TS + + W+M+EM++
Sbjct  265   RTLEAEEEDLVDVLLRVQKSGSLGINITIKHIKAMVSDIFIAGIDTSESIMEWSMTEMMR  324

Query  1023  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1202
              P+V  KAQAE+RQA KG +   + DLE ++YLKLVIKETLRLHPP+PL+ PRE  E   
Sbjct  325   NPTVREKAQAELRQAFKGKRIIHESDLEEISYLKLVIKETLRLHPPVPLLLPRECSEATI  384

Query  1203  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1382
             I  Y IP KT++++N WA+  +P+ W+D ERF+PERF+ SS DF GN++E++PFGAGRRM
Sbjct  385   IDGYEIPMKTKIMVNVWAMGRDPQYWDDAERFMPERFDGSSTDFKGNNFEYLPFGAGRRM  444

Query  1383  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             CPG+SF   SI L LA LLYHFNW+LP+G+ P+DLDMTE  G+   +K  LCLI
Sbjct  445   CPGMSFGLASIMLPLALLLYHFNWKLPNGIKPQDLDMTENFGLTIRRKGVLCLI  498



>ref|XP_007146608.1| hypothetical protein PHAVU_006G054500g [Phaseolus vulgaris]
 gb|ESW18602.1| hypothetical protein PHAVU_006G054500g [Phaseolus vulgaris]
Length=508

 Score =   475 bits (1223),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 243/500 (49%), Positives = 347/500 (69%), Gaps = 10/500 (2%)
 Frame = +3

Query  81    FLSFVFCIYTLRRRSNPARRQ-----KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
              L F+F    +++  N  R++     K+PPGP KLP+IG++H+L+  S PHR LR+L+ K
Sbjct  11    LLFFIFLTLIVQKIGNKPRKRDETTSKIPPGPTKLPIIGNIHNLLS-SQPHRKLRDLALK  69

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHLQLGE+S +VIS P+ A+ + KTHD+ FA+RP +  +D+  Y  TD+AFSPYG 
Sbjct  70    YGPLMHLQLGEVSTIVISTPECAKEVMKTHDINFATRPKLPTVDVFSYNCTDIAFSPYGY  129

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKIC LELLS+K V SF   R++ELSNLV  I   SE G P NLT+ +     ++
Sbjct  130   YWRQLRKICTLELLSLKRVNSFQPIREDELSNLVKWI--DSEKGSPINLTQALLSSIYTI  187

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
             I++ AFG+   +DQ  FI ++K+ + +AGGFD+GDLFPS  W+ + +GM+P+L +LH + 
Sbjct  188   ISRSAFGKK-YKDQENFITVVKKSMKVAGGFDIGDLFPSATWLQHVTGMRPELERLHQQT  246

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFS  965
             D I + II +HKE   + + +   + ED+VDVL++ ++G +  F +T  NIKA+I D+F 
Sbjct  247   DHIMENIINEHKEAK-SKAKDHEREPEDLVDVLIQYEDGSKQDFSLTRTNIKAIILDIFG  305

Query  966   TGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETl  1145
              G ETSATTI WAM+E++    VM KAQAEVR+        D+  +  L YLKLV+KETL
Sbjct  306   AGGETSATTIDWAMAEIMNDSRVMKKAQAEVREVFNMKGRVDENCINELKYLKLVVKETL  365

Query  1146  rlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSS  1325
             RLHPPLPL+ PRE  +  +I  Y IP K++VI+N WA+  +   W +PERF PERF +S+
Sbjct  366   RLHPPLPLLLPRECGKTCEIHGYNIPAKSKVIVNVWAIGRDSNYWTEPERFYPERFIDST  425

Query  1326  VDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAV  1505
             +D+ GN++E+IPFGAGRR+CPG  FA   + ++LA LLYHF+W+LP G+  ++LDM+E  
Sbjct  426   IDYKGNNFEYIPFGAGRRICPGSIFASRVVEVTLAMLLYHFDWKLPSGMISEELDMSEEF  485

Query  1506  GVIASKKKDLCLIARPFVDL  1565
             G+   +K DL L+  P++ L
Sbjct  486   GITVRRKHDLFLVPFPYIPL  505



>ref|XP_003617704.1| Cytochrome P450 [Medicago truncatula]
 gb|AET00663.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   475 bits (1222),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 251/502 (50%), Positives = 342/502 (68%), Gaps = 13/502 (3%)
 Frame = +3

Query  54    LFNPVSVIVF-LSFVFCIY---TLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHR  221
             L NP S I+F LSF+  +     ++R S      KLPPGPWKLPLIG+LH ++  SLPH 
Sbjct  3     LQNPFSNIIFILSFLILLVLFKIVQRWSFNNSTTKLPPGPWKLPLIGNLHQIISRSLPHH  62

Query  222   TLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTD  401
               + L+ KYGP+MHL+LGE+  V++S P++A+ I KTHDL F  RPN++  +I  Y +TD
Sbjct  63    LFKILADKYGPLMHLKLGEVPYVIVSSPEIAKEIMKTHDLNFCDRPNLLLSNIYSYNATD  122

Query  402   VAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEK  581
             +AF+ YG++WRQ+RKICV+ELLS K V+SF S R++E+SNLV SI  ++  G   NLT K
Sbjct  123   IAFAAYGEHWRQLRKICVIELLSAKRVQSFRSIREDEVSNLVKSI--TASEGSVVNLTRK  180

Query  582   VSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPK  761
             +   T+ + A+ AFG+  +  Q  FI  L++V+ L G F++ DL+PS K + + +  K K
Sbjct  181   IFSMTNGITARAAFGKR-NRHQDVFIPALEKVVVLLGRFEIADLYPSIKLLQWMTREKTK  239

Query  762   LLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVK-EGGELQFPITEDNI  938
             + KLH E+D I   II DH+  H       +  DED+VDVLL+++ E    + P+T+DN+
Sbjct  240   MEKLHTEIDMIAQDIIDDHRSIH-----KEASNDEDLVDVLLKIQQENYHSEHPLTDDNM  294

Query  939   KAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTY  1118
             K++I DMF  GTETS+  ++WAMSEM+K P VM +AQ EV +     +  D+ +L  L Y
Sbjct  295   KSIIQDMFLAGTETSSQVLLWAMSEMVKNPKVMEEAQDEVSRVFDKKEYVDETELHQLIY  354

Query  1119  LKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERF  1298
             LK VIKETLRLHP  PL+ PRES E  +I  Y IP KTRV++NAWA+  +   W + E F
Sbjct  355   LKSVIKETLRLHPVAPLLVPRESRERCQINGYEIPAKTRVMVNAWAIGRDSRYWVEAESF  414

Query  1299  LPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSP  1478
              PERF NS +DF G  +EFIPFGAGRRMCPGISFA  ++ L LA LLYHF+W+LP+G+S 
Sbjct  415   KPERFVNSPIDFKGTDFEFIPFGAGRRMCPGISFAIPNVELPLAKLLYHFDWKLPNGMSH  474

Query  1479  KDLDMTEAVGVIASKKKDLCLI  1544
             ++LDMTE  G+   +K DLCLI
Sbjct  475   QELDMTEFFGITVGRKHDLCLI  496



>gb|KHM99475.1| Cytochrome P450 71D9 [Glycine soja]
Length=474

 Score =   474 bits (1219),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 244/478 (51%), Positives = 341/478 (71%), Gaps = 14/478 (3%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQL  311
             A    LPPGPWKLP+IG++ ++VG SLPH  LR+LS KYGP+MHL+LGE+S +V+S P+ 
Sbjct  6     ASTPNLPPGPWKLPIIGNILNIVG-SLPHCRLRDLSAKYGPLMHLKLGEVSTIVVSSPEY  64

Query  312   ARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSF  491
             A+ +  T+DL+F+SRP I+A  I+ Y S  ++F+PYGDYWR +RKIC  ELLS K V+SF
Sbjct  65    AKEVLNTNDLIFSSRPPILASKIMSYDSKGMSFAPYGDYWRWLRKICTSELLSSKCVQSF  124

Query  492   CSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLK  671
                R EEL+N +   R++S+ G   NLT++V    S+++++ A G  C + Q KFI+ ++
Sbjct  125   QPIRGEELTNFIK--RIASKEGSAINLTKEVLTTVSTIVSRTALGNKCRDHQ-KFISSVR  181

Query  672   QVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNS  851
             +    AGGFDLGDL+PS +W+ + SG+KPKL K H + D+I   II +H+E   A S+ +
Sbjct  182   EGTEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADRIMQSIINEHRE---AKSSAT  238

Query  852   SGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKR  1025
              G+ E++ D L+ V  KE    +F +++++IKAVI DMF  GT+TS+TTI WAM+EMIK 
Sbjct  239   QGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDMFGGGTQTSSTTITWAMAEMIKN  294

Query  1026  PSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1202
             P VM K  AEVR    G     ++ D+ENL YLK V+KETLRL+PP PL+ PR+  ++ +
Sbjct  295   PRVMKKIHAEVRDVFGGKVGHPNESDVENLKYLKSVVKETLRLYPPGPLLLPRQCGQDCE  354

Query  1203  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRM  1382
             I  Y IP K++VI+NAWA+  +P  W + ERF PERF  SSVD+ GN +E+IPFGAGRR+
Sbjct  355   INGYHIPIKSKVIVNAWAIGRDPNHWSEAERFYPERFIGSSVDYKGNSFEYIPFGAGRRI  414

Query  1383  CPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             CPG++F  T++ L LA L+YHF+W+LP+G+  +DLDMTEA+GV A +K DLCLI   F
Sbjct  415   CPGLTFGLTNVELPLAFLMYHFDWKLPNGMKNEDLDMTEALGVSARRKDDLCLIPITF  472



>ref|XP_006452551.1| hypothetical protein CICLE_v10010293mg [Citrus clementina]
 ref|XP_006474926.1| PREDICTED: cytochrome P450 71D10-like [Citrus sinensis]
 gb|ESR65791.1| hypothetical protein CICLE_v10010293mg [Citrus clementina]
Length=501

 Score =   474 bits (1221),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 233/471 (49%), Positives = 335/471 (71%), Gaps = 6/471 (1%)
 Frame = +3

Query  141   QKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARA  320
             QKLPPGPW+LPLIG+LH LV  SLPH +LR+L++K+GP+MHL+LGE+S +V+S  ++A+ 
Sbjct  36    QKLPPGPWRLPLIGNLHQLVA-SLPHHSLRDLTQKHGPLMHLKLGEVSTIVVSSQEIAKE  94

Query  321   ITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSF  500
             + KTHDLVFA RP +++     Y  T++  +PYG YWRQ+R+IC +ELLS K V+SF S 
Sbjct  95    VLKTHDLVFAQRPLLVSAKFTSYDYTNIGLAPYGSYWRQLRRICTVELLSTKRVQSFRSI  154

Query  501   RQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVL  680
             R+EE+SNL+ ++R  S  G   NL EK+   T  + A+ AFG+ C +DQ  FI+++K+ +
Sbjct  155   REEEVSNLIKTVR--SNEGSVINLREKIFTMTFGITARAAFGKKC-KDQEVFISVVKEFI  211

Query  681   SLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK  860
              +  GF + DL+PS K +   SG++ KL KLH E D+IF  I+ +HKE      T  +  
Sbjct  212   KIMSGFSISDLYPSIKLLQEISGVRRKLKKLHLESDRIFGEILDEHKEKR--TKTAQAEA  269

Query  861   DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMA  1040
             +ED +DV + +++ G+L+FP+T++NIKAVI D+F  G++TS+T++ WAM+EM+K P ++ 
Sbjct  270   EEDPIDVFMNLQQNGDLEFPLTDNNIKAVIWDIFVAGSDTSSTSVEWAMAEMLKNPRILK  329

Query  1041  KAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYII  1220
             +AQAEVR+  KG +  ++  +  L +LKLV+KETLRLHPP PL+ PRES E  +I  Y I
Sbjct  330   EAQAEVRRVFKGKENVNEAAIHELKFLKLVVKETLRLHPPAPLLLPRESRESCEINGYAI  389

Query  1221  PPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISF  1400
             P  TR+I+NAWA+  +P  W + E   PERF NSS+D+ G  +E+IPFGAGRR+CPGI+F
Sbjct  390   PENTRIIVNAWAIGRDPSYWSEAEALYPERFLNSSIDYRGKDFEYIPFGAGRRICPGITF  449

Query  1401  AYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             A  +I L LA LL+HF+W+LP+G+    LDM+E  G+   +K DL LI  P
Sbjct  450   AIPNIELPLAQLLFHFDWKLPNGMKQDHLDMSEVFGLTIRRKNDLLLIPVP  500



>ref|XP_010061472.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=511

 Score =   475 bits (1222),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 241/496 (49%), Positives = 345/496 (70%), Gaps = 5/496 (1%)
 Frame = +3

Query  69    SVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKY  248
             SV+ F  F+F +  L  +S+     KLPPGP KLPLIG+LH L+G S PHR LR+L++K+
Sbjct  10    SVVSFCIFIFILRKLCHKSDVKGLPKLPPGPRKLPLIGNLHQLLG-SPPHRALRDLAKKH  68

