BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25863_g4_i1 len=1772 path=[13486:0-332 510:333-356 22501:357-359
3540:360-1771]

Length=1772
                                                                      Score     E

ref|XP_009603547.1|  PREDICTED: cytochrome P450 86B1-like               504   2e-169   
ref|XP_009802093.1|  PREDICTED: cytochrome P450 86B1-like               495   6e-166   
ref|XP_009759324.1|  PREDICTED: cytochrome P450 86B1-like               492   6e-165   
ref|XP_006351378.1|  PREDICTED: cytochrome P450 86B1-like               491   2e-164   
ref|XP_009626183.1|  PREDICTED: cytochrome P450 86B1-like               491   6e-164   
ref|XP_006351379.1|  PREDICTED: cytochrome P450 86B1-like               487   4e-163   
ref|XP_009623637.1|  PREDICTED: cytochrome P450 86B1-like               485   4e-162   
ref|XP_004249313.1|  PREDICTED: cytochrome P450 86B1-like               484   7e-162   
ref|XP_009622763.1|  PREDICTED: cytochrome P450 86B1-like               481   2e-160   
ref|XP_009631751.1|  PREDICTED: cytochrome P450 86B1-like               480   4e-160   
ref|XP_004249316.1|  PREDICTED: cytochrome P450 86B1-like               478   4e-159   
ref|XP_009589080.1|  PREDICTED: cytochrome P450 86B1-like               473   3e-157   
ref|XP_011095704.1|  PREDICTED: cytochrome P450 86B1-like               472   5e-157   
dbj|BAF46296.1|  cytochrome P450                                        472   7e-157   Ipomoea nil [qian niu]
ref|XP_006351377.1|  PREDICTED: cytochrome P450 86B1-like               469   1e-155   
ref|XP_006339337.1|  PREDICTED: cytochrome P450 86B1-like               464   5e-154   
ref|XP_006340071.1|  PREDICTED: cytochrome P450 86B1-like               462   4e-153   
gb|EYU27552.1|  hypothetical protein MIMGU_mgv1a004751mg                462   4e-153   
ref|XP_009782181.1|  PREDICTED: cytochrome P450 86B1-like               457   3e-151   
ref|XP_004249314.1|  PREDICTED: cytochrome P450 86B1-like               453   9e-150   
gb|EYU32453.1|  hypothetical protein MIMGU_mgv1a005630mg                451   3e-149   
gb|AEI59774.1|  cytochrome P450                                         450   2e-148   
ref|XP_006351417.1|  PREDICTED: cytochrome P450 86B1-like               445   2e-146   
ref|XP_011095825.1|  PREDICTED: cytochrome P450 86B1-like               442   2e-145   
gb|EPS60789.1|  hypothetical protein M569_14012                         436   2e-143   
gb|EYU27551.1|  hypothetical protein MIMGU_mgv1a027070mg                436   9e-143   
gb|EYU41723.1|  hypothetical protein MIMGU_mgv1a021724mg                432   3e-141   
ref|XP_006374652.1|  cytochrome P450 family protein                     431   7e-141   
ref|XP_011041669.1|  PREDICTED: cytochrome P450 86B1-like               430   9e-141   
gb|AJD25225.1|  cytochrome P450 CYP96A85                                420   6e-137   
gb|EYU33777.1|  hypothetical protein MIMGU_mgv1a004858mg                420   1e-136   
ref|XP_010261086.1|  PREDICTED: cytochrome P450 86B1-like               417   1e-135   
ref|XP_009615501.1|  PREDICTED: cytochrome P450 86B1-like               417   2e-135   
gb|EYU33779.1|  hypothetical protein MIMGU_mgv1a018283mg                415   2e-135   
gb|EYU33778.1|  hypothetical protein MIMGU_mgv1a020242mg                415   2e-135   
ref|XP_004237624.1|  PREDICTED: cytochrome P450 86B1-like               414   2e-134   
ref|XP_009795100.1|  PREDICTED: cytochrome P450 86B1-like               414   2e-134   
ref|XP_010652863.1|  PREDICTED: cytochrome P450 86B1                    413   4e-134   
ref|XP_009759082.1|  PREDICTED: cytochrome P450 86B1-like               411   3e-133   
ref|XP_002275905.2|  PREDICTED: cytochrome P450 86B1                    411   3e-133   Vitis vinifera
ref|XP_009614166.1|  PREDICTED: cytochrome P450 86B1-like               410   6e-133   
ref|XP_004237151.1|  PREDICTED: cytochrome P450 86B1                    409   2e-132   
ref|XP_002279531.1|  PREDICTED: cytochrome P450 86B1                    408   4e-132   Vitis vinifera
ref|XP_006370230.1|  hypothetical protein POPTR_0001s40840g             408   7e-132   
gb|KDP35257.1|  hypothetical protein JCGZ_09416                         407   1e-131   
ref|XP_002529227.1|  cytochrome P450, putative                          407   1e-131   Ricinus communis
ref|XP_011043827.1|  PREDICTED: cytochrome P450 86B1-like               406   3e-131   
ref|XP_011100902.1|  PREDICTED: cytochrome P450 86B1-like               405   7e-131   
ref|XP_006346789.1|  PREDICTED: cytochrome P450 86B1-like               403   2e-130   
gb|KDP35260.1|  hypothetical protein JCGZ_09419                         402   8e-130   
ref|XP_002521474.1|  cytochrome P450, putative                          401   2e-129   Ricinus communis
ref|XP_011025593.1|  PREDICTED: cytochrome P450 86B1-like               400   8e-129   
ref|XP_006470474.1|  PREDICTED: cytochrome P450 86B1-like               399   1e-128   
ref|XP_007150921.1|  hypothetical protein PHAVU_004G005800g             397   6e-128   
ref|XP_002310605.1|  hypothetical protein POPTR_0007s06670g             397   7e-128   Populus trichocarpa [western balsam poplar]
ref|XP_007048137.1|  Cytochrome P450                                    396   2e-127   
gb|EYU27553.1|  hypothetical protein MIMGU_mgv1a006542mg                393   3e-127   
ref|XP_010025512.1|  PREDICTED: cytochrome P450 86B1-like               395   3e-127   
emb|CDP18605.1|  unnamed protein product                                392   5e-127   
emb|CDP12888.1|  unnamed protein product                                394   5e-127   
ref|XP_006339338.1|  PREDICTED: cytochrome P450 86B1-like               393   5e-127   
emb|CAN80536.1|  hypothetical protein VITISV_035975                     393   1e-126   Vitis vinifera
gb|EYU24049.1|  hypothetical protein MIMGU_mgv1a004847mg                394   2e-126   
ref|XP_011031168.1|  PREDICTED: cytochrome P450 86B1-like               393   3e-126   
ref|XP_008801256.1|  PREDICTED: cytochrome P450 86B1-like               393   4e-126   
ref|XP_007150922.1|  hypothetical protein PHAVU_004G005900g             392   4e-126   
ref|XP_003554826.1|  PREDICTED: cytochrome P450 86B1-like               392   7e-126   
ref|XP_007150917.1|  hypothetical protein PHAVU_004G005400g             390   5e-125   
gb|EPS65366.1|  hypothetical protein M569_09411                         390   5e-125   
ref|XP_011100086.1|  PREDICTED: cytochrome P450 86B1-like               389   1e-124   
ref|XP_009601590.1|  PREDICTED: cytochrome P450 86B1-like               389   1e-124   
ref|XP_006446602.1|  hypothetical protein CICLE_v10014930mg             389   1e-124   
ref|XP_010027331.1|  PREDICTED: cytochrome P450 86B1-like               388   2e-124   
ref|XP_007150924.1|  hypothetical protein PHAVU_004G006100g             388   2e-124   
ref|XP_009759095.1|  PREDICTED: cytochrome P450 86B1-like               388   3e-124   
ref|XP_010027339.1|  PREDICTED: cytochrome P450 86B1-like               388   3e-124   
ref|XP_008440138.1|  PREDICTED: cytochrome P450 86B1-like               384   1e-122   
gb|KDP46408.1|  hypothetical protein JCGZ_10248                         384   1e-122   
ref|XP_010681071.1|  PREDICTED: cytochrome P450 86B1-like               382   2e-122   
ref|XP_002306257.2|  hypothetical protein POPTR_0005s06540g             382   4e-122   Populus trichocarpa [western balsam poplar]
ref|XP_006427987.1|  hypothetical protein CICLE_v10025412mg             382   4e-122   
gb|KGN48432.1|  hypothetical protein Csa_6G487530                       382   5e-122   
ref|XP_002521476.1|  cytochrome P450, putative                          382   5e-122   Ricinus communis
ref|XP_011095705.1|  PREDICTED: cytochrome P450 86B1-like               382   6e-122   
gb|EYU24048.1|  hypothetical protein MIMGU_mgv1a026886mg                382   7e-122   
ref|XP_004160508.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    382   8e-122   
gb|KHN19680.1|  Cytochrome P450 86B1                                    384   8e-122   
ref|XP_006446605.1|  hypothetical protein CICLE_v10017795mg             381   1e-121   
ref|XP_011100903.1|  PREDICTED: cytochrome P450 86B1-like               381   1e-121   
ref|XP_009397903.1|  PREDICTED: cytochrome P450 86B1-like               381   2e-121   
ref|XP_010911437.1|  PREDICTED: cytochrome P450 86B1-like               381   2e-121   
ref|XP_010554002.1|  PREDICTED: cytochrome P450 86B1-like               380   3e-121   
gb|KGN48434.1|  hypothetical protein Csa_6G487550                       380   4e-121   
ref|XP_004173396.1|  PREDICTED: cytochrome P450 86B1-like               379   5e-121   
ref|XP_003525679.1|  PREDICTED: cytochrome P450 86B1-like               379   5e-121   
gb|EYU27556.1|  hypothetical protein MIMGU_mgv1a021423mg                379   6e-121   
ref|XP_010681072.1|  PREDICTED: cytochrome P450 86B1-like               380   7e-121   
ref|XP_004142037.1|  PREDICTED: cytochrome P450 86B1-like               378   1e-120   
gb|EPS72790.1|  hypothetical protein M569_01963                         377   4e-120   
ref|NP_001031814.1|  cytochrome P450, family 96, subfamily A, pol...    377   7e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525678.1|  PREDICTED: cytochrome P450 86B1-like               376   8e-120   
ref|XP_010417073.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    377   8e-120   
ref|XP_011025646.1|  PREDICTED: cytochrome P450 86B1-like               376   1e-119   
ref|XP_007031599.1|  Cytochrome P450, family 96, subfamily A, pol...    375   1e-119   
ref|XP_004160509.1|  PREDICTED: cytochrome P450 86B1-like               375   2e-119   
ref|XP_010681074.1|  PREDICTED: cytochrome P450 86B1-like               376   2e-119   
ref|XP_010683407.1|  PREDICTED: cytochrome P450 86B1-like               375   2e-119   
ref|XP_007150923.1|  hypothetical protein PHAVU_004G006000g             375   2e-119   
ref|XP_003524561.1|  PREDICTED: cytochrome P450 86B1-like               374   4e-119   
gb|KCW62190.1|  hypothetical protein EUGRSUZ_H04847                     374   6e-119   
ref|XP_006470473.1|  PREDICTED: cytochrome P450 86B1-like               374   8e-119   
ref|XP_006404644.1|  hypothetical protein EUTSA_v10000679mg             374   1e-118   
emb|CDY46088.1|  BnaA09g42120D                                          373   2e-118   
gb|KFK32767.1|  hypothetical protein AALP_AA6G286100                    373   2e-118   
ref|XP_010437069.1|  PREDICTED: cytochrome P450 86B1 isoform X1         373   2e-118   
ref|XP_009117361.1|  PREDICTED: cytochrome P450 86B1                    372   3e-118   
ref|XP_003556827.2|  PREDICTED: cytochrome P450 86B1-like               372   4e-118   
ref|XP_002866853.1|  CYP96A10                                           372   8e-118   
ref|XP_010446495.1|  PREDICTED: cytochrome P450 86B1-like               371   1e-117   
ref|XP_002878665.1|  CYP96A1                                            371   1e-117   
ref|XP_010027341.1|  PREDICTED: cytochrome P450 86B1-like               370   2e-117   
ref|XP_010025513.1|  PREDICTED: cytochrome P450 86B1-like               370   2e-117   
ref|XP_010027335.1|  PREDICTED: cytochrome P450 86B1-like               370   2e-117   
ref|XP_010680693.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    369   3e-117   
emb|CDP12889.1|  unnamed protein product                                369   5e-117   
ref|XP_006405740.1|  hypothetical protein EUTSA_v10027725mg             369   6e-117   
ref|NP_179899.1|  cytochrome P450, family 96, subfamily A, polype...    369   7e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554824.1|  PREDICTED: cytochrome P450 86B1-like               369   7e-117   
ref|XP_006405739.1|  hypothetical protein EUTSA_v10028064mg             369   9e-117   
ref|XP_006285710.1|  hypothetical protein CARUB_v10007181mg             369   9e-117   
ref|XP_010429263.1|  PREDICTED: cytochrome P450 86B1-like               369   1e-116   
emb|CDX76962.1|  BnaC08g35480D                                          368   1e-116   
ref|XP_010416946.1|  PREDICTED: cytochrome P450 86B1-like               368   1e-116   
ref|XP_006294050.1|  hypothetical protein CARUB_v10023041mg             368   1e-116   
ref|NP_001048917.1|  Os03g0140100                                       368   1e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010027344.1|  PREDICTED: cytochrome P450 86B1-like               368   2e-116   
emb|CDY53181.1|  BnaA06g40600D                                          367   2e-116   
ref|XP_010555338.1|  PREDICTED: cytochrome P450 86B1-like               369   2e-116   
ref|XP_009101871.1|  PREDICTED: cytochrome P450 86B1                    367   2e-116   
gb|KHN27468.1|  Cytochrome P450 86B1                                    365   3e-116   
gb|EAY88476.1|  hypothetical protein OsI_09947                          367   3e-116   Oryza sativa Indica Group [Indian rice]
ref|XP_009400927.1|  PREDICTED: cytochrome P450 86B1-like               368   3e-116   
ref|XP_009117295.1|  PREDICTED: cytochrome P450 86B1                    368   4e-116   
ref|XP_009108130.1|  PREDICTED: cytochrome P450 86B1-like               367   4e-116   
gb|KEH22137.1|  cytochrome P450 family protein                          366   4e-116   
gb|EPS67771.1|  hypothetical protein M569_06997                         366   4e-116   
gb|KHN27469.1|  Cytochrome P450 86B1                                    365   5e-116   
ref|XP_010446494.1|  PREDICTED: cytochrome P450 86B1-like               366   7e-116   
emb|CDY27160.1|  BnaA08g07980D                                          366   1e-115   
ref|XP_004489209.1|  PREDICTED: cytochrome P450 86B1-like               365   2e-115   
ref|XP_010473744.1|  PREDICTED: cytochrome P450 86B1-like               365   2e-115   
ref|XP_006283543.1|  hypothetical protein CARUB_v10004594mg             365   3e-115   
emb|CDX76867.1|  BnaC08g34530D                                          365   3e-115   
ref|XP_006649380.1|  PREDICTED: cytochrome P450 86B1-like               364   3e-115   
ref|XP_010432764.1|  PREDICTED: cytochrome P450 86B1-like               364   4e-115   
emb|CDY12435.1|  BnaC08g09240D                                          364   5e-115   
dbj|BAD94304.1|  cytochrome p450 - like protein                         363   6e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869292.1|  CYP96A2                                            363   6e-115   
emb|CAB44684.1|  cytochrome P450-like protein                           362   8e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004492144.1|  PREDICTED: cytochrome P450 86B1-like               363   9e-115   
ref|NP_179782.1|  cytochrome P450, family 96, subfamily A, polype...    363   9e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009795090.1|  PREDICTED: cytochrome P450 86B1-like               363   1e-114   
ref|XP_009101866.1|  PREDICTED: cytochrome P450 86B1                    363   1e-114   
ref|XP_006411749.1|  hypothetical protein EUTSA_v10026828mg             363   1e-114   
ref|XP_010027329.1|  PREDICTED: cytochrome P450 86B1-like               363   1e-114   
ref|XP_010437945.1|  PREDICTED: cytochrome P450 86B1-like               363   1e-114   
ref|XP_003629932.1|  Cytochrome P450                                    362   2e-114   
emb|CDX72695.1|  BnaC07g47170D                                          362   3e-114   
ref|NP_194944.1|  cytochrome P450, family 96, subfamily A, polype...    362   3e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004166589.1|  PREDICTED: cytochrome P450 86B1-like               362   3e-114   
gb|KGN48435.1|  hypothetical protein Csa_6G487560                       361   4e-114   
ref|XP_004151610.1|  PREDICTED: cytochrome P450 86B1-like               362   6e-114   
ref|XP_004160507.1|  PREDICTED: cytochrome P450 86B1-like               361   7e-114   
gb|KEH40835.1|  cytochrome P450 family protein                          361   8e-114   
ref|XP_002878579.1|  CYP96A5                                            360   1e-113   
ref|XP_006604019.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    361   1e-113   
ref|XP_008440139.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    360   1e-113   
gb|KFK33664.1|  hypothetical protein AALP_AA5G043500                    360   1e-113   
ref|XP_006294031.1|  hypothetical protein CARUB_v10023023mg             360   3e-113   
ref|XP_010437068.1|  PREDICTED: cytochrome P450 86B1                    359   4e-113   
emb|CDY53179.1|  BnaA06g40580D                                          359   5e-113   
ref|XP_007134108.1|  hypothetical protein PHAVU_010G019500g             358   6e-113   
ref|XP_010447431.1|  PREDICTED: cytochrome P450 86B1                    358   6e-113   
gb|KFK32856.1|  hypothetical protein AALP_AA6G295800                    358   6e-113   
ref|XP_009389287.1|  PREDICTED: cytochrome P450 86B1-like               358   1e-112   
gb|KEH24773.1|  cytochrome P450 family protein                          358   1e-112   
ref|XP_009101870.1|  PREDICTED: cytochrome P450 86B1                    357   2e-112   
ref|XP_006283561.1|  hypothetical protein CARUB_v10004619mg             357   2e-112   
ref|XP_011005604.1|  PREDICTED: cytochrome P450 86B1-like               357   3e-112   
ref|XP_007150926.1|  hypothetical protein PHAVU_004G006300g             357   3e-112   
ref|XP_006411750.1|  hypothetical protein EUTSA_v10024958mg             357   3e-112   
gb|KEH40821.1|  cytochrome P450 family protein                          356   4e-112   
gb|EPS60696.1|  hypothetical protein M569_14105                         355   4e-112   
ref|XP_003555023.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    357   4e-112   
ref|XP_002322211.1|  hypothetical protein POPTR_0015s09840g             355   1e-111   Populus trichocarpa [western balsam poplar]
ref|XP_009101867.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    355   1e-111   
gb|KCW62191.1|  hypothetical protein EUGRSUZ_H04849                     355   1e-111   
gb|KEH22136.1|  cytochrome P450 family protein                          354   2e-111   
gb|EPS57870.1|  hypothetical protein M569_16947                         355   2e-111   
gb|KEH40805.1|  cytochrome P450 family protein                          354   2e-111   
ref|XP_010653011.1|  PREDICTED: cytochrome P450 86B1-like               352   8e-111   
ref|XP_006282055.1|  hypothetical protein CARUB_v10028299mg             353   1e-110   
gb|EEC74485.1|  hypothetical protein OsI_09945                          352   2e-110   Oryza sativa Indica Group [Indian rice]
dbj|BAJ86572.1|  predicted protein                                      352   3e-110   
ref|XP_009773631.1|  PREDICTED: cytochrome P450 86B1-like               352   3e-110   
gb|KEH40819.1|  cytochrome P450 family protein                          350   4e-110   
ref|XP_007134103.1|  hypothetical protein PHAVU_010G019100g             351   4e-110   
ref|XP_009400643.1|  PREDICTED: cytochrome P450 86B1-like               352   5e-110   
ref|NP_175193.1|  cytochrome P450, family 96, subfamily A, polype...    351   7e-110   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ25521.1|  hypothetical protein OsJ_09345                          350   7e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306153.1|  hypothetical protein CARUB_v10011665mg             351   7e-110   
ref|XP_010482535.1|  PREDICTED: cytochrome P450 86B1-like               351   8e-110   
ref|XP_002457224.1|  hypothetical protein SORBIDRAFT_03g003590          350   1e-109   Sorghum bicolor [broomcorn]
gb|KEH40811.1|  cytochrome P450 family protein                          350   1e-109   
gb|KEH24772.1|  cytochrome P450 family protein                          350   1e-109   
gb|KDP46411.1|  hypothetical protein JCGZ_10251                         348   2e-109   
ref|XP_007031595.1|  Cytochrome P450, putative                          349   2e-109   
emb|CDP04331.1|  unnamed protein product                                348   2e-109   
ref|XP_008440140.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    349   2e-109   
gb|EAY88475.1|  hypothetical protein OsI_09946                          349   3e-109   Oryza sativa Indica Group [Indian rice]
ref|XP_004968446.1|  PREDICTED: cytochrome P450 86B1-like               348   5e-109   
gb|EYU31098.1|  hypothetical protein MIMGU_mgv1a004607mg                348   7e-109   
ref|XP_006405350.1|  hypothetical protein EUTSA_v10027722mg             348   8e-109   
ref|XP_010680859.1|  PREDICTED: cytochrome P450 86B1-like               347   8e-109   
ref|XP_006283573.1|  hypothetical protein CARUB_v10004625mg             347   9e-109   
gb|KFK31020.1|  hypothetical protein AALP_AA6G057700                    348   9e-109   
ref|XP_009381852.1|  PREDICTED: cytochrome P450 86B1-like               348   1e-108   
ref|XP_006280314.1|  hypothetical protein CARUB_v10026237mg             348   1e-108   
gb|ABF93891.1|  Cytochrome P450 family protein                          348   1e-108   Oryza sativa Japonica Group [Japonica rice]
gb|KHN45347.1|  Cytochrome P450 86B1                                    346   1e-108   
emb|CDX72693.1|  BnaC07g47150D                                          346   1e-108   
gb|ABF93892.1|  Cytochrome P450 family protein                          347   2e-108   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002866852.1|  CYP96A9                                            347   2e-108   
ref|XP_010429268.1|  PREDICTED: cytochrome P450 86B1-like               346   2e-108   
ref|XP_010444065.1|  PREDICTED: cytochrome P450 86B1-like               347   3e-108   
gb|ACR38435.1|  unknown                                                 347   3e-108   Zea mays [maize]
ref|XP_006404787.1|  hypothetical protein EUTSA_v10000131mg             347   3e-108   
ref|XP_004489210.1|  PREDICTED: cytochrome P450 86B1-like               346   3e-108   
gb|KEH24775.1|  cytochrome P450 family protein                          345   7e-108   
gb|KEH24777.1|  cytochrome P450 family protein                          345   8e-108   
ref|XP_006651021.1|  PREDICTED: cytochrome P450 86B1-like               345   1e-107   
gb|KDP35253.1|  hypothetical protein JCGZ_09412                         344   2e-107   
gb|KEH41380.1|  cytochrome P450 family protein                          344   2e-107   
ref|XP_007019556.1|  Cytochrome P450                                    344   2e-107   
ref|XP_009123569.1|  PREDICTED: cytochrome P450 86B1-like               344   2e-107   
emb|CDY53178.1|  BnaA06g40570D                                          343   3e-107   
ref|XP_007019638.1|  Cytochrome P450                                    344   3e-107   
gb|KEH40818.1|  cytochrome P450 family protein                          343   4e-107   
gb|KEH40830.1|  cytochrome P450 family protein                          343   4e-107   
ref|XP_009101865.1|  PREDICTED: cytochrome P450 86B1-like               344   4e-107   
pir||C96517  hypothetical protein F16N3.7 [imported] - Arabidopsi...    343   5e-107
ref|XP_009132532.1|  PREDICTED: cytochrome P450 86B1                    342   7e-107   
ref|XP_008441106.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    343   7e-107   
gb|KFK33109.1|  hypothetical protein AALP_AA6G332200                    341   8e-107   
ref|XP_006279822.1|  hypothetical protein CARUB_v10028124mg             343   9e-107   
ref|XP_009783405.1|  PREDICTED: cytochrome P450 86B1-like               343   9e-107   
ref|XP_009128105.1|  PREDICTED: cytochrome P450 86B1-like               343   9e-107   
ref|NP_195658.3|  cytochrome P450, family 96, subfamily A, polype...    343   1e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KEH40839.1|  cytochrome P450 family protein                          342   1e-106   
ref|XP_004515481.1|  PREDICTED: cytochrome P450 86B1-like               342   1e-106   
ref|XP_007150920.1|  hypothetical protein PHAVU_004G005700g             340   1e-106   
emb|CDX72690.1|  BnaC07g47120D                                          342   1e-106   
ref|XP_002465888.1|  hypothetical protein SORBIDRAFT_01g047630          342   2e-106   Sorghum bicolor [broomcorn]
dbj|BAA99522.1|  putative cytochrome P450                               342   2e-106   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002894062.1|  CYP96A8                                            342   2e-106   
gb|KGN48430.1|  hypothetical protein Csa_6G487020                       342   3e-106   
gb|KEH40823.1|  cytochrome P450 family protein                          341   3e-106   
emb|CDY53177.1|  BnaA06g40560D                                          341   4e-106   
ref|XP_009134418.1|  PREDICTED: cytochrome P450 86B1-like               341   4e-106   
ref|XP_002868908.1|  hypothetical protein ARALYDRAFT_352944             353   5e-106   
ref|XP_009107985.1|  PREDICTED: cytochrome P450 86B1-like               340   5e-106   
gb|KDP35254.1|  hypothetical protein JCGZ_09413                         340   6e-106   
emb|CDY39035.1|  BnaA02g17240D                                          340   6e-106   
ref|XP_006427985.1|  hypothetical protein CICLE_v10025385mg             340   6e-106   
ref|XP_004489211.1|  PREDICTED: cytochrome P450 86B1-like               340   8e-106   
gb|KFK30522.1|  hypothetical protein AALP_AA7G273500                    340   9e-106   
ref|XP_010531420.1|  PREDICTED: cytochrome P450 86B1-like               340   1e-105   
ref|XP_002862576.1|  hypothetical protein ARALYDRAFT_920522             340   1e-105   
ref|XP_006405349.1|  hypothetical protein EUTSA_v10028238mg             340   1e-105   
ref|XP_010431923.1|  PREDICTED: cytochrome P450 86B1-like               339   2e-105   
ref|XP_010526618.1|  PREDICTED: cytochrome P450 86B1-like               339   2e-105   
ref|XP_004237152.1|  PREDICTED: cytochrome P450 86B1-like               339   2e-105   
ref|XP_010660343.1|  PREDICTED: cytochrome P450 86B1                    338   3e-105   
gb|KEH40842.1|  cytochrome P450 family protein                          338   3e-105   
emb|CDY42628.1|  BnaC01g00400D                                          340   3e-105   
ref|XP_004515489.1|  PREDICTED: cytochrome P450 86B1-like               339   4e-105   
ref|NP_195661.1|  cytochrome P450, family 96, subfamily A, polype...    338   4e-105   
ref|XP_004985762.1|  PREDICTED: cytochrome P450 86B1-like               338   4e-105   
ref|XP_006301857.1|  hypothetical protein CARUB_v10022327mg             338   5e-105   
ref|XP_010446498.1|  PREDICTED: cytochrome P450 86B1-like               338   6e-105   
gb|KEH40822.1|  cytochrome P450 family protein                          338   7e-105   
ref|XP_010437072.1|  PREDICTED: cytochrome P450 86B1-like               338   9e-105   
ref|XP_007042364.1|  Cytochrome P450-like protein                       337   9e-105   
gb|AJD25224.1|  cytochrome P450 CYP96A84                                336   1e-104   
ref|XP_006287519.1|  hypothetical protein CARUB_v10000726mg             337   1e-104   
ref|XP_008650864.1|  PREDICTED: cytochrome P450 86B1-like               337   2e-104   
emb|CDY44658.1|  BnaA08g06820D                                          336   2e-104   
ref|XP_007134109.1|  hypothetical protein PHAVU_010G019600g             335   3e-104   
emb|CDM81753.1|  unnamed protein product                                336   3e-104   
gb|KFK40984.1|  hypothetical protein AALP_AA2G070000                    335   4e-104   
ref|XP_004515488.1|  PREDICTED: cytochrome P450 86B1-like               334   5e-104   
ref|XP_006643842.1|  PREDICTED: cytochrome P450 86B1-like               335   8e-104   
gb|KEH40828.1|  cytochrome P450 family protein                          335   8e-104   
gb|KFK22570.1|  hypothetical protein AALP_AAs72953U000100               334   9e-104   
ref|XP_002868909.1|  CYP96A12                                           335   1e-103   
emb|CDM81752.1|  unnamed protein product                                335   1e-103   
ref|XP_009790818.1|  PREDICTED: cytochrome P450 86B1-like               335   1e-103   
gb|AHF22086.1|  CYP96A68                                                333   1e-103   
gb|KFK30510.1|  hypothetical protein AALP_AA7G271300                    334   1e-103   
ref|XP_009101869.1|  PREDICTED: cytochrome P450 86B1-like isoform X2    333   1e-103   
ref|XP_003604436.1|  Cytochrome P450                                    333   1e-103   
ref|NP_195660.1|  cytochrome P450, family 96, subfamily A, polype...    333   2e-103   
ref|XP_002894061.1|  CYP96A8                                            334   2e-103   
ref|XP_003558845.1|  PREDICTED: cytochrome P450 86B1-like               334   2e-103   
emb|CBH32607.1|  cytochrome P450, putative, expressed                   334   2e-103   
ref|XP_010414809.1|  PREDICTED: cytochrome P450 86B1-like               332   5e-103   
gb|EMT14219.1|  Cytochrome P450 86A2                                    333   5e-103   
ref|XP_003564427.1|  PREDICTED: cytochrome P450 86B1-like               333   5e-103   
gb|KDP35252.1|  hypothetical protein JCGZ_09411                         332   6e-103   
ref|XP_009151941.1|  PREDICTED: cytochrome P450 86A7-like               333   6e-103   
ref|XP_009109465.1|  PREDICTED: cytochrome P450 86B1-like               333   7e-103   
dbj|BAK07250.1|  predicted protein                                      332   8e-103   
ref|XP_010520636.1|  PREDICTED: cytochrome P450 86B1-like               332   1e-102   
ref|XP_010482590.1|  PREDICTED: cytochrome P450 86B1-like isoform X3    332   1e-102   
ref|XP_009109462.1|  PREDICTED: cytochrome P450 86B1-like               332   1e-102   
ref|XP_010482588.1|  PREDICTED: cytochrome P450 86B1-like isoform X1    332   2e-102   
gb|KHM99046.1|  Cytochrome P450 86B1                                    329   2e-102   
ref|XP_010479164.1|  PREDICTED: cytochrome P450 86B1                    332   2e-102   
ref|XP_004968445.1|  PREDICTED: cytochrome P450 86B1-like               331   2e-102   
ref|NP_001042228.1|  Os01g0183600                                       330   5e-102   
ref|XP_006464845.1|  PREDICTED: cytochrome P450 86B1-like               329   5e-102   
ref|XP_004157875.1|  PREDICTED: cytochrome P450 86B1-like               328   1e-101   
ref|NP_200045.1|  cytochrome P450, family 96, subfamily A, polype...    329   1e-101   
gb|KDP35251.1|  hypothetical protein JCGZ_09410                         328   1e-101   
ref|XP_010444711.1|  PREDICTED: cytochrome P450 86B1-like               329   1e-101   
ref|XP_004151191.1|  PREDICTED: cytochrome P450 86B1-like               328   2e-101   
ref|NP_176713.1|  cytochrome P450, family 96, subfamily A, polype...    329   2e-101   
ref|XP_007019555.1|  Cytochrome P450                                    328   2e-101   
ref|XP_010446497.1|  PREDICTED: cytochrome P450 86B1-like               329   2e-101   
ref|XP_004142038.1|  PREDICTED: cytochrome P450 86B1-like               327   2e-101   
ref|XP_010442757.1|  PREDICTED: cytochrome P450 86B1-like               329   2e-101   
gb|EAY72807.1|  hypothetical protein OsI_00673                          328   2e-101   
emb|CAN68037.1|  hypothetical protein VITISV_011827                     333   2e-101   
ref|XP_006392374.1|  hypothetical protein EUTSA_v10023421mg             328   3e-101   
ref|XP_009139809.1|  PREDICTED: cytochrome P450 86B1-like               328   4e-101   
ref|XP_009109464.1|  PREDICTED: cytochrome P450 86B1-like               328   4e-101   
dbj|BAC42841.1|  putative cytochrome P450                               327   7e-101   
ref|XP_009402197.1|  PREDICTED: cytochrome P450 86B1-like               328   7e-101   
ref|XP_002894690.1|  hypothetical protein ARALYDRAFT_474859             327   7e-101   
ref|XP_002457225.1|  hypothetical protein SORBIDRAFT_03g003600          327   1e-100   
gb|EMT29854.1|  Cytochrome P450 86A2                                    327   1e-100   
ref|XP_011100143.1|  PREDICTED: cytochrome P450 86B1-like               327   1e-100   
ref|XP_010555337.1|  PREDICTED: cytochrome P450 86B1-like               325   2e-100   
gb|KEH24774.1|  cytochrome P450 family protein                          324   4e-100   
ref|XP_006404465.1|  hypothetical protein EUTSA_v10010970mg             325   4e-100   
emb|CDX79038.1|  BnaA01g11050D                                          324   5e-100   
emb|CDX90337.1|  BnaA08g16470D                                          325   7e-100   
gb|KFK22353.1|  hypothetical protein AALP_AAs42226U000100               323   9e-100   
ref|XP_010470317.1|  PREDICTED: cytochrome P450 86B1-like               323   1e-99    
gb|AIE57505.1|  MAH1                                                    324   1e-99    
gb|KHN19678.1|  Cytochrome P450 86B1                                    321   1e-99    
ref|XP_006301880.1|  hypothetical protein CARUB_v10022359mg             322   2e-99    
ref|XP_010270986.1|  PREDICTED: cytochrome P450 86B1-like               324   2e-99    
ref|XP_006285226.1|  hypothetical protein CARUB_v10006585mg             323   3e-99    
ref|NP_176086.1|  alkane hydroxylase CYP96A15                           322   3e-99    
gb|KHN27470.1|  Cytochrome P450 86B1                                    319   6e-99    
ref|XP_010511350.1|  PREDICTED: cytochrome P450 86B1-like               322   7e-99    
gb|EYU43136.1|  hypothetical protein MIMGU_mgv1a007195mg                318   2e-98    
tpg|DAA43291.1|  TPA: putative cytochrome P450 superfamily protein      321   3e-98    
ref|XP_002465889.1|  hypothetical protein SORBIDRAFT_01g047640          321   3e-98    
gb|EMS62655.1|  Cytochrome P450 86B1                                    322   3e-98    
gb|KFK38027.1|  hypothetical protein AALP_AA3G060700                    318   6e-98    
ref|XP_010511352.1|  PREDICTED: cytochrome P450 86B1-like               319   7e-98    
gb|KFK30509.1|  hypothetical protein AALP_AA7G271200                    317   9e-98    
ref|XP_010270999.1|  PREDICTED: cytochrome P450 86B1-like               319   1e-97    
ref|XP_002865907.1|  CYP96A4                                            319   1e-97    
ref|XP_010681240.1|  PREDICTED: cytochrome P450 86A7-like               316   1e-97    
ref|XP_006392376.1|  hypothetical protein EUTSA_v10023422mg             318   1e-97    
ref|NP_001141467.1|  uncharacterized protein LOC100273577               320   1e-97    
ref|XP_010246220.1|  PREDICTED: cytochrome P450 86B1-like               318   2e-97    
gb|KEH40920.1|  cytochrome P450 family protein                          320   2e-97    
ref|XP_004142039.1|  PREDICTED: cytochrome P450 86B1-like               317   2e-97    
emb|CAE54308.1|  cytochrome P450-like protein                           318   3e-97    
gb|EMT05588.1|  Cytochrome P450 86A2                                    317   5e-97    
gb|AFW89633.1|  putative cytochrome P450 superfamily protein            318   5e-97    
gb|KDO45858.1|  hypothetical protein CISIN_1g047974mg                   316   1e-96    
ref|XP_004985761.1|  PREDICTED: cytochrome P450 86B1-like               316   1e-96    
ref|XP_010555325.1|  PREDICTED: cytochrome P450 86B1-like               316   1e-96    
emb|CDY39927.1|  BnaA09g15090D                                          315   2e-96    
ref|XP_011022068.1|  PREDICTED: cytochrome P450 86B1-like               315   2e-96    
ref|XP_010274128.1|  PREDICTED: cytochrome P450 86B1-like               316   2e-96    
ref|XP_009113344.1|  PREDICTED: cytochrome P450 86B1-like               315   3e-96    
ref|XP_010431920.1|  PREDICTED: cytochrome P450 86B1-like               312   3e-96    
ref|XP_010905514.1|  PREDICTED: cytochrome P450 86B1-like               316   4e-96    
emb|CDY39931.1|  BnaA09g15130D                                          314   5e-96    
ref|XP_006405689.1|  hypothetical protein EUTSA_v10028261mg             315   5e-96    
ref|XP_007042363.1|  Cytochrome P450-like protein                       314   6e-96    
ref|XP_007041219.1|  Cytochrome P450, putative                          314   8e-96    
ref|XP_003562115.1|  PREDICTED: cytochrome P450 86B1-like               314   1e-95    
ref|XP_004142036.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    313   1e-95    
ref|XP_003568803.1|  PREDICTED: cytochrome P450 86B1-like               314   1e-95    
emb|CDY58383.1|  BnaC09g51620D                                          313   2e-95    
emb|CDP12890.1|  unnamed protein product                                311   2e-95    
gb|KFK30508.1|  hypothetical protein AALP_AA7G271100                    310   3e-95    
ref|XP_011022663.1|  PREDICTED: cytochrome P450 86B1-like               311   3e-95    
dbj|BAJ89570.1|  predicted protein                                      312   3e-95    
gb|EMS45869.1|  Cytochrome P450 86B1                                    312   4e-95    
ref|XP_009113349.1|  PREDICTED: cytochrome P450 86B1-like               312   4e-95    
ref|XP_002307182.1|  cytochrome P450 family protein                     311   5e-95    
ref|XP_009109463.1|  PREDICTED: cytochrome P450 86B1-like               312   7e-95    
emb|CDY68678.1|  BnaCnng60030D                                          311   8e-95    
emb|CDY39928.1|  BnaA09g15100D                                          311   9e-95    
ref|NP_195910.1|  cytochrome P450, family 96, subfamily A, polype...    310   1e-94    
ref|XP_003538960.2|  PREDICTED: cytochrome P450 86B1-like               313   1e-94    
ref|XP_010436205.1|  PREDICTED: cytochrome P450 86B1-like               309   2e-94    
emb|CDY39926.1|  BnaA09g15080D                                          310   2e-94    
ref|XP_010275494.1|  PREDICTED: cytochrome P450 86B1-like               310   3e-94    
ref|XP_009113345.1|  PREDICTED: cytochrome P450 86B1-like               309   4e-94    
gb|EMS50674.1|  Cytochrome P450 86B1                                    310   9e-94    
ref|XP_010242796.1|  PREDICTED: cytochrome P450 86B1-like               309   9e-94    
ref|XP_002865881.1|  hypothetical protein ARALYDRAFT_331566             308   1e-93    
ref|XP_004960856.1|  PREDICTED: cytochrome P450 86B1-like               308   1e-93    
ref|XP_002312417.2|  cytochrome P450 family protein                     307   1e-93    
ref|XP_007042368.1|  Cytochrome P450-like protein                       308   1e-93    
ref|XP_002870817.1|  hypothetical protein ARALYDRAFT_916433             308   3e-93    
emb|CDY39934.1|  BnaA09g15160D                                          305   3e-93    
ref|XP_003607255.1|  Cytochrome P450                                    308   5e-93    
ref|XP_010269253.1|  PREDICTED: cytochrome P450 86B1-like               307   5e-93    
gb|EMT10522.1|  Cytochrome P450 86A1                                    306   6e-93    
ref|XP_008796514.1|  PREDICTED: cytochrome P450 86B1-like               307   6e-93    
dbj|BAJ85246.1|  predicted protein                                      306   7e-93    
emb|CDY66735.1|  BnaC03g60620D                                          306   7e-93    
gb|EMS52666.1|  Cytochrome P450 86B1                                    306   7e-93    
ref|XP_008440137.1|  PREDICTED: cytochrome P450 86B1-like               304   9e-93    
ref|XP_009113346.1|  PREDICTED: cytochrome P450 86B1-like               306   9e-93    
ref|XP_010242506.1|  PREDICTED: cytochrome P450 86B1-like               306   1e-92    
ref|XP_010510801.1|  PREDICTED: cytochrome P450 86B1-like               305   1e-92    
gb|ACG36565.1|  cytochrome P450 CYP96D3                                 305   2e-92    
ref|XP_011100144.1|  PREDICTED: cytochrome P450 86B1-like               305   3e-92    
ref|XP_010527154.1|  PREDICTED: cytochrome P450 86B1-like               303   3e-92    
ref|NP_001141058.1|  putative cytochrome P450 superfamily protein       305   3e-92    
gb|KEH40921.1|  cytochrome P450 family protein                          306   3e-92    
ref|XP_003558844.1|  PREDICTED: cytochrome P450 86B1-like               305   3e-92    
ref|XP_009113348.1|  PREDICTED: cytochrome P450 86B1-like               304   4e-92    
gb|KHN19669.1|  Cytochrome P450 86B1                                    302   8e-92    
dbj|BAK06179.1|  predicted protein                                      304   9e-92    
ref|XP_002523775.1|  cytochrome P450, putative                          305   1e-91    
ref|XP_011006771.1|  PREDICTED: cytochrome P450 86B1-like               304   2e-91    
gb|KHN32292.1|  Cytochrome P450 86B1                                    302   2e-91    
ref|XP_002310074.1|  hypothetical protein POPTR_0007s07700g             303   3e-91    
ref|XP_010242505.1|  PREDICTED: cytochrome P450 86B1-like               302   3e-91    
ref|XP_009397609.1|  PREDICTED: cytochrome P450 86B1-like               303   3e-91    
ref|XP_002322212.1|  hypothetical protein POPTR_0015s09850g             298   7e-91    
gb|KGN48429.1|  hypothetical protein Csa_6G487010                       299   8e-91    
ref|XP_002306380.1|  hypothetical protein POPTR_0005s09500g             302   1e-90    
gb|KFK22185.1|  hypothetical protein AALP_AAs38949U000100               311   1e-90    
ref|XP_010418988.1|  PREDICTED: cytochrome P450 86B1-like               300   2e-90    
ref|XP_011022041.1|  PREDICTED: cytochrome P450 86B1                    301   2e-90    
ref|XP_007043287.1|  Cytochrome P450, family 86, subfamily B, pol...    301   2e-90    
ref|XP_004513611.1|  PREDICTED: cytochrome P450 86B1-like               297   3e-90    
gb|KEH40826.1|  cytochrome P450 family protein                          298   5e-90    
gb|AAS58486.1|  phytochrome P450-like protein                           298   8e-90    
emb|CAB41474.1|  cytochrome P450                                        298   8e-90    
ref|XP_010554710.1|  PREDICTED: cytochrome P450 86B1-like               296   1e-89    
ref|XP_007131626.1|  hypothetical protein PHAVU_011G029000g             299   2e-89    
ref|XP_009389165.1|  PREDICTED: cytochrome P450 86B1-like               298   3e-89    
ref|XP_010513571.1|  PREDICTED: cytochrome P450 86B1-like               296   3e-89    
ref|XP_006301804.1|  hypothetical protein CARUB_v10022270mg             296   4e-89    
gb|ABF93894.1|  Cytochrome P450 family protein, expressed               296   4e-89    
ref|XP_010676593.1|  PREDICTED: cytochrome P450 86B1-like               297   5e-89    
ref|XP_006437581.1|  hypothetical protein CICLE_v10031117mg             298   5e-89    
ref|XP_006412935.1|  hypothetical protein EUTSA_v10027133mg             295   6e-89    
ref|XP_002468540.1|  hypothetical protein SORBIDRAFT_01g047610          296   6e-89    
ref|XP_009794122.1|  PREDICTED: cytochrome P450 86B1-like               297   6e-89    
gb|EAY88477.1|  hypothetical protein OsI_09948                          296   7e-89    
ref|XP_010274134.1|  PREDICTED: cytochrome P450 86B1-like               296   7e-89    
ref|XP_006379954.1|  cytochrome P450 family protein                     295   1e-88    
gb|KFK43173.1|  hypothetical protein AALP_AA1G089200                    301   2e-88    
dbj|BAJ87689.1|  predicted protein                                      296   2e-88    
ref|XP_006484536.1|  PREDICTED: cytochrome P450 86B1-like               296   2e-88    
ref|XP_010905515.1|  PREDICTED: cytochrome P450 86B1-like               295   3e-88    
ref|XP_002439386.1|  hypothetical protein SORBIDRAFT_09g005590          295   3e-88    
ref|XP_010241540.1|  PREDICTED: cytochrome P450 86B1-like               293   7e-88    
ref|XP_010473758.1|  PREDICTED: cytochrome P450 86B1-like               291   8e-88    
emb|CAN75428.1|  hypothetical protein VITISV_003302                     294   8e-88    
gb|KDO82148.1|  hypothetical protein CISIN_1g041858mg                   293   9e-88    
gb|KDO52746.1|  hypothetical protein CISIN_1g008922mg                   294   1e-87    
ref|XP_002277006.1|  PREDICTED: cytochrome P450 86B1                    293   1e-87    
emb|CDP11007.1|  unnamed protein product                                293   2e-87    
gb|KHG09498.1|  Cytochrome P450 protein                                 293   3e-87    
ref|XP_004982787.1|  PREDICTED: cytochrome P450 86B1-like               293   3e-87    
gb|EMT27434.1|  Cytochrome P450 86A2                                    291   3e-87    
ref|XP_003556602.2|  PREDICTED: cytochrome P450 86B1-like               292   6e-87    
ref|XP_006438203.1|  hypothetical protein CICLE_v10033706mg             291   6e-87    
gb|KHM99063.1|  Cytochrome P450 86B1                                    291   7e-87    
gb|AFW68533.1|  putative cytochrome P450 superfamily protein            291   1e-86    
gb|EYU35580.1|  hypothetical protein MIMGU_mgv1a004717mg                290   1e-86    
ref|XP_006397210.1|  hypothetical protein EUTSA_v10029295mg             289   2e-86    
emb|CDX90338.1|  BnaA08g16460D                                          289   2e-86    
ref|XP_011034022.1|  PREDICTED: cytochrome P450 86B1-like               290   3e-86    