Query  249   GPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDY  428
             GP+MHLQLGE+  V++S  ++A+ + KTHDL FA+RP ++A +++ Y STD+AF+PYG+Y
Sbjct  69    GPLMHLQLGEVPHVIVSSAEMAKEVMKTHDLTFATRPPLLASEVMSYGSTDIAFAPYGEY  128

Query  429   WRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLI  608
             WRQ+RKIC LEL S+K V+SF   R+EE SNLV  +  +S  G P NLT+K+        
Sbjct  129   WRQLRKICTLELFSVKRVQSFRHIREEETSNLVKWV--ASNAGSPINLTQKLFSTNYGAT  186

Query  609   AKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELD  788
             +  AFG+   E Q +FI+++ +   LA GF++GD+FPS KW+H  S MKP+L KLH + D
Sbjct  187   SIAAFGKKFKE-QEEFISVVTEANKLAAGFEVGDVFPSSKWLHVISRMKPRLEKLHRQAD  245

Query  789   KIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFST  968
              + + II + +E       + +  D D++DVLLR  + G  +F +T DNIKAVI D+F  
Sbjct  246   HMMNNIIRERREERAKRRDDETRHD-DLIDVLLRFADPGGPEFSLTADNIKAVILDIFVA  304

Query  969   GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1148
             G ETSAT + WA++EM+K P ++ KAQAEVR+        D+  L  L YLKLVIKE+LR
Sbjct  305   GGETSATQVDWALAEMMKNPRILKKAQAEVREVFDRRGKADEMGLPELEYLKLVIKESLR  364

Query  1149  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSV  1328
             + P +PL+ PRE  E  +I  Y IP KT+V++NAWA+  +P+ W++PE F PERF++S V
Sbjct  365   MRPSVPLLLPRECGERCEINGYEIPVKTKVVVNAWAIGRDPKYWDNPEVFYPERFKDSPV  424

Query  1329  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVG  1508
             D+ G  +E+IPFGAGRRMCPG++F   ++ L LA LLYHF+WELP+G+  ++LDM+E +G
Sbjct  425   DYKGTSFEYIPFGAGRRMCPGMNFGIVNVELPLAMLLYHFDWELPEGMKREELDMSELLG  484

Query  1509  VIASKKKDLCLIARPF  1556
                 +K+D+ L+ +P+
Sbjct  485   ATQRRKRDMYLVPKPY  500



>ref|XP_010910161.1| PREDICTED: premnaspirodiene oxygenase-like [Elaeis guineensis]
Length=494

 Score =   474 bits (1220),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 247/482 (51%), Positives = 333/482 (69%), Gaps = 12/482 (2%)
 Frame = +3

Query  117   RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVI  296
             RR NP    K PPGPWKLP+IGS+HHL+G SLPH +LRNLS ++GP+M L+LGE++ +V+
Sbjct  24    RRRNP----KFPPGPWKLPIIGSIHHLLG-SLPHHSLRNLSFRHGPLMLLKLGEVNTLVV  78

Query  297   SYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  476
             S P+ AR I KTHD+ FA+RP  +   +  Y   D+ F+PYGDYWR +RK+CVLELLS K
Sbjct  79    SSPEAAREIMKTHDITFANRPMPIGSKMASYGGKDLIFAPYGDYWRDLRKMCVLELLSAK  138

Query  477   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  656
              V+SF + R+EE+ NL+ SI     T    NL++K+    + +I +   G  C +DQ  F
Sbjct  139   RVQSFQAIREEEVHNLIRSISSMKTTSSLVNLSQKLFMLNNDIIMRAVVGNRC-KDQNTF  197

Query  657   IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLA  836
             I  L +++ LAGGF L DLFPS   I   + M  KL +   ++  I D II DH+E   A
Sbjct  198   ILALTEMIKLAGGFGLADLFPSSLLISRINMMASKLPRYQQKVGGILDDIIHDHQERKKA  257

Query  837   NSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1013
                     +ED++DVLLR++E GG    P+T D IKAVI DMF  GTETS+TT+ WAM+E
Sbjct  258   KLV-----EEDLLDVLLRIREEGGLPSTPLTLDEIKAVILDMFGAGTETSSTTLDWAMAE  312

Query  1014  MIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESME  1193
             ++K P V+ +AQAEVR+ L       + ++ ++ YLKLVIKETLRLHPP+PL+ PRES E
Sbjct  313   LMKNPKVLKRAQAEVRELLCRKTMVTESEISDINYLKLVIKETLRLHPPVPLLVPRESRE  372

Query  1194  EAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAG  1373
               ++  Y IP K RV++NAWAL  +P+ W+D E F PERF+ S++DF G ++EF+PFGAG
Sbjct  373   RVEVLGYEIPEKVRVLVNAWALGRDPQIWDDAEEFKPERFDGSTIDFKGTNFEFVPFGAG  432

Query  1374  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             RR+CPGISFA  ++ L+LA LLY+FNWELPDG+ P DLDM E+ G+ + +K +LCL A P
Sbjct  433   RRICPGISFALANVELTLACLLYYFNWELPDGMEPSDLDMAESFGMTSRRKLELCLRAIP  492

Query  1554  FV  1559
              V
Sbjct  493   VV  494



>gb|AES59944.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=492

 Score =   474 bits (1220),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 240/479 (50%), Positives = 340/479 (71%), Gaps = 13/479 (3%)
 Frame = +3

Query  117   RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVI  296
             +RS P    KLPPGPWKLP+IGS+HHLV  S PHR LR+L++ YGP+MHLQLGEISA+V+
Sbjct  14    KRSAP----KLPPGPWKLPIIGSIHHLVT-STPHRKLRDLAKIYGPLMHLQLGEISAIVV  68

Query  297   SYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  476
             S P+ AR + KTHD++FASRP ++ ++I+ Y  TD+AFSPYG+YWRQ+RKIC +EL + K
Sbjct  69    SSPEYAREVLKTHDVIFASRPKLLTIEILSYDYTDIAFSPYGNYWRQLRKICTMELFTQK  128

Query  477   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  656
              V SF   R+EEL+NLV   ++ S+ G P N+T+ V   T S+I K AFG   S+ +G+ 
Sbjct  129   RVSSFQPIREEELNNLVK--KIDSQQGSPVNITQLVVSSTFSIITKAAFG---SKGKGRE  183

Query  657   -IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  833
                 +    S+AGGFD+ +LFPS KW+   SG++PKL +LH ++D+I + I+ +HKE   
Sbjct  184   EFGSIGDGESIAGGFDIAELFPSAKWLQRVSGLRPKLERLHRQIDQILENIVTEHKEAKS  243

Query  834   ANSTNSSGKDEDIVDVLLRVKEGGELQFPI--TEDNIKAVINDMFSTGTETSATTIIWAM  1007
               + +  G++ED+VDVLL+ + G +    I  T++NIK++I ++   G +TSA+TI+WAM
Sbjct  244   KANESQGGEEEDLVDVLLKFQGGNDSNQDICLTDNNIKSIILNIVGAGGDTSASTIVWAM  303

Query  1008  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1187
             SE+++   VM KAQ EVR         ++  +  LTYLK V+KETLRLHPP PL+ PRE 
Sbjct  304   SELVRDKRVMKKAQDEVRDIFNMKGNVEENCINELTYLKSVVKETLRLHPPGPLLLPREC  363

Query  1188  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1367
              +  +I  Y IP K++VI+NAWA+  +P+ W +PE+F PERF  SS+D+ GN++E+IPFG
Sbjct  364   GQACEIDGYRIPIKSKVIVNAWAIGRDPKYWTEPEKFYPERFIGSSIDYKGNNFEYIPFG  423

Query  1368  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             AGRR+CPG +F   ++ L+LA +LYHF+W+LP+G+  +DLDMTE  G    +K DL LI
Sbjct  424   AGRRICPGSTFGLINVELALALMLYHFDWKLPNGMKGEDLDMTEQFGATVKRKDDLYLI  482



>ref|XP_007146606.1| hypothetical protein PHAVU_006G054300g [Phaseolus vulgaris]
 gb|ESW18600.1| hypothetical protein PHAVU_006G054300g [Phaseolus vulgaris]
Length=508

 Score =   474 bits (1221),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 247/510 (48%), Positives = 352/510 (69%), Gaps = 6/510 (1%)
 Frame = +3

Query  39    MEHKFLFNPVSVI-VFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
             M    L+ P  +  +FL+ V      + R       K+P GP KLP+IG++++L+  S P
Sbjct  1     MAQLVLYFPALIFFIFLTLVVQKIGKKPRKTDETTSKIPHGPTKLPIIGNIYNLLF-SQP  59

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H  LR+L+ KYGP+MHLQLGEIS +VIS P+ A+ + KTHD+ FA+RP ++A+DI+ Y S
Sbjct  60    HIKLRDLALKYGPLMHLQLGEISTIVISSPECAKEVMKTHDINFATRPKVLAVDIMSYNS  119

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             TD+AF+PYG+YWRQ+RKIC LELLS+K V S+   R+EELSNLV  I   S+ G P NLT
Sbjct  120   TDIAFAPYGEYWRQLRKICTLELLSLKRVNSYQPIREEELSNLVKWI--DSKKGSPINLT  177

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             + V     S+ ++ AFG+   +DQ  FI ++K+++  AGGFD+GDLFPS  W+ + +GM+
Sbjct  178   QAVLSSIYSIASRSAFGKK-YKDQENFILVIKKLIKAAGGFDIGDLFPSATWLQHVTGMR  236

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDN  935
             PKL  LH + D+I + II +HKE   + + +   + ED+VDVL++ +EG +  F +T +N
Sbjct  237   PKLENLHQQADQIMENIINEHKEAK-SEANDYEREAEDLVDVLIQYEEGSKQDFSLTRNN  295

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             IKA+I D+F+ G ETSATTI WAM+E++K   VM  AQAEVR+        D+  +  L 
Sbjct  296   IKAIILDIFAAGGETSATTIDWAMAEIMKNSRVMKHAQAEVREVFNMKGRVDENCINELK  355

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             YLKLV+KETLRLHPP+PL+ PRE  +  +I  Y IP K++VI+NAWA+  +   W +PER
Sbjct  356   YLKLVVKETLRLHPPIPLLLPRECGQTCEIHGYNIPAKSKVIVNAWAIGRDSNYWTEPER  415

Query  1296  FLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS  1475
             F PERF ++++D+ GN++E+IPFGAGRR+CPG  FA   + L+LA LLYHF+W+LP G+ 
Sbjct  416   FYPERFIDNTIDYKGNNFEYIPFGAGRRICPGSIFASRVVELTLAMLLYHFDWKLPSGMI  475

Query  1476  PKDLDMTEAVGVIASKKKDLCLIARPFVDL  1565
              ++LDM+E  G+   +K DL L+  P + L
Sbjct  476   SEELDMSEEFGITVRRKHDLFLVPFPCLPL  505



>ref|XP_003589693.1| Cytochrome P450 [Medicago truncatula]
Length=500

 Score =   474 bits (1220),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 241/479 (50%), Positives = 339/479 (71%), Gaps = 13/479 (3%)
 Frame = +3

Query  117   RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVI  296
             +RS P    KLPPGPWKLP+IGS+HHLV  S PHR LR+L++ YGP+MHLQLGEISA+V+
Sbjct  22    KRSAP----KLPPGPWKLPIIGSIHHLVT-STPHRKLRDLAKIYGPLMHLQLGEISAIVV  76

Query  297   SYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMK  476
             S P+ AR + KTHD++FASRP ++ ++I+ Y  TD+AFSPYG+YWRQ+RKIC +EL + K
Sbjct  77    SSPEYAREVLKTHDVIFASRPKLLTIEILSYDYTDIAFSPYGNYWRQLRKICTMELFTQK  136

Query  477   MVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKF  656
              V SF   R+EEL+NLV  I   S+ G P N+T+ V   T S+I K AFG   S+ +G+ 
Sbjct  137   RVSSFQPIREEELNNLVKKI--DSQQGSPVNITQLVVSSTFSIITKAAFG---SKGKGRE  191

Query  657   -IALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHL  833
                 +    S+AGGFD+ +LFPS KW+   SG++PKL +LH ++D+I + I+ +HKE   
Sbjct  192   EFGSIGDGESIAGGFDIAELFPSAKWLQRVSGLRPKLERLHRQIDQILENIVTEHKEAKS  251

Query  834   ANSTNSSGKDEDIVDVLLRVKEGGELQFPI--TEDNIKAVINDMFSTGTETSATTIIWAM  1007
               + +  G++ED+VDVLL+ + G +    I  T++NIK++I ++   G +TSA+TI+WAM
Sbjct  252   KANESQGGEEEDLVDVLLKFQGGNDSNQDICLTDNNIKSIILNIVGAGGDTSASTIVWAM  311

Query  1008  SEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprES  1187
             SE+++   VM KAQ EVR         ++  +  LTYLK V+KETLRLHPP PL+ PRE 
Sbjct  312   SELVRDKRVMKKAQDEVRDIFNMKGNVEENCINELTYLKSVVKETLRLHPPGPLLLPREC  371