>ref|XP_009603547.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=512

 Score =   504 bits (1297),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 254/491 (52%), Positives = 349/491 (71%), Gaps = 18/491 (4%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W KSS     PTNWP+ GMLP L++NAHR+HDFAT  L + GGTFE  GP   N +ML+T
Sbjct  29    WCKSS----TPTNWPLFGMLPGLIRNAHRIHDFATSILMETGGTFEFYGPVLTNLNMLVT  84

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDPANI +I +KNF+NYPKG  FQK+F+I G+GI N DSELW++HRKTT +LM+H  F+ 
Sbjct  85    SDPANIHHILSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRKTTMSLMSHAKFQT  144

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
              LER +  T+E GL P+LD +A++GT FDLQ+IF+R +FD   ++ LD +P SL +  P 
Sbjct  145   LLERNMWDTIEKGLRPILDTFAEQGTPFDLQDIFQRFTFDAISKLLLDHDPKSLSIGLPH  204

Query  1005  DHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL  826
               P  KA  D V+A+LY+H+LP+  WKLQ+W   I +EKK  +AW+ FD+F+YP +S + 
Sbjct  205   V-PCEKAFNDIVDALLYRHVLPKGCWKLQRW-LQIGKEKKLIQAWEAFDQFLYPCISRQQ  262

Query  825   NQLHDQDEDDSQNFSMLTSHMKAYK--------GKPMQFLRDTFVsltisggggttssal  670
              +L ++   D ++F + T+++KAY         G   +FLRDTF+   +  G  TTS+A+
Sbjct  263   EELMNKIIKD-EDFDLFTAYIKAYNLWKNGDNTGNVQEFLRDTFL-NLMLAGRDTTSAAI  320

Query  669   TWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPP  490
             TW FWLLA+NPLVE K+  EIL+       +  + F +EE   LVYLH A CE+LRLFP 
Sbjct  321   TWFFWLLAENPLVETKIREEILEQLQLKEDENLKYFNIEETRKLVYLHCALCETLRLFPS  380

Query  489   IPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGI  310
             + + HK+SLE D LPSGH+V P TRI+ SFY+MGRME IWG+DC+EFKPERW+S+  G I
Sbjct  381   VSLEHKVSLEFDILPSGHRVNPNTRIVLSFYTMGRMENIWGKDCLEFKPERWISE-QGKI  439

Query  309   KHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEV  130
             KH PS KFP F+ GPRTC+G++M  +  K++AA+II+ YH +LME  T + PS ++++++
Sbjct  440   KHEPSFKFPAFNAGPRTCLGKEMALIQMKMIAATIIYSYHIQLMEAQT-ISPSASIIVQM  498

Query  129   KHGVKVKLTKR  97
             KHG+KV++ KR
Sbjct  499   KHGLKVRIVKR  509



>ref|XP_009802093.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=519

 Score =   495 bits (1275),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 254/491 (52%), Positives = 346/491 (70%), Gaps = 18/491 (4%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W KSS     PTNWP++GMLP L++NAHR+HDFAT  L + GGTFE  GP   N +ML T
Sbjct  29    WCKSSV----PTNWPLVGMLPGLIRNAHRVHDFATSILVETGGTFEFYGPVLTNSNMLAT  84

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDPANI ++ +KNF+NYPKG  FQK+F+I G+GI N DSELW++HRKTT +LM+H  F+ 
Sbjct  85    SDPANIHHVLSKNFSNYPKGLEFQKIFDILGNGIFNVDSELWEIHRKTTMSLMSHAKFQT  144

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
              LER +  T E GL P+LD +A++GT FDLQ+IF+R +FD   ++ LD +P SL +  P 
Sbjct  145   LLERNMWDTFEKGLQPILDTFAEQGTPFDLQDIFQRFTFDAISKLLLDHDPKSLSIGLPH  204

Query  1005  DHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL  826
               P  KA  DAV+A+LY+HILPE  WKLQ+W   I +EKK  +AW+ FD+F+YP +S K 
Sbjct  205   V-PCEKAFNDAVDALLYRHILPEGCWKLQRW-LQIGKEKKLIQAWEAFDRFLYPCISRKQ  262

Query  825   NQLHDQDEDDSQNFSMLTSHMKAYK--------GKPMQFLRDTFVsltisggggttssal  670
              +  ++   D ++F + T+++KAY         G   +FLRDTF+   +  G  TTS+A+
Sbjct  263   EEWMNKIIKD-EDFDLFTAYVKAYNLWKNGDNTGNVQEFLRDTFL-NLMFAGRDTTSAAI  320

Query  669   TWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPP  490
             TW FWLLA+NPLVE K+  EI +          + F +EE   L+YLHAA CE+LRLFP 
Sbjct  321   TWFFWLLAENPLVETKIREEIQQKLQLKEDGNLKLFNIEETRKLIYLHAALCETLRLFPS  380

Query  489   IPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGI  310
             + + HK+ LE+D LPSGH+V P TRI+ SFY+MGRME IWG+DC+EFKPERW+S+  G I
Sbjct  381   VSLEHKVPLESDILPSGHRVNPNTRIVLSFYTMGRMETIWGKDCLEFKPERWISE-KGKI  439

Query  309   KHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEV  130
             KH PS KFP F+ GPRTC+G++M F+  K++ A+II  YH +L+E  T + PS ++++++
Sbjct  440   KHEPSFKFPAFNAGPRTCLGKEMAFIQMKMMVATIIHSYHIQLVEGQT-ISPSASIIVQM  498

Query  129   KHGVKVKLTKR  97
             KHG+KV+L KR
Sbjct  499   KHGLKVRLFKR  509



>ref|XP_009759324.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=509

 Score =   492 bits (1267),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 254/496 (51%), Positives = 347/496 (70%), Gaps = 22/496 (4%)
 Frame = -3

Query  1545  WKKSSRRS--MDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             W   +RRS   +PTNWP++GMLP L+QNAHR+HDF T+ L + G  FE  GPA  N +ML
Sbjct  20    WLFINRRSKTSEPTNWPLVGMLPGLIQNAHRIHDFFTDILLETGNNFEFYGPALGNMNML  79

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
              TSDPANI +I ++NF+NYPKG  F+K+FEI G+GI N DSELW++HRK T +LM+H  F
Sbjct  80    FTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRKITMSLMSHAKF  139

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
             +  L++ V  TVE GL PVLD +A+RGT FDLQ+IF+R +FD   ++ LD +P SLF++ 
Sbjct  140   QILLKKNVWNTVEKGLVPVLDAFAERGTTFDLQDIFQRFTFDNISKLLLDCDPKSLFIDL  199

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   P  K   D V+A+LY+H++PE +W+LQK    I +EK  ++AW  FD+FIYP +S+
Sbjct  200   PH-LPCEKGFNDMVDALLYRHVVPESYWQLQKK-LNIGKEKNLSQAWVAFDQFIYPAISQ  257

Query  831   KLNQLHDQDEDDSQNFSMLTSHMKAY--------KGKPMQFLRDTFVsltisggggttss  676
             K  +L ++   D ++F + + ++KAY         G   QFLRDTF+   +  G  TTS+
Sbjct  258   KQEKLLNKTNKD-EDFDLFSDYIKAYNQWTIGDTSGNVQQFLRDTFL-NLMFAGRDTTST  315

Query  675   alTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTET---FKVEECCDLVYLHAAFCESL  505
             ALTW FWLL KNPLVE K+  EI   + Q H K+ E    F +EE   LVYLH A CE+L
Sbjct  316   ALTWFFWLLTKNPLVETKIKEEI---EQQFHLKKGENLKFFDIEESRKLVYLHGALCEAL  372

Query  504   RLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD  325
             RLFPP+ + HK  LE D LPSGH+V P  +IL SFY+MGRM+ +WG+DC+EFKPERW+S+
Sbjct  373   RLFPPVSIEHKAPLELDVLPSGHRVTPDMKILISFYTMGRMQTLWGKDCLEFKPERWISE  432

Query  324   CGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDT  145
               GGIKHVPS +FP F+ GPRTCIG+ M F+  K+VAA+I++ YH +L+E    + P+ T
Sbjct  433   -RGGIKHVPSYQFPAFNAGPRTCIGKDMGFIQMKMVAATIVYNYHIQLVEGQA-ISPTAT  490

Query  144   LVLEVKHGVKVKLTKR  97
             +V+ + +G+KV++ KR
Sbjct  491   VVIRMTNGLKVRVVKR  506



>ref|XP_006351378.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=517

 Score =   491 bits (1265),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 253/495 (51%), Positives = 344/495 (69%), Gaps = 21/495 (4%)
 Frame = -3

Query  1551  NIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             N W KSS     PTNWP++GMLP L++N HR+H+FAT+ L +  GTFE  GP  AN +ML
Sbjct  27    NRWWKSSSV---PTNWPLVGMLPGLIRNVHRVHEFATDVLVETKGTFEFHGPVLANLNML  83

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
              TSDPANI +I +KNF+NYPKG  F+K F+I G+GI N D ELW++HRKTT +LM+H  F
Sbjct  84    ATSDPANIHHILSKNFSNYPKGVEFRKFFDILGNGIFNVDYELWEIHRKTTMSLMSHAKF  143

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
             +  LER +   +E+GL P+LD +A++ T FDLQ+IF+R +FD   ++ LD +P SL ++ 
Sbjct  144   QTFLERNLWDIIENGLRPILDTFAEQDTLFDLQDIFQRFTFDAISKLLLDYDPKSLSIDL  203

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   P  KA  D V+A++Y+HILPE  WKLQKW   I +EK+  +AW+ FD+F+YP +S 
Sbjct  204   PHV-PCEKAFNDVVDALMYRHILPEGCWKLQKW-LRIGKEKQLIQAWEAFDQFLYPCISR  261

Query  831   KLNQLHDQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttssa  673
             K  +L  +     + F+ L  ++K Y        G    FLRDTF+   +  G  TTS+A
Sbjct  262   KQEELMQKSTIKDEEFTFLNEYIKMYNQWKDGDLGTLQTFLRDTFL-NLMLAGRDTTSAA  320

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTET---FKVEECCDLVYLHAAFCESLR  502
             LTW FWLLAKNPLVE ++  EI   + Q H K+ E    F +EE   LVYLH A CE+LR
Sbjct  321   LTWFFWLLAKNPLVEKRIREEI---QQQLHLKEDENLKCFNIEETKRLVYLHGALCETLR  377

Query  501   LFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDC  322
              FP + + HK+ LE D LPSGH V P TR++ SFY+MGRME+IWG+DC+EFKPERW+S+ 
Sbjct  378   FFPSVAIEHKLPLEFDILPSGHHVSPNTRVVLSFYTMGRMESIWGKDCLEFKPERWISE-  436

Query  321   GGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTL  142
              GGIKH PS KFP F+ GPRTCIG++M F+  KIVAA+II+ YH +L E   +++P+ ++
Sbjct  437   RGGIKHEPSYKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYNYHIQLGEDQ-IILPNSSV  495

Query  141   VLEVKHGVKVKLTKR  97
             ++++KHG+KV+L KR
Sbjct  496   IIQMKHGLKVRLVKR  510



>ref|XP_009626183.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=534

 Score =   491 bits (1263),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 248/498 (50%), Positives = 342/498 (69%), Gaps = 21/498 (4%)
 Frame = -3

Query  1533  SRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             S++ + PTNWP+IGMLP LL+N HRLH+F TE L +N G FE KGP F+N +ML +SDPA
Sbjct  36    SKKPVTPTNWPLIGMLPGLLRNTHRLHEFVTEILIENEGIFEFKGPVFSNLNMLFSSDPA  95

Query  1353  NIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLER  1174
             N+ ++ +KNFNNYPKG+ ++KMF+I GDGI N D+ELW++ RK T ++M+H  F   LER
Sbjct  96    NLHHMLSKNFNNYPKGSEYKKMFDIMGDGIFNVDNELWEVQRKITISIMSHPKFLSCLER  155

Query  1173  TVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPF  994
              V   V  GL PVLD++A++G+ FDLQ+IF+R +FD   ++ LD +PGSL ++ P+D  F
Sbjct  156   NVWDKVVKGLQPVLDNFAKQGSCFDLQDIFQRFTFDTISKLLLDHDPGSLSIDLPTDSLF  215

Query  993   RKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH  814
             + A  DA +AILY+HI+PE  WKLQKW   + +EKK ++AW  FD+ IY  +S K  ++ 
Sbjct  216   KNAFQDAGDAILYRHIMPESCWKLQKW-LRVGKEKKLSQAWKAFDQLIYSCISRKQEEML  274

Query  813   DQD---EDDSQNFSMLTSHMKAYKGKPM--------------QFLRDTFVsltisggggt  685
              +    E++ ++F  LT+ MKAY    M              +FLRDT     +  G  T
Sbjct  275   RRSGFIEEEDEDFDFLTACMKAYNSLFMKNIVDTDLENNNAKKFLRDT-CMNLMFAGKDT  333

Query  684   tssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESL  505
             TSSALTW FWLLAKNP V+  + +EI ++      +    F V+E  +LVYLH A CESL
Sbjct  334   TSSALTWFFWLLAKNPSVQTTIRDEIQEILQLKEDENLRFFNVQESRELVYLHGALCESL  393

Query  504   RLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD  325
             RLFPPIP+ HK++ ETD LPSGH + P  R++ SFY+MGRME +WG DC++FKPERW+S 
Sbjct  394   RLFPPIPLEHKIATETDILPSGHHLCPGKRVILSFYTMGRMETLWGNDCLDFKPERWISG  453

Query  324   CGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDT  145
               G IKH PS KFP+F+ GPRTC+G+ + F   K+VAA+IIF Y  +L+E   L  PS +
Sbjct  454   GRGKIKHEPSFKFPVFNAGPRTCLGKDISFFQMKMVAATIIFNYQVQLVEGQHLDFPSAS  513

Query  144   LVLEV--KHGVKVKLTKR  97
             ++L++  KHG+KV+L +R
Sbjct  514   ILLQLKMKHGLKVRLIQR  531



>ref|XP_006351379.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=501

 Score =   487 bits (1254),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 247/492 (50%), Positives = 342/492 (70%), Gaps = 16/492 (3%)
 Frame = -3

Query  1551  NIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             N W KSS     PTNWP++GMLP L++NAHR+H+F T+ L +  GTFE  GP  AN +ML
Sbjct  13    NRWWKSSSV---PTNWPLVGMLPGLIRNAHRVHEFVTDALIETKGTFEFHGPVLANLNML  69

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             LTSDPANI +I +KNF+NYPKG  F+K+F++ G+G+ N D ELW++HRKTT +LMNH  F
Sbjct  70    LTSDPANIHHILSKNFSNYPKGVEFRKIFDMLGNGMFNVDYELWEMHRKTTMSLMNHAKF  129

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
             +  LER +   +E+GL PVLD +A++GT FDLQ+IF+R +FD   ++ LD +P SL +  
Sbjct  130   QTLLERNMWSIIENGLQPVLDGFAEQGTLFDLQDIFQRFTFDAISKLLLDHDPKSLSIGL  189

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   P   A  D+++A++Y+H LPE  WKLQKW   I +EKK  +AW+  D+F+YP +S 
Sbjct  190   PHV-PCENAFNDSLDALMYRHFLPESCWKLQKW-LRIGKEKKLIQAWEAIDQFLYPCISR  247