Query  1188  MEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFG  1367
              +  +I  Y IP K++VI+NAWA+  +P+ W +PE+F PERF  SS+D+ GN++E+IPFG
Sbjct  372   GQACEIDGYRIPIKSKVIVNAWAIGRDPKYWTEPEKFYPERFIGSSIDYKGNNFEYIPFG  431

Query  1368  AGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             AGRR+CPG +F   ++ L+LA +LYHF+W+LP+G+  +DLDMTE  G    +K DL LI
Sbjct  432   AGRRICPGSTFGLINVELALALMLYHFDWKLPNGMKGEDLDMTEQFGATVKRKDDLYLI  490



>gb|KDO37182.1| hypothetical protein CISIN_1g010699mg [Citrus sinensis]
Length=503

 Score =   474 bits (1220),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 239/496 (48%), Positives = 339/496 (68%), Gaps = 7/496 (1%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
             +I+ +  +F I  L RR+    +  LPPGPWKLP+IG+LH L    LPHR L +L+++YG
Sbjct  8     LIISVLSLFIILKLFRRNE---KLNLPPGPWKLPIIGNLHQLARYELPHRGLADLAKQYG  64

Query  252   PIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYW  431
             P+MHL+LGE+  +V+S P  A+ IT THDLVFASRP++ A  I+ Y  +D+AF+PYG YW
Sbjct  65    PLMHLRLGEVCTIVVSSPDYAKEITTTHDLVFASRPHVPAAQILSYDFSDIAFAPYGPYW  124

Query  432   RQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIA  611
             R ++KICV ELL +K V+SF S R+EE++NLV  I   S+ G   NLTEKV     S+ +
Sbjct  125   RTLKKICVTELLGVKRVQSFRSIREEEVTNLVDWI--GSKAGSVVNLTEKVFLLMCSITS  182

Query  612   KVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDK  791
             + AFG+  +ED   F A++ +   +  G  + DL+PS K++   +G+K K+ ++H++ DK
Sbjct  183   RAAFGKK-NEDIEAFQAVVSEATEMFAGSSIADLYPSIKFLLALTGVKAKMQRMHNKTDK  241

Query  792   IFDIIIGDHKENHLANSTNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFST  968
             I   I+ DHK+     S +   ++ ED+VDVLL+ +E G L+FP+T  N+KAV+ D+FS 
Sbjct  242   ILSKIVEDHKKRRAMRSKSGKKEEVEDLVDVLLKAQEDGNLEFPLTTKNVKAVVMDVFSA  301

Query  969   GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1148
             GTETSATT+ WAMS ++K P  M KAQ EVR+        D+  LE + YLKLVIKETLR
Sbjct  302   GTETSATTVDWAMSLLMKYPKTMKKAQDEVREVFNRRGKVDEAALEEMKYLKLVIKETLR  361

Query  1149  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSV  1328
             +HP  P++ PRE  E   I  Y IP K +V++N WA+  + + W +PE F+PERF +S +
Sbjct  362   IHPSAPMLFPRECAETCNINGYDIPAKAQVLVNVWAMTRDSKYWTEPESFIPERFLDSPI  421

Query  1329  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVG  1508
             DF G ++EF+PFGAGRRMCPG+++A  +I L LA  LYHF+W+LP+G+  +DLDMTE  G
Sbjct  422   DFKGANFEFLPFGAGRRMCPGMTYANANIELPLAMFLYHFDWKLPNGMKNEDLDMTEGFG  481

Query  1509  VIASKKKDLCLIARPF  1556
             V   +K++LCLI  P+
Sbjct  482   VTVKRKQNLCLIPTPY  497



>gb|AET00662.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   474 bits (1219),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 249/502 (50%), Positives = 344/502 (69%), Gaps = 13/502 (3%)
 Frame = +3

Query  54    LFNPVSVIVF-LSFVFCIY---TLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHR  221
             L NP S I+F LSF+  +     ++R S      KLPPGPW+LPLIG+LH ++  SLPH 
Sbjct  3     LHNPFSNIIFMLSFLILLVLFKIVKRWSFNNSTTKLPPGPWELPLIGNLHQIISRSLPHH  62

Query  222   TLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTD  401
               + L+ KYGP+MHL+LGE+  +++S P++A+ I KTHDL F+ RPN++   I+ Y +TD
Sbjct  63    RFKILADKYGPLMHLKLGEVPYIIVSSPEIAKEIMKTHDLTFSDRPNLLLATILTYNATD  122

Query  402   VAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEK  581
             V FS YG+ WRQ+RKICV+ELLS K V+SF S R++E+SNL +SI  ++  G   NLT K
Sbjct  123   VIFSKYGERWRQLRKICVVELLSAKRVQSFRSTREDEVSNLATSI--TASEGSIVNLTHK  180

Query  582   VSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPK  761
             +   T  +  + AFG+  S+ Q  F + +++++SL GG  + DL+PS K +   S  K K
Sbjct  181   IFSMTYGITTRAAFGKR-SKHQQSFKSAVEEIVSLLGGICIVDLYPSIKLLQCVSRAKAK  239

Query  762   LLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVK-EGGELQFPITEDNI  938
             + KLH E+D I   II DHK  H  +S      +E +VDVLL+++ E    Q P+T+DNI
Sbjct  240   MEKLHKEIDMILQDIIDDHKSIHKEDSN-----EEYLVDVLLKIQQENYHSQHPLTDDNI  294

Query  939   KAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTY  1118
             K++I D+F  GTETS+TT++WA+SEM+K P VM +AQAEVR+        D+ +L  L Y
Sbjct  295   KSIIQDIFDAGTETSSTTVLWAISEMVKNPKVMEEAQAEVRRVFDRKGFVDETELHQLIY  354

Query  1119  LKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERF  1298
             LK VIKET+RLHP +PL+ PRES E  +I  Y IP KTRV++NAWA+  +P  W D E F
Sbjct  355   LKSVIKETMRLHPTVPLLLPRESRERCQINGYEIPAKTRVMVNAWAIGRDPRYWVDAESF  414

Query  1299  LPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSP  1478
              PERF NS +DF G  +E+IPFGAGRRMCPGI+FA  ++ L LA LLYHF+W+LP+ +  
Sbjct  415   KPERFVNSPIDFKGTDFEYIPFGAGRRMCPGIAFALPNVELPLASLLYHFDWKLPNKMKN  474

Query  1479  KDLDMTEAVGVIASKKKDLCLI  1544
             ++LDMTE+ G+ A +K +LCLI
Sbjct  475   EELDMTESFGITAGRKHNLCLI  496



>gb|KHG02344.1| Cytochrome P450 [Gossypium arboreum]
Length=512

 Score =   474 bits (1220),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 249/497 (50%), Positives = 336/497 (68%), Gaps = 14/497 (3%)
 Frame = +3

Query  78    VFLSFVF----CIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             +F+SF+      I ++R+    +   +L PGP KLPLIG+LH L G +LPHRTLR+L+ K
Sbjct  10    IFISFLLVLLIAIRSVRKSKARSLTHRLIPGPRKLPLIGNLHQLAGSTLPHRTLRDLATK  69

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YG +MHLQLG++S VVIS  ++A  I KTHD+VFASRP ++A  I+ Y+ TD+ FSPYG 
Sbjct  70    YGAVMHLQLGQVSTVVISSAEMAEEIMKTHDIVFASRPLLLAAKIITYECTDIVFSPYGK  129

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWR +RKIC  ELLS   V SF S R+EE+ NLV +I+  S  G   NL++KV   T  +
Sbjct  130   YWRNLRKICTSELLSASRVASFRSIREEEVLNLVKTIK--SNDGLAVNLSQKVFSMTYGI  187

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
              A+ AFG+ C + Q  FI++      L  GF + + FPS +++   SG+K ++ K H E 
Sbjct  188   TARAAFGKKC-KYQDSFISVAADQTKLVSGFFVSEFFPSLQFLDVASGVKYRVEKTHAEA  246

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFS  965
             D+I   I+ DHKE+       S    ED+VD+LLR++E  E  FP+T++N+KA+I D+F+
Sbjct  247   DRILQSIVNDHKESRARG--RSKDDREDLVDLLLRLQEDDE--FPLTDNNVKAIILDIFT  302

Query  966   TGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETl  1145
              G+ETSA+T+ WA+SEMIK P VM KAQAEVRQ  +G    D+  +  L YLK VIKETL
Sbjct  303   AGSETSASTVEWALSEMIKNPRVMTKAQAEVRQVFQGKGNVDETGIHQLQYLKCVIKETL  362

Query  1146  rlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSS  1325
             RLHP LPL+ PRE  +  +I  + IP KTRVIINAWA+  +P  W  PE+F PERF NSS
Sbjct  363   RLHPILPLLLPRECGKNCEINGFEIPSKTRVIINAWAIGRDPNHWAQPEKFEPERFINSS  422

Query  1326  VDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAV  1505
             VDF+G ++EFIPFGAGRR+CPGI FA  ++ L LA LL+HF+W+LP     +D+DMTE  
Sbjct  423   VDFLGTNFEFIPFGAGRRICPGILFAVPNLELPLAQLLFHFDWKLP---KQEDIDMTEEF  479

Query  1506  GVIASKKKDLCLIARPF  1556
              +   +K DL L+  P+
Sbjct  480   ALSVRRKTDLVLVPTPY  496



>gb|AGB55874.1| flavonoid 6-hydroxylase 3 [Glycine max]
 gb|AGB55875.1| flavonoid 6-hydroxylase 3 [Glycine max]
 gb|AGB55876.1| flavonoid 6-hydroxylase 3 [Glycine max]
Length=481

 Score =   473 bits (1216),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 243/482 (50%), Positives = 341/482 (71%), Gaps = 14/482 (3%)
 Frame = +3

Query  120   RSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVIS  299
             +   A    LPPGPWKLP+IG++ ++VG SLPH  LR+LS KYGP+MHL+LGE+S +V+S
Sbjct  9     KKKSASTPNLPPGPWKLPIIGNILNIVG-SLPHCRLRDLSAKYGPLMHLKLGEVSTIVVS  67

Query  300   YPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKM  479
              P+ A+ +  THDL+F+SRP I+A  I+ Y S  ++F+PYGDYWR +RKIC  ELLS K 
Sbjct  68    SPEYAKEVLNTHDLIFSSRPPILASKIMSYDSKGMSFAPYGDYWRWLRKICTSELLSSKC  127

Query  480   VKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFI  659
             V+SF   R EEL+N +   R++S+ G   NLT++V    S+++++ A G  C + Q KFI
Sbjct  128   VQSFQPIRGEELTNFIK--RIASKEGSAINLTKEVLTTVSTIVSRTALGNKCRDHQ-KFI  184

Query  660   ALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLAN  839
             + +++    AGGFDLGDL+PS +W+ + SG+KPKL K H + D+I   II +H+E   A 
Sbjct  185   SSVREGTEAAGGFDLGDLYPSAEWLQHISGLKPKLEKYHQQADRIMQSIINEHRE---AK  241

Query  840   STNSSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSE  1013
             S+ + G+ E++ D L+ V  KE    +F +++++IKAVI DMF  GT+TS+TTI WAM+E
Sbjct  242   SSATQGQGEEVADDLVDVLMKE----EFGLSDNSIKAVILDMFGGGTQTSSTTITWAMAE  297

Query  1014  MIKRPSVMAKAQAEVRQALKGNKTF-DDKDLENLTYLKLVIKETlrlhpplplihprESM  1190
             MIK P V  K  AE+R    G     ++ D+ENL YLK V+KETLRL+PP PL+ PR+  
Sbjct  298   MIKNPRVTKKIHAELRDVFGGKVGHPNESDMENLKYLKSVVKETLRLYPPGPLLLPRQCG  357

Query  1191  EEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGA  1370
             ++ +I  Y IP K++VI+NAWA+  +P  W + ERF PERF  SSVD+ GN +E+IPFGA
Sbjct  358   QDCEINGYHIPIKSKVIVNAWAIGRDPNHWSEAERFYPERFIGSSVDYKGNSFEYIPFGA  417

Query  1371  GRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIAR  1550
             GRR+CPG++F  T++ L LA L+YHF+W+LP+G+  +DLDMTEA+GV A +K DLCLI  
Sbjct  418   GRRICPGLTFGLTNVELPLAFLMYHFDWKLPNGMKNEDLDMTEALGVSARRKDDLCLIPI  477

Query  1551  PF  1556
              F
Sbjct  478   TF  479



>ref|XP_007146291.1| hypothetical protein PHAVU_006G028100g [Phaseolus vulgaris]
 gb|ESW18285.1| hypothetical protein PHAVU_006G028100g [Phaseolus vulgaris]
Length=507

 Score =   473 bits (1218),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 239/500 (48%), Positives = 345/500 (69%), Gaps = 10/500 (2%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQK-----LPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
              +VF+S VF    +R+  N  ++ +     +P GP KLP+IG++H+L+  S PHR LR+L
Sbjct  7     CLVFISCVFTTLVVRKIGNTNKKGEDTPCNMPHGPRKLPVIGNIHNLLF-SQPHRKLRDL  65

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             + K+GP+MHLQLGE+S +VIS P+  + + KTHD+ FA+RP ++A +I+ Y ST +AF+P
Sbjct  66    ALKHGPLMHLQLGEVSTIVISSPECVKEVMKTHDINFATRPKVLASEIISYNSTSIAFAP  125

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YG+YWRQ+RKIC LELLS+K V S+   R+EELSNLV  I   SE G P NLT  +    
Sbjct  126   YGNYWRQLRKICTLELLSLKRVNSYQPIREEELSNLVKWI--DSEKGSPINLTLALLSSI  183

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
               + ++ AFG+ C +DQ  FI+ +K+   L  GF++GD FPS  W+   SG++ KL K H
Sbjct  184   YKIASRSAFGKKC-KDQENFISEMKKATELFAGFNIGDFFPSSTWLQLVSGLRHKLEKSH  242

Query  777   HELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIND  956
              ++D+I + II +HKE   + + +   + ED+VDVL++ ++G +  F +T +NIKA+I D
Sbjct  243   QQVDQILENIINEHKEAK-SKAKDDQSEAEDLVDVLIQYEDGRKKDFSLTRNNIKAIILD  301

Query  957   MFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIK  1136
             +F+ G +TSAT I WAM+EM+K P +M KAQ+EVR+A  G    D+  +  L YLKLV+K
Sbjct  302   IFAAGGDTSATVIDWAMAEMVKDPRIMKKAQSEVREAFSGKGRVDENSINELKYLKLVVK  361

Query  1137  ETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE  1316
             ET+RLHPP  L+ PRE  +  +I  Y IP K++VIINAW +  +P  W +PERF PERF 
Sbjct  362   ETMRLHPPASLLLPRECGQACEIHGYHIPAKSKVIINAWTIGRDPNYWTEPERFYPERFT  421

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
              S++D+ G ++EFIPFGAGRR+CPG +FA  +I L+LA LLYHF+W+LP G+  ++L+M+
Sbjct  422   ASTIDYKGTNFEFIPFGAGRRICPGSTFALRTIELALAMLLYHFDWKLPSGMRSEELNMS  481

Query  1497  EAVGVIASKKKDLCLIARPF  1556
             E  GV   +K DL L+  P+
Sbjct  482   EVFGVTMKRKYDLFLVPFPY  501



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   473 bits (1218),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 247/485 (51%), Positives = 342/485 (71%), Gaps = 10/485 (2%)
 Frame = +3

Query  111   LRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAV  290
             L   S   +   LPPGP KLPLIG+LH L+G SLPH TLR+++ +YGPIMHL+ GE+  V
Sbjct  24    LMSESKRGKGSNLPPGPRKLPLIGNLHQLMG-SLPHHTLRDMANEYGPIMHLRFGEVPTV  82

Query  291   VISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLS  470
             ++S  + A+ + KTHDLVFA RP I+  DI+ Y ST + FSPYGD+WRQ+RKICV ELL+
Sbjct  83    IVSSAEAAKEVMKTHDLVFADRPKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLN  142

Query  471   MKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQG  650
             +K V+SF S RQEE+ +L+ +I  S+ +G   NL++ +   T+++IA+ AFGR   E+Q 
Sbjct  143   VKRVQSFESIRQEEVEDLIKTIS-SNPSGTTINLSQMIFTLTNNIIARAAFGRKL-ENQD  200

Query  651   KFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENH  830
             +FI  L++++ LAGGFDL D FPS K++H  +G K  + K+HH++DKI + ++ +HK   
Sbjct  201   EFIGTLRKIVDLAGGFDLPDTFPSLKFLHPLTGAKAAMEKIHHQIDKILESVLQEHKA--  258

Query  831   LANSTNSSGKD----EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTII  998
              A     + KD    ED+VDVLLRV+E  +L  PIT D IKAVI + F  GT+TS+T + 
Sbjct  259   -ARKVTINHKDKMHKEDLVDVLLRVQESSDLDVPITTDTIKAVILETFIAGTDTSSTALE  317

Query  999   WAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihp  1178
             WAM+E++K P VM +AQAEVR+A KG     + +++ L YLKLVIKETLRLH P+PL+ P
Sbjct  318   WAMAELMKNPHVMEQAQAEVRKAFKGKSMMTESEVQQLDYLKLVIKETLRLHAPVPLLVP  377

Query  1179  rESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFI  1358
             R + E  ++G Y I   TR+++NAWA+  +P+ WE+ E F PER  NS++DF GN++EFI
Sbjct  378   RVARERCELGGYEIQANTRLMVNAWAICRDPKYWENAECFEPERHRNSTLDFKGNNFEFI  437

Query  1359  PFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLC  1538
             PFGAGRR CPGI F  +++ L LA LL HF+W+LP+G+ P +LDMTEA G    KK +L 
Sbjct  438   PFGAGRRACPGILFGISNLELPLAQLLLHFDWKLPNGIEPNNLDMTEAFGETVRKKTNLH  497

Query  1539  LIARP  1553
             +I  P
Sbjct  498   VIGIP  502



>gb|AIA09039.1| costunolide synthase [Cynara cardunculus var. altilis]
 gb|AIA09040.1| costunolide synthase [Cynara cardunculus var. scolymus]
Length=494

 Score =   472 bits (1215),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 240/499 (48%), Positives = 334/499 (67%), Gaps = 10/499 (2%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
               P++++ FL     ++       P   + LPPGP KLP+IG++H L   + PHR LR+L
Sbjct  1     MEPLTIVSFLVTSLILFAFWALVTPKTSKNLPPGPPKLPIIGNIHQLKTPT-PHRVLRSL  59

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             +RKYGPIMHLQLG++S VV+S P+LAR I KT+D+ FA RP      I FYK+ D+ ++P
Sbjct  60    ARKYGPIMHLQLGQVSTVVVSTPRLAREIMKTNDISFADRPTTTTSQIFFYKAQDIGWAP  119

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YG+YWRQM+KIC LELLS K V+SF S R+EEL  +     L S++G P N TE      
Sbjct  120   YGEYWRQMKKICTLELLSAKKVRSFSSIREEELRRIGKV--LESKSGTPINFTEMTIEMV  177

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
             +++I K   G  C +DQ K I LL  VL     F+L   +P  ++++  SG K K LK+ 
Sbjct  178   NNVICKATLGDSC-KDQAKLIELLYDVLKTLSAFNLASYYPRLQFLNVISGKKAKWLKMQ  236

Query  777   HELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIND  956
              +LD I + I+ +H+     N+     + ED+VDVLLRVKE G L F I +D++KAVI D
Sbjct  237   KQLDGIMNDILKEHRAEGRKNN-----EQEDLVDVLLRVKETGGLDFNIRDDDVKAVILD  291

Query  957   MFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIK  1136
             M + GT+TS+TT+ WAM+E+I+ P +M +AQ EVR  +KG+    + DL++L YLKL++K
Sbjct  292   MLTAGTDTSSTTLEWAMTELIRNPEMMKRAQTEVRSVVKGD-VITETDLQSLHYLKLIVK  350

Query  1137  ETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE  1316
             ETLRLH P PL+ PRE  ++  +  Y IP KT++I+NAWA  T+P+SWE+PE F+PERFE
Sbjct  351   ETLRLHAPTPLLVPRECRQDCNVDGYDIPAKTKIIVNAWACGTDPDSWENPESFIPERFE  410

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
             NS V +MG  +EFIPFGAGRR+CPG++F  + +   LA  LYHF+W+LP+G+ P +LD+T
Sbjct  411   NSPVSYMGADFEFIPFGAGRRICPGLTFGLSMVEFPLANFLYHFDWKLPNGMKPHELDIT  470

Query  1497  EAVGVIASKKKDLCLIARP  1553
             E  G+  S K  L L+A P
Sbjct  471   EVTGISTSLKHHLKLVAIP  489



>sp|D5JBW9.1|GAO_SAUCO RecName: Full=Germacrene A oxidase; Short=SlGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Saussurea costus]
 gb|ADF43081.1| germacrene A oxidase [Saussurea costus]
Length=488

 Score =   472 bits (1214),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 232/490 (47%), Positives = 343/490 (70%), Gaps = 13/490 (3%)
 Frame = +3

Query  75    IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
             I   + VF ++ L  R  P   +KL P PW+LP+IG +HHL+G ++PHR + +L+RKYG 
Sbjct  9     IAVATIVFVLFKLATR--PKSNKKLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLARKYGS  65

Query  255   IMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWR  434
             +MHLQLGE+S +V+S P+ A+ I  THD+ FA+RP  +  +I+ Y +TD+  +PYG+YWR
Sbjct  66    LMHLQLGEVSTIVVSSPKWAKEILTTHDITFANRPETLTGEIIAYHNTDIVLAPYGEYWR  125

Query  435   QMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAK  614
             Q+RK+C LELLS+K VKSF S R+EE  NLV  ++  S +G P +L+E +    ++++++
Sbjct  126   QLRKLCTLELLSVKKVKSFQSLREEECWNLVQEVK-ESGSGRPVDLSENIFKMIATILSR  184

Query  615   VAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKI  794
              AFG+   +DQ +F  ++K++L   GGFD+ D+FPSKK++H+ SG + +L  +H +LD +
Sbjct  185   AAFGKGI-KDQKEFTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNL  243

Query  795   FDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGT  974
              + I+ +H  N      NSS  +E ++DV+LR+K+   ++FP+T DN+KA+I DMF  GT
Sbjct  244   INNIVAEHPGN------NSSKSNETLLDVMLRLKDS--VEFPLTADNVKAIILDMFGAGT  295

Query  975   ETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlh  1154
             +TS+ T+ WA+SE+I+ P  M K QAE+RQALKG     ++D+++L+YL LVIKETLRLH
Sbjct  296   DTSSATVEWAISELIRCPRAMEKVQAELRQALKGKDKVKEEDIQDLSYLDLVIKETLRLH  355

Query  1155  pplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDF  1334
             PPLPL+ PRE  +   +  Y I  KT++I+N +A+  +PE W+D E F+PERFENS +  
Sbjct  356   PPLPLVMPRECRQPVNLAGYDIANKTKLIVNVFAINRDPEYWKDAESFIPERFENSPITV  415

Query  1335  MGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVI  1514
             MG  YE++PFGAGRRMCPG +    ++ L LA +LYHFNW+LP+G S   LDMTE+ G  
Sbjct  416   MGAEYEYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTESFGAT  475

Query  1515  ASKKKDLCLI  1544
               +K  L L+
Sbjct  476   VQRKTHLVLV  485



>gb|ADD84654.1| CYP71D175 [Scoparia dulcis]
Length=519

 Score =   473 bits (1217),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 248/481 (52%), Positives = 338/481 (70%), Gaps = 16/481 (3%)
 Frame = +3

Query  147   LPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAIT  326
             LPP PWKLPLIG LHHL  G LPHR  +  S KYGPIMH +LG ++ +V+S P LA+ + 
Sbjct  38    LPPSPWKLPLIGHLHHL-AGRLPHRCFQEFSTKYGPIMHFKLGGVTTIVVSSPDLAKEVL  96

Query  327   KTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQ  506
             K  D  F  +P ++A +I++Y S+ ++FS YGDYWRQMRKIC++ELLS+K V+SF   R 
Sbjct  97    KVQDPTFTDKPEMIAAEILWYNSS-LSFSQYGDYWRQMRKICMIELLSVKNVRSFGLIRN  155

Query  507   EELSNLVSSI-RLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             +E+S L  SI   S   G   +LTE+V+  TSS+I + AFGRVC  D+ K I +LK  ++
Sbjct  156   DEVSRLAHSIVGDSGNRGTLVDLTEEVAKMTSSIICRAAFGRVC-RDKEKMIEMLKDGIA  214

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGK-  860
             L  G D+ DL+PS K +   S  + +LLK+  +LD I D II +H+ N  A   +SSG  
Sbjct  215   LLSGLDVCDLYPSSKMLKAMSWNRVRLLKMRRKLDPILDGIIAEHRRNR-AEKLDSSGNI  273

Query  861   ------DEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIK  1022
                   +ED++DVL+R  E GEL+FPIT+DNIKA+I D+F+ GTET++TTI W M+E+++
Sbjct  274   GNGEFGNEDLIDVLIRHMESGELEFPITDDNIKAMIYDIFAAGTETASTTINWIMAELMR  333

Query  1023  RPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAK  1202
              P+VMAKAQ+E+RQ LK N TF + +++ L YLKLVIKE LRLHPP+PLI       + +
Sbjct  334   HPNVMAKAQSEIRQTLKENTTFGETEVQKLKYLKLVIKEGLRLHPPVPLIPRV-CRNDTE  392

Query  1203  IGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFEN---SSVDFMGNHYEFIPFGAG  1373
             I  Y IP ++RV +N+WA+  +P  W DPE F+PERFE+   SS+DF GNH E+IPFGAG
Sbjct  393   IKGYFIPARSRVPVNSWAIGRDPRIWPDPESFIPERFEDMNHSSIDFNGNHAEYIPFGAG  452