Query  831   KLNQLHDQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttssa  673
             K  +L  +       F+ L +++K Y        G    FLRDTF+   +  G  TTS+A
Sbjct  248   KQEELMHESTAKDDEFTFLNAYIKMYNQWKDGDLGTLQTFLRDTFL-NLMLAGRDTTSAA  306

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFP  493
             LTW FWLLA+NPLVE K+  EI +       +  + F++EE   LVYLH A CE+LR FP
Sbjct  307   LTWFFWLLAENPLVEKKIREEIQQQFNLKEGENLKFFEIEEARKLVYLHGALCETLRFFP  366

Query  492   PIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGG  313
              + + HK+ LE D LPSGH V P TR++ SFY+MGRME+IWG+DC+EFKPERW+S+  GG
Sbjct  367   SVAIEHKLPLEFDILPSGHHVSPNTRVVLSFYTMGRMESIWGKDCLEFKPERWISE-RGG  425

Query  312   IKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLE  133
             IKH PS KFP F+ GPRTCIG++M F+  KIVAA+II+ YH +L +   +++P+ +++++
Sbjct  426   IKHEPSYKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYNYHIKLED--QIILPNSSVIIQ  483

Query  132   VKHGVKVKLTKR  97
             +KHG+KV+L KR
Sbjct  484   MKHGLKVRLVKR  495



>ref|XP_009623637.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=511

 Score =   485 bits (1248),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 249/496 (50%), Positives = 343/496 (69%), Gaps = 21/496 (4%)
 Frame = -3

Query  1545  WKKSSRRSMD--PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             W   +RRS    PT+WP+ GMLP L+QNAHR+H+F T+ L + G  FE +GP  +N +ML
Sbjct  20    WFLINRRSKSSAPTDWPLAGMLPGLIQNAHRIHEFFTDILLETGNNFEFRGPVISNMNML  79

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
              TSDPANI +I ++NF+NYPKG  F+K+FEI G+GI N DSELW++HRK T +LM+H  F
Sbjct  80    FTSDPANIHHILSRNFSNYPKGPEFRKIFEILGNGIFNVDSELWEIHRKITMSLMSHAKF  139

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
             +  L++ V  TVE GL PVLD +A+RGT FDLQ+IF+R +FD   ++ LD +P SL ++ 
Sbjct  140   QILLKKNVWDTVEKGLVPVLDAFAERGTTFDLQDIFQRFTFDNISKLLLDHDPKSLSIDL  199

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   P  K   D V+A+LY+H+LP+ +W+LQK    I +EK  ++AW+ FD+FIYP +S+
Sbjct  200   PH-LPCEKGFNDMVDALLYRHVLPDSYWQLQK-KLNIGKEKNLSQAWEAFDQFIYPAISQ  257

Query  831   KLNQLHDQDEDDSQNFSMLTSHMKAY--------KGKPMQFLRDTFVsltisggggttss  676
             K  +L     +  ++F +   ++KAY         G   +FLRDTF+   +  G  TTS+
Sbjct  258   KQEKLLLNKTNKDEDFDLFADYIKAYNQWTNGDTSGNVQEFLRDTFL-NLMFAGRDTTST  316

Query  675   alTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTET---FKVEECCDLVYLHAAFCESL  505
              LTW FWLLAKNPLVE K+  EI   + Q H K+ E    F +EE   LVYLH A CE+L
Sbjct  317   TLTWFFWLLAKNPLVETKIREEI---EQQLHLKKDENLKFFDIEESRKLVYLHGALCEAL  373

Query  504   RLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD  325
             RLFPP+ + HK  LE D LPSGH+V P  +IL SFY+MGR++ IWG+DC+EFKPERW+S+
Sbjct  374   RLFPPVSLEHKSPLELDVLPSGHRVTPDMKILISFYTMGRLQTIWGKDCLEFKPERWISE  433

Query  324   CGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDT  145
                GIKHVPS +FP F+ GPRTCIG+ M F+  K+VAA+II+ YH +L+E  T + P+ T
Sbjct  434   -RRGIKHVPSYQFPAFNAGPRTCIGKDMGFIQMKMVAATIIYNYHIQLVEGQT-ISPTAT  491

Query  144   LVLEVKHGVKVKLTKR  97
             +V+ + +G+KV++ KR
Sbjct  492   VVIRMTNGLKVRVVKR  507



>ref|XP_004249313.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=515

 Score =   484 bits (1247),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 245/492 (50%), Positives = 343/492 (70%), Gaps = 16/492 (3%)
 Frame = -3

Query  1551  NIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             NIW KSS     PTNWP++GMLP L+QN HR+H+F T+ L ++ GTFE  GP  AN +ML
Sbjct  27    NIWWKSSSA---PTNWPLVGMLPGLIQNTHRVHEFVTDALVESKGTFEFHGPVLANLNML  83

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             LTSDPANI +I +KNF+NYPKG  F+K+F++ G+GI N D ELW++HRKTT +LMNH  F
Sbjct  84    LTSDPANIHHILSKNFSNYPKGVEFRKIFDMIGNGIFNVDYELWEMHRKTTMSLMNHPKF  143

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
             +  LER +   +E+GL+P+LD +A++GT FDLQ+IF+R +FD   ++ LD +P SL +  
Sbjct  144   QTMLERNMWSIIENGLWPILDGFAEQGTLFDLQDIFQRFTFDAITKLLLDHDPKSLSIGL  203

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   P   A  D+++A +Y+H LPE  WKLQKW   I +EKK  +AW+  D+FIYP +S 
Sbjct  204   PHV-PCENAFNDSLDAFMYRHFLPESCWKLQKW-LRIGKEKKLIQAWEAIDQFIYPCISR  261

Query  831   KLNQLHDQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttssa  673
             K  +L        + F  L ++++ Y        G    FLRDTF+   +  G  TTS+A
Sbjct  262   KQEELMHTSRAKDEEFIFLNAYIRMYNQWKDGDLGTLQTFLRDTFL-SLLFAGRDTTSAA  320

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFP  493
             LTW FWLLAKNP VE ++  EI +       +  + F++EE   LVYLH A CE+LRLFP
Sbjct  321   LTWFFWLLAKNPSVEKRIREEIQQQLNLKEGENLKFFEIEEARKLVYLHGALCETLRLFP  380

Query  492   PIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGG  313
              + + HK+ LE D LPSGH+V P TR++ SFY+MGRME+IWG+DC+EFKPERW+S+  GG
Sbjct  381   SVAIEHKLPLEFDLLPSGHRVSPNTRVVLSFYTMGRMESIWGKDCLEFKPERWISE-RGG  439

Query  312   IKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLE  133
             IKH PS KFP F+ GPRTCIG++M F+  KIVAA+II+ Y+ +L +   +++P+ +++++
Sbjct  440   IKHEPSFKFPAFNAGPRTCIGKEMAFIQMKIVAATIIYNYYIKLED--QIILPNSSVIIQ  497

Query  132   VKHGVKVKLTKR  97
             +K+G+KV++ KR
Sbjct  498   MKNGLKVRVFKR  509



>ref|XP_009622763.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   481 bits (1238),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 245/489 (50%), Positives = 341/489 (70%), Gaps = 18/489 (4%)
 Frame = -3

Query  1533  SRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             ++ S +PTNWP I MLPA++ N HR+H++ TE L   GGT+E +GP FAN DM +T D A
Sbjct  29    TKTSSEPTNWPFIRMLPAVIMNLHRIHEYMTEVLIDVGGTYEFEGPMFANLDMFVTCDSA  88

Query  1353  NIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLER  1174
             NI +I +KNF+NYPKG  F+K+F+I G+GI N D ELW++HRKTT ++M+H  F+  LER
Sbjct  89    NIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIHRKTTLSIMSHAKFQTLLER  148

Query  1173  TVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPF  994
              +  TVE GL P+LD + ++    DLQ++ +R +FD   ++ LD +P SL ++ P   P+
Sbjct  149   NLWDTVEKGLRPILDAFTEQDKTLDLQDVLQRFTFDSITKLLLDHDPRSLSIDLPY-LPY  207

Query  993   RKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH  814
              KA  DA++A+L++HI PE  WKLQKW   I +EKK  +AW++FD+FIYP +S+KL +L 
Sbjct  208   EKAFGDALDALLHRHITPENCWKLQKW-LQIGKEKKLTQAWESFDQFIYPCISQKLEELM  266

Query  813   DQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttssalTWLFW  655
              +   D ++F+ LT++++ Y        G   +FLRDTF+   +  G  TT +ALTW FW
Sbjct  267   KKTIKDEESFTFLTAYIRMYNLRNKGDLGTLQKFLRDTFL-NLMFAGRDTTGAALTWFFW  325

Query  654   LLAKNPLVEAKLFNEILKVKPQNHAKQTETFKV---EECCDLVYLHAAFCESLRLFPPIP  484
             LLAKNPLVE K+  EI   + Q H K+ E  K    EE   LVYLHAAFCE+LR FP + 
Sbjct  326   LLAKNPLVETKIREEI---QQQLHLKKDENLKFFNKEETRKLVYLHAAFCETLRFFPSVS  382

Query  483   MNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKH  304
             + HK+ LE D LPSGH+V PKTR++  FYSMGRME IWG+DC+EFKPERW+S+  GGIKH
Sbjct  383   LEHKVPLEHDILPSGHRVTPKTRMIIPFYSMGRMETIWGKDCLEFKPERWISE-RGGIKH  441

Query  303   VPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKH  124
              PS KFP F+ GPRTCIG++M F+  KIVAA I++ Y  +L+E      P+ ++++++KH
Sbjct  442   EPSFKFPAFNAGPRTCIGKEMAFVQMKIVAAIILYNYDIQLVEAQN-SSPTTSIIMQMKH  500

Query  123   GVKVKLTKR  97
             G+ V++ KR
Sbjct  501   GLMVRVVKR  509



>ref|XP_009631751.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=510

 Score =   480 bits (1235),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 245/489 (50%), Positives = 340/489 (70%), Gaps = 18/489 (4%)
 Frame = -3

Query  1533  SRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             ++ S +PTNWP I MLPA++ N HR+H + TE L   GGT+E +GP FAN DM +T D A
Sbjct  29    TKTSSEPTNWPFIRMLPAVIMNLHRIHKYMTEVLIDVGGTYEFEGPMFANLDMFVTCDSA  88

Query  1353  NIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLER  1174
             NI +I +KNF+NYPKG  F+K+F+I G+GI N D ELW++HRKTT ++M+H  F+  LER
Sbjct  89    NIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWEIHRKTTLSIMSHAKFQTLLER  148

Query  1173  TVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPF  994
              +  TVE GL P+LD + ++    DLQ++ +R +FD   ++ LD +P SL ++ P   P+
Sbjct  149   NLWDTVEKGLRPILDAFTEQDKTLDLQDVLQRFTFDSITKLLLDHDPRSLSIDLPY-LPY  207

Query  993   RKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH  814
              KA  DA++A+L++HI PE  WKLQKW   I +EKK  +AW++FD+FIYP +S+KL +L 
Sbjct  208   EKAFGDALDALLHRHITPENCWKLQKW-LQIGKEKKLTQAWESFDQFIYPCISQKLEELM  266

Query  813   DQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttssalTWLFW  655
              +   D ++F+ LT++++ Y        G   +FLRDTF+   +  G  TT +ALTW FW
Sbjct  267   KKTIKDEESFTFLTAYIRMYNLRNKGDLGTLQKFLRDTFL-NLMFAGRDTTGAALTWFFW  325

Query  654   LLAKNPLVEAKLFNEILKVKPQNHAKQTETFKV---EECCDLVYLHAAFCESLRLFPPIP  484
             LLAKNPLVE K+  EI   + Q H K+ E  K    EE   LVYLHAAFCE+LR FP + 
Sbjct  326   LLAKNPLVETKIREEI---QQQLHLKKDENLKFFNKEETRKLVYLHAAFCETLRFFPSVS  382

Query  483   MNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKH  304
             + HK+ LE D LPSGH+V PKTR++  FYSMGRME IWG+DC+EFKPERW+S+  GGIKH
Sbjct  383   LEHKVPLEHDILPSGHRVTPKTRMIIPFYSMGRMETIWGKDCLEFKPERWISE-RGGIKH  441

Query  303   VPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKH  124
              PS KFP F+ GPRTCIG++M F+  KIVAA I++ Y  +L+E      P+ ++++++KH
Sbjct  442   EPSFKFPAFNAGPRTCIGKEMAFVQMKIVAAIILYNYDIQLVEAQN-SSPTTSIIMQMKH  500

Query  123   GVKVKLTKR  97
             G+ V++ KR
Sbjct  501   GLMVRVVKR  509



>ref|XP_004249316.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=513

 Score =   478 bits (1229),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 248/499 (50%), Positives = 345/499 (69%), Gaps = 26/499 (5%)
 Frame = -3

Query  1554  KNIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDM  1375
             KN W KSS+    PTNWP+ GMLP L+ NAHR+H F T+ L +    FE +GP FAN DM
Sbjct  25    KNKWAKSSK----PTNWPIFGMLPGLVHNAHRIHSFFTDILLETTSNFEFRGPIFANMDM  80

Query  1374  LLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIG  1195
             L TSDPANI +I ++NF+NYPKG  F+++F+I G+GI N DSELW++HRKTT +LMNH  
Sbjct  81    LFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSELWEIHRKTTMSLMNHSK  140

Query  1194  FRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVE  1015
             F+  L+R V  T++ G+ P LD  A++ T  DLQ+IF+R SFD   ++ LD +P SL V 
Sbjct  141   FQTLLQRNVWDTIDKGIVPTLDILAKQDTPVDLQDIFQRFSFDTISKLLLDHDPKSLSVN  200

Query  1014  PPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS  835
              P   P  KA  D V+A+LY+H+LPER+WKLQKW   I +EK   +AW++FD+FIYP +S
Sbjct  201   LPH-VPCEKAFNDMVDALLYRHVLPERYWKLQKW-LRIGKEKNLMKAWESFDQFIYPAIS  258

Query  834   EKLNQLHDQDEDDSQNFSMLTSHMKAYK----------GKPMQFLRDTFVsltisggggt  685
             ++  +L + +  D  +F + + ++KAYK          G   +FLRDTF+   +  G  T
Sbjct  259   KRQEKLINNEIKDD-DFDLFSDYVKAYKEWTNEDDKNLGSVEKFLRDTFL-NLMFAGRDT  316

Query  684   tssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTET---FKVEECCDLVYLHAAFC  514
             TSS LTW FWLL+KNPLV  K+  EI   + Q H K+ E+   F ++E   LVYLH A C
Sbjct  317   TSSNLTWFFWLLSKNPLVVKKIREEI---QQQLHLKEDESLKFFNIQESRKLVYLHGALC  373

Query  513   ESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERW  334
             E+LRLFPP+ + HK  L+ D LPSGH+V P T+IL SFY+MGRME++WG+DC+EF+PERW
Sbjct  374   EALRLFPPVSIEHKSPLQLDVLPSGHRVSPNTKILISFYTMGRMESLWGKDCLEFRPERW  433

Query  333   LSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVP  154
             +++  GG+KH PS KFP F  GPRTC+G++M F+  K+VAA++I  Y+ +L+E  T + P
Sbjct  434   ITE-RGGLKHEPSYKFPAFLAGPRTCVGKEMAFIQMKMVAATMIHNYNIQLVEAQT-ISP  491

Query  153   SDTLVLEVKHGVKVKLTKR  97
             + T+V+ + +G+ VK+ K+
Sbjct  492   TATVVIRMTNGLMVKVGKK  510



>ref|XP_009589080.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   473 bits (1216),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 249/496 (50%), Positives = 335/496 (68%), Gaps = 23/496 (5%)
 Frame = -3

Query  1554  KNIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDM  1375
             +N W K+S     PT WP +GMLPA++ N HR+HD+ T+ L + GGTFE KGP FA  DM
Sbjct  25    RNRWTKTSA----PTYWPFVGMLPAIILNFHRIHDYITKVLIETGGTFEFKGPIFAYMDM  80

Query  1374  LLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIG  1195
             L+T DPANI +I +KNF+NYPKG  F+K+F+I G+GI N DSELW+LHRKTT ++M+H  
Sbjct  81    LITCDPANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDSELWELHRKTTMSIMSHAK  140

Query  1194  FRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVE  1015
             F+  LER +   +E    P+LD +A++G   DLQ+I +RLSFD   ++ LD +P SL ++
Sbjct  141   FQTLLERNMWNIIEKRFRPILDAFAEQGNSLDLQDILQRLSFDSITKLLLDHDPRSLSID  200

Query  1014  PPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS  835
              P   P  KA  DA++A+L++HI+PE  WKLQKW   I +EKK  +AW+ FD+F+YP +S
Sbjct  201   FPHV-PCEKAFTDAIDALLFRHIIPESCWKLQKW-LQIGKEKKLTQAWEAFDEFLYPCIS  258

Query  834   EKLNQLHDQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttss  676
             +K  +L  +   D + F+ L +++K Y        G    FLRDTF+   +  G  +TSS
Sbjct  259   QKQEELMKKTIKDEE-FTFLAAYIKMYNSWNKGDLGTLQNFLRDTFL-NLMLAGRDSTSS  316

Query  675   alTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKV---EECCDLVYLHAAFCESL  505
             A+TW FW LAKNPLVE K+  EI   + Q H K+ E  K    EE   LVYLH A CE+L
Sbjct  317   AITWFFWFLAKNPLVETKIREEI---QQQLHLKKEENLKFFNNEEMLKLVYLHGALCETL  373

Query  504   RLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD  325
             R FP + + HK+ L  D LPSGH V PKTR++  FYS GRME IWG+D +EFKPERW+S+
Sbjct  374   RFFPSLSLEHKVPLAHDILPSGHHVTPKTRLIIPFYSTGRMETIWGKDYLEFKPERWISE  433

Query  324   CGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDT  145
               GGIKH PS KFP F+ GPRTCIG+ M F   KIVAA+II  YH +L+E    + P+ +
Sbjct  434   -RGGIKHEPSFKFPAFNAGPRTCIGKNMAFTHLKIVAATIIHNYHIQLVEAQN-ISPTTS  491

Query  144   LVLEVKHGVKVKLTKR  97
             +++ VKHG+KV++ KR
Sbjct  492   IIMLVKHGLKVRVVKR  507



>ref|XP_011095704.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=503

 Score =   472 bits (1214),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 246/495 (50%), Positives = 336/495 (68%), Gaps = 23/495 (5%)
 Frame = -3

Query  1560  MRKNIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANF  1381
             +R   W+KSS     PTNWP++GMLP LL+ + R+H  AT+ + ++GGTFE KGP F N 
Sbjct  23    LRSRSWRKSS----GPTNWPLLGMLPWLLRISRRIHSSATQLMNESGGTFEFKGPWFCNM  78

Query  1380  DMLLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNH  1201
             DML+T DPANI +I ++NF+NYPKG  F+K+F++ GDGI N D ELW+LHR+TT +  +H
Sbjct  79    DMLITCDPANIHHIFSRNFSNYPKGPEFRKIFDVLGDGIFNADFELWELHRRTTLSFFSH  138

Query  1200  IGFRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLF  1021
               F   L R V   VE+ L PVLD + ++G   DLQ+IF+R SFD   ++ LD +P SL 
Sbjct  139   ARFHTLLGRAVWGKVETALLPVLDSFLEQGVAVDLQDIFQRFSFDNICKLVLDYDPQSLS  198

Query  1020  VEPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPI  841
             ++ P   P  KA   A+ A+LY+HILPE  WKLQKW  G+ +EKK  EAW  FD+FIYP 
Sbjct  199   IDLPYV-PCEKAFNGAIEALLYRHILPESLWKLQKW-LGVGKEKKLMEAWKAFDEFIYPH  256

Query  840   LSEKLNQLHDQDEDDSQNFSMLTSHMKAYKGKPMQ-------FLRDTFVsltisggggtt  682
             ++      + + +DD++   +LT+  KAY+ K +        FLRDT     +  G  TT
Sbjct  257   ITLG----NGEQKDDAK---LLTTFRKAYEEKNIGSSNGLRVFLRDT-ALSLMFAGRDTT  308

Query  681   ssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLR  502
             S+ LTWLFWL+AKNPL E K+  E+         K+   F VEE   L+YLH A CESLR
Sbjct  309   STCLTWLFWLIAKNPLTETKILEEMESKLQLKEDKKWRFFSVEESRKLIYLHGALCESLR  368

Query  501   LFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDC  322
             LFPP+ + HK  +  DTLPSG+ ++P T+I+ SFYS GRME++WG+DC+EFKPERW+S  
Sbjct  369   LFPPVALEHKAPIAPDTLPSGNYLEPNTKIIVSFYSTGRMESVWGKDCLEFKPERWISK-  427

Query  321   GGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTL  142
             GGG KH PS KFP F+ GPRTC+G++M F+  K+VAA+II+ Y+ +L+E H  V PSD++
Sbjct  428   GGGTKHEPSYKFPAFNAGPRTCLGKEMAFVQMKMVAAAIIYHYNLQLVEDHP-VTPSDSV  486

Query  141   VLEVKHGVKVKLTKR  97
             +L+ KHG+KV+L +R
Sbjct  487   ILQAKHGLKVRLFRR  501



>dbj|BAF46296.1| cytochrome P450 [Ipomoea nil]
Length=525

 Score =   472 bits (1215),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 255/500 (51%), Positives = 342/500 (68%), Gaps = 26/500 (5%)
 Frame = -3

Query  1539  KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPA-FANFDMLLTS  1363
             +SS   + P NWP++GM+PALL+NAHR+H+FAT+ LK +GGTFE KGPA FAN  ML TS
Sbjct  31    RSSDDKVVPRNWPLVGMMPALLKNAHRVHEFATDVLKHSGGTFEFKGPAAFANLSMLATS  90

Query  1362  DPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPS  1183
             DPANI ++ +KNF+NYPKG  F+K+F+I GDGI N DS+LW+LHRKTT + +NH  F   
Sbjct  91    DPANIHHVLSKNFSNYPKGPEFRKIFDILGDGIFNVDSQLWELHRKTTLSFLNHAQFYTL  150

Query  1182  LERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSD  1003
             L+  V   VE GL PVLD +A+ G  FDLQ++F+R +FD   ++ L  +P SL +  P  
Sbjct  151   LQTNVWHKVEKGLLPVLDWFAEEGAEFDLQDVFQRFTFDAISKLVLHHDPESLCLGLPYV  210

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPI---LSE  832
              P  KA   AV+A+LY+HI PE FWKLQ W  GI +EKK  +A+  FD+FIY     L E
Sbjct  211   -PCEKAFNHAVDALLYRHIFPESFWKLQNW-LGIGKEKKLIQAYRAFDEFIYSALKRLEE  268

Query  831   KLNQLH---DQDEDDSQNFSMLTSHMKAYKGKPM------------QFLRDTFVsltisg  697
             ++  +    D + DD  + S+ T++++AYK +              +F RDTF+   +  
Sbjct  269   RMMMITPNIDNNSDD-HHLSLFTAYVQAYKQQEQPQAALLTTTTTTKFPRDTFL-SLMFA  326

Query  696   gggttssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAF  517
             G  TTSS LTW F+LLA+NPLV+A   +EI + K     +    FK+EEC  LVYLHAA 
Sbjct  327   GRDTTSSTLTWFFYLLAQNPLVQANARDEI-ENKLNLKQEIKRFFKLEECHKLVYLHAAL  385

Query  516   CESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPER  337
             CE+LRLFPP+ + HK+S   D LPSGH VKP TRI+  FYS GRM++IWGEDCMEFKPER
Sbjct  386   CETLRLFPPLAIQHKVSTAMDVLPSGHLVKPNTRIILLFYSSGRMDSIWGEDCMEFKPER  445

Query  336   WLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVV  157
             W+S   G IKH PS KFP F+ GPRTC+G++M F+  K++AA I+  Y  ++++ H+ V 
Sbjct  446   WISG-NGRIKHEPSYKFPAFNAGPRTCLGKEMSFVQMKMIAAIILHHYEFQVVDSHS-VS  503

Query  156   PSDTLVLEVKHGVKVKLTKR  97
             PSD+++++ KHG+KVK TKR
Sbjct  504   PSDSIIIQAKHGLKVKFTKR  523



>ref|XP_006351377.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=524

 Score =   469 bits (1206),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 246/492 (50%), Positives = 331/492 (67%), Gaps = 15/492 (3%)
 Frame = -3

Query  1551  NIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             N W KSS     PTNWP++GMLP L+QNAHR+H+FAT+ L +  GTF+  GP  AN +ML
Sbjct  27    NRWWKSSSV---PTNWPLVGMLPGLIQNAHRVHEFATDILVETKGTFKFHGPVLANLNML  83

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             +TSDPANI YI +KNF+NYPKG  F+K+F+I G+G+ N D ELW++HRKTT +LMNH  F
Sbjct  84    ITSDPANIHYILSKNFSNYPKGVEFRKIFDILGNGMFNVDYELWEMHRKTTMSLMNHAKF  143

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
             +  LER +   +E+ L P+LD +A++   FD+Q+IF+R +FD   ++ LD +P SL +  
Sbjct  144   QTLLERNMWNIIENRLRPILDAFAEQDILFDMQDIFQRFTFDAISKLLLDHDPKSLSIGL  203

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   P  KA  D V+A+LY+H+LPE  WKLQKW   I REKK  +AW+ FD+F+YP +S 
Sbjct  204   PHV-PCEKAFNDTVDALLYRHLLPESCWKLQKW-LRIGREKKLIQAWEAFDQFLYPCISR  261

Query  831   KLNQLHDQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttssa  673
             K  +L  Q     + F+ L  ++K Y        G    FLRDTF+   +  G  TTS+A
Sbjct  262   KQEELLHQSTIKDEEFTFLNEYIKMYNQWKDGDLGTLQTFLRDTFL-SLMLAGRDTTSAA  320

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFP  493
             LTW FWLLAKNPL E ++  EI +       +    F ++E   LVYLH A CE+LR FP
Sbjct  321   LTWFFWLLAKNPLAEKRIREEIQQQLNLKEDENLNFFSIQETRKLVYLHGALCETLRFFP  380

Query  492   PIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGG  313
              + + HK+  + D LPSGH V P  RI+ S Y+MGRME+IWGEDC+EFKPERW+S   GG
Sbjct  381   SVAIEHKLPHDFDILPSGHHVSPNMRIVLSLYTMGRMESIWGEDCLEFKPERWISK-RGG  439

Query  312   IKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLE  133
             IKH PS KF  F+ GPRTCIG++M F+  KIVAA+II+ YH +L E   +   S +++++
Sbjct  440   IKHEPSFKFSAFNAGPRTCIGKEMAFIQMKIVAATIIYNYHIQLGEDQIISP-SASIIIQ  498

Query  132   VKHGVKVKLTKR  97
             +KHG+KV+L KR
Sbjct  499   MKHGLKVRLVKR  510



>ref|XP_006339337.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=510

 Score =   464 bits (1195),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 241/499 (48%), Positives = 334/499 (67%), Gaps = 26/499 (5%)
 Frame = -3

Query  1554  KNIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDM  1375
             KN W K+S+    P +WP+IGMLP  + NAHR+H F T+ L +    FE +GP FAN DM
Sbjct  22    KNKWTKTSK----PIDWPIIGMLPGFVHNAHRIHSFFTDLLLETSSNFEFRGPIFANMDM  77

Query  1374  LLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIG  1195
             L TSDPANI +I ++NF+NYPKG  F+++F+I G+GI N DSELW++HRKTT  LMNH  
Sbjct  78    LFTSDPANIHHILSRNFSNYPKGPEFREIFDILGNGIFNVDSELWEIHRKTTMYLMNHAK  137

Query  1194  FRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVE  1015
             F+  L+R V  T++ G+ P LD +A++ T  DLQ+IF+R SFD   ++ LD +P SL V 
Sbjct  138   FQTLLQRNVWDTIDKGIVPTLDIFAKQDTPVDLQDIFQRFSFDTISKLLLDHDPKSLSVN  197

Query  1014  PPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS  835
              P   P  KA  D V+A+LY+H+LPE  WKLQKW   I +EK    AW+  D+FIYP +S
Sbjct  198   LPY-VPCEKAFNDMVDALLYRHVLPESCWKLQKW-LRIGKEKNLMNAWEALDQFIYPAIS  255

Query  834   EKLNQLHDQDEDDSQNFSMLTSHMKAYK----------GKPMQFLRDTFVsltisggggt  685
             ++  +L      D  +F + + ++KAY           G   +FLRDTF+   +  G  T
Sbjct  256   KRQEKLMSNKIKDD-DFDLFSDYVKAYNQWTNEDDKNLGSVEKFLRDTFL-NLMFAGRDT  313

Query  684   tssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTET---FKVEECCDLVYLHAAFC  514
             TS+ LTW FW LAKNPLV  K+  EI   + Q H K+ E+   F +EE   LVYLH A C
Sbjct  314   TSTTLTWCFWHLAKNPLVVKKIREEI---QQQLHLKEDESLKFFNIEESRKLVYLHGALC  370

Query  513   ESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERW  334
             E+LRLFPP+ + HK  L+ D LPSGH+V P  +IL SFY+MGRME++WG+DC+EF+PERW
Sbjct  371   EALRLFPPVSIEHKSPLKLDVLPSGHRVSPNMKILISFYTMGRMESLWGKDCLEFRPERW  430

Query  333   LSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVP  154
             +++  GG+KH PS KFP F  GPRTC+G++M F+  K+VAA++I+ Y+ +L+E  T + P
Sbjct  431   ITE-RGGLKHEPSYKFPAFLAGPRTCVGKEMAFIQMKMVAATMIYNYNIQLLEAQT-ISP  488

Query  153   SDTLVLEVKHGVKVKLTKR  97
             + T+V+ + +G+  K+ KR
Sbjct  489   TATVVIRMTNGLMAKVVKR  507



>ref|XP_006340071.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=499

 Score =   462 bits (1188),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 253/493 (51%), Positives = 334/493 (68%), Gaps = 23/493 (5%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             WK SS     PTNWP++GMLP L++N HR+H+  TE L ++ GTFE  GP FANF+ML T
Sbjct  16    WKLSSL----PTNWPIVGMLPELIRNLHRVHEKTTEVLIESNGTFEFHGPVFANFNMLGT  71

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDP NI YI +KNF+NYPKG  F+K F+IFG+GI + D ELW++HRKTT  LM H  F  
Sbjct  72    SDPENIHYILSKNFSNYPKGVEFRKYFDIFGNGIFSVDYELWEIHRKTTMYLMGHAKFHT  131

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
              LER + + +E+GL P+LD +A+  T FDLQ+IF R +FD+  ++ LD +P SL +  P 
Sbjct  132   LLERNIWEIIENGLRPILDDFAELDTLFDLQDIFHRFTFDVICKLLLDHDPKSLSIGLPH  191

Query  1005  DHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL  826
               P  KA  D V+A+LY++ILPE  WKLQKW   I REKK  +AW+ FD+F+YP +S K 
Sbjct  192   V-PCEKAFNDTVDALLYRYILPECCWKLQKW-LRIGREKKLIQAWEAFDQFLYPCISRKQ  249