Query  1374  RRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARP  1553
             RRMCPG++F   S+ L LA LLYHF W+LP G+SP+DLDM E + + A+++ +L LIA P
Sbjct  453   RRMCPGMNFGLASVELPLAHLLYHFEWKLPHGMSPQDLDMVERLALAAARRTNLKLIAVP  512

Query  1554  F  1556
             +
Sbjct  513   Y  513



>ref|XP_010921587.1| PREDICTED: premnaspirodiene oxygenase-like [Elaeis guineensis]
Length=507

 Score =   473 bits (1216),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 344/507 (68%), Gaps = 6/507 (1%)
 Frame = +3

Query  39    MEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPH  218
             ME +F   P   +  L  V  I   +  S   R +KLPP PW+LP+IG LHHLVG ++PH
Sbjct  1     MELQFPTIPFLSLFLLFAVIAIKLTKSTSQKTRARKLPPSPWRLPIIGHLHHLVG-AVPH  59

Query  219   RTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKST  398
             R LR LS ++GP+MHL+LG++  +V+S P+ A+ I  THDL FASR  + A D++ Y  T
Sbjct  60    RALRELSLRHGPLMHLRLGQVDHIVVSSPEAAKEILTTHDLTFASRTKLFASDVLAYGGT  119

Query  399   DVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTE  578
             ++ F+PYG YWR +RKICV ELLS K V SF + R+EE+S+LV SI   S++  P NL++
Sbjct  120   NLVFAPYGSYWRLLRKICVQELLSPKRVNSFRTCREEEMSDLVGSISTISKS--PVNLSD  177

Query  579   KVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKP  758
              +   T +L+++VAFG+ C     +F A  K+ + L  G  + DLFPS K+I   SG   
Sbjct  178   LLFLSTKNLVSRVAFGKKCKHGL-RFHAAAKEGIELVSGLCVADLFPSMKFIDVLSGGSS  236

Query  759   KLLKLHHELDKIFDIIIGDHKENHLANSTN--SSGKDEDIVDVLLRVKEGGELQFPITED  932
             K  K+H E+DK+ + II +H+E   + ++N  + G+DED+VDVLL V E G+L+FP+  D
Sbjct  237   KASKVHQEIDKVLEEIIKEHQEKRSSMNSNRGAPGEDEDLVDVLLDVMENGKLEFPLALD  296

Query  933   NIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENL  1112
             NIKAVI DMF  GT+T++TT+ WAMSE+ + P  M KAQAEVRQALKG     ++D+  L
Sbjct  297   NIKAVILDMFLGGTDTASTTLEWAMSELARHPEAMQKAQAEVRQALKGKAKIQEEDISEL  356

Query  1113  TYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPE  1292
              Y+KLVIKETLRLHPP+PL+ PR+  E  ++  Y IP  +RVIIN WA+A +   W D E
Sbjct  357   HYMKLVIKETLRLHPPVPLLLPRDCSETCELEGYDIPMGSRVIINVWAIARDARYWGDAE  416

Query  1293  RFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGV  1472
              F PERF  SSV+++   +E++PFG GRR+CPG +F    + L+LA LL++F+W+LP G+
Sbjct  417   SFRPERFYVSSVEYLAGSFEYLPFGGGRRVCPGFTFGMAHLELALANLLFYFDWKLPHGI  476

Query  1473  SPKDLDMTEAVGVIASKKKDLCLIARP  1553
             +PKDLDM E++G   S+K  L LIA P
Sbjct  477   APKDLDMEESMGATVSRKSALWLIATP  503



>gb|AGC29947.1| CYP71BE30 [Sinopodophyllum hexandrum]
Length=498

 Score =   472 bits (1215),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 236/475 (50%), Positives = 339/475 (71%), Gaps = 6/475 (1%)
 Frame = +3

Query  132   ARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQL  311
              +R +LPPGPWKLPLIGSLHHL+ G LPH TLR+L++K+G +MHLQLG++S VV++ P++
Sbjct  23    GKRSQLPPGPWKLPLIGSLHHLLVG-LPHHTLRDLAKKHGSLMHLQLGQVSTVVVTSPRI  81

Query  312   ARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSF  491
             A+ + KTHD++F  RP + A  IV Y + D+  +PYG++WRQMRKI  LE+ S K V+SF
Sbjct  82    AKEMFKTHDIMFLDRPFMFAPSIVTYGAKDIVLAPYGEFWRQMRKISTLEVFSAKRVQSF  141

Query  492   CSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLK  671
              S R++E+S L+ SI  SS  G   NLT+++  F + L A+VAFG  C +DQ  F++++ 
Sbjct  142   QSVREDEVSMLIESI--SSMNGSVFNLTKRIFSFMNDLTARVAFGNKC-KDQEAFVSMMD  198

Query  672   QVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNS  851
             QV+ ++GGF + DL+PS + I+  SG+K ++  +H + D+I + II +H + +  N+ N 
Sbjct  199   QVIKVSGGFGVADLYPSLEIINVISGLKSEMEGIHQKTDEILENIIKEHMQRN--NNPNK  256

Query  852   SGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPS  1031
                +EDIVDVLLR+++   L F +T DNIKAV+ D+FS G+ETS+T + WA+ E++K P+
Sbjct  257   DVNEEDIVDVLLRLQKDANLGFQLTSDNIKAVLFDIFSGGSETSSTVMDWAICELMKSPT  316

Query  1032  VMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGE  1211
              M K Q EVRQ L G     + D+  L YLK VIKETLRLHPP PL+ PRE  E  ++  
Sbjct  317   SMEKVQREVRQVLNGKTNIIETDIHELKYLKSVIKETLRLHPPFPLLIPRECRERCEVDG  376

Query  1212  YIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPG  1391
             Y IP  T++I+NAWA+  +P+ W+D E+F+PERF+  SVD+ G H+++IPFGAGRR+CPG
Sbjct  377   YEIPVGTKIIVNAWAIGRDPQHWKDAEKFVPERFDEGSVDYKGAHFQYIPFGAGRRICPG  436

Query  1392  ISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLIARPF  1556
             IS    +I L+LA LLYHF+W+LP+GV   +LDM EA G+   ++KDL + A P+
Sbjct  437   ISLGVANIELALAQLLYHFDWKLPNGVGTDELDMAEAFGLAVRRRKDLYVNATPY  491



>ref|XP_003600322.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=499

 Score =   472 bits (1214),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 248/501 (50%), Positives = 349/501 (70%), Gaps = 16/501 (3%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
              S+   L FVF +  +  + + +    LPPGP  LP+IG++H+L+G SLPH  LR+LS K
Sbjct  9     TSIFSLLFFVFIVNKIVTKKSNSSTPNLPPGPLMLPIIGNIHNLIG-SLPHHRLRDLSTK  67

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHL+LGE+S +V+S  + A+ + KTHDLVFASRP I A  I+ Y S  ++FSPYGD
Sbjct  68    YGPLMHLKLGEVSTIVVSSAEYAKEVLKTHDLVFASRPPIQASKIMSYNSIGLSFSPYGD  127

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKIC LELLS K V+SF   R EE++NL+  I  +S+ G   NLT++V+     +
Sbjct  128   YWRQLRKICALELLSSKRVQSFQPIRSEEMTNLIKWI--ASKEGSEINLTKEVNSRIFLI  185

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
              ++VAFG+ C +D  KFI+L+ +   +AGGF+LGDL+PS KW+   SG+KPKL KLH + 
Sbjct  186   TSRVAFGKEC-KDNKKFISLVWEATRVAGGFNLGDLYPSYKWLQNISGLKPKLEKLHKQT  244

Query  786   DKIFDIIIGDHK--ENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDM  959
             D I   II +H+  +   A   +S    ED+VDVLL+       Q  ++++++KAVI DM
Sbjct  245   DVILQNIIDEHRLVDKSRAIEDHSEEVAEDLVDVLLK-------QDCLSDNSVKAVILDM  297

Query  960   FSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKE  1139
             +  G+ETSA+TI+WAM+EMIK P +M K QAEVR+  +  +  ++ D+E L YLK V+KE
Sbjct  298   YGGGSETSASTILWAMAEMIKNPRIMKKLQAEVREVFEKERKPNESDMEKLKYLKCVVKE  357

Query  1140  TlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFEN  1319
             TLRLHPP   + PRE  +  +I  Y IP K++VI+NAWA+  +P +W+DPERF PERF +
Sbjct  358   TLRLHPPGAFLLPRECGQACEINGYGIPFKSKVIVNAWAIGRDPNNWDDPERFYPERFID  417

Query  1320  SSVDFM-GNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
             + VD+  GN++EFIPFG+GRRMCPG++F   +I  SLA L+YHF+W+LP+ +  +DLDM+
Sbjct  418   NCVDYYKGNNFEFIPFGSGRRMCPGVTFGLVNIEFSLALLMYHFDWKLPNAMKKEDLDMS  477

Query  1497  EAVGVIASKKKDLCLIARPFV  1559
             E+ GV  ++K DL LI  PF 
Sbjct  478   ESFGVAVTRKNDLHLI--PFT  496



>gb|AEX07771.1| cytochrome P450 [Catharanthus roseus]
Length=506

 Score =   472 bits (1215),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 249/511 (49%), Positives = 348/511 (68%), Gaps = 17/511 (3%)
 Frame = +3

Query  57    FNPVSVIVFLS--FVFCIYTLR--RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRT  224
             F+  S  VF++  F+F   ++   RR    + + LPPGPWKLPLIG+LH  +G S+P++ 
Sbjct  3     FHESSPFVFITRGFIFIAISIAVLRRIISKKTKTLPPGPWKLPLIGNLHQFLG-SVPYQI  61

Query  225   LRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDV  404
             LR+L++K GP+MHLQLGE+SA+V + PQ+A+ ITKT DL FA RP I AL IV Y   D+
Sbjct  62    LRDLAQKNGPLMHLQLGEVSAIVAASPQMAKEITKTLDLQFADRPVIQALRIVTYDYLDI  121

Query  405   AFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKV  584
             +F+ YG YWRQ+RKI V ELL+ K V+SFCS R++E SNLV +I  +S  G   NL++ +
Sbjct  122   SFNAYGKYWRQLRKIFVQELLTSKRVRSFCSIREDEFSNLVKTI--NSANGKSINLSKLM  179

Query  585   SWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKL  764
             +  T+S+I KVAFG+V  E +  FI L+ Q+L+LAGGF L DLFPS K +H   G + KL
Sbjct  180   TSCTNSIINKVAFGKVRYERE-VFIDLINQILALAGGFKLVDLFPSYKILHVLEGTERKL  238

Query  765   LKLHHELDKIFDIIIGDHKEN-HLANSTNSSGKDEDIVDVLLRVKEGGELQF--PITEDN  935
              ++  ++DKI D +I +H+EN       N     EDIVD+LLR++EGG+L    P   +N
Sbjct  239   WEIRGKIDKILDKVIDEHRENSSRTGKGNGCNGQEDIVDILLRIEEGGDLDLDIPFGNNN  298

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             IKA++ D+ + GTETS+T + WAMSEM++ P VM+KAQ E+R+A  G +  ++ D++NL 
Sbjct  299   IKALLFDIIAGGTETSSTAVDWAMSEMMRNPHVMSKAQKEIREAFNGKEKIEENDIQNLK  358

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             YLKLVI+ET     P   +  R+  E+ +IG Y IP  T+  IN WA+  +P  W +PE 
Sbjct  359   YLKLVIQET-LRLHPPAPLLMRQCREKCEIGGYHIPVGTKAFINVWAIGRDPAYWPNPES  417

Query  1296  FLPERFENSSVDFMGNH---YEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPD  1466
             F+PERF++++ +F  +    +E++PFGAGRRMCPGISF   ++ L LA LLYHFNW+LPD
Sbjct  418   FIPERFDDNTYEFTKSEHHAFEYLPFGAGRRMCPGISFGLANVELPLALLLYHFNWQLPD  477

Query  1467  GVSPKDLDMTEAVGVIASKKKDLCLIARPFV  1559
             G +   LDMTEA G+ A +K DL LIA  + 
Sbjct  478   GST--TLDMTEATGLAARRKYDLQLIATSYA  506



>ref|XP_004491491.1| PREDICTED: premnaspirodiene oxygenase-like [Cicer arietinum]
Length=515

 Score =   473 bits (1216),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 248/511 (49%), Positives = 353/511 (69%), Gaps = 18/511 (4%)
 Frame = +3

Query  39    MEH------KFLFNPVSVIVFLSFVFCI-YTLRRRSNPARRQKLPPGPWKLPLIGSLHHL  197
             MEH       F+    S I+FL+ +  +   +  R      +K PPGPWKLP+IGS+HHL
Sbjct  1     MEHPNISFLHFILFSTSFILFLTQIIKVGKIILLRVTKTTHKKFPPGPWKLPIIGSIHHL  60

Query  198   VGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALD  377
             +G SLPH +LR LS+ YGP+MHL+LGE+S +V+S P+ A+ I KT+D  FA RP+ +  D
Sbjct  61    IG-SLPHHSLRQLSKIYGPLMHLKLGEVSTIVVSSPEFAKEILKTYDSNFAQRPHQIGAD  119

Query  378   IVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETG  557
             I+ Y S+D+A +PYG YW+Q+RK+C  ELL  K V+SF S R++E+ NL++ I  S+  G
Sbjct  120   IMCYGSSDIATAPYGSYWKQLRKLCSQELLCTKRVRSFQSIREQEVHNLITYI--SNNIG  177

Query  558   FPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIH  737
                NL+EKV+  TS++ ++ AFG++C +DQ +FI+L+K++++LA GF + DLFPS+KW+H
Sbjct  178   SCINLSEKVACMTSTITSRSAFGKIC-KDQQEFISLIKKLVTLAEGFVVIDLFPSQKWLH  236

Query  738   YTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGE-LQ  914
               SGMKPKL +LH + D I + II +     +    N     E  + VLLR+K+  E L+
Sbjct  237   LISGMKPKLEELHRKFDNIIENIIKEA----VTKKGNDGETIESFLSVLLRIKDHDEALE  292

Query  915   FPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTF-D  1091
             +P+T DNIKAVI DMF  G++T++  I W++SEM+K P+ M KAQ EVR+   GNK + D
Sbjct  293   YPLTIDNIKAVILDMFVAGSDTTSAIIEWSISEMLKNPTTMIKAQKEVREHF-GNKGYID  351

Query  1092  DKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNP  1271
             +  L+ L YLK +IKETLRLHPP PL+ PRE  E  ++  Y I    +VI+NAWA+  +P
Sbjct  352   ETSLQELKYLKAIIKETLRLHPPFPLLLPRECRETCEVKGYTIQAGNKVIVNAWAIGRDP  411

Query  1272  ESWEDPERFLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFN  1451
             E W + ERFLPERF +  +D+ G++ E+IPFGAGRR+CPGI F  +SI L LA LLYH+N
Sbjct  412   EYWNEAERFLPERFLDCKIDYKGSNIEYIPFGAGRRICPGILFGVSSIELCLAKLLYHYN  471

Query  1452  WELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             WELP G++ ++L+MTEA+   + +K DL L+
Sbjct  472   WELPSGLTEENLEMTEALSSSSRRKTDLILV  502



>gb|AGN04217.1| cytochrome P450 [Salvia miltiorrhiza]
Length=502

 Score =   472 bits (1215),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 252/503 (50%), Positives = 345/503 (69%), Gaps = 10/503 (2%)
 Frame = +3

Query  36    EMEHKFLFNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLP  215
             E +  F+F    +++     F +    +  +P   Q LPP P KLP+IG +H LVG  LP
Sbjct  2     ERDLPFIFTNTLLLLSSFIFFLLKAWTKPKSPKAHQNLPPSPPKLPVIGHIHLLVG-DLP  60

Query  216   HRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKS  395
             H+ L+  ++K+GP+MHLQLGE+ AVVIS  +  R + K  D   A RP  +A  I++Y  
Sbjct  61    HKALQRQAQKHGPVMHLQLGEVPAVVISSREATREVLKVQDPACADRPESIASKILWYDY  120

Query  396   TDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLT  575
             TD+AFS Y +YWRQMRKIC++ELLS K VKSF   R++E S L+ ++  SS  G   +LT
Sbjct  121   TDIAFSAYNEYWRQMRKICIVELLSSKNVKSFGHIRRDESSRLMKNLECSS--GNAIDLT  178

Query  576   EKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMK  755
             +K+  FTS++  + AFG+V ++  G  IAL K+ +++AGGF+L DLFPS K ++  S  K
Sbjct  179   DKIFTFTSTITCRAAFGKVMTDRDG-LIALFKEAVAMAGGFELADLFPSWKLLNVLSWSK  237

Query  756   PKLLKLHHELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDN  935
              +L ++  +LD I D II +HK   L  S    G  EDIVDVL+R+++ GEL+FPIT DN
Sbjct  238   YRLWRMRGKLDAILDGIIDEHK---LKQSGEFGG--EDIVDVLIRMQQTGELKFPITTDN  292

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             IKAVI DMF  GTETS+TT +WAMSEM++ P VM KAQAEVR ALKG    ++ D++ L 
Sbjct  293   IKAVIFDMFVAGTETSSTTTVWAMSEMMRNPRVMEKAQAEVRAALKGKAAVEESDVQELK  352

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             YLKLVIKET RLHPP+PL+   ++ EE K+  Y IP KT+V++N W++  +P+ WE PE 
Sbjct  353   YLKLVIKETFRLHPPIPLLPR-QTREECKVDGYSIPIKTKVMLNIWSMGRDPQYWEQPEM  411

Query  1296  FLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS  1475
             F PERFENS  DF+GN +E+IPFGAGRR+CPG++F   +I L LA +LYHF+W+LP G+S
Sbjct  412   FQPERFENSPKDFIGNDFEYIPFGAGRRICPGLNFGLANIELPLAKMLYHFDWKLPKGMS  471

Query  1476  PKDLDMTEAVGVIASKKKDLCLI  1544
              + LDM+E  G+  S+KK L +I
Sbjct  472   CERLDMSEGEGLTVSRKKPLIII  494



>gb|AIA09038.1| costunolide synthase [Cynara cardunculus var. scolymus]
Length=494

 Score =   472 bits (1214),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 240/499 (48%), Positives = 333/499 (67%), Gaps = 10/499 (2%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNL  236
               P++++ FL     ++       P   + LPPGP KLP+IG++H L   + PHR LR+L
Sbjct  1     MEPLTIVSFLVTSLILFAFWALVTPKTSKNLPPGPPKLPIIGNIHQLKTPT-PHRVLRSL  59

Query  237   SRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSP  416
             +RKYGPIMHLQLG++S VV+S P+LAR I KT+D+ FA RP      I FYK+ D+ ++P
Sbjct  60    ARKYGPIMHLQLGQVSTVVVSTPRLAREIMKTNDISFADRPTTTTSQIFFYKAQDIGWAP  119

Query  417   YGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFT  596
             YG+YWRQM+KIC LELLS K V+SF S R+EEL  +     L S++G P N TE      
Sbjct  120   YGEYWRQMKKICTLELLSAKKVRSFSSIREEELRRIGKV--LESKSGTPINFTEMTIEMV  177

Query  597   SSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLH  776
             +++I K   G  C +DQ K I LL  VL     F+L   +P  + ++  SG K K LK+ 
Sbjct  178   NNVICKATLGDSC-KDQAKLIELLYDVLKTLSAFNLASYYPRLQILNVISGKKAKWLKMQ  236

Query  777   HELDKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVIND  956
              +LD I + I+ +H+     N+     + ED+VDVLLRVKE G L F I +D++KAVI D
Sbjct  237   KQLDGIMNDILKEHRAEGRKNN-----EQEDLVDVLLRVKETGGLDFNIRDDDVKAVILD  291

Query  957   MFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIK  1136
             M + GT+TS+TT+ WAM+E+I+ P +M +AQ EVR  +KG+    + DL++L YLKL++K
Sbjct  292   MLTAGTDTSSTTLEWAMTELIRNPEMMKRAQTEVRSVVKGD-VITETDLQSLHYLKLIVK  350

Query  1137  ETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFE  1316
             ETLRLH P PL+ PRE  ++  +  Y IP KT++I+NAWA  T+P+SWE+PE F+PERFE
Sbjct  351   ETLRLHAPTPLLVPRECRQDCNVDGYDIPAKTKIIVNAWACGTDPDSWENPESFIPERFE  410

Query  1317  NSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMT  1496
             NS V +MG  +EFIPFGAGRR+CPG++F  + +   LA  LYHF+W+LP+G+ P +LD+T
Sbjct  411   NSPVSYMGADFEFIPFGAGRRICPGLTFGLSMVEFPLANFLYHFDWKLPNGMKPHELDIT  470

Query  1497  EAVGVIASKKKDLCLIARP  1553
             E  G+  S K  L L+A P
Sbjct  471   EVTGISTSLKHHLKLVAIP  489



>ref|XP_006452560.1| hypothetical protein CICLE_v10008075mg [Citrus clementina]
 ref|XP_006474919.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
 gb|ESR65800.1| hypothetical protein CICLE_v10008075mg [Citrus clementina]
Length=503

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 237/496 (48%), Positives = 338/496 (68%), Gaps = 7/496 (1%)
 Frame = +3

Query  72    VIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYG  251
             +I+ +  +F I  L RR+    +  LPPGPWKLP+IG+LH L    LPHR L +L+++YG
Sbjct  8     LIISVLSLFIILKLFRRN---EKLNLPPGPWKLPIIGNLHQLARYELPHRGLADLAKQYG  64

Query  252   PIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYW  431
             P+MHL+LGE+  +V+S P  A+ IT THDLVFASRP++ A  I+ Y  +D+AF+PYG YW
Sbjct  65    PLMHLRLGEVCTIVVSSPDYAKEITTTHDLVFASRPHVPAAQILSYDFSDIAFAPYGPYW  124

Query  432   RQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIA  611
             R ++KICV ELL +K V+SF S R+EE++NLV  I   S+ G   NLTEKV     S+ +
Sbjct  125   RTLKKICVTELLGVKRVQSFRSIREEEVTNLVDWI--GSKAGSVVNLTEKVFLLMCSITS  182

Query  612   KVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDK  791
             + AFG+  +ED   F A++ +   +  G  + DL+PS K++   +G+K K+ ++H++ DK
Sbjct  183   RAAFGKK-NEDIEAFQAVVSEATEMFAGSSIADLYPSIKFLLALTGVKAKMQRMHNKTDK  241

Query  792   IFDIIIGDHKENHLANSTNSSGKD-EDIVDVLLRVKEGGELQFPITEDNIKAVINDMFST  968
             I   I+ DHK+     S +   ++ ED+VDVLL+ +E G L+FP+   N+KAV+ D+FS 
Sbjct  242   ILSKIVEDHKKRRAMRSKSGKKEEVEDLVDVLLKAQEDGNLEFPLNTKNVKAVVMDVFSA  301

Query  969   GTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlr  1148
             GTETSATT+ WAMS ++K P +M KAQ EVR+        D+  LE + YLKL IKETLR
Sbjct  302   GTETSATTVDWAMSLLMKYPKIMKKAQDEVREVFNRRGKVDEAGLEEMKYLKLAIKETLR  361

Query  1149  lhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSV  1328
             +HP  P++ PRE  E   I  Y IP K +V++N WA+  + + W +PE F+PERF +S +
Sbjct  362   IHPSAPMLFPRECAETCNINGYDIPAKAQVLVNVWAMTRDSKYWTEPESFIPERFLDSPI  421

Query  1329  DFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVG  1508
             DF G ++EF+PFGAGRRMCPG+++A  +I L LA  LYHF+W+LP+G+  +DLDMTE  G
Sbjct  422   DFKGANFEFLPFGAGRRMCPGMTYANANIELPLAMFLYHFDWKLPNGMKNEDLDMTEGFG  481

Query  1509  VIASKKKDLCLIARPF  1556
             V   +K++LCLI  P+
Sbjct  482   VTVKRKQNLCLIPTPY  497



>ref|XP_008778208.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=515

 Score =   472 bits (1214),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/485 (50%), Positives = 343/485 (71%), Gaps = 18/485 (4%)
 Frame = +3

Query  144   KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEISAVVISYPQLARAI  323
             K+PP P KLP+IG LH+L+G ++PHR   NLSR+YGP+MHL+LG++  V+IS P+ AR I
Sbjct  31    KMPPSPPKLPIIGHLHYLLG-NIPHRAFGNLSRRYGPVMHLKLGQVDHVIISSPEAAREI  89

Query  324   TKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLELLSMKMVKSFCSFR  503
              KTHDL+FA+RP ++  + VF+  TD+AF+PYG+YWRQ+RKIC++ELLS K VKS+ + +
Sbjct  90    MKTHDLIFATRPRLLIAE-VFHNCTDIAFAPYGNYWRQLRKICIVELLSTKRVKSYATLQ  148

Query  504   QEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLS  683
             QEE+SNL+  I + +++  P NL+EK+   T+ +IA++AFG  C   Q  FI+  K++++
Sbjct  149   QEEISNLMGDISMMNKS--PVNLSEKLFVLTNDVIARIAFGNTCKHGQS-FISACKKMMA  205

Query  684   LAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHKENHLANSTNSSG--  857
             LA GF + DLFPS  +I   SG++  L  L  E+D+I + II +H+E   A  +N     
Sbjct  206   LASGFCVADLFPSLSFIDTLSGLRSALENLRREMDEIIEEIIKEHQEKRAATISNKGDDQ  265

Query  858   KDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIWAMSEMIKRPSVM  1037
             ++ED+VDVLL +KE G L+FP+T+ NIKAVI DMF  GTET++TT++WAM+E+++ P +M
Sbjct  266   REEDLVDVLLGLKENGGLEFPLTDTNIKAVIMDMFIAGTETASTTMVWAMAELMRHPEMM  325