Query  825   NQLHDQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttssalT  667
              +L  +     + FS L + +K Y        G    FLRDTF+   + GG  TTS+ALT
Sbjct  250   EELMHKSTMKDEEFSFLNAFIKMYDQWKDGDLGTLQTFLRDTFL-SLMLGGRDTTSAALT  308

Query  666   WLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTET---FKVEECCDLVYLHAAFCESLRLF  496
             W F L+AKNPLVE K+  EI   + Q H K+ E    F ++E   LVYLHAAFCE+LRLF
Sbjct  309   WFFALMAKNPLVEKKIREEI---QQQLHLKEDENLNFFNIQETRKLVYLHAAFCETLRLF  365

Query  495   PPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGG  316
             P + + HK+ LE D LPSGH+V P TR++ SFY+MGRME++WG+DC+EFKPERW+S   G
Sbjct  366   PSVAIEHKLPLEFDILPSGHRVSPNTRVMLSFYTMGRMESLWGKDCLEFKPERWISK-RG  424

Query  315   GIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVL  136
              IKH PS KF  F+ GPR CIG++M F   KIVAA+II  YH ++ +       S ++++
Sbjct  425   EIKHEPSFKFTAFNAGPRACIGKEMAFTQMKIVAATIIHNYHIQVEDQIISP--SSSVII  482

Query  135   EVKHGVKVKLTKR  97
             +VKHG+KV+L KR
Sbjct  483   QVKHGLKVRLIKR  495



>gb|EYU27552.1| hypothetical protein MIMGU_mgv1a004751mg [Erythranthe guttata]
Length=511

 Score =   462 bits (1189),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 247/504 (49%), Positives = 333/504 (66%), Gaps = 35/504 (7%)
 Frame = -3

Query  1548  IWK-KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             +W+ K+ +++  PTNWP++GMLP +LQN+HR+HD+AT+ L ++GGTF+ K P   N DML
Sbjct  22    VWRTKTQKKTSLPTNWPLVGMLPGILQNSHRIHDYATDILSESGGTFQFKFPGVFNMDML  81

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             +T DPANI +I ++NF+NYPKG  F+K+FEI GDGI N D ELW+LHR+TT A +NH  F
Sbjct  82    VTCDPANIHHIFSRNFSNYPKGPEFRKIFEILGDGIFNADFELWELHRRTTLAFLNHTKF  141

Query  1191  RPSLERTVCQTVESGLFPVLDHY-AQRGTH----FDLQEIFKRLSFDIGFQVFLDKNPGS  1027
                LE +V   V +GL PVLD   A++G +     DLQ++F+RL+FD   ++ LD +P S
Sbjct  142   YSLLESSVWGKVGTGLLPVLDDLIAKQGANNSHEVDLQDVFQRLTFDNICKLVLDYDPCS  201

Query  1026  LFVEPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIY  847
             L V+ P   P  KA  DAV A+LY+H+LPE  WKL KW   + +EKK  EAW  FD FIY
Sbjct  202   LSVDMPY-IPSEKAFNDAVEALLYRHVLPESVWKLLKW-LELGKEKKLVEAWKAFDDFIY  259

Query  846   PILSEKLNQLHDQDEDDSQNFSMLTSHMKAYKGK------------PMQFLRDTFVslti  703
             P++        + D+ D  N  ML    KAY+ K               FLRDT     +
Sbjct  260   PLIPSTF----EGDKRDDHN--MLACFRKAYEEKLSNKGLSTSTTTTRDFLRDT-ALSLM  312

Query  702   sggggttssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHA  523
               G  TTS+ LTWLFWL+AKNP  E K+  EI     +   K+   F VEE   L+YLH 
Sbjct  313   FAGRDTTSTCLTWLFWLIAKNPSTETKILEEI-----EIEFKKWRLFSVEESRRLIYLHG  367

Query  522   AFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKP  343
             A CESLRLFPP+ + HK  ++ D LPSG  VK   +++ SFYS GRME++WG+DC+EFKP
Sbjct  368   ALCESLRLFPPVALEHKAPIQPDNLPSGDYVKSNAKVIVSFYSTGRMESVWGKDCLEFKP  427

Query  342   ERWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELME--PH  169
             ERW+S   GGIKH PS KFP F+ GPRTC+G++M F   K+VAA+II+RY  EL+E   +
Sbjct  428   ERWIS-ASGGIKHEPSYKFPAFNAGPRTCLGKEMAFAQMKMVAATIIYRYKIELLEGGGY  486

Query  168   TLVVPSDTLVLEVKHGVKVKLTKR  97
              +V P D+++L+ KHG+KV+L++R
Sbjct  487   PVVSPRDSIILQAKHGLKVRLSRR  510



>ref|XP_009782181.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   457 bits (1177),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 242/493 (49%), Positives = 333/493 (68%), Gaps = 23/493 (5%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W K+S     P  WP +GMLPA++ N H +HD+ T+ L + GGTFE KGP FAN DML+T
Sbjct  28    WTKTSA----PIYWPFVGMLPAIILNFHHIHDYITKVLTETGGTFEFKGPIFANMDMLIT  83

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
              DPANI +I +KNF+NYPKG  F+K+F+I G+GI N DSELW+LHRK T ++M+H  F+ 
Sbjct  84    CDPANIHHIFSKNFSNYPKGPEFRKIFDILGNGIFNVDSELWELHRKITMSIMSHAKFQT  143

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
              LE  +   ++  L P+LD +A++G  FDLQ+I +RLSFD   ++ LD +P SL ++ P 
Sbjct  144   LLENNMWGIMDKRLRPILDVFAEQGNSFDLQDILQRLSFDSITKLLLDHDPRSLSIDVPH  203

Query  1005  DHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL  826
               P  KA  DA++A+L++HI+PE  WKLQKW   I +EKK ++AW+ FD+F+YP +S K 
Sbjct  204   V-PCEKAFTDAIDALLFRHIMPESCWKLQKW-LQIGKEKKLSQAWEAFDEFLYPCISHKQ  261

Query  825   NQLHDQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttssalT  667
              +L  +   D ++F+ L +++K Y        G   +FLRDTF+   +  G  +TSSALT
Sbjct  262   EELMKKTAKD-EDFTFLAAYIKMYNSWNKGDLGTLQKFLRDTFL-NLMLAGRDSTSSALT  319

Query  666   WLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKV---EECCDLVYLHAAFCESLRLF  496
             W F  LAK+PLVE K+  EI   + + H K+ E  K    EE   LVYLH A CE+LR F
Sbjct  320   WFFLFLAKHPLVETKIREEI---QQKMHLKKDENLKFFNKEEMLKLVYLHGALCETLRFF  376

Query  495   PPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGG  316
             P + + HK+ L  D LPSGH V PKT+++  FY+MGRME IWG+D +EFKPERW+S+  G
Sbjct  377   PSLSLEHKVPLAHDILPSGHHVTPKTKMIIPFYTMGRMETIWGKDYLEFKPERWISE-QG  435

Query  315   GIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVL  136
              IKH PS KFP F+ GPRTCIG+ M F   KIVAA+II  YH +L+E    + P+ ++++
Sbjct  436   KIKHEPSFKFPAFNAGPRTCIGKNMAFTQLKIVAATIIHNYHIQLVEAQN-ISPTTSIIM  494

Query  135   EVKHGVKVKLTKR  97
              VKHG+KV++ KR
Sbjct  495   LVKHGLKVRVVKR  507



>ref|XP_004249314.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=509

 Score =   453 bits (1166),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 235/497 (47%), Positives = 335/497 (67%), Gaps = 20/497 (4%)
 Frame = -3

Query  1551  NIWKKSSRRSMD--PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFD  1378
             +IW    RR+    PTNWP++  LP ++ N HR H + TE L + GGT++ KGP F N D
Sbjct  19    SIWFIIYRRTKTSAPTNWPILRELPGVIGNLHRGHAYMTEVLIEYGGTYDFKGPIFTNVD  78

Query  1377  MLLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHI  1198
             M  T DPANI YI +KNF+NYPKG  F+K+F++ G+GI N D ELW+LHR+TT ++M+H 
Sbjct  79    MFFTCDPANIHYIFSKNFSNYPKGPEFRKIFDMLGNGIFNVDHELWELHRRTTMSIMSHA  138

Query  1197  GFRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFV  1018
              F+  LE+T+   +E GL P+LD +A++G   DLQ++ +R +FD   ++ LD +P SL +
Sbjct  139   KFQMLLEKTMWDIIEKGLKPILDAFAKQGKTLDLQDVLQRFTFDSITRLLLDHDPKSLSM  198

Query  1017  EPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPIL  838
             + P   P+ KA  DA++A+L++HI P+R WKLQ+W   I +EKK   A + FD+FIYP +
Sbjct  199   DLPY-LPYEKAFGDALDALLHRHITPQRLWKLQQW-LRIGKEKKLMHACEAFDQFIYPCI  256

Query  837   SEKLNQLHDQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggtts  679
             + K  +L  +     + F+ L +++K Y        G    FLRDTF+   +  G  TTS
Sbjct  257   ARKQEELMHKSRIKEEEFAFLNAYIKVYNQWNGGDLGTLQTFLRDTFL-NLMLAGKDTTS  315

Query  678   salTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKV---EECCDLVYLHAAFCES  508
             +ALTW F LLAKNPLVE K+  EI   + Q H K+ E  K    EE   L+YLH A CE+
Sbjct  316   AALTWFFVLLAKNPLVEKKIREEI---QQQLHVKEDENLKFFTKEESRKLIYLHGALCET  372

Query  507   LRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLS  328
             LRL+P + + HK+ L+ D LP+GH+V PKTR++  FY MGRME +WG+DC+EFKPERW+S
Sbjct  373   LRLYPSVSLEHKVPLDHDILPTGHRVSPKTRMILPFYVMGRMETLWGKDCLEFKPERWIS  432

Query  327   DCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSD  148
             +  GGIKH PS KFP F+ GPRTC+G++M F+  KIVAA+II  Y+ +++EP   V P+ 
Sbjct  433   E-RGGIKHEPSFKFPAFNAGPRTCLGKEMAFIQMKIVAATIIHNYNIQVVEPQN-VYPTT  490

Query  147   TLVLEVKHGVKVKLTKR  97
             +++++VK+G+ VK+ KR
Sbjct  491   SIIMQVKNGLMVKVVKR  507



>gb|EYU32453.1| hypothetical protein MIMGU_mgv1a005630mg [Erythranthe guttata]
Length=476

 Score =   451 bits (1160),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 235/495 (47%), Positives = 325/495 (66%), Gaps = 63/495 (13%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             WKKSS +   PTNWP++GMLPA++QN HR+HD+AT  L + GGTFE KGP F + DM++T
Sbjct  31    WKKSSSK---PTNWPLVGMLPAVVQNLHRIHDYATTVLTECGGTFEFKGPWFCHVDMVVT  87

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDPANI +I ++NF+NYPKG  F+KMFEI GDGI N D ELW+LHR+TT +++ H  F  
Sbjct  88    SDPANIHHIFSRNFSNYPKGPEFRKMFEILGDGIFNADFELWELHRRTTLSMLTHPEFPD  147

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
              LE  V   V++GL PVLD++A+ G +FDLQ++F+RL+FD   ++ L+ +P SL V+ P 
Sbjct  148   FLEVNVWHKVQTGLLPVLDYFAENGDYFDLQDVFQRLTFDGICKLVLNYDPCSLCVDLPY  207

Query  1005  DHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL  826
               P  KA  DA+ A+LY+H+LPE  WKL KW   I  E+K  EAW  FD+FIYP++    
Sbjct  208   I-PSEKAFNDAIEALLYRHVLPETIWKLLKW-LQIGTERKLLEAWKAFDEFIYPLIP---  262

Query  825   NQLHDQDEDDSQNFSMLTSHMKAYKGK----------PMQFLRDTFVsltisggggttss  676
                 +  +++S +++ML S  KAY+ K             FLRDT +SL           
Sbjct  263   ----NSSKEESDDYNMLASFRKAYEEKLSTGLSTTTTTTDFLRDTALSL-----------  307

Query  675   alTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLF  496
                    +LA++                    K+  +F VEE   L+YLH A CESLRLF
Sbjct  308   -------MLAED--------------------KKWRSFSVEESRKLIYLHGALCESLRLF  340

Query  495   PPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGG  316
             PP+ + HK  +E D LPSG+++KP T+++ SFYS GRME++WG+DC+EFKPERW+SD  G
Sbjct  341   PPVALEHKAPIEPDILPSGNQLKPNTKVIVSFYSTGRMESVWGKDCLEFKPERWISD-SG  399

Query  315   GIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELME--PHTLVVPSDTL  142
               KH PS KFP F+ GPRTC+G++M F   K+VAA+II+RY  EL+E   + +V P D++
Sbjct  400   RTKHEPSYKFPAFNAGPRTCLGKEMAFAQMKMVAATIIYRYKIELLEGRGYPVVSPRDSI  459

Query  141   VLEVKHGVKVKLTKR  97
             +L+ KHG+KV+L+ R
Sbjct  460   ILQAKHGLKVRLSTR  474



>gb|AEI59774.1| cytochrome P450 [Helianthus annuus]
Length=505

 Score =   450 bits (1157),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 230/493 (47%), Positives = 329/493 (67%), Gaps = 19/493 (4%)
 Frame = -3

Query  1551  NIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
              I+   + R + P+NWP++GM+P +L NAH+LHD+ TE L Q+ GTF LKGP  AN DML
Sbjct  22    TIYTHKTLRHVIPSNWPILGMIPGVLVNAHQLHDYTTELLIQSRGTFMLKGPWLANMDML  81

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             LT+DP +I +I +KNF+NYPKG  FQK+F+I GDGILN D ++W++  K   +++NH+GF
Sbjct  82    LTTDPLDIHHILSKNFSNYPKGDKFQKIFDILGDGILNADGKIWEISHKVIFSVLNHVGF  141

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
             +  +E  +   VE+GL P+L+   +RGT  DLQ+IF+R +FDI F++ LD +  SL +  
Sbjct  142   QSKMETIIWDKVENGLLPILESICERGTEMDLQDIFQRFAFDIVFKLLLDNDQESLSLNF  201

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P + P+ +A  D+  A+L +H+ P   WKLQ+    + +EKK ++AW + D+FIY  L++
Sbjct  202   PYN-PYSEAFTDSEEAVLLRHVTPPFLWKLQQ-ILRVGKEKKLSDAWKSLDQFIYKCLAQ  259

Query  831   KLNQLHDQDEDDSQNFSMLTSHMKAYKG------KPMQFLRDTFVsltisggggttssal  670
             K    ++ +  +++ F+   + M+  K          +FLRDTF     + G  T SSAL
Sbjct  260   KEMDYNNMNH-EAEKFTFFDAIMRELKDHIDTSMDCTKFLRDTFF-NLTAAGKDTISSAL  317

Query  669   TWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQT--ETFKVEECCDLVYLHAAFCESLRLF  496
              W F+LLA NP VE K+  E+     Q H + +  + +   E   +VYLH A CE+LRL+
Sbjct  318   CWFFYLLATNPTVEDKILEEM-----QTHLEVSALKRWNATELDKMVYLHGALCETLRLY  372

Query  495   PPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGG  316
             PP+P N+K  L+ D LPSGH+V   T I+  FYSMGRM +IWGEDCMEFKPERW+S   G
Sbjct  373   PPVPFNNKSPLQPDILPSGHQVDQNTNIILCFYSMGRMRSIWGEDCMEFKPERWISS-SG  431

Query  315   GIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVL  136
             GIKHVPS KFP F+ GPR C+G+ M F   KIVA +II+ YH +L+E H LV+P+D++VL
Sbjct  432   GIKHVPSYKFPTFNAGPRACLGKNMAFSELKIVATTIIYHYHIQLVEGH-LVLPADSMVL  490

Query  135   EVKHGVKVKLTKR  97
              +K+G+KVKL +R
Sbjct  491   HMKYGLKVKLNRR  503



>ref|XP_006351417.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=508

 Score =   445 bits (1145),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 234/497 (47%), Positives = 333/497 (67%), Gaps = 20/497 (4%)
 Frame = -3

Query  1551  NIWKKSSRRSMD--PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFD  1378
             +IW    RR+    PTNWP++  LPA++ N HR H + TE L + G T++ KGP F N D
Sbjct  19    SIWFIIYRRTKTSAPTNWPILRELPAVIGNIHRGHAYMTEVLIEYGSTYKFKGPIFTNMD  78

Query  1377  MLLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHI  1198
             ML T DP +I YI +KNF+NYPKG  F+K+F+I G+GI N D ELW+LHRKTT ++M+H 
Sbjct  79    MLFTCDPGDIHYIFSKNFSNYPKGPEFRKIFDILGNGIFNVDHELWELHRKTTMSIMSHA  138

Query  1197  GFRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFV  1018
              F+  LE+T+   +E GL P+LD +A++G   DLQ++ +R +FD   ++ LD +P SL +
Sbjct  139   KFQILLEKTLWDIIEKGLRPILDAFAKQGKTLDLQDVLQRFTFDSITRLLLDHDPRSLSM  198

Query  1017  EPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPIL  838
             + P   P+ KA  DA++A+L++HI P+  WKLQ+W   I +EKK  +A + FD+FIYP +
Sbjct  199   DLPY-LPYEKAFGDALDALLHRHITPKCLWKLQQW-LRIGKEKKLMQACEAFDQFIYPCI  256

Query  837   SEKLNQLHDQDEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggtts  679
             + K  +L  +     + F+ L +++K Y        G    FLRDTF+   +  G  TTS
Sbjct  257   ARKQEELMHKTTIKDEEFAFLNAYIKMYNQWNDGDLGTLQTFLRDTFI-NLMFAGRDTTS  315

Query  678   salTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKV---EECCDLVYLHAAFCES  508
             +ALTW F LLAKNPLVE K+  EI   + Q H K+ E  K    EE   L+YLH A CE+
Sbjct  316   AALTWFFVLLAKNPLVEKKIREEI---QQQLHVKEDENLKFFTKEESRKLIYLHGALCET  372

Query  507   LRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLS  328
             LRLFP + + HK+ L+ D LPSGH+V PKTR++  FY MGRME +WG+DC+EFKPERW+S
Sbjct  373   LRLFPSVSLEHKVPLDHDILPSGHRVSPKTRMILPFYVMGRMETLWGKDCLEFKPERWIS  432

Query  327   DCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSD  148
             +  GGIKH PS KFP F+ GPRTC+G++M F+  KIV+A II  Y+ +++EP   V P+ 
Sbjct  433   E-RGGIKHEPSFKFPAFNAGPRTCLGKEMAFVQMKIVSAIIIHNYNIQVVEPEN-VYPTT  490

Query  147   TLVLEVKHGVKVKLTKR  97
             +++++VK+G+ V + K+
Sbjct  491   SIIMQVKNGLMVNVVKK  507



>ref|XP_011095825.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=492

 Score =   442 bits (1136),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 240/484 (50%), Positives = 323/484 (67%), Gaps = 19/484 (4%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             +S  PTNWP++ M+PALL+N  RLH F TE L+Q+GGT+  KGP F+N DML T DPANI
Sbjct  19    KSSLPTNWPILDMIPALLKNIDRLHQFKTELLEQSGGTYMFKGPWFSNTDMLFTCDPANI  78

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              ++ +KNF+NYPKG  F+K+FEI GDGI N D ELW++HR+TT +L+ H  F  SLE TV
Sbjct  79    HHVFSKNFSNYPKGPEFRKIFEILGDGIFNADFELWEIHRRTTISLLTHSKFHSSLESTV  138

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
                VE+GL PVL  + ++G   DLQ+IF+R +FD   +V LD +P SL VE P   P  K
Sbjct  139   WGKVETGLLPVLASFCKQGAEVDLQDIFQRFTFDNICKVVLDFDPSSLCVELPHI-PCEK  197

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ  808
             A   +V  +L +HI+PE  WKLQK    I  EK+  EA   FD FIYP++S K    + +
Sbjct  198   AFSHSVEPLLLRHIVPESIWKLQK-RLKIGSEKQLMEASQNFDDFIYPLISLK----NGE  252

Query  807   DEDDSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLL  649
              E+D+   ++LT   K Y+ K +        FL+DT +   I  G  TTS+ LTWLFWL+
Sbjct  253   QENDT---NLLTVFRKVYEEKHVGPSSGLRDFLKDTSL-SLIFAGRDTTSTCLTWLFWLI  308

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             A+NPL E K+  EI  V      K+   F VEE   L+YLH A CESLRLFPP+ + HK 
Sbjct  309   ARNPLTETKILEEIHTVLHLKEDKKWRRFNVEESHKLIYLHGALCESLRLFPPVALEHKA  368

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
               + D LPSGH +    +++ SFYS+GRME +WG+DC+EF+P+RW++  GG IKH PS K
Sbjct  369   PTKPDILPSGHYLPANAKLIFSFYSVGRMETVWGKDCLEFRPDRWIAP-GGRIKHEPSYK  427

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             FP F+VGPRTC+G++M F+  K+VAA+II+ Y  EL+E +  V P  +++L+ K G+KV+
Sbjct  428   FPAFNVGPRTCLGKEMAFIQMKMVAAAIIYHYRIELVEGNQ-VSPRVSIILQAKPGLKVR  486

Query  108   LTKR  97
             LTKR
Sbjct  487   LTKR  490



>gb|EPS60789.1| hypothetical protein M569_14012, partial [Genlisea aurea]
Length=489

 Score =   436 bits (1122),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 231/491 (47%), Positives = 314/491 (64%), Gaps = 20/491 (4%)
 Frame = -3

Query  1545  WKKSSR-RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             WK S +  +  PTNWPV+GM PA L+N HR+HDF TE L + GGTFE KGP   N DML 
Sbjct  11    WKSSGKFATAVPTNWPVVGMWPAALRNCHRVHDFITEVLSECGGTFEFKGPWLCNMDMLF  70

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T DPANI ++ ++NF NYPKG  F K+F++ G+GI N D ELW  HRKTT   M  + F 
Sbjct  71    TCDPANIHHVFSRNFANYPKGPEFMKIFDVLGNGIFNADFELWKFHRKTTMGFMGSLEFS  130

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
               +E  V + VE GLFPVLD +A+ G   DLQ++F+R +FD   +V LD +P SL V  P
Sbjct  131   GLIEGIVWRKVEKGLFPVLDLFAETGDSVDLQDVFQRFTFDGICKVVLDFDPESLSVGFP  190

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
                   KA  D ++A+LY+H+LPE  WK  K   GI +EK+   A + FD FIYP L   
Sbjct  191   EIQ-CEKAFNDVIDALLYRHVLPEFLWKAMK-NLGIGKEKRLTAAKEVFDSFIYPKLGGG  248

Query  828   LNQLHDQDEDDSQNFSMLTSHMKAY----KGKPMQFLRDTFVsltisggggttssalTWL  661
                  D+D    + F+       A     +G   +FLRDT     +  G  TTS+ LTWL
Sbjct  249   -----DRDCTMLRTFTAAVDENDAVLGPLEGSSAKFLRDT-ALSLMFAGRDTTSTCLTWL  302

Query  660   FWLLAKNPLVEAKLFNEI---LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPP  490
             FWLL +NP  E K+  EI   L ++P +  +    F VEE   L YLH A  ESLRLFPP
Sbjct  303   FWLLTQNPSAEGKILGEIEEKLNLRPGDRWRG---FTVEESRRLSYLHGALSESLRLFPP  359

Query  489   IPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGI  310
             + + HK   + DTLP+G++++  T+I+ SFYSMGRME+IWG+DC++FKPERW+SD  GG+
Sbjct  360   VALEHKAPADGDTLPTGNRIEKNTKIIFSFYSMGRMESIWGKDCLKFKPERWISDVTGGV  419

Query  309   KHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEV  130
              H PS  FP F+VGPRTC+G+ M F+  K+VAA+I+F Y  E+++   + +P D+++L+ 
Sbjct  420   VHAPSYYFPAFNVGPRTCLGKDMAFIQMKMVAAAIVFHYQVEIVD-GAVALPRDSIILQT  478

Query  129   KHGVKVKLTKR  97
             K+G++V+L+KR
Sbjct  479   KNGLRVRLSKR  489



>gb|EYU27551.1| hypothetical protein MIMGU_mgv1a027070mg [Erythranthe guttata]
Length=508

 Score =   436 bits (1120),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 229/495 (46%), Positives = 328/495 (66%), Gaps = 23/495 (5%)
 Frame = -3

Query  1548  IWK-KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             +W+ K+  ++  PTNWP++GMLPA+LQN HR+  + TE L ++GGTF+LK P   N DML
Sbjct  24    VWRTKTPAKTSLPTNWPLVGMLPAILQNCHRIQPYFTEILTESGGTFQLKFPRVFNMDML  83

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             LTS PANI +I ++NF+NYPKG  F+K+FEI GDGI N D ELW+LHR+TT + +NH  F
Sbjct  84    LTSHPANIHHIFSRNFSNYPKGPEFRKVFEILGDGIFNADFELWELHRRTTLSFLNHSEF  143

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
                LE +V + VE+GL PVLD +++    FD Q++F+R +FD   ++ LD +P SL  + 
Sbjct  144   YGLLESSVWEKVETGLLPVLDDFSENRASFDFQDVFQRFAFDSICRLVLDHDPRSLCRDL  203

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P      KA      A+LY+H+LPE  WKLQ+W   +  E+K ++AW+ FD+FIYPI+  
Sbjct  204   PYVAS-EKAFNGTTQALLYRHLLPESIWKLQRW-LRVGEERKLSQAWEAFDEFIYPIID-  260

Query  831   KLNQLHDQDEDDSQNFSMLTSHMKAYKGK------PMQFLRDTFVsltisggggttssal  670
                   ++    S + ++L S  KAY+ K         FLRDT V   +  G  TTS+ L
Sbjct  261   -----FNEKNPKSDHNNLLASFRKAYEEKNGSSSLTRDFLRDT-VLSLMFAGRDTTSTCL  314

Query  669   TWLFWLLAKNP----LVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLR  502
             TW FWL+A NP     +  ++ +++++ K +   ++   F VE+   LVYLH A CESLR
Sbjct  315   TWFFWLVATNPKAEIEILEEIESKLMRQKDEG-GEKWRLFNVEDSHKLVYLHGALCESLR  373

Query  501   LFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDC  322
             LFPP+ + HK  ++ D LPSG  VK   +++  FYS GRME++WG+DC+EFKPERW+S  
Sbjct  374   LFPPVALEHKAPIQPDNLPSGDYVKSNAKVIVCFYSTGRMESVWGKDCLEFKPERWIS-A  432

Query  321   GGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTL  142
              GGIKH PS KFP F+ GPRTC+G++M F+  K++AA+I++ Y  EL+E H +V P D++
Sbjct  433   SGGIKHEPSYKFPAFNAGPRTCLGKQMAFVQMKMLAATIVYHYKIELVEGH-VVAPRDSV  491

Query  141   VLEVKHGVKVKLTKR  97
             +L  K+G+KV L+KR
Sbjct  492   ILHAKNGLKVTLSKR  506



>gb|EYU41723.1| hypothetical protein MIMGU_mgv1a021724mg [Erythranthe guttata]
Length=518

 Score =   432 bits (1110),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 232/506 (46%), Positives = 333/506 (66%), Gaps = 34/506 (7%)
 Frame = -3

Query  1548  IWKKSSRRSMD-----PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFAN  1384
             +W+  +R+S       PTNWP++GMLPA+ +N HR+ D+ TE L ++GGTF+ K P F N
Sbjct  23    VWRICNRKSYGKKTSLPTNWPLVGMLPAIQRNRHRMQDYITEILIESGGTFQFKFPHFLN  82

Query  1383  FDMLLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMN  1204
              D L+TS+P NI++I  KNF+NYPKG  F+K+FE  GD I + D+ELW+  R+TT++ M 
Sbjct  83    MDTLITSNPDNINHIFTKNFSNYPKGPEFKKIFEELGDSIFSVDNELWEFQRRTTHSFMT  142

Query  1203  HIGFRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSL  1024
             H  F   LE  V Q VE+GL PVLDH+ Q    FDLQ++F+R +FD   ++ LD +P SL
Sbjct  143   HPEFNSLLEGVVWQKVENGLLPVLDHFLQGNIDFDLQDVFQRFTFDSICKLVLDFDPKSL  202

Query  1023  FVEPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYP  844
              V+ P   P  KA  D++ A+ ++HILPE  WKLQK   GI RE+K  E     D+FIYP
Sbjct  203   CVDLPVI-PSMKAFCDSIEAVFHRHILPEFVWKLQKR-LGIGRERKLLEGRKIVDEFIYP  260

Query  843   ILSEKLNQLHDQDEDDSQNFSMLTSHMKAYKGKPM-----------QFLRDTFVsltisg  697
             +L+           +D  N ++LT+  KAY+ K +           +F+RDT V   +  
Sbjct  261   LLA---------INNDDDNLNLLTNFTKAYEEKNVSSLLRGDSSRNKFMRDT-VLGLLLA  310

Query  696   gggttssalTWLFWLLAKNPLVEAKLFNEI----LKVKPQNHAKQTETFKVEECCDLVYL  529
             G  T+S+ LTW+ +L+ KNP   AK+  EI    + +K ++   + E F V+E   L+YL
Sbjct  311   GRDTSSTCLTWVLYLITKNPATIAKILEEIETALVHLKGKDGRIKWELFTVKESKKLIYL  370

Query  528   HAAFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEF  349
             HAA CESLRL+PP P+ HK  +++D LPSGH +K   +++ SFYS+GRME++WG+DC+EF
Sbjct  371   HAALCESLRLYPPGPLEHKSPMKSDNLPSGHYIKEDAKVILSFYSIGRMESVWGKDCLEF  430

Query  348   KPERWLSDCGGG--IKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELME  175
             KPERW+S       IKHVPS KFP+F++GPRTC+G++M F   K+VAA+II+ Y+  L+E
Sbjct  431   KPERWISTTSSTAIIKHVPSYKFPVFNIGPRTCLGKEMAFFEMKMVAATIIYHYNIHLVE  490

Query  174   PHTLVVPSDTLVLEVKHGVKVKLTKR  97
              H ++   D ++LE+KHG++VKL+KR
Sbjct  491   GHPVIPRHDCIILEMKHGLRVKLSKR  516



>ref|XP_006374652.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52449.1| cytochrome P450 family protein [Populus trichocarpa]
Length=506

 Score =   431 bits (1107),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 223/481 (46%), Positives = 312/481 (65%), Gaps = 14/481 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP+IGMLP LL   HR HD+ T+ L+Q+  TF+ KGP F + D+L+T+DPANI YI 
Sbjct  30    PKNWPLIGMLPGLLFQVHRFHDWVTDVLEQSKCTFQFKGPWFGDMDILVTADPANIHYIT  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+N+ KG+ F K F+I GDGI+N D +LW   RK   AL+NH  F   L +T+   V
Sbjct  90    SSNFSNFEKGSDFNKRFDILGDGIINADRDLWKSQRKVAQALVNHRLFYQRLVKTIQDKV  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL PVL+H  ++    DLQ++F+R +FD    +    +PG L ++ P +  F KA+ +
Sbjct  150   ERGLIPVLEHVYKQSLVLDLQDLFQRFTFDATCVIVTGFDPGCLSIDLP-EVAFSKAMDN  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD---  805
             A+ AI Y+H+LPE  W+LQ+W  GI +EKK  +A +T D+ I  I+S K  +L   +   
Sbjct  209   AMEAIFYRHVLPESTWRLQRW-LGIGKEKKLKKARETLDRIIAEIISMKREELSKGNRLM  267