Query  1038  AKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihprESMEEAKIGEYI  1217
              KAQAEVR+ LKG    ++ D+    Y+KLVIKETLRLHPPLPL  PR   +  ++  Y 
Sbjct  326   EKAQAEVRRVLKGRAKIEEGDMREFHYMKLVIKETLRLHPPLPLQLPRVCTKSCQVDGYD  385

Query  1218  IPPKTRVIINAWALATNPESWEDPER-----------FLPERFENSSVDFMGNHYEFIPF  1364
             IP  +RV+INAWA+  +P+ WEDPER           F P++F+ SSVD  GN +E +PF
Sbjct  386   IPVGSRVMINAWAIGRDPKYWEDPERRDPRYWEDPEKFKPQKFDGSSVDHTGNSFELLPF  445

Query  1365  GAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCLI  1544
             G GRR+CPG++F    + L L+ LLY+F+W+LP+G+ P D++MTE  G    +K  LCLI
Sbjct  446   GRGRRICPGMNFGLAEMELILSHLLYYFDWKLPNGMGPNDVEMTETFGAAVGRKSPLCLI  505

Query  1545  ARPFV  1559
             A P V
Sbjct  506   ATPCV  510



>ref|XP_010910607.1| PREDICTED: premnaspirodiene oxygenase-like [Elaeis guineensis]
Length=503

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 246/486 (51%), Positives = 332/486 (68%), Gaps = 5/486 (1%)
 Frame = +3

Query  102   IYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIMHLQLGEI  281
             I  ++   + A   KLPP PWKLP+IG LHH +G  LPHR LR LS ++GP+MHL+LG++
Sbjct  20    IVIIKLTKSTATGIKLPPSPWKLPIIGHLHHFLGAQLPHRALRELSWRHGPVMHLRLGQV  79

Query  282   SAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQMRKICVLE  461
               +++S P++AR I KTHDL+FA+R  I+ +  VFY  TD+ F+PYG YWR++RKICVLE
Sbjct  80    DHIIVSSPEMAREILKTHDLIFATRDKIL-ISKVFYDGTDIVFAPYGSYWRELRKICVLE  138

Query  462   LLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVAFGRVCSE  641
             LLS K V+SF + RQEE+SNLV  I  S+    P NL+E     ++++ ++VAFG  C  
Sbjct  139   LLSAKRVQSFSTLRQEEMSNLVGYI--SNMRNSPVNLSEMFLLTSNTVTSRVAFGTQCKH  196

Query  642   DQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFDIIIGDHK  821
                +FI+  K+VL L  G ++ DLFPS   I   SG+  +L K   E+D+I   II +H 
Sbjct  197   GP-RFISATKKVLELFIGSNVTDLFPSLSVIDTLSGLSSRLDKCGREMDEILGQIIEEH-  254

Query  822   ENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGTETSATTIIW  1001
             E   A S     + ED+VDVLL +KE G L+FP T  NIKAVI DMF+ GTETSAT + W
Sbjct  255   EAKRATSNGGPQEGEDLVDVLLGLKENGGLEFPFTLTNIKAVILDMFAGGTETSATKLQW  314

Query  1002  AMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlhpplplihpr  1181
              M+E+++ P +M KAQ EVRQA KG    +++D+  L Y+KLVIKE+LRLHPP+PL+ P+
Sbjct  315   TMAELMRHPEIMVKAQVEVRQAFKGKTKIEEEDITKLHYIKLVIKESLRLHPPVPLLGPK  374

Query  1182  ESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDFMGNHYEFIP  1361
                E  K+  Y IP  +R+IINAWA+A +P  WEDPE F PERF+ SSVD+ G ++E++P
Sbjct  375   VCREACKVDGYDIPFGSRIIINAWAVARDPRYWEDPESFKPERFDGSSVDYKGGNFEYLP  434

Query  1362  FGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVIASKKKDLCL  1541
             FG GRR+CPGI+F    +   LA LLY+F+W++PDG+ PKDLD+TE  G   S K  L L
Sbjct  435   FGGGRRICPGITFGMAQVETVLAHLLYYFDWKIPDGMDPKDLDITELFGGTVSLKSPLWL  494

Query  1542  IARPFV  1559
             IA P +
Sbjct  495   IATPHI  500



>gb|AFO64615.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=488

 Score =   471 bits (1211),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/490 (48%), Positives = 339/490 (69%), Gaps = 13/490 (3%)
 Frame = +3

Query  75    IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
             I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  9     IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIGTT-PHRRVRDLARKYGS  65

Query  255   IMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWR  434
             +MHLQLGE+  +V+S P+ A+ I  T+D+ FA+RP  +  +IV Y +TDV  +PYG+YWR
Sbjct  66    LMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWR  125

Query  435   QMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAK  614
             Q+RKIC LELLS+K VKSF S R+EE  NLV  I+ +S +G P NL+E V    ++++++
Sbjct  126   QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIK-ASGSGRPVNLSENVFKLIATILSR  184

Query  615   VAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKI  794
              AFG+   +DQ +   ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D +
Sbjct  185   AAFGKGI-KDQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNL  243

Query  795   FDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGT  974
              D ++ +H  N       SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT
Sbjct  244   IDNLVAEHTVN------TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGT  295

Query  975   ETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlh  1154
             +TS++TI WA+SE+IK P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLH
Sbjct  296   DTSSSTIEWAISELIKCPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLH  355

Query  1155  pplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDF  1334
             PPLPL+ PRE  +   +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   
Sbjct  356   PPLPLVLPRECRQPVNLAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATV  415

Query  1335  MGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVI  1514
             MG  YE++PFGAGRRMCPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G  
Sbjct  416   MGAEYEYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGAT  475

Query  1515  ASKKKDLCLI  1544
               +K +L L+
Sbjct  476   MQRKTELLLV  485



>ref|XP_004295869.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   472 bits (1214),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 242/498 (49%), Positives = 342/498 (69%), Gaps = 10/498 (2%)
 Frame = +3

Query  78    VFLSF-VFCIYTLR---RRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
             V L+F +F +  L+   R    +    LPPGP +LP IG++H L  GSLPHR+LRNL+ K
Sbjct  10    VILTFSLFVVMVLKITIRGKTKSSSSNLPPGPRELPFIGNIHQL-AGSLPHRSLRNLANK  68

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YGP+MHL+LGEIS VV+S  + AR + KTHD+ FA+RP ++A DIV Y  T++ F+ YGD
Sbjct  69    YGPLMHLRLGEISTVVVSSAEFAREVMKTHDVTFATRPYLLAADIVNYNCTNIVFAKYGD  128

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKIC LE+LS K V+S+   R+EE+ NL+  I  +S+   P NLTEK+   T ++
Sbjct  129   YWRQLRKICTLEVLSPKRVQSYRPIREEEMLNLIKWI--ASKARSPINLTEKIYSSTYTI  186

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
               + AFG+  S+   +FI  +K+ + L GGFDL D+FPS + +H  +G++PKL +LH + 
Sbjct  187   TTRAAFGKK-SKYHEEFIDCVKEGIQLGGGFDLADVFPSYRLLHMITGLRPKLERLHKKT  245

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKE-GGELQFPITEDNIKAVINDMF  962
             D+I + II + ++   +    S  + E +++VLL+  E  G L+F +T DNIKAV+ D+F
Sbjct  246   DRILENIIKELRDKETSKGGESETQ-EHLIEVLLKFHEDNGSLEFTLTTDNIKAVMMDIF  304

Query  963   STGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKET  1142
             + G+ETSAT + WAMSEM+K P +M +AQ EVR+         +  ++ + YL  +IKET
Sbjct  305   AAGSETSATAVDWAMSEMVKNPQIMKRAQDEVREVFNKLGHVSETGIKEMKYLNSIIKET  364

Query  1143  lrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENS  1322
             LRLHP  PL+ PRE  E  +IG Y IP KT+V++N WA+  +P+ W +PERF P+RF +S
Sbjct  365   LRLHPSAPLLIPRECRETCEIGGYEIPVKTKVVVNGWAIGRDPKYWTEPERFYPDRFLDS  424

Query  1323  SVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEA  1502
             SVDF G  +EFIPFGAGRRMCPGI++   ++ L LA LLYHF+W+LPDG   +DLDMTEA
Sbjct  425   SVDFRGTDFEFIPFGAGRRMCPGITYGLANVDLPLAMLLYHFDWKLPDGKKHEDLDMTEA  484

Query  1503  VGVIASKKKDLCLIARPF  1556
              G+   +K++LCLI  P+
Sbjct  485   FGITVGRKENLCLIPIPY  502



>dbj|BAM68819.1| putative cytochrome P450 monooxygenase CYP71AV1 [Artemisia chamaemelifolia]
Length=495

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 236/493 (48%), Positives = 338/493 (69%), Gaps = 13/493 (3%)
 Frame = +3

Query  66    VSVIVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRK  245
              + I   + +F +Y    RS   +     P PW+LP+IG +HHL+G +LPHR +  L+RK
Sbjct  13    TTTIALATILFFVYKFATRSKSTKNSL--PEPWRLPIIGHMHHLIG-TLPHRGVMELARK  69

Query  246   YGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGD  425
             YG +MHLQLGE+S +V+S P+ A+ I  T+D+ FA RP  +  +IV Y +TD+A SPYG+
Sbjct  70    YGSLMHLQLGEVSTIVVSSPKWAKEILTTYDITFAYRPETLTGEIVAYHNTDIALSPYGE  129

Query  426   YWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSL  605
             YWRQ+RKIC LELLS+K VKSF S R+EE  NLV  I+ +S +G P NL+E V    +++
Sbjct  130   YWRQLRKICTLELLSVKKVKSFQSLREEECWNLVQQIK-ASGSGRPVNLSENVFKLIATI  188

Query  606   IAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHEL  785
             + + AFG+   +DQ +F  + K++   AGGFD+ D+FPSKK++H+ SG + +L  +H +L
Sbjct  189   LCRAAFGKRI-KDQEEFTEIAKEIAKQAGGFDVADIFPSKKFLHHLSGKRARLTSIHKKL  247

Query  786   DKIFDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFS  965
             D + + ++ +H  N       SS  +E ++DVLLR+K+  E  FPIT DN+KA+I D+F+
Sbjct  248   DNLINNLVAEHTIN------TSSKANETLLDVLLRLKDSAE--FPITFDNVKAIIMDVFA  299

Query  966   TGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETl  1145
              GT+TS+ TI WA+SE+IK P  M K QAE+R+ L G +   ++D++ L+YL LVIKETL
Sbjct  300   AGTDTSSDTIEWAISELIKCPRAMEKVQAELRKGLNGKEKIHEEDIQELSYLNLVIKETL  359

Query  1146  rlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSS  1325
             RLHPPLPL+ PRE  +   +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS
Sbjct  360   RLHPPLPLVLPRECRQPVNLAGYNIPNKTKLIVNVFAINRDPEYWKDAETFIPERFENSS  419

Query  1326  VDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAV  1505
                MG  YE++PFGAGRRMCPG +    ++ L LA +LYHFNW+LP+G S   +DMTE+ 
Sbjct  420   ATVMGAEYEYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGASYDQIDMTESF  479

Query  1506  GVIASKKKDLCLI  1544
             G    +K +L L+
Sbjct  480   GATVKRKTELLLV  492



>sp|Q1PS23.1|AMO_ARTAN RecName: Full=Amorpha-4,11-diene 12-monooxygenase; AltName: Full=Amorpha-4,11-diene 
C-12 oxidase; AltName: Full=Cytochrome 
P450 71AV1 [Artemisia annua]
 gb|ABB82944.1| amorpha-4,11-diene C-12 oxidase [Artemisia annua]
 gb|AEQ63684.1| amorpha-4,11-diene oxidase [synthetic construct]
Length=495

 Score =   471 bits (1212),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 234/490 (48%), Positives = 339/490 (69%), Gaps = 13/490 (3%)
 Frame = +3

Query  75    IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
             I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  16    IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIGTT-PHRGVRDLARKYGS  72

Query  255   IMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWR  434
             +MHLQLGE+  +V+S P+ A+ I  T+D+ FA+RP  +  +IV Y +TDV  +PYG+YWR
Sbjct  73    LMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWR  132

Query  435   QMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAK  614
             Q+RKIC LELLS+K VKSF S R+EE  NLV  I+ +S +G P NL+E V    ++++++
Sbjct  133   QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIK-ASGSGRPVNLSENVFKLIATILSR  191

Query  615   VAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKI  794
              AFG+   +DQ +   ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D +
Sbjct  192   AAFGKGI-KDQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNL  250

Query  795   FDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGT  974
              D ++ +H  N       SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT
Sbjct  251   IDNLVAEHTVN------TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGT  302

Query  975   ETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlh  1154
             +TS++TI WA+SE+IK P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLH
Sbjct  303   DTSSSTIEWAISELIKCPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLH  362

Query  1155  pplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDF  1334
             PPLPL+ PRE  +   +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   
Sbjct  363   PPLPLVLPRECRQPVNLAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATV  422

Query  1335  MGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVI  1514
             MG  YE++PFGAGRRMCPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G  
Sbjct  423   MGAEYEYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGAT  482

Query  1515  ASKKKDLCLI  1544
               +K +L L+
Sbjct  483   MQRKTELLLV  492



>ref|XP_003589691.1| Cytochrome P450 [Medicago truncatula]
 gb|AES59942.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   471 bits (1213),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/503 (48%), Positives = 340/503 (68%), Gaps = 17/503 (3%)
 Frame = +3

Query  54    LFNPVSVIVFLSFVFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRT  224
             +F  +++++F  F+F +  L +  N  ++     LPPGPWKLP+IG +HHLV  S PH+ 
Sbjct  5     IFYLLALVLF--FIFMLVVLTKGRNLKKKSSAPNLPPGPWKLPIIGHIHHLVS-STPHQK  61

Query  225   LRNLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDV  404
             LR+L++ YGP+MHLQLGEISA+V+S P+ AR + KTHD++FAS+P I+A+DI+ Y STD+
Sbjct  62    LRDLAKVYGPLMHLQLGEISAIVVSSPEYAREVMKTHDIIFASKPKIVAIDILLYGSTDI  121

Query  405   AFSPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKV  584
             AFSPYG+YWRQ+RKIC +ELL+ K V SF   R+EE +NL+ SI   S+ G P N+T+ V
Sbjct  122   AFSPYGNYWRQLRKICTIELLTQKRVSSFRPIREEEFTNLIKSI--DSQQGSPINITQAV  179

Query  585   SWFTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKL  764
                  ++  + AFG  C + Q + ++L     S+ GGFD+G+LFPS KW+   SG + K+
Sbjct  180   VTSIMTITTRAAFGNKC-KGQEQLVSLANGE-SVGGGFDIGELFPSAKWLQLVSGFRSKI  237

Query  765   LKLHHELDKIFDIIIGDHKENHLANSTNSSGK-DEDIVDVLLRVKEGGELQFPI--TEDN  935
               LH ++D I   II +HKE   A S    G+ +ED+VDVL + + G ++   I  T++N
Sbjct  238   EVLHRQIDLILVNIINEHKE---AKSKAKEGEVEEDLVDVLQKFQGGNDIDQDICLTDNN  294

Query  936   IKAVINDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLT  1115
             IKA+I D+   G ETS+TTI+WAM+E+++ P VM KAQ EVR+      T  +  +  L 
Sbjct  295   IKAIILDIIGAGGETSSTTIVWAMAELVRDPRVMKKAQYEVRKIFNKKGTVGENYINELE  354

Query  1116  YLKLVIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPER  1295
             YLKLV+KET     P   +  RE  +  +I  Y IP K++VI+NAW +  +P+ W +PER
Sbjct  355   YLKLVVKET-LRLHPPTPLLLRECGQACEIEGYHIPAKSKVIVNAWTIGRDPKYWTEPER  413

Query  1296  FLPERFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVS  1475
             F PERF  SS+D+ GN++E+IPFGAGRR+CPGI+F   ++ L+LA LLYHF+W LP+G+ 
Sbjct  414   FHPERFIGSSIDYKGNNFEYIPFGAGRRICPGITFGLINVELALALLLYHFDWRLPNGMK  473

Query  1476  PKDLDMTEAVGVIASKKKDLCLI  1544
              +DLDMTE  G    +K DL LI
Sbjct  474   GEDLDMTEQFGANVKRKSDLYLI  496



>gb|KHG11859.1| Cytochrome P450 [Gossypium arboreum]
Length=511

 Score =   471 bits (1213),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 241/503 (48%), Positives = 336/503 (67%), Gaps = 12/503 (2%)
 Frame = +3

Query  57    FNPVSVIVFLSFVFC--IYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLR  230
             FN +  I+F SF+    + TL+ +    R   LPPGPWKLPLIG++H LV  SLPH TLR
Sbjct  12    FNILLTILFFSFIITRLVKTLKAKKPSPR---LPPGPWKLPLIGNIHQLVAVSLPHFTLR  68

Query  231   NLSRKYGPIMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAF  410
             NL+  +GP+MHLQLGE+S VVIS P+ A    + +D++FASR   +A  I+ Y  T++ F
Sbjct  69    NLALNHGPLMHLQLGEVSTVVISSPEFAEEAMRKNDIIFASRSYQLAPSIISYDCTNIVF  128

Query  411   SPYGDYWRQMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSW  590
             SPYG YWR + KICV ELLS + V+SF   R+E +SNL+ +I  SS  G P NL++++  
Sbjct  129   SPYGSYWRHLPKICVTELLSAQRVRSFRRVREEMVSNLIKTI--SSSQGSPINLSDQIFS  186

Query  591   FTSSLIAKVAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLK  770
              T  + A +AFG  CSE++ KF +++ +V  L+ G  L D FPS K +   SG+KPKL K
Sbjct  187   LTYRITAAMAFGSKCSEEE-KFKSIITKVAELSTGLTLADFFPSIKAVEVVSGIKPKLEK  245

Query  771   LHHELDKIFDIIIGDHKENHLANSTNSSGKDE-DIVDVLLRVKEGGELQFPITEDNIKAV  947
             LH E D+I + II +HKE  +    N SG+DE DIVD+LL +++ G L FP++ +NIK+V
Sbjct  246   LHGEADRILENIISEHKERRVEG--NGSGEDEKDIVDMLLNLQQHGNLDFPLSSNNIKSV  303

Query  948   INDMFSTGTETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKL  1127
             I DMF+ G+ETS+ ++ WAMS+++K PS+M KA AEVRQ   GN   D+     L +LKL
Sbjct  304   ILDMFAAGSETSSISVEWAMSQLLKNPSLMEKATAEVRQVFNGNGYVDEAQFGELKFLKL  363

Query  1128  VIKETlrlhpplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPE  1307
             VIKET         + PRE  E  K+G Y IP  T+V+IN+WA+A +   W +PE F PE
Sbjct  364   VIKET-LRLHNPVPLIPRECRENCKLGGYDIPANTKVLINSWAIARDSRYWSEPESFNPE  422

Query  1308  RFENSSVDFMGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDL  1487
             RF +SS+D+ G  +++IPFGAGRR+CPGI+F   ++   LA L+YHF+W+LP+G+  +DL
Sbjct  423   RFLDSSLDYKGTDFQYIPFGAGRRICPGITFGLANVEQQLAQLVYHFDWKLPNGMKCEDL  482

Query  1488  DMTEAVGVIASKKKDLCLIARPF  1556
             DMT   G+   +K DL +I  P+
Sbjct  483   DMTSGPGLTIRRKHDLFVIPVPY  505



>gb|KEH41118.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=504

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 243/490 (50%), Positives = 338/490 (69%), Gaps = 10/490 (2%)
 Frame = +3

Query  90    FVFCIYTLRRRSNPARRQ---KLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGPIM  260
             F+F +  L+ R N  ++     LPPGPWKLP+IG +HHLV  S PH+ LR+L++ +GP+M
Sbjct  12    FLFMLVALKIRKNLKKKGSSPNLPPGPWKLPIIGHIHHLVT-STPHQKLRDLAKIHGPLM  70

Query  261   HLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWRQM  440
              LQLGEI A+V+S P  A+ + KTHD++FASRP I+A++I+ Y  T++ FSPYG+YWR +
Sbjct  71    QLQLGEIFAIVVSSPDYAKEVLKTHDVIFASRPKILAIEILSYGFTNIGFSPYGNYWRHL  130

Query  441   RKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAKVA  620
             RKIC +ELLS K V SF   R+E  +NL+   R+ S+ G   NLTE V   T +++++ A
Sbjct  131   RKICTMELLSQKHVSSFHPIREEVFTNLIK--RIGSKQGSSINLTELVVSSTFAILSRAA  188

Query  621   FGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKIFD  800
             FG  C +DQ +F +L K   S+AGGFD+G+LFPS KWI   SG++PKL +LH  +D+I +
Sbjct  189   FGNKC-KDQEEFASLGKGE-SIAGGFDIGELFPSSKWIQLVSGLRPKLERLHRRIDRILE  246

Query  801   IIIGDHKENHLANSTNSSGKDEDIVDVLLRV--KEGGELQFPITEDNIKAVINDMFSTGT  974
              II +HKE +          +ED+VDVLL+   +   E    +T++NIKAV+ DMF  G 
Sbjct  247   NIIIEHKEANSKAKECQEEAEEDLVDVLLKYQRRNDNEKDICLTDNNIKAVLLDMFGAGG  306

Query  975   ETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlh  1154
             +TS+TTI+WAM+E+++   VM KAQ EVR+         +  +  LTYLK V+KETLRLH
Sbjct  307   DTSSTTIVWAMAELVRDERVMKKAQDEVREMFNTKGIVGENYINELTYLKSVVKETLRLH  366

Query  1155  pplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDF  1334
             PP PL+ PRE  +  +I  Y IP K++VI+NAWA+  +P+ W +PERF PERF  SS+D+
Sbjct  367   PPAPLLLPRECEQACEIDGYHIPTKSKVIVNAWAIGRDPKYWTEPERFYPERFIGSSIDY  426

Query  1335  MGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVI  1514
              GN++E+IPFG+GRR+CPGI+F   ++ L+LA LLYHF+W LPDG   +DLDMTE  G  
Sbjct  427   KGNNFEYIPFGSGRRICPGITFGLVNVELALALLLYHFDWRLPDGTKGEDLDMTEQFGAT  486

Query  1515  ASKKKDLCLI  1544
               +K DL LI
Sbjct  487   VKRKDDLYLI  496



>gb|AFP19100.1| amorphadiene oxidase [Artemisia annua]
Length=488

 Score =   471 bits (1211),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 234/490 (48%), Positives = 339/490 (69%), Gaps = 13/490 (3%)
 Frame = +3

Query  75    IVFLSFVFCIYTLRRRSNPARRQKLPPGPWKLPLIGSLHHLVGGSLPHRTLRNLSRKYGP  254
             I   + +  +Y    RS   ++    P PW+LP+IG +HHL+G + PHR +R+L+RKYG 
Sbjct  9     IALATILLFVYKFATRSKSTKKSL--PEPWRLPIIGHMHHLIGTT-PHRGVRDLARKYGS  65

Query  255   IMHLQLGEISAVVISYPQLARAITKTHDLVFASRPNIMALDIVFYKSTDVAFSPYGDYWR  434
             +MHLQLGE+  +V+S P+ A+ I  T+D+ FA+RP  +  +IV Y +TDV  +PYG+YWR
Sbjct  66    LMHLQLGEVPTIVVSSPKWAKEILTTYDITFANRPETLTGEIVLYHNTDVVLAPYGEYWR  125

Query  435   QMRKICVLELLSMKMVKSFCSFRQEELSNLVSSIRLSSETGFPTNLTEKVSWFTSSLIAK  614
             Q+RKIC LELLS+K VKSF S R+EE  NLV  I+ +S +G P NL+E V    ++++++
Sbjct  126   QLRKICTLELLSVKKVKSFQSLREEECWNLVQEIK-ASGSGRPVNLSENVFKLIATILSR  184

Query  615   VAFGRVCSEDQGKFIALLKQVLSLAGGFDLGDLFPSKKWIHYTSGMKPKLLKLHHELDKI  794
              AFG+   +DQ +   ++K++L   GGFD+ D+FPSKK++H+ SG + +L  L  ++D +
Sbjct  185   AAFGKGI-KDQKELTEIVKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSLRKKIDNL  243

Query  795   FDIIIGDHKENHLANSTNSSGKDEDIVDVLLRVKEGGELQFPITEDNIKAVINDMFSTGT  974
              D ++ +H  N       SS  +E ++DVLLR+K+  E  FP+T DNIKA+I DMF  GT
Sbjct  244   IDNLVAEHTVN------TSSKTNETLLDVLLRLKDSAE--FPLTSDNIKAIILDMFGAGT  295

Query  975   ETSATTIIWAMSEMIKRPSVMAKAQAEVRQALKGNKTFDDKDLENLTYLKLVIKETlrlh  1154
             +TS++TI WA+SE+IK P  M K QAE+R+AL G +   ++D++ L+YL +VIKETLRLH
Sbjct  296   DTSSSTIEWAISELIKCPKAMEKVQAELRKALNGKEKIHEEDIQELSYLNMVIKETLRLH  355

Query  1155  pplplihprESMEEAKIGEYIIPPKTRVIINAWALATNPESWEDPERFLPERFENSSVDF  1334
             PPLPL+ PRE  +   +  Y IP KT++I+N +A+  +PE W+D E F+PERFENSS   
Sbjct  356   PPLPLVLPRECRQPVNLAGYNIPNKTKLIVNVFAINRDPEYWKDAEAFIPERFENSSATV  415

Query  1335  MGNHYEFIPFGAGRRMCPGISFAYTSIALSLAGLLYHFNWELPDGVSPKDLDMTEAVGVI  1514
             MG  YE++PFGAGRRMCPG +    ++ L LA +LYHFNW+LP+GVS   +DMTE+ G  
Sbjct  416   MGAEYEYLPFGAGRRMCPGAALGLANVQLPLANILYHFNWKLPNGVSYDQIDMTESSGAT  475

Query  1515  ASKKKDLCLI  1544
               +K +L L+
Sbjct  476   MQRKAELLLV  485



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4531252235272