Query  804   EDDSQNFSMLTSHMK-----AYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             E+D +   +LTS+M       +K    +FLRDT V   +  G  T SS L+W FWL++KN
Sbjct  268   EEDGEGIDLLTSYMSEDYNMGFKSDD-EFLRDTIV-TFMLAGRDTVSSCLSWFFWLVSKN  325

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P   AK+  E+    P+  A++   F +EE   LVYLH A CESLRL+PPI    K  + 
Sbjct  326   PAAGAKIREELKTTLPEKEAEKRRLFDIEEIKKLVYLHGALCESLRLYPPIHSEFKSPVR  385

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              D LPSGH+V PKT+I+ S Y+MGRM ++WG+DC EFKPERW++D  GG+KH PS KF  
Sbjct  386   QDILPSGHRVNPKTKIVFSLYAMGRMSSVWGDDCFEFKPERWITD-RGGMKHEPSYKFFS  444

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC+G+ + F   K V A+II+ Y  ++++ HT V PS +++L +KHG+KVKLTK
Sbjct  445   FNAGPRTCLGKDVAFTQMKAVVAAIIYNYQVQVVDEHT-VTPSQSVILHMKHGMKVKLTK  503

Query  99    R  97
             R
Sbjct  504   R  504



>ref|XP_011041669.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=507

 Score =   430 bits (1106),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 223/481 (46%), Positives = 313/481 (65%), Gaps = 14/481 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLP+LL + HR HD  T+ L+Q+  TF+ KGP F + D+L+T+DPANI YI 
Sbjct  31    PMNWPLVGMLPSLLVHVHRFHDHVTDVLEQSKCTFQFKGPWFGDMDILVTADPANIHYIM  90

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+N+ KG+ F K F+I G GILN D +LW   RK   AL+NH  F   L +T+   V
Sbjct  91    SSNFSNFEKGSDFNKRFDILGHGILNADRDLWKNQRKVAQALVNHRLFYQRLVKTIQDKV  150

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL PVL+H  ++    DLQ++F+R +FD    +    +PG L ++ P +  F KAI +
Sbjct  151   ERGLIPVLEHVCKQSLVLDLQDVFQRFAFDATSMIVTSFDPGCLSIDLP-EVAFSKAIDN  209

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD---  805
             A+ AI Y+H+LPE  WKLQ+W  GI +EKK  +A +T D+ I  I+S+K  +L   +   
Sbjct  210   AMEAIFYRHVLPESTWKLQRW-LGIGKEKKLKKARETLDRIIAEIISKKREELSKGNRLM  268

Query  804   EDDSQNFSMLTSHMK-----AYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             ++D +   +LTS+M       +K    +FLRDT V   +  G  T SS L+W FWL++KN
Sbjct  269   QEDGEGIDLLTSYMSENYNMGFKSDD-EFLRDTIV-NFMLAGRDTVSSCLSWFFWLVSKN  326

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P   AK+  E+    P+  A++   F +EE   LVYLH A CESLRL+PP+    K  L 
Sbjct  327   PAAGAKIREELKTTLPEKEAEKRRLFNIEEIKKLVYLHGALCESLRLYPPVHSEFKSPLR  386

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              D LPSGH+V PKT+I+ S Y+MGRM ++WG+DC EFKPERW++D  GG+KH PS KF  
Sbjct  387   RDILPSGHQVNPKTKIVFSLYAMGRMSSVWGDDCFEFKPERWITD-RGGMKHEPSYKFFS  445

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC+G+ + F   K V A+II+ Y  ++++ HT V PS +++L +KHG+KVKLTK
Sbjct  446   FNAGPRTCLGKDVAFTQMKAVVAAIIYNYQVQVVDEHT-VPPSQSVILHMKHGMKVKLTK  504

Query  99    R  97
             R
Sbjct  505   R  505



>gb|AJD25225.1| cytochrome P450 CYP96A85 [Salvia miltiorrhiza]
Length=502

 Score =   420 bits (1080),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 218/487 (45%), Positives = 309/487 (63%), Gaps = 24/487 (5%)
 Frame = -3

Query  1539  KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSD  1360
             +  ++  +PT+WP+IGMLP ++ N HR+HD+ T  L   GGT+  +GP F N DML TSD
Sbjct  24    RRGKKPPEPTDWPLIGMLPRVILNFHRVHDYITSVLTVCGGTYMFRGPCFFNIDMLFTSD  83

Query  1359  PANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSL  1180
             PANI ++ ++NF+NYPKG  F+K+F+I GDGI   D ELW++HRKTT A + H  F   L
Sbjct  84    PANIHHVFSRNFSNYPKGPEFRKIFDILGDGIFGADFELWEIHRKTTLAQLTHADFNAQL  143

Query  1179  ERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDH  1000
             ER V   VE+GL PVLDH+   G   DLQ++F+R +FD   ++ LD +P SL ++ P D 
Sbjct  144   ERAVWHKVETGLLPVLDHFCAEGKDLDLQDVFQRFTFDNICKIVLDYDPCSLCLDMP-DL  202

Query  999   PFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQ  820
             P  KA   A   +L++H++P+R WKL +W   +  E+K  E    F +FIYP +      
Sbjct  203   PCEKAFSVAAEPLLHRHVIPQRIWKLLRW-LNVGSERKLLECSRAFSEFIYPRIV-----  256

Query  819   LHDQDEDDSQNFSMLTSHMKAYKGKPMQ------FLRDTFVsltisggggttssalTWLF  658
                  E+     S+L +    YK K M       FL+DT +   +  G  TTS+ LTWLF
Sbjct  257   ---TGEEQKNEGSLLRAFEDVYKQKNMNGRSLRDFLKDTSL-NLMFAGRDTTSTCLTWLF  312

Query  657   WLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
             WL+A++P  E K+  E+     +    + + +  +E   LVYLH A CESLRLFPP+ + 
Sbjct  313   WLVARHPASERKILEEV-----EAELGKKKEWSAQESHKLVYLHGALCESLRLFPPVALE  367

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
             HK  +  D LPSGH +    +++ SFYS+GRME++WG+DC+EFKPERW+S   G IKH  
Sbjct  368   HKAPVRADNLPSGHHLPRDAKLIISFYSVGRMESVWGKDCLEFKPERWISG-SGKIKHEA  426

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KFP F+ GPRTC+G++M F+  K+VAA+II  Y  +L+E H  V P D+++L+ KHG+
Sbjct  427   SYKFPAFNAGPRTCLGKEMAFVQMKMVAAAIICDYQVQLVEGHP-VSPRDSVILQAKHGL  485

Query  117   KVKLTKR  97
             KVKL++R
Sbjct  486   KVKLSRR  492



>gb|EYU33777.1| hypothetical protein MIMGU_mgv1a004858mg [Erythranthe guttata]
Length=507

 Score =   420 bits (1079),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 220/488 (45%), Positives = 309/488 (63%), Gaps = 13/488 (3%)
 Frame = -3

Query  1539  KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSD  1360
             ++ R+   PTNWPV+GMLP L+ NAHR+HD+ TE L++NG TF  KGP F N DM+ T D
Sbjct  25    ENRRKGSTPTNWPVVGMLPGLVGNAHRIHDYITEILRENGATFVFKGPLFTNMDMVFTCD  84

Query  1359  PANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSL  1180
             P NI++I NK F+NYPKG  FQK+FEI GDGI  +D E+W+L R+ T +++N +GF  S+
Sbjct  85    PININHIFNKRFSNYPKGPEFQKIFEIMGDGIFRSDFEMWELQRRLTLSIVNQVGFYTSV  144

Query  1179  ERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDH  1000
             E+T   TV + L PVLDH+ QRG   ++Q+I +R +FD    +  + NP SL  + P   
Sbjct  145   EKTTWGTVRTELVPVLDHFLQRGIEMEMQDILERFAFDNICHLLFNHNPCSLSTDFPHVR  204

Query  999   PFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQ  820
                KA+ DA+  +L++HI PE  W+LQ W   I  EKK  EA   FD F++  ++   ++
Sbjct  205   C-EKALGDALEPLLHRHIWPESIWRLQNW-LNIGNEKKLTEASKAFDDFLHRCITSMEDK  262

Query  819   LHDQDEDDSQNFSML------TSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLF  658
               DQ  +D   F +        S+   + G    FLRD F+   +  G  + S+ L W F
Sbjct  263   --DQTTNDVNIFGIFKKAYEENSNKIRFAGDLRLFLRDGFL-GLLIAGRDSLSTTLIWFF  319

Query  657   WLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
             WLL++NP  E K+  EI  V   +       F VEEC  LVYLHA F E+LRL+P +P+ 
Sbjct  320   WLLSENPSAETKILEEIENVLSLSLHDDLRFFDVEECKKLVYLHACFYETLRLYPAVPLE  379

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
              K S+  DTLP+  +VK  T+I+ SFYS GRME++WG+D +EFKPERW+SD  G +++ P
Sbjct  380   LKSSILPDTLPNNIEVKKNTKIVLSFYSTGRMESVWGKDALEFKPERWISD-RGVLRNEP  438

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KFP F+VGPR+C G++M  +  KIV  +I+ RY   ++E H  V PSD++ L+ KHG+
Sbjct  439   SFKFPAFNVGPRSCPGKEMALVEMKIVVVAIMHRYRVRVVEGHR-VSPSDSVFLKTKHGL  497

Query  117   KVKLTKRK  94
             KV+L  RK
Sbjct  498   KVRLLSRK  505



>ref|XP_010261086.1| PREDICTED: cytochrome P450 86B1-like [Nelumbo nucifera]
Length=513

 Score =   417 bits (1072),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 215/488 (44%), Positives = 317/488 (65%), Gaps = 11/488 (2%)
 Frame = -3

Query  1542  KKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGG-TFELKGPAFANFDMLLT  1366
             ++ SR      +WPV+GMLP+LL+N H +HD+ T+ L+Q+   TF  +GP  A  DM+ T
Sbjct  28    RRLSRNDSPLPDWPVLGMLPSLLRNIHHVHDWTTKLLEQSRSYTFTFRGPWLAGMDMVWT  87

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
              DPAN+ YI + +F+N+PKG  F+ +F++ GDGI N+DS+LW   RK  + L++   F  
Sbjct  88    CDPANVHYIMSTHFSNFPKGPEFKNIFDVLGDGIFNSDSDLWKTQRKVAHGLISRRRFCR  147

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
              LERT  + VE GL PVLDH +++G   DLQ++F+R +FD    +    +PG L VE P 
Sbjct  148   FLERTSRKNVEEGLIPVLDHISEQGMIVDLQDVFQRFTFDSTCTLISGIDPGCLSVEFP-  206

Query  1005  DHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL  826
             D  F KA+ D   AI ++HI+P+ +WKLQ+W  GI  EKK + AW T D++I   +S K 
Sbjct  207   DVAFSKALDDVEEAIFFRHIVPKSYWKLQRWL-GIGEEKKMSRAWKTLDRYIAHCISLKR  265

Query  825   NQLHDQ-DEDDSQNFSMLTSHMKAYKG----KPMQFLRDTFVsltisggggttssalTWL  661
              +L+++ ++++ +   +LTS+M+   G    K  + LRDT ++  I+G   T+++   W 
Sbjct  266   EELNNRTNKNEEEGIDLLTSYMEDDYGSDWLKSDKLLRDTMLNFMIAGRDTTSAALS-WF  324

Query  660   FWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPM  481
             FWL+AKNP VE K+  E+    P   A++   F   E   L YLH A CE+LRLFPP+P 
Sbjct  325   FWLVAKNPSVETKIREELKSNLPAEEAEKWRVFDAGELSGLAYLHGALCEALRLFPPVPF  384

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
              HK  +  D LPSGH+V  +T+IL S Y MGRME +WG+DC+EFKPERW+++  G I+H 
Sbjct  385   EHKSPVCPDVLPSGHRVDERTKILFSLYGMGRMEGLWGKDCLEFKPERWITE-RGRIRHE  443

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             PS KF  F+ GPRTC+G+++ F   K+VAA+ I  YH E++E H  V P+ +++L +KHG
Sbjct  444   PSYKFLAFNAGPRTCLGKEVAFTQMKVVAAAFIHNYHVEVIEGHP-VSPNLSIILHMKHG  502

Query  120   VKVKLTKR  97
             + V++TKR
Sbjct  503   LMVRVTKR  510



>ref|XP_009615501.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=507

 Score =   417 bits (1071),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 221/482 (46%), Positives = 311/482 (65%), Gaps = 16/482 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP+ GMLP  L     +H+  T  ++++GGTF  KGP FA  DML T DPAN+ YI 
Sbjct  31    PRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGTFLFKGPLFAKMDMLATVDPANVHYIM  90

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             ++NF N+PKG  F+++F++ GDGI N D +LW + RKT  AL+ H  F   L +T  + V
Sbjct  91    SENFMNFPKGPKFREIFDVLGDGIFNADMDLWKIQRKTARALITHQQFYKFLVKTSREKV  150

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL PVLDH   +G   DLQ++F+R +FD    +    +PG + ++ P D PF KA+ D
Sbjct  151   EKGLIPVLDHVCHKGVIVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFP-DVPFSKAMDD  209

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED-  799
             A  AIL +H++PE  W+LQKW  GI  EKK  +AW+T D  I   +S+K ++L   + + 
Sbjct  210   AEEAILVRHVMPEAIWRLQKW-LGIGEEKKLIKAWETMDNVIGNYISKKRDKLLKTESEL  268

Query  798   --DSQNFSMLTSHMKAYKGKPM------QFLRDTFVsltisggggttssalTWLFWLLAK  643
               + + F +LT ++K  +G+ M      +FLRDT +   +  G  TTSSALTW  WL+ +
Sbjct  269   KLEDEGFDLLTFYLK--EGQNMGVNCDDKFLRDT-ILNLMIAGRDTTSSALTWFIWLVTQ  325

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             NP VE KL  EI  V P+    +   F V E   LVYLH A C+SLRL+PP+P  HK  L
Sbjct  326   NPQVEKKLREEINSVIPKEEVGKWRIFNVHELNKLVYLHGALCDSLRLYPPVPFQHKEPL  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV PK +IL S Y+MGRME+IWG+DC+EFKPERW+S+  G IKH PS KF 
Sbjct  386   KEDILPSGHKVHPKLKILFSLYAMGRMESIWGKDCLEFKPERWISE-RGTIKHEPSYKFL  444

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++ F   K VAA+II  Y  +++E H  + P+ +++L +++G KV+++
Sbjct  445   AFNAGPRTCLGKEVAFTQMKAVAATIIHNYQVQVVEGHP-IKPNTSIILYMRYGFKVRIS  503

Query  102   KR  97
             +R
Sbjct  504   RR  505



>gb|EYU33779.1| hypothetical protein MIMGU_mgv1a018283mg [Erythranthe guttata]
Length=454

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 219/459 (48%), Positives = 313/459 (68%), Gaps = 11/459 (2%)
 Frame = -3

Query  1464  HRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYPKGTHFQKMF  1285
             HR H+  T+ L + GGT+ L+GP F   ++L TSDPANI +I +K F+NYPKGT F+  F
Sbjct  2     HRAHEKITQVLNERGGTYLLRGPWFFRIEILFTSDPANIQHIFSKRFSNYPKGTEFRNKF  61

Query  1284  EIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVLDHYAQRGTH  1105
             EI GDGI ++D E+W+L R+T  +L++H  F  SLER V + +E+GL PVLD+++ +G  
Sbjct  62    EILGDGIFSSDFEMWELQRRTILSLISHAKFHTSLERNVWEKIETGLIPVLDYFSGQGIV  121

Query  1104  FDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYKHILPERFWK  925
              DLQEIF+R +FD   Q+ L+ +PGSL    P   P  KA   A+  ++Y+H+LPER WK
Sbjct  122   VDLQEIFQRFAFDNICQLVLEYDPGSLSAALPYI-PCEKAFSVALQPLMYRHVLPERIWK  180

Query  924   LQKWFFGIDREKKHAEAWDTFDKFIYPILS--EKLNQLHDQDEDDSQNFSMLTSHMKAYK  751
             LQKW   I  EKK  E+W  FD F+YPI+S  EK N+L D        +    ++   + 
Sbjct  181   LQKW-LKIGNEKKLTESWKAFDDFLYPIISSKEKNNRL-DVFTAFENAYENNNNNNVNFS  238

Query  750   GKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLFNEILK-VKPQNHAKQ  574
             G   +FLRD+ +   +  G  TTS+ +TWLF+L+A NPL E+K+ +EI + + P  +  +
Sbjct  239   GDLRKFLRDSLL-GLLFAGRDTTSTCITWLFYLIATNPLSESKILDEIEREIIPVKN--E  295

Query  573   TETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYS  394
                F +EE   LVYLHA  CESLRLFPP+ + +K  +E+DTLPSGH V   ++++ SFY+
Sbjct  296   WRFFNIEESKKLVYLHACLCESLRLFPPLALEYKSPIESDTLPSGHFVSRNSKVVISFYT  355

Query  393   MGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVA  214
             +GR E++WG+DC+EFKPERW++   GGIKH PS KFP F+VGPRTC+G++M F+  K+VA
Sbjct  356   VGRSESVWGKDCLEFKPERWITP-RGGIKHEPSYKFPAFNVGPRTCLGKEMSFIQMKMVA  414

Query  213   ASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             A+I++RY   L++ H LVVP D+L+L  K+G+KV+L +R
Sbjct  415   ATIVYRYRVRLVDGH-LVVPRDSLMLHAKNGLKVRLFER  452



>gb|EYU33778.1| hypothetical protein MIMGU_mgv1a020242mg [Erythranthe guttata]
Length=458

 Score =   415 bits (1066),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 219/474 (46%), Positives = 315/474 (66%), Gaps = 27/474 (6%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             MLP +++N HR HD  TE L + G TF L+GP F + D+L TSDPANI +I +K F+NYP
Sbjct  1     MLPTIVRNLHRAHDKLTEVLIECGATFLLRGPWFFDTDILFTSDPANIQHIFSKRFSNYP  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG+ F+  FEI GDG+ ++D ELW+L R+T  ++++H  F  SLER V + +E+GL PVL
Sbjct  61    KGSEFRNKFEILGDGVFSSDFELWELQRRTILSIISHAKFHTSLERNVWEKIETGLIPVL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             D+++ +G   DLQEIF+R +FD   Q+ L+ +PGSL    P   P  KA   A+  ++Y+
Sbjct  121   DYFSGQGIVVDLQEIFQRFAFDNICQLVLEYDPGSLSAALPYI-PCEKAFSIALQPLMYR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDSQNFSMLT  772
             H+LPE  WK+QKW   I  EKK +E+W  FD FIYPI+S K          +  N  + T
Sbjct  180   HVLPEIIWKMQKW-LNIGNEKKLSESWKAFDDFIYPIISSK----------EKINLDVFT  228

Query  771   SHMKAYK-------GKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLFN  613
             +   AY+       G   +FLRD+ +   +  G  TTS+ LTWLF+L+A NPL E+K+  
Sbjct  229   AFRNAYENNNNNFSGDSRKFLRDSLL-GLLFAGRDTTSTCLTWLFYLIATNPLSESKILE  287

Query  612   EILK--VKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSG  439
             EI +  V  +N  +      +E+   LVYLHA  CESLRLFPP+ + +K  +E+D LPSG
Sbjct  288   EIERELVPVKNEWR---FINIEKSKKLVYLHACLCESLRLFPPLALEYKSPIESDILPSG  344

Query  438   HKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRT  259
             H V+  ++++ SFY++GR E++WG DC+EFKPERW++   GGIKH PS KFP F+VGPRT
Sbjct  345   HFVRRNSKVVISFYTVGRTESVWGGDCLEFKPERWITP-RGGIKHEPSYKFPAFNVGPRT  403

Query  258   CIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             C+G++M F+  K+VAA+I++RY   L++ H+ V+P D+L+L  K+G+ V+L+ R
Sbjct  404   CLGKEMSFIQMKMVAATIVYRYRVRLVDGHS-VIPRDSLMLHAKNGLMVRLSYR  456



>ref|XP_004237624.1| PREDICTED: cytochrome P450 86B1-like [Solanum lycopersicum]
Length=510

 Score =   414 bits (1064),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 219/483 (45%), Positives = 312/483 (65%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P +WP++GMLP++L +   +HD  T  +   GGTF  KGP FA  D+L T DP+N+ YI 
Sbjct  31    PKSWPIVGMLPSMLFHLKHIHDRLTVIMSVTGGTFVPKGPLFAEMDILATVDPSNVHYIM  90

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             ++NF N+PKG  F+++F++ GDGI N D +LW + RKTT +L+ H  F   L +T    V
Sbjct  91    SQNFMNFPKGKKFKELFDVLGDGIFNADMDLWKIQRKTTRSLVTHQQFYKFLIKTSRDKV  150

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL  VLDH   +G   DLQ++F+R +FD    +    +PG + ++ P   PF KA+ D
Sbjct  151   EKGLVNVLDHVCNKGVIVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFPH-VPFSKALDD  209

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL------H  814
             A  AIL++H++PE  WKLQ+W  GI  EKK ++AW+T D  I   +S+K ++L       
Sbjct  210   AEEAILFRHVIPEPIWKLQRW-LGIGEEKKLSKAWETMDDVIGNYISKKRDELTKIETHD  268

Query  813   DQDEDDSQNFSMLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalTWLFWLLA  646
             D+ E++ + F +LT ++K  +G  +    +FLRDT +   +  G  TTSSALTW  WL+ 
Sbjct  269   DEVEENDEGFDLLTFYLKEGQGLGVNCDDKFLRDT-ILNLMIAGRDTTSSALTWFIWLVT  327

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             KNP VE KL  EI  + P+    +   F V E   LVYLH A C+SLRL+PP+P  HK  
Sbjct  328   KNPQVEKKLREEINSIIPKEEVGKFRVFNVHELNKLVYLHGALCDSLRLYPPVPFQHKEP  387

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             L+ DTLPSGHKV PKT IL S Y+M R E+IWG+DC+EFKPERW+S+  G IKH PS KF
Sbjct  388   LKEDTLPSGHKVHPKTMILFSLYAMARTESIWGKDCLEFKPERWISET-GTIKHEPSYKF  446

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+++ F   K VAA+II  Y  E++E  T + P+ +++L +++G KV++
Sbjct  447   MAFNAGPRTCLGKEVAFTQMKAVAATIIHNYKVEVVEGQT-IEPNTSIILYMRYGFKVRI  505

Query  105   TKR  97
             ++R
Sbjct  506   SRR  508



>ref|XP_009795100.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=505

 Score =   414 bits (1063),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 218/484 (45%), Positives = 314/484 (65%), Gaps = 11/484 (2%)
 Frame = -3

Query  1530  RRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPAN  1351
             R S  P NWP+ GMLP  L +  ++H+  T  ++ +GGTF  KGP FAN DML T DPAN
Sbjct  25    RDSKYPINWPIFGMLPGALYHIQQIHERCTMTMRASGGTFLFKGPWFANMDMLSTVDPAN  84

Query  1350  IDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERT  1171
             + YI + NF N+PKG  F++MF++ G+GI N D ++W + RKTT AL+ H+ F   L +T
Sbjct  85    VHYIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHLQFYKFLVKT  144

Query  1170  VCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFR  991
               + VE GL PVLD+   +G+  DLQ++F+R +FD    +    +PG + ++ P D PF 
Sbjct  145   SREKVEKGLIPVLDYICDKGSIVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFP-DVPFS  203

Query  990   KAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD  811
             KA+ DA  AIL++H LPE  WKLQ+W   I  EKK   A +T D  +   +S+K  +L +
Sbjct  204   KAMDDAEEAILFRHALPEIIWKLQRW-LRIGEEKKLIRARETLDYTLSKYISKKREKLKE  262

Query  810   QD--EDDSQNFSMLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalTWLFWLL  649
              +  ++  +   +LT ++K  +   +    ++LRDT +   +  G  TTSSALTW  WL+
Sbjct  263   GENVKESEEGIDLLTFYLKEEENLGVKCDDKYLRDT-ILNLMIAGRDTTSSALTWFIWLV  321

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             + NP V+ K+ +EI  + P+    +   F V+E   LVYLH A C+SLRL+PP+P  HK 
Sbjct  322   STNPQVKKKIRDEINSIIPKQEIGKWRLFNVQELNKLVYLHGALCDSLRLYPPVPFQHKE  381

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
              LE D LPSGHKV PK +I+ S Y+MGRME+IWG+DC+EFKPERW+SD GG IKH PS K
Sbjct  382   PLENDILPSGHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWISD-GGTIKHEPSYK  440

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++ F   K VAA+II  Y  EL++ H  + P+ +++L ++HG KV+
Sbjct  441   FLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGHP-IEPNASIILYMRHGFKVR  499

Query  108   LTKR  97
             +++R
Sbjct  500   ISRR  503



>ref|XP_010652863.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=502

 Score =   413 bits (1062),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 221/485 (46%), Positives = 316/485 (65%), Gaps = 12/485 (2%)
 Frame = -3

Query  1533  SRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             S  +M P NWP++GMLP + +N  ++ D  TE L+Q+ GTF LKGP FAN DML+TSDPA
Sbjct  23    SNSNMLPWNWPLVGMLPWIFRNIQQIQDRCTEVLEQSSGTFLLKGPWFANMDMLITSDPA  82

Query  1353  NIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLER  1174
             N+ YI + NF+N+PKG  F K+F++ G+GI N+DS+LW   RK    L+N   F+  L +
Sbjct  83    NVHYIMSTNFSNFPKGPEFLKIFDVLGEGIFNSDSDLWRKQRKLAQVLINDRQFQQFLVK  142

Query  1173  TVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPF  994
             T    V+ GL PVL+H +++G   DLQ++F+R +FD   ++    +   L +E P    F
Sbjct  143   TTENKVDEGLIPVLEHVSKQGLLVDLQDLFQRFTFDTTCKLITGFDTKCLSIEFPRVL-F  201

Query  993   RKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS---EKLN  823
              KA+ D   AI ++H++PE  WKLQ+W  GI  EKK ++ W+T D  I   +S   E+L+
Sbjct  202   AKAMDDVEEAIFFRHVVPESLWKLQRW-LGIGEEKKLSKGWETIDNVIAEYISMKHEELS  260

Query  822   QLHDQDEDDSQNFSMLTSHM---KAYKGKPMQFLRDTFVsltisggggttssalTWLFWL  652
             +   + ++D +   +LTS+M      + K  +FLRDT V   +  G  TTS+ALTW FWL
Sbjct  261   KGIAKLQEDEEGTDLLTSYMNEDSTMELKSNKFLRDTIV-NFLLAGRDTTSAALTWFFWL  319

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             ++KNPLVEAK+  E+ +  P+   K    F+ EE   LVYLH A CE+LRL+PP+P  HK
Sbjct  320   VSKNPLVEAKIREELKETIPEKDQKW-HIFRTEELNKLVYLHGALCETLRLYPPVPFQHK  378

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
                + D LPSGH+V PK +IL S Y+MGRM  IWG+DC EFKPERW+++  GGIK+ PS 
Sbjct  379   APHQADVLPSGHRVHPKMKILFSLYAMGRMTTIWGKDCFEFKPERWITE-QGGIKYEPSY  437

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTC+G+ + F   K VAA+II  Y+ +L++ H  V P+ +++L +KH + V
Sbjct  438   KFFAFNAGPRTCLGKGVAFTQMKAVAAAIIHNYNVQLVQGHP-VAPNVSIILHMKHELMV  496

Query  111   KLTKR  97
             ++TKR
Sbjct  497   RVTKR  501



>ref|XP_009759082.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=507

 Score =   411 bits (1056),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 219/482 (45%), Positives = 308/482 (64%), Gaps = 16/482 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP+ GMLP  L     +H+  T  ++++GGTF  KGP FA  DML T DPAN+ YI 
Sbjct  31    PRNWPIFGMLPGTLYYMQEIHERVTMTMRRSGGTFLFKGPIFAKLDMLATVDPANVHYIM  90

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             ++NF N+PKG  F+++F++ GDGI N D +LW + RKT  AL+ H  F   L +T  + V
Sbjct  91    SENFMNFPKGPKFREIFDVLGDGIFNADLDLWKIQRKTARALITHQQFYKFLVKTSREKV  150

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL PVL+H   +G   DLQ++F+R +FD    +    +PG + ++ P D PF KA+ D
Sbjct  151   EKGLIPVLNHVCHKGVIVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFP-DVPFSKAMDD  209

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED-  799
             A   IL +H++PE  W+LQKW  GI  EKK  +AW+  D  I   +S+K ++L   + + 
Sbjct  210   AEEVILVRHVMPEAIWRLQKW-LGIGEEKKLIKAWEIMDNVIGNYISKKRDKLLKMEPEL  268

Query  798   --DSQNFSMLTSHMKAYKGKPM------QFLRDTFVsltisggggttssalTWLFWLLAK  643
               + + F +LT ++K  +G+ M      +FLRDT +   +  G  TTSSALTW  WL+ +
Sbjct  269   KLEDEGFDLLTFYLK--EGQYMGVNCDDKFLRDT-ILNLMIAGRDTTSSALTWFIWLVTQ  325

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             NP VE KL  EI  V P+        F V E   LVYLH A C+SLRL+PP+P  HK  L
Sbjct  326   NPQVEKKLREEINSVIPKEEVGNWRLFNVHELNKLVYLHGALCDSLRLYPPVPFQHKEPL  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV PK +IL S Y+MGRME+IWG+DC+EFKPERW+S+  G IKH PS KF 
Sbjct  386   QEDMLPSGHKVHPKLKILFSLYAMGRMESIWGKDCLEFKPERWISE-RGTIKHEPSYKFL  444

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++ F   K VAA+II  Y  +++E H  + P+ +++L ++HG KV+++
Sbjct  445   AFNAGPRTCLGKEVAFNQMKAVAATIIHNYQVQVVEGHP-IKPNTSIILYMRHGFKVRIS  503

Query  102   KR  97
             +R
Sbjct  504   RR  505



>ref|XP_002275905.2| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=522

 Score =   411 bits (1057),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 220/484 (45%), Positives = 318/484 (66%), Gaps = 18/484 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GM P++  + HR+HD  T+ L+++G TF +KGP F N D+L+T+DPAN+ YI 
Sbjct  44    PWNWPLLGMFPSVFLHLHRIHDRVTDILEKSGCTFLVKGPWFCNMDLLVTTDPANVHYIM  103

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + +F+N+PKG+ F K+F+  GDGI N+D+E W   RK    ++N++     L +     V
Sbjct  104   SSHFSNFPKGSEFSKIFDFLGDGIFNSDAESWRKQRKLGQLMINNVRLYRFLGKITQNKV  163

Query  1155  ESGLFPVLDHYA-QRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAII  979
             E GL P+LD+ + Q     DLQ++F+RL+FD    +    +   L +E P + PF  A+ 
Sbjct  164   EKGLLPILDYLSEQEDRAMDLQDVFQRLTFDTTCMLVTGFDSKCLSIELP-EVPFATALE  222

Query  978   DAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD----  811
             DA  AIL++H+LPE  W+LQ+W  GI +EKKH +AW+T D  I   +S+K ++L      
Sbjct  223   DAEEAILHRHVLPETLWRLQRW-LGIGKEKKHQKAWETLDHTIAEYISKKRDELSKGIIN  281

Query  810   -QDEDDSQNFSMLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalTWLFWLLA  646
              Q+E+D  +  +LTS+M       +    +FLRDT +   +  G  TTSSALTW FWL++
Sbjct  282   LQEEEDGVD--LLTSYMSEDITMGLKCDHKFLRDT-ILNFMIAGRDTTSSALTWFFWLVS  338

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTE-TFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             KNPLVE+K+  E+    P+   K+   TFK E    LVYLHAA CE+LRL+PP+P  HK 
Sbjct  339   KNPLVESKIREELESAIPEKEDKKGRHTFKTEALNKLVYLHAALCETLRLYPPVPFQHKA  398

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
              L+ D LPSGH+V PK +IL S Y+MGRM +IWG DC+EFKPERW+S+  G IKH PS K
Sbjct  399   PLQPDMLPSGHRVDPKMKILFSLYAMGRMTSIWGTDCLEFKPERWISE-RGRIKHEPSYK  457

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++ F   K VAA+II  YH +++E H  V P+ +++L +KHG+ V+
Sbjct  458   FFAFNAGPRTCLGKEVAFTQMKAVAATIIHNYHVQVVEGHH-VAPNVSIILYMKHGLMVR  516

Query  108   LTKR  97
             ++KR
Sbjct  517   VSKR  520



>ref|XP_009614166.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=505

 Score =   410 bits (1054),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 220/484 (45%), Positives = 312/484 (64%), Gaps = 11/484 (2%)
 Frame = -3

Query  1530  RRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPAN  1351
             R S  P NWP+ GMLP  L +  ++H+  T  ++ +GGTF  KGP FAN DML T DPAN
Sbjct  25    RDSKYPINWPIFGMLPGALYHIQQIHERCTMTMRASGGTFLFKGPWFANMDMLSTVDPAN  84

Query  1350  IDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERT  1171
             + YI + NF N+PKG  F++MF++ G+GI N D ++W + RKTT AL+ H  F   L +T
Sbjct  85    VHYIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKIQRKTTRALITHQQFYKFLVKT  144

Query  1170  VCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFR  991
                 VE GL PVLD+   +G+  DLQ++F+R +FD    +    +PG + ++ P D PF 
Sbjct  145   SRDKVEKGLIPVLDYICDKGSIVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFP-DVPFS  203

Query  990   KAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD  811
             KA+ DA  AIL++H LPE  WKLQ+W   I  EKK   A +T D  I   +S+K ++L +
Sbjct  204   KAMDDAEEAILFRHALPEIIWKLQRW-LRIGEEKKLIRARETLDYTISKYISKKRDELKE  262

Query  810   QD--EDDSQNFSMLTSHMKAYKGKPMQ----FLRDTFVsltisggggttssalTWLFWLL  649
              D  ++  + F +LT ++K  +   ++    +LRDT +   +  G  TTSSALTW  WL+
Sbjct  263   GDKLKESEEGFDLLTFYLKEEENLGVKCDDNYLRDT-ILNLMIAGRDTTSSALTWFIWLV  321

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             + NP VE K+ +EI  + P+    +   F V+E   LVYLH A C+SLRL+PP+P  HK 
Sbjct  322   STNPQVEKKIRDEINFIIPKQEVGKWRLFNVQELNKLVYLHGALCDSLRLYPPVPFQHKE  381

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
              LE D LPS HKV PK +I+ S Y+MGRME+IWG+DC+EFKPERW+SD  G IKH PS K
Sbjct  382   PLEKDILPSVHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWISD-RGTIKHEPSYK  440

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++ F   K VAA+II  Y  EL++ H  + P+ +++L ++HG KV+
Sbjct  441   FLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGHP-IEPNASIILYMRHGFKVR  499

Query  108   LTKR  97
             +++R
Sbjct  500   ISRR  503



>ref|XP_004237151.1| PREDICTED: cytochrome P450 86B1 [Solanum lycopersicum]
Length=506

 Score =   409 bits (1050),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 224/485 (46%), Positives = 305/485 (63%), Gaps = 12/485 (2%)
 Frame = -3

Query  1530  RRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPAN  1351
             R S  P N+P+ GMLP LL N  ++H+  T  +K +GGTF  KG  FAN D L T DPAN
Sbjct  25    RHSNYPINFPIFGMLPGLLYNIQQIHERCTMSMKASGGTFLFKGLWFANMDTLTTVDPAN  84

Query  1350  IDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERT  1171
             + YI + NF N+PKG  F++MF++ G+GI N D ++W + RK T +L+ H  F   L +T
Sbjct  85    VHYIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRSLITHHEFYKFLVKT  144

Query  1170  VCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFR  991
              C  VE GL PV+DH   +G   DLQ++F+R +FD    +    +PG + ++ P D PF 
Sbjct  145   SCDKVEKGLIPVIDHVCNKGCVVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFP-DVPFS  203

Query  990   KAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD  811
             KA+ DA  AIL++H LPE  WKLQ+W   I  EKK   A +  D  I   +S K   L +
Sbjct  204   KAMDDAEEAILFRHALPEIVWKLQRW-LRIGEEKKMINAQEVLDYTIDKYISMKREDLKE  262

Query  810   QDED---DSQNFSMLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalTWLFWL  652
              D D     + F +LT ++K  K   +    +FLRD  +   +  G  TTSSALTW  WL
Sbjct  263   VDHDLKESEEGFDLLTFYLKDEKELGVKCDDKFLRDN-ILNLMIAGRDTTSSALTWFIWL  321

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             ++ NP VE K+ +EI  V P    ++   F V+E   LVYLH A C+SLRL+PP+P  HK
Sbjct  322   VSTNPQVEKKIRDEINFVIPNEEGEKFRLFNVQELNKLVYLHGALCDSLRLYPPVPFQHK  381

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
               LE D LPSGHKV PK +I+ S Y+MGRME+IWG+DC+EFKPERW+S+  G IKH PS 
Sbjct  382   EPLEEDILPSGHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWISE-RGTIKHEPSY  440

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTC+G+++ F   K VAA+II  Y  EL++ H +V P+ +++L ++HG KV
Sbjct  441   KFLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGH-IVEPNASIILYMRHGFKV  499

Query  111   KLTKR  97
             K+ KR
Sbjct  500   KINKR  504



>ref|XP_002279531.1| PREDICTED: cytochrome P450 86B1 [Vitis vinifera]
Length=507

 Score =   408 bits (1048),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 221/481 (46%), Positives = 304/481 (63%), Gaps = 13/481 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GM   LL + HR+HD A E L++ G TF  KGP F N DML T+DPAN+ YI 
Sbjct  29    PWNWPIVGMFAGLLFHVHRIHDEAAEILEKTGCTFLFKGPWFCNMDMLGTTDPANVHYIM  88

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+N+PKGT F+KMFE+ GDGI N D E W   RK   +++N+  F   L +     V
Sbjct  89    SSNFSNFPKGTEFRKMFEVLGDGIFNADGESWRNQRKLGQSMINNPRFHRFLAKVTYNKV  148

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH +++G   DLQ++F+RL+FD    +    +   L +E P + PF  A+ D
Sbjct  149   EKGLVPLLDHLSEQGRVVDLQDVFQRLTFDTTCMLVTGFDTKCLSIEFP-EVPFATALED  207

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS---EKLNQLHDQD  805
                A+ Y+H LPE  W+L +W  GI +EKK  + W T D  I   +S   E+L++   + 
Sbjct  208   VEEAVFYRHALPETLWRLLRW-LGIGKEKKLRKGWKTLDHTIAEYISMKREELSKGITKL  266

Query  804   EDDSQNFSMLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalTWLFWLLAKNP  637
              +D     +LTS+M       +    +FLRDT +   +  G  TTSSALTW FWL++KNP
Sbjct  267   REDEDGADLLTSYMTEDNAIGLKCDGKFLRDT-ILNFMIAGRDTTSSALTWFFWLVSKNP  325

Query  636   LVEAKLFNEILKVKPQNHAKQTE-TFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             LVE+K+  EI    P+   ++    FK E    LVYLHAA CE+LRL+PP+P  HK  ++
Sbjct  326   LVESKIREEIETAIPEKEDRKGRHIFKTEGLNKLVYLHAAMCEALRLYPPVPFQHKAPIQ  385

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              D LPSGHKV PK +I    Y+MGRM AIWG+DC+EFKPERW+S+  G IKH PS KF  
Sbjct  386   PDVLPSGHKVDPKMKIFFPVYAMGRMTAIWGKDCLEFKPERWISEL-GKIKHEPSYKFFS  444

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTCIG+++ F   K VAA+II  YH E+++ H  V P+ +++L +K G KV+++K
Sbjct  445   FNAGPRTCIGKEVAFTQMKAVAATIIHNYHVEMVKGHH-VAPNVSIILYMKRGFKVRVSK  503

Query  99    R  97
             R
Sbjct  504   R  504



>ref|XP_006370230.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
 gb|ERP66799.1| hypothetical protein POPTR_0001s40840g [Populus trichocarpa]
Length=519

 Score =   408 bits (1048),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 214/505 (42%), Positives = 317/505 (63%), Gaps = 30/505 (6%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W +  +   D  NWP++GMLP LL N+  ++++ T  L+ NGGT + KGP FAN D ++T
Sbjct  22    WDQIRKLDADKRNWPIVGMLPRLLINSSNVYEYTTRTLRNNGGTSKFKGPWFANMDFVIT  81

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDP N+ +I + NF NYPKG  ++K+FE  GDGILN+DSE W   RK     M +  ++ 
Sbjct  82    SDPKNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRKMIQLFMKNNKYKE  141

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTH--FDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
              +E+T+ Q +  GLFP+LDH +++      D+Q++ +R  +D      L  +P  L +E 
Sbjct  142   LVEKTILQKLVQGLFPILDHVSRKEMSEIIDMQDVIQRFMYDSNCMSVLGFDPNCLTIEF  201

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P +    KA      A+ Y+HI+PE +WK QKW   I  EKK + A  TFD+F+Y  +S 
Sbjct  202   P-EVAHAKAFDIMEEAVFYRHIVPEFYWKFQKW-LQIGEEKKLSRALQTFDQFMYKCIST  259

Query  831   KLNQLHDQ---------DEDDSQNFSMLTSHMKAY-------KGKPMQFLRDTFVsltis  700
             +  Q+ ++         +E ++ +F +LT+++K              +FLRDT  +  + 
Sbjct  260   RCEQVLNENKAKMENIVEEKEAADFDLLTAYIKVQMKEHGNSAASSNKFLRDT-ATNLLV  318

Query  699   ggggttssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTE----TFKVEECCDLVY  532
              G  T S+ L W FWL+A++PLVE+K+  EI   +  N  K+ +     F  EE   LVY
Sbjct  319   AGRDTPSAGLVWFFWLVAEHPLVESKILEEI---RAANLVKEKDGKLRVFSAEEVNGLVY  375

Query  531   LHAAFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCME  352
             LHAA CE+LRL+P +  NHK ++E DTLPSGH+++ K ++L SFYSMGRMEAIWG+DC+E
Sbjct  376   LHAAMCETLRLYPSVHTNHKAAVEEDTLPSGHRIRRKMQVLISFYSMGRMEAIWGKDCLE  435

Query  351   FKPERWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEP  172
             FKPERW+SD  GGI HVP  KF  F+ GPRTC+G+ + F+  K+VA ++++ YH +++E 
Sbjct  436   FKPERWISD-KGGIIHVPPYKFAAFNDGPRTCLGKDVSFIQMKMVACAVLWNYHVQVVEG  494

Query  171   HTLVVPSDTLVLEVKHGVKVKLTKR  97
             H  V PS  +VL +K+G+KV++TKR
Sbjct  495   HQ-VFPSVAVVLHMKNGLKVRITKR  518



>gb|KDP35257.1| hypothetical protein JCGZ_09416 [Jatropha curcas]
Length=502

 Score =   407 bits (1045),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 221/479 (46%), Positives = 306/479 (64%), Gaps = 13/479 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP+ GMLP  L + HRL+++ TE +++ G TF  KGP F+N  +L+T DP N+ Y+ 
Sbjct  29    PINWPIFGMLPETLYHLHRLYEWLTEKIERAGLTFFYKGPWFSNVKILITVDPTNVHYVM  88

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+N+PKG+ F K+F+I GDGI N DS  W   RK    L+N   F   L     + V
Sbjct  89    SSNFSNFPKGSEFSKIFDILGDGIFNADSHSWKTQRKLVQTLINRGCFHNFLIEACQEMV  148

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL PV++H + + +  DLQ++F+R +FDI  ++    NP SL  E P    F KA+ D
Sbjct  149   EKGLVPVIEHASDQDSVVDLQDLFQRFTFDITCELVTGYNPRSLSTEFPKIE-FSKALDD  207

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
             A  A+ Y+HI+PE  WK Q+W  GI +EKK A+A    D      +S K  QL   ++  
Sbjct  208   AEEALFYRHIIPEFIWKFQRW-LGIGQEKKMAKAEKVLDDTSRKYISRKREQLVKNNK--  264

Query  795   SQNFSMLTSHM----KAYKGKP-MQFLRDTFVsltisggggttssalTWLFWLLAKNPLV  631
              +   MLTS+M    K  + KP  +FLRDT +   +  G  TTSSALTW FWL++KNP  
Sbjct  265   GEGVDMLTSYMNEGEKILESKPDEKFLRDTII-NLLLAGRDTTSSALTWFFWLISKNPRA  323

Query  630   EAKLFNEILKVKPQNHAKQTE-TFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETD  454
             E+K+  EI ++  Q     T     V+E   LVYLHAA CE+LRL+PP+P  HK  L+ D
Sbjct  324   ESKIRQEIQEITLQGKKANTWCALNVQEVNSLVYLHAALCETLRLYPPVPFQHKSPLQKD  383

Query  453   TLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFS  274
              LPSGH+V P+ +I+   Y+MGRM +IWGEDC+EFKPERW+++ GG IKH PS KF  F+
Sbjct  384   VLPSGHEVNPEMKIVICSYAMGRMASIWGEDCLEFKPERWITE-GGKIKHEPSYKFLAFN  442

Query  273   VGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
              GPRTC+G+++ F   KIVAASII  YH +++E H  V P+ +++L +KHG+KVK+T+R
Sbjct  443   AGPRTCLGKEVAFTQMKIVAASIIHNYHVKVVEDHP-VSPNVSIILHMKHGLKVKVTRR  500



>ref|XP_002529227.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33140.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   407 bits (1045),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 221/480 (46%), Positives = 298/480 (62%), Gaps = 12/480 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP  + N HR+H+   E L+QNG TF   GP F+N  +L T DPANI Y+ 
Sbjct  29    PINWPVVGMLPDTIFNFHRIHERFAEVLEQNGLTFLYAGPWFSNVKILGTVDPANIHYVM  88

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG+ F K+F I GDGI N+DS+ W   RKT  AL+NH  F   L +T    V
Sbjct  89    SSNFANFPKGSEFSKIFNILGDGIFNSDSDSWKNQRKTAQALINHQRFHQFLVKTCRNMV  148

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL PVL+H A + +  DLQ+IF+R +FDI   +    NP  L +  P +  F KAI D
Sbjct  149   EKGLLPVLEHVADQESVMDLQDIFQRFTFDITCILVTGYNPKCLSIAFP-EVEFSKAIDD  207

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD--E  802
             A  A+ Y+H  PE  WKLQ+W  G  +E K  +AW   D      +S K  QL +     
Sbjct  208   AEEALFYRHFCPEYTWKLQRW-LGFGQEWKMEKAWKVLDDVSARFVSRKREQLKEGSILR  266

Query  801   DDSQNFSMLTSHMKA--YKGKPM---QFLRDTFVsltisggggttssalTWLFWLLAKNP  637
             +D +   +LTS+M +      P    +FLRDT +   +  G  TTSSALTWLFWL+ KNP
Sbjct  267   EDGEGVDLLTSYMSSEVESNGPQPEDKFLRDTII-NFLLAGRDTTSSALTWLFWLVCKNP  325

Query  636   LVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
              V +K+  EI    P+N  ++   F  +E   LVYLH AFCESLRL+PP+P  HK  L  
Sbjct  326   QVLSKIREEIKAKIPENQDEKCRMFNPQELNSLVYLHGAFCESLRLYPPVPFQHKAPLRE  385

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGHKV P  +I+   YSMGRM +IWGEDC+EFKPERW++  GG IKH PS KF  F
Sbjct  386   DVLPSGHKVSPDMKIIFCLYSMGRMASIWGEDCLEFKPERWIT--GGKIKHEPSYKFLAF  443

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+++ F+  K VAA ++  Y+  L+E   +   +++++L +K+G+KV +++R
Sbjct  444   NAGPRTCLGKEIAFIQMKTVAAFVLNNYNVHLVEGQHVSPATNSIILHMKYGLKVSVSRR  503



>ref|XP_011043827.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=520

 Score =   406 bits (1044),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 215/504 (43%), Positives = 315/504 (63%), Gaps = 27/504 (5%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W +  +   D  NWPV+GMLP LL N+  ++++ T+ L+ NGGT + KGP FAN D ++T
Sbjct  22    WDQIRKLDADKANWPVVGMLPRLLINSSNVYEYTTQALRNNGGTSKFKGPWFANMDFVIT  81

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDP N+ +I + NF NYPKG  ++K+FE  GDGILN+DSE W   RK     M +  ++ 
Sbjct  82    SDPRNVHHILSDNFANYPKGPVYKKIFEPLGDGILNSDSESWRAQRKMIQLFMKNNKYKG  141

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTH--FDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
              +E+T+ Q +  GLFP+LDH +++      D+Q++ +R  +D      L  +P  L +E 
Sbjct  142   LVEKTILQKLVQGLFPILDHVSRKEMSEIIDMQDVIQRFMYDSNCMSVLGFDPNCLTIEF  201

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P +    KA      AI Y+HI+PE +WK QKW   I  EKK + A  TFD+F+Y  +S 
Sbjct  202   P-EVAHAKAFDIMEEAIFYRHIVPEFYWKFQKW-LQIGEEKKLSRALQTFDQFMYKCIST  259

Query  831   KLNQLHDQ---------DEDDSQNFSMLTSHMKAY-------KGKPMQFLRDTFVsltis  700
             +  Q+ ++         +E ++ +F +LT+++K              +FLRDT  +  + 
Sbjct  260   RCEQVLNENKAKMENLVEEKEAADFDLLTAYIKVQMKEHGNSAASSNKFLRDT-ATNLLV  318

Query  699   ggggttssalTWLFWLLAKNPLVEAKLFNEILK---VKPQNHAKQTETFKVEECCDLVYL  529
              G  T  + L W FWL+A++PLVE K+  EI     VK ++  K    F  EE   LVYL
Sbjct  319   AGRDTPGAGLVWFFWLVAEHPLVENKILEEIRAANLVKEKDIGK-LRVFSAEEVNGLVYL  377

Query  528   HAAFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEF  349
             HAA CE+LRL+P +  NHK ++E D LPSGH+++ K ++L SFYSMGRMEAIWG+DC+EF
Sbjct  378   HAAMCETLRLYPSVHTNHKAAVEEDILPSGHRIRRKMQVLISFYSMGRMEAIWGKDCLEF  437

Query  348   KPERWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPH  169
             KPERW+SD  GGI HVP  KF  F+ GPRTC+G+ + F+  K+VA ++++ YH +++E H
Sbjct  438   KPERWISD-KGGIIHVPPYKFAAFNDGPRTCLGKDVSFIQMKMVACAVLWNYHVQVIEDH  496

Query  168   TLVVPSDTLVLEVKHGVKVKLTKR  97
               V PS  +VL +K+G+KV++TKR
Sbjct  497   Q-VFPSVAVVLHMKNGLKVRITKR  519



>ref|XP_011100902.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   405 bits (1040),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 217/491 (44%), Positives = 318/491 (65%), Gaps = 13/491 (3%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             +W  S+   M P NWP++GMLP++  + +++HD      +Q GGTF LKGP FAN D++ 
Sbjct  21    VWCFSNINGM-PWNWPLVGMLPSVFWHVNQIHDRCVNIFEQVGGTFLLKGPWFANMDIIA  79

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T+DPAN+ +I + NF N+PKG  F+K+F++ GDGI N+D++LW   RK   AL+ H  FR
Sbjct  80    TADPANVHFIMSANFANFPKGAEFKKIFDVLGDGIFNSDADLWRSQRKQARALITHERFR  139

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
               L +T  + VE GL PVL+H +++G   DLQ++F+RL+FD    +    +PG L  E P
Sbjct  140   KFLIKTSWEKVEKGLIPVLEHVSEQGMVIDLQDLFQRLTFDTTCILVTGFDPGCLSTEFP  199

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS--  835
              D PF KA+ +A  AIL +H LPE  W+L K   GI  EKK + AW   D  I   +S  
Sbjct  200   -DVPFSKAMDEAEEAILMRHCLPESLWRLGK-LLGIGPEKKLSRAWTVLDDVIGKYVSMK  257

Query  834   -EKLNQLHDQDEDDSQNFSMLTSHMKAYKGKPMQ----FLRDTFVsltisggggttssal  670
              E++++ +  +EDD +   +LTS++   +   ++    FLRDT +   +  G  TTSSAL
Sbjct  258   REEMSKSNKCNEDDDEGLDLLTSYINGDESTGLECNDKFLRDT-ILNFMIAGRDTTSSAL  316

Query  669   TWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPP  490
             TW  WL++ +P VE K+ +E+  V P   + +   F+V+E  +LVYLH A CE+LRL+PP
Sbjct  317   TWFLWLVSTHPEVERKIRDELNSVVPAKDSNKWRMFQVDELRNLVYLHGALCEALRLYPP  376

Query  489   IPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGI  310
             +P  HK  ++   LPSGH V PK +IL S Y+MGRM+ IWG+D  EFKPERW++D  G I
Sbjct  377   VPFQHKAPIQPVMLPSGHYVHPKMKILFSLYAMGRMDYIWGKDSKEFKPERWITD-RGTI  435

Query  309   KHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEV  130
             K+ PS KF  F+ GPRTC+G+++ F   K VAA+II  Y  E+++ H +V P+ +++L +
Sbjct  436   KYEPSYKFLAFNAGPRTCLGKEVAFTQLKAVAAAIIHNYQVEVVKGH-IVTPNVSVILYM  494

Query  129   KHGVKVKLTKR  97
             KHG+KV+++KR
Sbjct  495   KHGLKVRISKR  505



>ref|XP_006346789.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=505

 Score =   403 bits (1036),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 220/484 (45%), Positives = 306/484 (63%), Gaps = 11/484 (2%)
 Frame = -3

Query  1530  RRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPAN  1351
             R S  P N+P+ GMLP LL N  ++H+  T  ++ +GGTF  KG  FAN D L T DPAN
Sbjct  25    RHSNYPINFPIFGMLPGLLYNIQQIHERCTMSMRASGGTFLFKGLWFANMDTLTTVDPAN  84

Query  1350  IDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERT  1171
             + YI + NF N+PKG  F++MF++ G+GI N D ++W + RK T AL+ H  F   L +T
Sbjct  85    VHYIMSANFMNFPKGPKFKEMFDVLGNGIFNADLDMWKVQRKMTRALITHHEFYKFLVKT  144

Query  1170  VCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFR  991
                 VE GL PV+DH   +G   DLQ++F+R +FD    +    +PG + ++ P D PF 
Sbjct  145   SRDKVEKGLIPVIDHVCNKGCVVDLQDLFQRFTFDTTCILVTGYDPGCVSIDFP-DVPFS  203

Query  990   KAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD  811
             KA+ D   AIL++H LPE  WKLQ+W   I  EKK   A +  D  I   +S+K   L +
Sbjct  204   KAMDDVEEAILFRHALPEIVWKLQRW-LRIGEEKKMINAQEVLDYTIDKYISKKREDLKE  262

Query  810   QDE--DDSQNFSMLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalTWLFWLL  649
              D+  +  + F +LT ++K  K   +    +FLRD  +   +  G  TTSSALTW  WL+
Sbjct  263   GDDLKESEEGFDLLTFYLKDEKSLGVKCDDKFLRDN-ILNLMIAGRDTTSSALTWFIWLV  321

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             + NP VE K+ +EI  V P    ++ + F V+E   LVYLH A C+SLRL+PP+P  HK 
Sbjct  322   STNPQVEKKIRDEINFVIPNEEVEKFKLFNVQELNKLVYLHGALCDSLRLYPPVPFQHKE  381

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
              LE D LPSGHKV PK +I+ S Y+MGRME+IWG+DC+EFKPERW+S+  G IKH PS K
Sbjct  382   PLEEDILPSGHKVHPKLKIMFSLYAMGRMESIWGKDCLEFKPERWISE-RGTIKHEPSYK  440

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++ F   K VAA+II  Y  EL++ H +V P+ +++L ++HG KV+
Sbjct  441   FLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVELVKGH-IVEPNASIILYMRHGFKVR  499

Query  108   LTKR  97
             + KR
Sbjct  500   INKR  503



>gb|KDP35260.1| hypothetical protein JCGZ_09419 [Jatropha curcas]
Length=506

 Score =   402 bits (1033),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 221/485 (46%), Positives = 301/485 (62%), Gaps = 13/485 (3%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             ++  P NWPV GMLP  L + HR+H   TE L++ G T   KGP F+N  +L T DP NI
Sbjct  25    KNGQPINWPVFGMLPDTLYHLHRIHQRTTEVLERAGSTLYYKGPWFSNVKILATVDPTNI  84

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              YI + NF+N+PKG  F K+F+I GDGI N+DS  W   RK  + L+N   F   L  T 
Sbjct  85    HYIMSSNFSNFPKGPEFSKIFDILGDGIFNSDSNSWKNQRKLAHTLINRGCFHKFLINTC  144

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
                VE GL PVL+H + +    DLQ++F+R +FDI   +    NP  L +E P    F K
Sbjct  145   QDMVEKGLLPVLEHVSDQDLEVDLQDLFQRFTFDITCALVTGYNPRCLSIELPLVE-FSK  203

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL--H  814
             A+ DA  A+ Y+H+ PE  WKLQ+W  GI +EKK A+A    D      +S K  QL  +
Sbjct  204   AMDDAEEALFYRHLTPEFVWKLQRW-LGIGQEKKMAKARKVLDDTSRNYISRKREQLVKN  262

Query  813   DQDEDDSQNFSMLTSHM----KAYKGKP-MQFLRDTFVsltisggggttssalTWLFWLL  649
             +  +++ +   +LTS+M    K     P  +FLRDT +   +  G  TTSS L+W FWL+
Sbjct  263   NNIQENGEGVDLLTSYMNEGDKILGTIPDEKFLRDTII-NLLLAGRDTTSSGLSWFFWLI  321

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQT-ETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             +KNP  E+K+  EI ++  Q     T     V+E   LVYLHAA CESLRL+PP+P  HK
Sbjct  322   SKNPRAESKIRQEIQEITLQGKKANTWCALNVQEVNSLVYLHAALCESLRLYPPVPFQHK  381

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
               L+ D LPSGH+V P+ +I+   YSMGRM +IWGEDC+EFKPERW+S  GG IKH PS 
Sbjct  382   SPLQNDVLPSGHEVSPEMKIVFCLYSMGRMASIWGEDCLEFKPERWISG-GGKIKHEPSY  440

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTC+G+++ F   KIVAASI+  Y+ +++E H  V PS +++L +KHG+KV
Sbjct  441   KFLAFNAGPRTCLGKEVAFTQMKIVAASILHNYNVKVVEDHP-VTPSASIILHMKHGLKV  499

Query  111   KLTKR  97
              +++R
Sbjct  500   NVSRR  504



>ref|XP_002521474.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40964.1| cytochrome P450, putative [Ricinus communis]
Length=509

 Score =   401 bits (1030),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 217/496 (44%), Positives = 314/496 (63%), Gaps = 20/496 (4%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALL-QNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             +W +S  R +  TNWPV+GM+P LL +    +HDFAT  L+++GGT   +GP F+  + L
Sbjct  19    VWWRS--RGLVVTNWPVVGMIPGLLFRPISSVHDFATYVLQRSGGTLLFQGPWFSGMNFL  76

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             +TSDP N+ YI +KNF NYPKG  F+++FE+ GDGI N DS+ W + R+  ++L+    F
Sbjct  77    MTSDPMNVQYIVSKNFANYPKGPDFRQIFEVLGDGIFNVDSDSWRIQRRIMHSLLKSKRF  136

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
               ++ERTV   +  GLF VLD+ ++  +  D+Q++F+R +FD    + L  +P SL +E 
Sbjct  137   HLAVERTVEHKILKGLFVVLDNVSELASEVDIQDVFQRFTFDSICILALSYDPDSLSIEF  196

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   PF KA  D   A+LY++++P   WKLQK    I +EKK   AWDTFD+F+   ++ 
Sbjct  197   PH-VPFAKAFDDIEEAVLYRYLVPSSIWKLQK-RLRIGKEKKLRNAWDTFDRFLEQCITR  254

Query  831   KLNQLH---DQDEDDSQNFSMLTSHMKAYKG-------KPMQFLRDTFVsltisggggtt  682
             K  Q+    +Q E D   F +LT +    +G       K  + LRDT  +  +  G  T 
Sbjct  255   KREQVRRSKNQKERDQDYFDLLTYYFMEVEGGDVNVPVKSNKLLRDT-ATALLIAGRDTV  313

Query  681   ssalTWLFWLLAKNPLVEAKLFNEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESL  505
             S+AL W FWL+  +P  E K+  EI  KV+P  +  +   F +E    LVYLHAA CE+L
Sbjct  314   SAALAWFFWLIGTHPSAEKKILEEIKAKVQPDTN-DEWRHFSLEALNKLVYLHAAICETL  372

Query  504   RLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD  325
             RL+P IP+NHKMS+E D LPSGH+V   TRIL   YSMGRME IWG+DC EFKPERW+ +
Sbjct  373   RLYPSIPINHKMSVEADVLPSGHRVPGNTRILYFLYSMGRMEEIWGKDCSEFKPERWICE  432

Query  324   CGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDT  145
               G IKH+PS K+  F+ GPRTC+G+ + F+  KIVA++II+ Y  ++++      P ++
Sbjct  433   -KGQIKHIPSYKYIAFNAGPRTCLGKDLTFLQMKIVASAIIWNYSLQVVDNRP-ATPCNS  490

Query  144   LVLEVKHGVKVKLTKR  97
             +VL +K G+KV+++KR
Sbjct  491   VVLHMKGGLKVRVSKR  506



>ref|XP_011025593.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=513

 Score =   400 bits (1027),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 217/479 (45%), Positives = 300/479 (63%), Gaps = 11/479 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP++GMLP  +QN HR ++   E ++ +GG+F  K   F +  +L T DPANI YI 
Sbjct  38    PTNWPLVGMLPDSIQNLHRPYERIAEVIQLSGGSFIYKSLWFLSPHVLNTVDPANIHYIM  97

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+N+PKG+ F ++F+I GDGI N DS LW   RK  + L+NH  F+  L  +    V
Sbjct  98    SSNFSNFPKGSMFSRIFDILGDGIFNADSHLWKNQRKLAHMLINHQQFQRFLVNSSWSKV  157

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL PVL+  A++G+  DLQ++F+R +FDI   +    +PG L +E P    F KA+ D
Sbjct  158   EKGLIPVLEQVAKQGSVVDLQDVFQRFTFDITSILVTGYDPGCLSIEFPQVE-FSKAMDD  216

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDE--  802
             A  AI Y+H+ PE F KLQ+W  G   E+K  EAW T D  +   +S K  +L+ ++   
Sbjct  217   AEEAIFYRHLWPEIFLKLQRW-LGFGHEQKLKEAWQTLDHMVAEYISRKREKLNKKNTMI  275

Query  801   DDSQNFSMLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
             +D     +LTS+M   +   +    +FLRDT V      G  TTSSALTW FWL+++NP 
Sbjct  276   EDEDGVDLLTSYMSHPEIMGLKTDDKFLRDTIV-NFFLAGRDTTSSALTWFFWLVSQNPQ  334

Query  633   VEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETD  454
             VE+K+  E+    P    +    F  +E  +LVYLH A CE+LRL+PP+P  HK  L++D
Sbjct  335   VESKIREELKSTMPAEERENWRLFSTQELSNLVYLHGALCETLRLYPPVPFQHKEPLKSD  394

Query  453   TLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFS  274
              LPSGH+V P T +L S Y MGRM +IWG DC+EFKPERW+SD  G IKH PS KF  F+
Sbjct  395   VLPSGHRVGPNTMVLFSVYVMGRMASIWGPDCIEFKPERWISD-SGKIKHEPSYKFLAFN  453

Query  273   VGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
              GPRTC+G+ + F   K VAA+II  Y   ++E H  V PS +++L +KHG+KV L+K+
Sbjct  454   AGPRTCLGRGVAFTQMKAVAAAIIHNYQVHVVEGHP-VAPSSSIILHMKHGLKVSLSKK  511



>ref|XP_006470474.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
Length=510

 Score =   399 bits (1026),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 218/502 (43%), Positives = 308/502 (61%), Gaps = 30/502 (6%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDF-ATEFLKQNGGTFELKGPAFANFDMLL  1369
             W  S R S    NWPV+GMLP LL N    H+F A + LK+N GTFE  GP FA  D+++
Sbjct  17    WSWSDRNS-PMRNWPVLGMLPGLLANTWHFHEFLAHDVLKKNRGTFEFTGPWFAQMDLII  75

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             TSDP N+ YI +KNF+NYPKG  F+ + E  GDG+LN D +LW + RK  +++M H  F 
Sbjct  76    TSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDGVLNADGDLWKIQRKIIHSVMKHNKFE  135

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
              +LE+   Q +E+GL PVLDH ++ GT  DLQ++ KR +FD    + L  +P  L VE P
Sbjct  136   SALEKVAHQKMETGLIPVLDHASELGTVVDLQDVLKRFAFDNICMLVLGIDPNYLSVEFP  195

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
                 +  A      A+LY+HI+P+  WKLQKW   I  EKK + AW TFD+F+Y  +S +
Sbjct  196   QT-VYANAFNTMEQALLYRHIVPKICWKLQKW-LQIGEEKKLSRAWKTFDRFLYERISSR  253

Query  828   LNQLHDQDEDDSQNFSMLTSHMKAYKG-------------KPMQFLRDTFVsltisgggg  688
                +  ++E+    F +LT++M   +              K  +FLRDT     +  G  
Sbjct  254   KANMEKKEEE----FDLLTAYMAEEEEEEVKEDEQISALRKTDKFLRDT-AFSFLGAGND  308

Query  687   ttssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTET-----FKVEECCDLVYLHA  523
             T SS L W FWL+A +P VE K+  EI K     H K+ +      F  ++  +LVYLHA
Sbjct  309   TISSGLVWFFWLVATHPSVENKILKEI-KATIVMHKKEEDGERRFFFNTKQVNNLVYLHA  367

Query  522   AFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKP  343
             A CE+LRL+PP+P NHK++ + D LPSGH +K    +L S+Y+MGRME IWG DC+EFKP
Sbjct  368   ALCETLRLYPPVPYNHKIAAQADILPSGHHIKKNQTVLISYYAMGRMEEIWGNDCLEFKP  427

Query  342   ERWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTL  163
             ERW+S+  G I HVP+ KF  F  GPR C+G+    +  K+VA+++I  YH ++ + H  
Sbjct  428   ERWISE-KGCIVHVPTYKFTAFHAGPRNCLGKDKALIQMKMVASAVIGNYHVKVAKGHP-  485

Query  162   VVPSDTLVLEVKHGVKVKLTKR  97
             V+P  +++L +K+G+KV+L+KR
Sbjct  486   VLPRKSIILNMKYGLKVQLSKR  507



>ref|XP_007150921.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
 gb|ESW22915.1| hypothetical protein PHAVU_004G005800g [Phaseolus vulgaris]
Length=508

 Score =   397 bits (1021),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 222/480 (46%), Positives = 302/480 (63%), Gaps = 13/480 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             T++P++GMLP LL N  R HDF TE LKQ GGT E  GP F N + L+TSDP N+ +I +
Sbjct  34    TDYPILGMLPQLLFNLSRCHDFFTEVLKQKGGTGEFTGPWFTNMNYLVTSDPLNVHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
             K+F+NY KG  F+ +FE FG+GI   DSE W  +R   ++L     F   LE+T+ + V+
Sbjct  94    KSFHNYVKGPVFRDIFEAFGEGIFTADSETWKYNRDLFHSLFKQKSFEMFLEKTIHKKVQ  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             + L PVLDH  Q+G+  DLQ++F R +FD    + L  +P  L ++ P +    KA  +A
Sbjct  154   NSLLPVLDHVHQQGSVVDLQDVFNRFTFDNICSIVLGYDPNCLSLDFP-EVEIEKAFNEA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDE---  802
                I ++H++P+  WKLQKW   I +EKK  EA  T D+FIY  +  K   L   DE   
Sbjct  213   EETIFHRHVVPKCVWKLQKW-LQIGQEKKMREACKTLDEFIYACIESKREDLSKYDENEK  271

Query  801   DDSQNFSMLTSHMKAYKGKPMQ----FLRDTFVsltisggggttssalTWLFWLLAKNPL  634
             ++S +  +LT  ++  KGK       FLRD  V      G  T +SALTW FWL+A NPL
Sbjct  272   EESSHVDLLTVLLREGKGKGEAHDDIFLRDA-VFNLFVAGRDTITSALTWFFWLVATNPL  330

Query  633   VEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETD  454
             VEAK+  E +K K   + K+ E   VEE   LVYLH A CESLRLFPPIP   K +L++D
Sbjct  331   VEAKILEE-MKEKFGRNEKKAEVLSVEEVKKLVYLHGAICESLRLFPPIPFERKEALKSD  389

Query  453   TLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFS  274
              LPSGH V P T IL   YSMGR E IWGEDCMEFKPERW+S  GG + +VPS KF  F+
Sbjct  390   VLPSGHGVNPSTVILFCLYSMGRFEEIWGEDCMEFKPERWISQKGGNV-YVPSYKFIAFN  448

Query  273   VGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK  94
              GPRTC+G+ + F+  K+VA +I+ +Y  +++E + +  P+ ++VL +K G+KVK+ KR+
Sbjct  449   AGPRTCLGKDVSFIQMKMVATAILHKYRLQVVEGY-VAKPNLSIVLLMKDGLKVKIKKRE  507



>ref|XP_002310605.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
 gb|EEE91055.1| hypothetical protein POPTR_0007s06670g [Populus trichocarpa]
Length=505

 Score =   397 bits (1020),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 214/479 (45%), Positives = 300/479 (63%), Gaps = 11/479 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLP  ++N HR ++   E ++ +GG+F  K   F + ++L T DPANI YI 
Sbjct  30    PRNWPLVGMLPDSIRNLHRPYERIAEVIQLSGGSFIYKSLWFFSPNVLNTVDPANIHYIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+N+PKG+ F ++F+I GDGI N DS LW   RK  + L+NH  F+  L ++    V
Sbjct  90    SSNFSNFPKGSMFSRIFDILGDGIFNADSHLWKNQRKLAHVLINHQQFQRFLVKSSWNKV  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL PVL+H A++G+  DLQ++F+R +FDI   +    +PG L +E P    F KA+ D
Sbjct  150   EKGLIPVLEHVAKQGSVVDLQDVFQRFTFDITSILVTGYDPGCLSIEFPQVE-FSKAMDD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDE--  802
             A  AI Y+H+ PE F KLQ+W  G  +E+K  EAW T D  +   +S K  +L  +    
Sbjct  209   AEEAIFYRHLWPEIFLKLQRW-LGFGQEQKLKEAWQTLDHMVAEYISRKREKLSKKTTTI  267

Query  801   DDSQNFSMLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
             +D     +LTS+M   +   +    +FLRDT V      G  TTSSALTW FWL+++NP 
Sbjct  268   EDEDGVDLLTSYMSHPEIMGLKTDDKFLRDTIV-NFFLAGRDTTSSALTWFFWLVSQNPQ  326

Query  633   VEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETD  454
             VE+K+  E+    P    +    F  +E  +LVYLH A CE+LRL+PP+P  HK  L++D
Sbjct  327   VESKIRQELKATMPAEERENWRLFSTQELSNLVYLHGALCETLRLYPPVPFQHKEPLKSD  386

Query  453   TLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFS  274
              LPSGH+V P   +L S Y MGRM +IWG DC+EFKPERW+SD  G IKH PS KF  F+
Sbjct  387   VLPSGHRVGPNMMVLFSVYVMGRMTSIWGPDCLEFKPERWISD-SGKIKHEPSYKFLAFN  445

Query  273   VGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
              GPRTC+G+ + F   K VAA+II  Y   ++E H  V PS +++L +KHG+KV L+++
Sbjct  446   AGPRTCLGRGVAFTQMKAVAAAIIHNYQVHVVEGHP-VAPSSSIILHMKHGLKVSLSRK  503



>ref|XP_007048137.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92294.1| Cytochrome P450 [Theobroma cacao]
Length=509

 Score =   396 bits (1017),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 212/483 (44%), Positives = 309/483 (64%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQ-NGGTFELKGPAFANFDMLLTSDPANIDYI  1339
             P N+P++GM+P LL N HR+HD+ TE L++    T+  +GP FA  +ML+T DPANI YI
Sbjct  30    PKNFPLVGMMPGLLLNTHRIHDWCTEILERCQCSTYLFQGPWFAKMNMLVTCDPANIHYI  89

Query  1338  HNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQT  1159
              + NF N+PKG+ F+++F+I GDGI N D +LW   RK     M H  F   L RT    
Sbjct  90    MSSNFCNFPKGSEFKEIFDILGDGIFNADMDLWKKQRKAAQGFMRHQLFYLFLLRTSRAK  149

Query  1158  VESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAII  979
             VE GL PVL+H A+RG   +L+++F+R +FD    +    +P  L VE P +  F KA+ 
Sbjct  150   VEKGLIPVLEHVAKRGLVLNLEDVFQRFAFDSTCILVTGYDPECLSVEFP-EVLFSKALD  208

Query  978   DAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK---LNQLHDQ  808
             DA  AI Y+ I P+ F KLQ+W   + +E+K+ +AW+  D  I   + +K   LN+L + 
Sbjct  209   DAEEAIFYRQIRPQSFVKLQRWL-NMGQERKYRKAWEVLDDIIPKYICQKREELNKLKEG  267

Query  807   --DEDDSQNFSMLTSHMKAYKGKPMQ----FLRDTFVsltisggggttssalTWLFWLLA  646
                E D +   +LTS++   K   ++    FLRDT +   +  G  TTSS LTW FWL++
Sbjct  268   FVSEIDEEGVDLLTSYITEEKTTDLKCDDKFLRDT-ILNMMLAGRDTTSSGLTWFFWLVS  326

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             ++P VE K+  E+  + P    K+   F  EE  +LVYLH A CE+LRL+PP+P  HK  
Sbjct  327   RHPKVENKIIAELESIIPAEETKKWRLFNAEEVKNLVYLHGALCEALRLYPPVPFQHKEP  386

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             L+ D+LPSGH V PKT+IL S Y++GRM+++WGEDC EFKPERW++D GG  KH PS KF
Sbjct  387   LKPDSLPSGHPVYPKTKILFSLYALGRMKSVWGEDCFEFKPERWITDRGGN-KHEPSYKF  445

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+++ F+  K VA++II+ Y  +++E  T VVP+ +++L  K+G+  ++
Sbjct  446   LSFNAGPRTCLGKEVAFVQMKCVASAIIYNYRIQVLE-ETPVVPAVSIILHTKNGLMARV  504

Query  105   TKR  97
             ++R
Sbjct  505   SRR  507



>gb|EYU27553.1| hypothetical protein MIMGU_mgv1a006542mg [Erythranthe guttata]
Length=440

 Score =   393 bits (1010),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 218/485 (45%), Positives = 292/485 (60%), Gaps = 73/485 (15%)
 Frame = -3

Query  1548  IWKKSSRRSMD-PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             +W+   R+    PTNWP++GMLPA+L N HR+H + TE L ++GGTF  +G  F +    
Sbjct  22    VWRTKIRKKTSLPTNWPLVGMLPAILLNCHRIHAYFTEILIESGGTFIPRG--FQH----  75

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
                    + Y   +NF+NYPKG  F+KMFEI GDGI N D ELW+LHR+TT + +NH  F
Sbjct  76    -----GYVGYF--RNFSNYPKGPEFKKMFEILGDGIFNADFELWELHRRTTLSFLNHTKF  128

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
                LER++ + VE+GL PVLD ++++G  FDLQ+IF+R +FD    + LD +P SL V+ 
Sbjct  129   YDLLERSIWEKVETGLLPVLDDFSEQGIDFDLQDIFQRFTFDSICNLVLDYDPCSLCVDM  188

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   P  KA  DA+ A+LY+H+LPE  WKLQKW   I +E K  EAW  FD+FIYP    
Sbjct  189   PL-IPCEKAFNDAIEALLYRHVLPESIWKLQKW-LRIGKEGKLIEAWKAFDEFIYP----  242

Query  831   KLNQLHDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWL  652
                                             FLRDT     +  G  TTS+ LTWLFWL
Sbjct  243   -------------------------------DFLRDT-TLSLMFAGRDTTSTCLTWLFWL  270

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             +A NP  E K+  EI     +   K+  +F VEE   L+YLH A CESLRLFPP+ + HK
Sbjct  271   IATNPSTEMKILEEI-----EAEFKKWRSFNVEESRRLIYLHGALCESLRLFPPVALEHK  325

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
               +E D LPSG  +K   +++ SFYS GRME++WG DC EFKPERW+SD  G IKH PS 
Sbjct  326   APIEPDNLPSGEYIKSNAKVIVSFYSTGRMESVWGNDCSEFKPERWISD-SGLIKHEPSY  384

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KFP F+ GPRTC+G++M F+               +L+E + ++ P D+++L+ KHG+KV
Sbjct  385   KFPAFNAGPRTCVGKEMAFI---------------QLVEGNDVISPRDSIILQAKHGLKV  429

Query  111   KLTKR  97
              L+KR
Sbjct  430   TLSKR  434



>ref|XP_010025512.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62204.1| hypothetical protein EUGRSUZ_H04862 [Eucalyptus grandis]
Length=507

 Score =   395 bits (1016),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 212/483 (44%), Positives = 302/483 (63%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLPAL  N   +HD+ T FL+++ G F  +   F+  DML+T+DPAN+ YI 
Sbjct  30    PQNWPLVGMLPALFLNLGSVHDWVTSFLERSRGNFLFRFHWFSGMDMLVTADPANVHYIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG  F+++F++ GDGILN+DS++W + R+     MN   F   L +T    V
Sbjct  90    STNFENFPKGAEFKRVFDVLGDGILNSDSDVWRMQRRVAQVFMNDQRFCQFLAKTTRDKV  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL  VLD  +QRG   DLQ++F+R +FD   +     +PGSL VE P + PF KA+ D
Sbjct  150   ENGLLRVLDELSQRGVAVDLQDLFQRFTFDAACRFVTGFDPGSLSVEFP-EVPFSKALDD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD---QD  805
             A   I Y+H+ PE F  LQ+W  G+  E+K   AW+  D+ +   +  K  +L +   + 
Sbjct  209   AEEVIFYRHMYPEWFGALQRW-LGLGVEEKLRSAWEVMDQVVGSYIEMKRVELREGTSKA  267

Query  804   EDDSQNFSMLTSHM--KAYKGKPM---QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             E D     +LT +M  K   G      +FLRDT +   +  G  TTS  LTW FW L+ N
Sbjct  268   ERDENGADLLTLYMVEKEILGALECNDKFLRDT-ILNLMIAGKDTTSLVLTWFFWALSTN  326

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKV-EECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
               VE K+  EI  V P+   +  + FK+ E   +LVYLH A CESLRL+PPIP  HK  +
Sbjct  327   RSVEMKIREEIKSVIPEEE-QNLKVFKIGEHVHNLVYLHGALCESLRLYPPIPFEHKCPV  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV P  +IL   Y+MGRM+++WGEDC EF+PERW+S   GG++H PS KF 
Sbjct  386   KPDVLPSGHKVNPGKKILIHLYAMGRMKSVWGEDCFEFRPERWISK-SGGVRHEPSYKFL  444

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++ F   K++AA +I  Y   ++E H LV PS++++L +KHG++VKL 
Sbjct  445   AFNAGPRTCLGKQVAFTQMKMIAAVVIHNYEVHVVEGH-LVRPSNSIILHMKHGLRVKLA  503

Query  102   KRK  94
             +R+
Sbjct  504   RRR  506



>emb|CDP18605.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   392 bits (1008),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 206/434 (47%), Positives = 295/434 (68%), Gaps = 13/434 (3%)
 Frame = -3

Query  1377  MLLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHI  1198
             M+LT DPANI YI +KNF+NYPKG  F+K+F+I GDGI N DS+LW+ HR+ T +LM+H 
Sbjct  3     MVLTCDPANIHYILSKNFSNYPKGPEFRKIFDILGDGIFNADSQLWETHRRVTLSLMHHP  62

Query  1197  GFRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFV  1018
              F   LE TV   VE GL PVL + A+ G+  DLQ+IF+R +FD   ++ LD +PGSL +
Sbjct  63    SFLKVLEVTVWDKVEKGLLPVLQNCAKTGSQLDLQDIFQRFAFDSISKLVLDHDPGSLSL  122

Query  1017  EPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPIL  838
             + P + P  KA  D    +L++HILPER+WKLQKW  GI +EKK ++AWD FD+FIYP +
Sbjct  123   DLP-NIPCEKAFNDLALVLLHRHILPERYWKLQKW-LGIGKEKKLSKAWDAFDQFIYPRI  180

Query  837   SEKLNQLHDQDEDDSQNFSMLTSHMKAYKGK------PMQFLRDTFVsltisggggttss  676
             S K  +   +  D+ + F  LT+ M+AY+           F+RD  +   +  G  TTS+
Sbjct  181   SLK-QEKRSKMFDEERRFVGLTTLMEAYEETNNSIRDAKAFIRDN-ILNLMFAGRDTTST  238

Query  675   alTWLFWLLAKNPLVEAKLFNEIL-KVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRL  499
             ALTW FWL+A N   E K+  EI  ++      + +  F V++   LVYLHAA CE+LRL
Sbjct  239   ALTWFFWLIATNHWAEEKILEEIANELDVVKQGQDSRLFNVQQSHKLVYLHAALCEALRL  298

Query  498   FPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCG  319
             +PP+ + HK  ++   LPSG +V+P T+++  FYSMGRME++WGEDC+EFKPERW+S+  
Sbjct  299   YPPVALEHKAPVQAVILPSGVRVEPNTKLILFFYSMGRMESLWGEDCLEFKPERWISE-R  357

Query  318   GGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLV  139
             G ++H PS KFP F+ GPRTC+G++M F+  K+VAASII+ YH  +++ H  + PSD+++
Sbjct  358   GRVRHEPSFKFPAFNAGPRTCLGKEMAFVQMKMVAASIIYNYHVRVVDGHP-ISPSDSII  416

Query  138   LEVKHGVKVKLTKR  97
             +++K G+ V+L +R
Sbjct  417   IQMKQGLMVRLFQR  430



>emb|CDP12888.1| unnamed protein product [Coffea canephora]
Length=477

 Score =   394 bits (1012),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 218/475 (46%), Positives = 298/475 (63%), Gaps = 15/475 (3%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             MLP L+  A+ LHD  T   +  GGTF  KGP F N D LLT DPANI +I + NF N+P
Sbjct  1     MLPNLILYANWLHDNCTNVARLAGGTFLFKGPWFFNMDTLLTVDPANIHHIMSGNFPNFP  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  F++MF++ GDGI N D +LW   RKTT  L+NH  F   L +T    VE GL PVL
Sbjct  61    KGPKFKEMFDVLGDGIFNADMDLWKSQRKTTRFLINHHRFHQFLVKTSRDKVEKGLIPVL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             DH  + G   DLQ++F+R +FD   ++    +PG + +  P D PF +A+  A  AI  +
Sbjct  121   DHLCKTGQVLDLQDLFQRFTFDTTCKLVTGYDPGCVSINFP-DVPFARALDRAEEAIAAR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD-----EDDSQN  787
             +I PE  WKLQ+    I  EKK++EAW T D+ I   +S+K  +L  +       DD   
Sbjct  180   NIQPESTWKLQR-LLNIGEEKKYSEAWKTLDRVIGEYISKKREELSSKSSSKSRTDDQDG  238

Query  786   FSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAK  622
               +LTS++   K   +      FLRDT +   +  G  TTSSALTW FWLL++NP+VE K
Sbjct  239   IDLLTSYITEAKTMELPSDDDTFLRDT-ILNLMIAGRDTTSSALTWFFWLLSQNPIVETK  297

Query  621   LFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPS  442
             +  E+  + P    ++ + FKV++   LVYLH A CESLRL+PP+P  HK  LE D LP+
Sbjct  298   IREELRSITPPVDTEKYQLFKVQDLNKLVYLHGALCESLRLYPPVPFQHKEPLEPDILPT  357

Query  441   GHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPR  262
             GH+V PK +I+ S Y+MGRM +IWG+DCME KPERW+SD  G IKH PS KF  F+ GPR
Sbjct  358   GHQVYPKMKIMFSLYAMGRMASIWGKDCMEMKPERWISD-RGTIKHEPSYKFLAFNAGPR  416

Query  261   TCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             TC+G+++ F   K VAA+II  YH  +++    +VP+ +++L +K G+KVK++KR
Sbjct  417   TCLGKEVAFTQLKAVAATIIHNYHVRVVKGQK-IVPNISVILYIKQGLKVKVSKR  470



>ref|XP_006339338.1| PREDICTED: cytochrome P450 86B1-like [Solanum tuberosum]
Length=465

 Score =   393 bits (1010),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 207/430 (48%), Positives = 284/430 (66%), Gaps = 21/430 (5%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             MLP  + N HR+H F T+ L +    FE +GP FAN DML  SDPANI +I ++NF+NYP
Sbjct  1     MLPGFVHNMHRVHSFFTDILLETNSNFEFRGPIFANMDMLFPSDPANIHHILSRNFSNYP  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  F ++F+I G+ I N DSELW++HRKTT +LMNH  F+  L+R V  T++ G+ P L
Sbjct  61    KGPEFHEIFDILGNEIFNVDSELWEIHRKTTMSLMNHAKFQTLLQRNVWDTIDKGIVPTL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             D +A++ T  DLQ+IF+R SFD   ++ LD +P SL +  P   P   A  D  +A+ Y+
Sbjct  121   DIFAKQDTPVDLQDIFQRYSFDTNSKLLLDHDPKSLSLNLPHV-PCEIAFNDMGDALAYR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDSQNFSMLT  772
             HILP+ + KLQKW   I +EK   +AW+ FD+F+Y ++SEK  +L D +  D  +F + +
Sbjct  180   HILPKNYRKLQKW-LRIGKEKDLIKAWEAFDQFMYHVISEKQKKLIDNNIKDD-DFELFS  237

Query  771   SHMKAYK----------GKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAK  622
             +++KAY           G   +FLRDTF+   +  G  T S+ LTW FWL+AKNPLVE K
Sbjct  238   NYIKAYDKLKNEVDENLGSVQKFLRDTFL-NLMFAGRDTISTTLTWFFWLVAKNPLVEKK  296

Query  621   LFNEILKVKPQNHAKQTET---FKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
             +  EI   + Q H K+ E    F +EE   LVYLH A CE LRLFPPI + H+  +E D 
Sbjct  297   IREEI---QQQLHLKEDEYLKFFNIEESRKLVYLHGALCECLRLFPPIGVEHRAPVELDV  353

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH+V P  +IL S Y++GRME+IWG DC+EFKPERW+++  GG+KH PS KFP+F  
Sbjct  354   LPSGHRVTPNVKILISIYTLGRMESIWGNDCLEFKPERWITE-RGGVKHEPSLKFPVFHS  412

Query  270   GPRTCIGQKM  241
             GPRTC+G+++
Sbjct  413   GPRTCLGKEL  422



>emb|CAN80536.1| hypothetical protein VITISV_035975 [Vitis vinifera]
Length=471

 Score =   393 bits (1009),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 216/473 (46%), Positives = 297/473 (63%), Gaps = 13/473 (3%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             M   LL + HR+HD A E L++ G TF  KGP F N DML T+DPAN+ YI + NF+N+P
Sbjct  1     MFAGLLFHVHRIHDEAAEILEKTGCTFLFKGPWFCNMDMLGTTDPANVHYIMSSNFSNFP  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KGT F+KMFE+ GDGI N D E W   RK   +++N+  F   L +     VE GL P+L
Sbjct  61    KGTEFRKMFEVLGDGIFNADGESWRNQRKLGQSMINNPRFHRFLAKVTYNKVEKGLVPLL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             DH +++G   DLQ++F+RL+FD    +    +   L +E P + PF  A+ D   A+ Y+
Sbjct  121   DHLSEQGRVVDLQDVFQRLTFDTTCMLVTGFDTKCLSIEFP-EVPFATALEDVEEAVFYR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS---EKLNQLHDQDEDDSQNFS  781
             H LPE  W+L +W  GI +EKK  + W T D  I   +S   E+L++   +  +D     
Sbjct  180   HALPETLWRLLRW-LGIGKEKKLRKGWKTLDHTIAEYISMKREELSKGITKLREDEDGAD  238

Query  780   MLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLFN  613
             +LTS+M       +    +FLRDT +   +  G  TTSSALTW FWL++KNPLVE+K+  
Sbjct  239   LLTSYMTEDNAIGLKCDGKFLRDT-ILNFMIAGRDTTSSALTWFFWLVSKNPLVESKIRE  297

Query  612   EILKVKPQNHAKQTE-TFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGH  436
             EI    P+   ++    FK E    LVYLHAA CE+LRL+PP+P  HK  ++ D LPSGH
Sbjct  298   EIETAIPEKEDRKGRHIFKTEGLNKLVYLHAAMCEALRLYPPVPFQHKAPIQPDVLPSGH  357

Query  435   KVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTC  256
             KV PK +I    Y+MGRM AIWG+DC+EFKPERW+S+  G IKH PS KF  F+ GPRTC
Sbjct  358   KVDPKMKIFFPVYAMGRMTAIWGKDCLEFKPERWISEL-GKIKHEPSYKFFSFNAGPRTC  416

Query  255   IGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             IG+++ F   K VAA+II  YH E+++ H  V P+ +++L +K G KV+++KR
Sbjct  417   IGKEVAFTQMKAVAATIIHNYHVEMVKGHH-VAPNVSIILYMKRGFKVRVSKR  468



>gb|EYU24049.1| hypothetical protein MIMGU_mgv1a004847mg [Erythranthe guttata]
Length=507

 Score =   394 bits (1011),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 206/476 (43%), Positives = 298/476 (63%), Gaps = 10/476 (2%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNG-GTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             NWP+IGMLP LL N  R+H+  TE L+++  GTF  +GP FAN DML T DP NI YI  
Sbjct  33    NWPLIGMLPGLLLNVGRIHEICTEVLRKSRRGTFHFQGPCFANMDMLWTVDPENIHYIMT  92

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF N+PKG  F+++F++ GDGI N+D + W   R  + AL+ H  F   L     + VE
Sbjct  93    SNFRNFPKGPEFREIFDVLGDGIFNSDDDSWKDQRNVSRALITHRSFHRFLAVISREKVE  152

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL PVL+  A      DLQ++F+R +FD   Q+    NPG L ++   D PF KA+ D 
Sbjct  153   KGLIPVLEKAALENRVLDLQDLFQRFTFDSICQLVTGYNPGCLSLDLADDVPFSKAMDDV  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED--  799
               +I  +H+LPE+ WKLQ+W  G+  E++ ++A +  D FI   ++ K N++  ++ D  
Sbjct  213   EESIFVRHVLPEKIWKLQRWL-GVGGERRLSKASEILDSFIIKYIAMKRNEISRKNGDWN  271

Query  798   --DSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
               +     +LT++M        +FLRDT +   +  G  TTSSALTW  WL++ +P VE 
Sbjct  272   IENENGEDLLTAYMNLGDRDDDKFLRDT-ILNLMIAGRDTTSSALTWFVWLVSTHPQVEN  330

Query  624   KLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLP  445
             K+ +EI  + P    ++   F V+E   LVYLH A CE+LRL+PP+P  HK  +E DTLP
Sbjct  331   KIRDEIKTIIPS--GERRGFFSVDETKKLVYLHGALCEALRLYPPVPFQHKEPVEPDTLP  388

Query  444   SGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGP  265
             SGH V PK ++L S Y+MGRME+IWG+DC EFKPERW+S+ G  ++H PS KF  F+ GP
Sbjct  389   SGHFVHPKMKVLFSLYAMGRMESIWGKDCSEFKPERWISEGGRSVRHEPSYKFLAFNAGP  448

Query  264   RTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             RTC+G+++ F   K VAA++I  Y   +++ H  VVP+ +++L ++ G+KV++  R
Sbjct  449   RTCLGKEVAFTQMKAVAAALIHNYRVRVVDGHR-VVPNCSIILYMRDGLKVRVASR  503



>ref|XP_011031168.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=518

 Score =   393 bits (1010),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 214/502 (43%), Positives = 319/502 (64%), Gaps = 33/502 (7%)
 Frame = -3

Query  1530  RRSMDP-TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             R ++ P TNWPV+GMLP LL  A  +H++AT+ LKQ+GGTFE KGP FAN ++ LT+DP 
Sbjct  24    RNTVSPVTNWPVVGMLPGLLFQAQNVHEYATQLLKQSGGTFEFKGPWFANMNIFLTADPL  83

Query  1353  NIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLER  1174
             N+ +I  KNF NYPKG  ++K+FE FGDG+LN+D E W   RK  ++++    F+  LER
Sbjct  84    NVRHISTKNFVNYPKGPEYKKIFEPFGDGVLNSDFESWKSFRKLIHSMIKDNKFQVFLER  143

Query  1173  TVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPF  994
             ++ + +  GL PVL+H +++    D+Q++F+R +FD    + L  +P SL V+ P +  +
Sbjct  144   SLREKIVKGLIPVLEHVSRQEIELDMQDVFQRFTFDNICLLVLGFDPQSLSVDLP-EIAY  202

Query  993   RKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK-----  829
             + A  D   A  Y+HI+PE  WKLQKW   +  EKK ++A DT D F+   +S K     
Sbjct  203   KTAFDDVEEAAFYRHIVPESIWKLQKW-LNVGEEKKLSQAMDTIDNFLEQCISSKKEEIR  261

Query  828   ------LNQLHDQDEDDSQNFSMLTSHMKA---------YKGKPMQFLRDTFVsltisgg  694
                   + Q+ D D+DD   + ++T+ +K             K  ++LRD      I+ G
Sbjct  262   QRKVQNMVQVEDNDQDD---YDLITACIKEEGEAAEQMDASKKTDKYLRD-IGFNFIAAG  317

Query  693   ggttssalTWLFWLLAKNPLVEAKLFNEI---LKVKPQNHAKQTETFKVEECCDLVYLHA  523
               T ++ALTW FWL+A +  VE K+  EI   +K K  +H      F +EE   LVYLH 
Sbjct  318   KDTVNAALTWFFWLVATHHEVEKKIVEEIRANMKSKG-DHTINGMFFNLEELNKLVYLHG  376

Query  522   AFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKP  343
             A CE+LRL+P +P N+++S+E DTLPSGH VK  T+++ S YSMG ME IWG+DC+ FKP
Sbjct  377   AICETLRLYPAVPFNYRVSVEADTLPSGHLVKANTKVMFSLYSMGSMEEIWGDDCLAFKP  436

Query  342   ERWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTL  163
             ERW+S+  GGI HVPS K+  F+ GPR+C+G+++ F+  K +A +I+  +H +++E H  
Sbjct  437   ERWISE-RGGIIHVPSYKYIAFNTGPRSCLGKEITFIQMKTIATAILMNFHLQVVEGHP-  494

Query  162   VVPSDTLVLEVKHGVKVKLTKR  97
             V P  +++L +KHG+K+++TKR
Sbjct  495   VSPGLSVMLHMKHGLKLRVTKR  516



>ref|XP_008801256.1| PREDICTED: cytochrome P450 86B1-like [Phoenix dactylifera]
Length=528

 Score =   393 bits (1010),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 210/487 (43%), Positives = 309/487 (63%), Gaps = 21/487 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP +GMLPALL + H+LHD+ T  LK+ G  F   GP ++  DML+T DPAN+ ++ 
Sbjct  44    PVNWPFVGMLPALLVHLHQLHDWGTMILKETGCNFFFHGPWYSGMDMLITCDPANVYHVF  103

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NYPKG  F ++F++ GDGI N+D+E W   R   ++L+N   FR  + ++    V
Sbjct  104   SANFHNYPKGDDFSEIFDVLGDGIFNSDAESWRRQRMKAHSLINDRRFRAFVAQSSRSKV  163

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LD  A++    DLQ++F RL+FD    +    +PG L +  P+  PF KA+ D
Sbjct  164   EKGLIPLLDQLAEQEVAVDLQDVFLRLTFDTTCYLVFGVDPGCLSIGFPT-IPFAKAMDD  222

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK---LNQLHDQD  805
             A  A+L +H +P  +WKLQ+W   +  EKK A AW+  D+FI   ++EK    N+    +
Sbjct  223   ATGALLVRHTVPPAWWKLQRW-LRVGVEKKMALAWEVMDQFIAQRIAEKKEERNRSRSHE  281

Query  804   EDDSQNFSMLTSHMKAYKG-------KPMQ---FLRDTFVsltisggggttssalTWLFW  655
             E+  ++  +L+S++             PM+   FLRDT     +  G  TT +ALTW FW
Sbjct  282   EEAPRD--LLSSYVDVCDDLHLVDAENPMEFDKFLRDT-AMNFMIAGRDTTGAALTWFFW  338

Query  654   LLAKNPLVEAKLFNEILKVKPQNHAKQTET-FKVEECCDLVYLHAAFCESLRLFPPIPMN  478
             LL+KNPLVE+K+  E+  ++ ++      T F  EE   LVYLHAA CESLRL+PP+P  
Sbjct  339   LLSKNPLVESKILEELKSLRKKSSCFDNMTLFDAEELKGLVYLHAALCESLRLYPPVPFE  398

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
             HK  L+++ LPSG K +P T+IL S YSMGRME +WG+DC+EFKPERW+S+  G ++H P
Sbjct  399   HKGVLQSEVLPSGDKAQPSTKILFSLYSMGRMEGVWGKDCLEFKPERWISE-KGRLRHEP  457

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KF  F+ GPRTCIG+ M F   K V A++++ +H +++E H +V P  +++L +K+G+
Sbjct  458   SYKFTSFNSGPRTCIGKDMAFTQMKAVVAAMVYNFHVDVVEGH-VVQPKISIILHMKNGL  516

Query  117   KVKLTKR  97
              V++ KR
Sbjct  517   MVRIRKR  523



>ref|XP_007150922.1| hypothetical protein PHAVU_004G005900g [Phaseolus vulgaris]
 gb|ESW22916.1| hypothetical protein PHAVU_004G005900g [Phaseolus vulgaris]
Length=509

 Score =   392 bits (1008),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 217/481 (45%), Positives = 303/481 (63%), Gaps = 14/481 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             T++P++GMLP +L N  R+HDFATE LKQ GGT +  GP F N + L TSDP N+ ++ +
Sbjct  34    TDYPILGMLPEVLCNLWRIHDFATEVLKQKGGTGDFTGPWFTNMNYLFTSDPLNVRHVMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              +F+NY KG  F+ +FE FG+G+   DSE W  +R   + L+    F   LE+TV + V+
Sbjct  94    TSFHNYVKGPVFRDIFEAFGEGLAAADSEAWKYNRDLIHYLLKQKNFEGFLEKTVHKKVQ  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             S L PVLDH  Q+G+  DLQ++F R +FD    + L  +P  L V+ P +    KA  +A
Sbjct  154   SSLLPVLDHVHQQGSVVDLQDLFNRFTFDNICYIVLGHDPNCLSVDFP-EVEIEKAFNEA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL----HDQD  805
                I ++H++P+  WKLQKW   I +EKK  EA  T D+FIY  ++ K   L       +
Sbjct  213   GETIFHRHVVPKCVWKLQKWLH-IGQEKKMTEACKTLDEFIYACIASKRKNLSKCIEKNE  271

Query  804   EDDSQNFSMLTSHMKAYKGKPMQ----FLRDTFVsltisggggttssalTWLFWLLAKNP  637
              +++ +  +LT+ M+  K K  +    FLRDT V      G    +SALTW FWL+A NP
Sbjct  272   TEETSDVDLLTTLMREGKEKGEEYDDIFLRDT-VFNFFVAGRDAVTSALTWFFWLVATNP  330

Query  636   LVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
             LVEAK+  E +K K  ++ K  +   VEE   LVYLH A CESLRLFPPIP   K +L++
Sbjct  331   LVEAKILEE-MKEKIGSNEKAMDVLSVEEVKKLVYLHGAICESLRLFPPIPFERKEALKS  389

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGH V P T IL   YSMGR E IWGEDCMEFKPERW+S+  GGI +VPS KF  F
Sbjct  390   DLLPSGHGVNPSTVILFFLYSMGRSEEIWGEDCMEFKPERWISE-KGGIVYVPSYKFVAF  448

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+ + F+  K+VA +I+ +Y  +++E + +  P+ ++VL +K G+KV + KR
Sbjct  449   NTGPRTCLGKDVSFIQIKMVATAILHKYRLQVVEGY-VAKPNLSIVLLIKDGLKVTIKKR  507

Query  96    K  94
             +
Sbjct  508   E  508



>ref|XP_003554826.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=501

 Score =   392 bits (1006),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 210/484 (43%), Positives = 311/484 (64%), Gaps = 8/484 (2%)
 Frame = -3

Query  1542  KKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTS  1363
             K+  R  + P ++P+IGMLP +L N  R HD  ++ LKQ+GGT E  GP F   + L++S
Sbjct  24    KRCCRHPLFP-DYPIIGMLPPVLCNLWRAHDLISDVLKQHGGTGEFTGPWFTIMNCLISS  82

Query  1362  DPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPS  1183
             DP N+ ++ +KNF+NY KG  F+ +F+ FGDGI   DSE W  +R   ++L  +  F   
Sbjct  83    DPINVHHVMSKNFHNYVKGPVFRDIFQAFGDGIFTADSEAWKYNRDLFHSLFKNRSFEFF  142

Query  1182  LERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSD  1003
             LE+T+   V++ L P+LDH  Q+    DLQ++F R +FD    + L  +P  L V+ P +
Sbjct  143   LEKTIQNKVQNSLLPMLDHMHQQRKVVDLQDVFGRFTFDNICSLVLGYDPNCLSVDIP-E  201

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLN  823
                 KA  +A  +I Y+H +P+  WKLQKW   I +EKK  EA  T D+FI+  ++ K  
Sbjct  202   VAIEKAFNEAEESIFYRHTVPKCVWKLQKW-LQIGQEKKMTEACKTLDQFIHACIASKRV  260

Query  822   QLHDQDE-DDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLA  646
             +L + +E  ++ +  ++T+ M+  +    +F+RD  V      G  T +SALTW FWL+A
Sbjct  261   ELSNDNEMGEAHHVDLITALMREKQTHDDRFIRDA-VFNLFVAGRDTITSALTWFFWLVA  319

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
              NPLVEAK+  EI K K + + K      VE+   LVYLH A CE+LRLFPPIP   K++
Sbjct  320   TNPLVEAKILEEI-KEKLETNEKTLGVLSVEKVKKLVYLHGAICETLRLFPPIPFERKLA  378

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             ++ D LPSGH+V P+T IL S Y+MGR+E  WG+DC+EFKPERW+S+  GGI +VPS KF
Sbjct  379   IKADMLPSGHRVNPRTMILISLYAMGRLEETWGKDCLEFKPERWISE-KGGIVYVPSYKF  437

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+ + F+  K+VAA+I+++YH +++E + +  PS ++VL +K G+KV +
Sbjct  438   IAFNAGPRTCLGKDLSFIQMKMVAAAILYKYHVQVVEDY-VATPSLSIVLLIKDGLKVMI  496

Query  105   TKRK  94
             TKR+
Sbjct  497   TKRE  500



>ref|XP_007150917.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
 gb|ESW22911.1| hypothetical protein PHAVU_004G005400g [Phaseolus vulgaris]
Length=504

 Score =   390 bits (1001),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 212/477 (44%), Positives = 294/477 (62%), Gaps = 10/477 (2%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             T +P +GMLP +L N    HD++T+ LKQ+GGT E  GP F N + L+T DP N+ ++ +
Sbjct  33    TEYPFVGMLPQVLCNLWHAHDYSTQVLKQHGGTAEFGGPWFTNMNYLVTCDPLNVHHMLS  92

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
             KNF+NY KG  F+ +F+ FGDGI   D E W   R   ++L  H  F   LE+T+ + V+
Sbjct  93    KNFHNYVKGPEFRDIFQAFGDGIFTADGEAWKYSRDLFHSLFKHKSFEVLLEKTIHKKVQ  152

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             + L PVLDH  Q+G   DLQ++F R +FD      L ++P  L ++ P +    KA   A
Sbjct  153   NSLLPVLDHVQQQGRVVDLQDLFNRFTFDNICSTVLGRDPECLSIDFP-EVAVEKAFNQA  211

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDS  793
                I Y+HI+P+  WK+Q+W   I +E+K  EA  T D+FIY  ++ K   L + +   +
Sbjct  212   EECIFYRHIVPKSVWKVQQW-LQIGQERKMTEACKTLDEFIYSCIASKREDLMENETGKT  270

Query  792   QNFSMLTSHMKAYKGKPMQ----FLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
                 +LT+ M+  KGK       FLRD  V      G  T +SALTW FWL+A NPLVEA
Sbjct  271   FQVDLLTTLMREGKGKGEAHDDTFLRDA-VFNLFVAGRDTITSALTWFFWLVATNPLVEA  329

Query  624   KLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLP  445
             K+  EI +   +N  K  E   VEE   LVYLH A CE+LRLFPPIP   K +LE D LP
Sbjct  330   KILEEIKETYGRNEEK-AEVLSVEEVKKLVYLHGAICETLRLFPPIPFERKQALEADMLP  388

Query  444   SGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGP  265
             SGH V  +T+IL   Y+MGR+E  WG+DCMEFKPERW+S  GG + + PS KF  F+ GP
Sbjct  389   SGHGVDSRTKILLFLYAMGRLEETWGKDCMEFKPERWISKRGGNV-YEPSYKFIAFNAGP  447

Query  264   RTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK  94
             R C+G+ + F+  K+VAA+I+  Y  +++E + +  PS ++VL +K G+KVK+TKRK
Sbjct  448   RNCLGKDLSFIQLKMVAAAILRNYCVKVVEGY-VASPSLSIVLLMKDGLKVKITKRK  503



>gb|EPS65366.1| hypothetical protein M569_09411 [Genlisea aurea]
Length=503

 Score =   390 bits (1001),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 219/490 (45%), Positives = 307/490 (63%), Gaps = 10/490 (2%)
 Frame = -3

Query  1560  MRKNIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANF  1381
             +R+N+ K ++     PTN+P++GMLPALL N+HR+HDF T+ L + GGTFE KGP F+N 
Sbjct  20    LRRNLKKPTA----IPTNFPIVGMLPALLLNSHRVHDFITDILSEVGGTFEFKGPTFSNL  75

Query  1380  DMLLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNH  1201
             DM+LTSDP+N+ ++ +++F  YPKG  F+KMF + GDGI NTD  +W++HRK T   +  
Sbjct  76    DMVLTSDPSNVHHVFSRSFLKYPKGPDFRKMFGVLGDGIFNTDFAVWEVHRKATLGFVGD  135

Query  1200  IGFRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLF  1021
               F   +E  V   VE G+FPVLD + + G   DLQ++F+R+SFD   ++ L  +P SL 
Sbjct  136   REFNGLVEGVVWGKVEKGVFPVLDSFVESGGFVDLQDVFQRMSFDGICRLVLGFDPESLA  195

Query  1020  VEPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPI  841
             V  P      KA  DA  A+ Y+H+LPE  W+LQ+   GI RE K A A    D+FIYP 
Sbjct  196   VGLPEIQ-CEKAFNDAFQAVFYRHLLPETVWRLQRR-LGIGREAKLAAAEKALDEFIYPK  253

Query  840   LSEKLNQLHDQD--EDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalT  667
             +    ++ H     +  +  +    + +  +     +FLRDT +   +  G  TTS+ LT
Sbjct  254   VVGGADEKHKPGLLKLFADVYKQNAAAVPGFPADRNKFLRDTSL-SLMFAGRDTTSACLT  312

Query  666   WLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPI  487
             WLF+L+A+NP  E K+  EI +       +    F  EE   LVYL  A  ESLRLFPP+
Sbjct  313   WLFFLIARNPSAEEKILEEIEEKLRVRRGEAWRRFTAEESRRLVYLQGALSESLRLFPPV  372

Query  486   PMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIK  307
              + HK   E DTLP+G +VK   RI+ SFY+MGRME+IWG+D  EF+PERW+SD  GG+ 
Sbjct  373   ALEHKAPAEDDTLPTGTRVKKDGRIIFSFYTMGRMESIWGKDWPEFRPERWISDKIGGVV  432

Query  306   HVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVK  127
             HVPS  FP F+ GPRTC+G+ M F+  K+ AA+I+FRY  EL+       P D ++L+ +
Sbjct  433   HVPSFHFPAFNAGPRTCLGKDMAFIQMKMAAAAILFRYRVELVGNFE-TSPRDAVILQSR  491

Query  126   HGVKVKLTKR  97
             HG+KV L+KR
Sbjct  492   HGLKVTLSKR  501



>ref|XP_011100086.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=512

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 210/498 (42%), Positives = 312/498 (63%), Gaps = 22/498 (4%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNG-GTFELKGPAFANFDML  1372
             +W   +RR M   NWP++GMLP LL +  R+HD  TE L+++  GTF  +GP FAN ++L
Sbjct  21    LWAWRNRR-MIGWNWPLMGMLPTLLLHVDRIHDTCTEILRRSRRGTFRFQGPWFANMEIL  79

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
              T++PA++ YI + NF N+PKG  F++MF++ G+GI N DS+ W   R+   AL+ H  F
Sbjct  80    GTANPADVHYIMSSNFQNFPKGPVFREMFDVLGEGIFNADSDSWKHQRRAARALIGHQRF  139

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
                L +   + VE GL  VL+   +     DLQ++F+RL+FD    +    +PG L V+ 
Sbjct  140   HRCLSKISFEKVEKGLVSVLEMVCREKQVIDLQDLFQRLTFDTTCALVTGYDPGCLSVDL  199

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P D PF KA+ DA  AI  +H+LP+R WKLQ+W  G+  E+K ++AW   D  I   ++ 
Sbjct  200   P-DVPFSKAMDDAEEAIFMRHVLPDRVWKLQRWL-GVGSERKLSKAWGVLDSVIGKYIAM  257

Query  831   KLNQLH-----DQDEDDSQNFSMLTSHMKAYKGKPMQ-------FLRDTFVsltisgggg  688
             K  +L      D +E+D  +  +LTS++      P Q       FLRDT +   +  G  
Sbjct  258   KREELRRGKLMDHEEEDGAD--LLTSYINGGDDAPSQYLKCDDKFLRDT-ILNLMIAGRD  314

Query  687   ttssalTWLFWLLAKNPLVEAKLFNEILKV-KPQNHAKQTETFKVEECCDLVYLHAAFCE  511
             TTSSALTW  WL++ +P VE K+ +E+  +  P   + +   FK++E   LVY+H A CE
Sbjct  315   TTSSALTWFMWLVSTHPEVEKKIRDELSSICDPSEESHKWRIFKIDEINKLVYMHGAMCE  374

Query  510   SLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWL  331
             +LRL+PP+P  HK  ++ D LPSGH V PK +++   Y+MGRME+IWG+DC+EFKPERW+
Sbjct  375   ALRLYPPVPFQHKEPMKPDILPSGHYVHPKMKVMFFLYAMGRMESIWGKDCLEFKPERWI  434

Query  330   SDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPS  151
             S+  G IKH PS KF  F+ GPRTC+G+++ F   K+VAA++I  Y   ++E H  V P+
Sbjct  435   SE-RGTIKHEPSYKFLAFNAGPRTCLGREVAFTQMKMVAATVIHNYQVRVVEGHR-VAPN  492

Query  150   DTLVLEVKHGVKVKLTKR  97
              +++L ++HG+KV++ KR
Sbjct  493   CSVILYMRHGLKVRVAKR  510



>ref|XP_009601590.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana tomentosiformis]
Length=508

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 211/484 (44%), Positives = 299/484 (62%), Gaps = 15/484 (3%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             RS  P NWP +GM P LL + +R+H+   E     GGTF LKGP FAN D+L T DPAN+
Sbjct  31    RSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSTTGGTFLLKGPWFANIDILGTVDPANV  90

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              YI + NF N+PKG  F+K+F++ GDGI N+D +LW   RK T  L+ H  F   LE+T 
Sbjct  91    HYIMSANFENFPKGEEFKKIFDVLGDGIFNSDLDLWKSQRKITRTLITHQRFHNCLEKTS  150

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
                +E+GL PVL+  A+     DLQ++F+R +FD   Q+    +PG L +E P + PF K
Sbjct  151   WDKIENGLIPVLEFVARESKIVDLQDVFQRFTFDTTCQLVTGFDPGCLSLEFP-NVPFSK  209

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ  808
             A+ +A   +  +H+LPE  WKLQKW  GI  EKK ++AW   D+ I   +S K ++L + 
Sbjct  210   AMDEAEEVLFIRHLLPESVWKLQKW-LGIGHEKKLSKAWQVLDQVIGKYISMKRDELSNG  268

Query  807   ---DEDDSQNFSMLTSHMKAYKGKPMQF----LRDTFVsltisggggttssalTWLFWLL  649
                 ED+ + F +LTS++       + F    LRDT +   +  G  TTSS LTW  WL+
Sbjct  269   TKLKEDNEEGFDLLTSYI---LDDGLNFDDKSLRDT-ILNLMIAGRDTTSSGLTWFIWLV  324

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             + +P VE K+  E++ +     +++   F+  E  + +YLHAA CESLRL+PP+P  HK 
Sbjct  325   STHPEVEKKIREELMAIISVAKSQKWRLFRANELKNAIYLHAALCESLRLYPPVPFQHKT  384

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
               E   LPSGH V P  R++ S Y+MGR+E+IWG+D  EFKPERW+SD  G +KH PS K
Sbjct  385   PREPCILPSGHHVHPNMRVMFSLYAMGRIESIWGKDAAEFKPERWISD-RGIVKHEPSYK  443

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++ F   K VAA+II  Y  E+++ H  V P+ +++L ++HG K  
Sbjct  444   FLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVEVIKGHK-VYPNVSIILYMQHGFKAS  502

Query  108   LTKR  97
             + KR
Sbjct  503   IKKR  506



>ref|XP_006446602.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
 gb|ESR59842.1| hypothetical protein CICLE_v10014930mg [Citrus clementina]
Length=519

 Score =   389 bits (999),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 218/503 (43%), Positives = 307/503 (61%), Gaps = 34/503 (7%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFAT-EFLKQNGGTFELKGPAFANFDMLL  1369
             W ++S R     N PV+GMLP LL N  RLH+F T + LK+N GTFE  GP FA  D+++
Sbjct  28    WSRNSLRR----NRPVLGMLPGLLGNTWRLHEFLTHDVLKKNRGTFEFTGPWFAQMDLII  83

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             TSDP N+ YI +KNF+NYPKG  F+ + E  GDG+ N D +LW + RK  +++M H  F 
Sbjct  84    TSDPMNVHYISSKNFSNYPKGPDFRMIMEPLGDGVFNADGDLWKIQRKIIHSVMKHNKFE  143

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
              +LE    Q +E+GL PVLDH ++ GT  DLQ++ KR +FD    + L  NP  L VE P
Sbjct  144   SALENVAHQKLETGLIPVLDHASELGTVVDLQDVLKRFAFDNICMLVLGINPNYLSVEFP  203

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
                 +  A      A+LY+HI+P+  WKLQKW   I  EKK + AW TFD+F+Y  +S +
Sbjct  204   QT-VYANAFNTMEQALLYRHIVPKICWKLQKW-LQIGEEKKLSRAWKTFDRFLYGRISGR  261

Query  828   LNQLHDQDEDDSQNFSMLTSHMKAYKG------------KPMQFLRDTFVsltisggggt  685
                +  + +   + F +L + M+  +             K  +FLRDT     +  G  T
Sbjct  262   KANM--EQQQQQEEFDLLAAFMEEEEEEVKEDEQICALRKTDKFLRDT-AFSFLGAGNDT  318

Query  684   tssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTET-----FKVEECCDLVYLHAA  520
              SS L W FWL+A +P VE K+  EI K     H K+ +      FK ++   LVYLHAA
Sbjct  319   ISSGLVWFFWLVATHPSVENKILEEI-KANMVMHKKEEDGEKRFFFKAKQVNSLVYLHAA  377

Query  519   FCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPE  340
              CE+LRL+PPIP NHK++ + D LPSGH +K    +L S+Y+MGRME IWG+DC+EFKPE
Sbjct  378   LCETLRLYPPIPYNHKIAAQADILPSGHHIKKNQTVLISYYAMGRMEEIWGDDCLEFKPE  437

Query  339   RWLSD--CGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHT  166
             RW+S+  C   I HVPS KF  F  GPR C+G+    +  K+VA+++I  YH ++ + H 
Sbjct  438   RWISEKWC---IVHVPSYKFTAFHAGPRNCLGKDKALIQMKMVASAVIGNYHVKIAKGHP  494

Query  165   LVVPSDTLVLEVKHGVKVKLTKR  97
              V P ++++L +K+G+KV+++KR
Sbjct  495   -VSPCNSIILNMKYGLKVQVSKR  516



>ref|XP_010027331.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62195.1| hypothetical protein EUGRSUZ_H04853 [Eucalyptus grandis]
Length=507

 Score =   388 bits (997),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 206/483 (43%), Positives = 301/483 (62%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLPAL  N   +HD+AT  L+++   F  +   F+  DML+T+DPAN+ YI 
Sbjct  30    PNNWPLVGMLPALWLNLSHVHDWATGILERSCCNFLFRFHWFSGMDMLVTADPANVHYIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG  F+++F++ GDGI N+DS++W + R+     MN   F   L +T    V
Sbjct  90    STNFENFPKGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQVFMNDQRFHRFLAKTTRDKV  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL  VLD  +QRG   DLQ++F+R +FD   +     +PGSL VE P + PF +A+ D
Sbjct  150   ENGLLRVLDELSQRGVAVDLQDLFQRFTFDSACRFVTGFDPGSLSVEFP-EVPFSRALDD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD---QD  805
             A   I Y+H+ P  F  LQ+W  G+  E+K   AW+  D+ +   +  K  +L +   + 
Sbjct  209   AEEVIFYRHLYPAWFGTLQRW-LGLGVEEKLRRAWEVMDQIVGRYIEMKKAELREGTSKV  267

Query  804   EDDSQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             + D     +LTS+M   +         +FLRDT +   +  G  TTS  LTW FW L+ N
Sbjct  268   KGDENGADLLTSYMVENETLGALECNDKFLRDT-ILNLMIAGKDTTSLELTWFFWALSTN  326

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKV-EECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             P VE K+  EI  V  +   +  + FK+ E   ++VYLH A CESLRL+PPIP  HK  +
Sbjct  327   PSVEMKIREEIKSVILEEE-QNLKVFKIGEHVHNMVYLHGALCESLRLYPPIPFEHKCPV  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV P T+IL   Y+MGRM+++WGEDC EF+PERW+S+  GGI+H PS KF 
Sbjct  386   KPDVLPSGHKVNPSTKILILLYAMGRMKSVWGEDCFEFRPERWISE-RGGIRHEPSYKFL  444

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++ F   K++AA++I+ Y   L+E H  V PS++++L +KHG++VK  
Sbjct  445   AFNAGPRTCLGKEVAFTQMKMIAAAMIYNYEVHLVESHP-VRPSNSIILHIKHGLRVKFA  503

Query  102   KRK  94
             +R+
Sbjct  504   RRR  506



>ref|XP_007150924.1| hypothetical protein PHAVU_004G006100g [Phaseolus vulgaris]
 gb|ESW22918.1| hypothetical protein PHAVU_004G006100g [Phaseolus vulgaris]
Length=509

 Score =   388 bits (997),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 218/481 (45%), Positives = 296/481 (62%), Gaps = 14/481 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             T+ P++GMLP LL N  R HDF TE LKQ GGT E  GP F N + L TSDP N+ ++ N
Sbjct  34    TDHPILGMLPQLLFNLWRFHDFFTEILKQKGGTGEFTGPWFTNMNYLFTSDPLNVRHVMN  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              +F+NY KG  F+ +FE+FG GI+ TDSE W  +R   + L+    F   LE+T+ + ++
Sbjct  94    TSFHNYGKGPVFRDIFEVFGKGIVGTDSEAWKYNRDLVHYLLKQKKFEVFLEKTIHKKIQ  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             + L PVLDH  Q+G+  DLQ++F R +FD         +P  L V+ P +    KA  DA
Sbjct  154   NSLLPVLDHVHQQGSVVDLQDLFNRFTFDNLCYSVNGHDPNCLSVDFP-EVEIEKAFNDA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL----HDQD  805
                I  +H++P+  WKLQKW   I +EKK  EA    D+FIY  ++ K   L       +
Sbjct  213   GETIFRRHVVPKCVWKLQKW-LQIGQEKKMTEACKNLDEFIYACIASKRKNLSKCIEKNE  271

Query  804   EDDSQNFSMLTSHMKAYKGKPMQ----FLRDTFVsltisggggttssalTWLFWLLAKNP  637
              +++ +  +LT+ M+  K K  +    FLRDT V      G    +SALTW FWL+A NP
Sbjct  272   TEETSDVDLLTTLMREGKEKGEEHDDIFLRDT-VFNFFVAGRDAVTSALTWFFWLVATNP  330

Query  636   LVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
             LVEAK+  EI +   +N  K+ E   VEE   LVYLH A CESLRLFPPIP   K +L++
Sbjct  331   LVEAKILEEIKETFGRNE-KKAEVLSVEEVKKLVYLHGAICESLRLFPPIPFERKEALKS  389

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGH V P T IL   YSMGR E IWGEDCMEFKPERW+S+  GGI +VPS KF  F
Sbjct  390   DVLPSGHGVNPSTVILFFLYSMGRSEEIWGEDCMEFKPERWISE-KGGIVYVPSYKFVAF  448

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+ +  +  K+VA +I+ +Y  +++E H +  P  ++VL +K G+KV + KR
Sbjct  449   NTGPRTCLGKGVSLIQMKMVATAILHKYRLQVVEGH-VAKPKLSIVLLMKDGLKVTIKKR  507

Query  96    K  94
             +
Sbjct  508   E  508



>ref|XP_009759095.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=508

 Score =   388 bits (996),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 208/484 (43%), Positives = 298/484 (62%), Gaps = 15/484 (3%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             RS  P NWP +GM P LL + +R+H+   E   + GGT+ LKGP FAN D+L T DPAN+
Sbjct  31    RSGLPCNWPFLGMFPGLLFHVNRIHERCFEVFSRTGGTYLLKGPWFANMDILGTVDPANV  90

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              YI +  F N+PKG  F+K+F++ GDGI N+D +LW   RK T  L+ H  F   L +T 
Sbjct  91    HYIMSAKFENFPKGEEFKKIFDVLGDGIFNSDLDLWKTQRKITRTLITHQRFHNCLVKTS  150

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
                +E+GL  VL+  A+     DLQ++F+R +FD   Q+    +PG L +E P D+PF K
Sbjct  151   WDKIENGLISVLEFVARESKIVDLQDVFQRFTFDTTCQLVTGYDPGCLSLEFP-DNPFSK  209

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ  808
             A+ +A   +  +H+LPE  WKLQKW  G   EKK ++AW   D+ I   +S K ++L + 
Sbjct  210   AMDEAEEVLFIRHLLPESVWKLQKW-LGFGHEKKLSKAWQVLDQVIGKYISMKRDELSNG  268

Query  807   ---DEDDSQNFSMLTSHMKAYKGKPMQF----LRDTFVsltisggggttssalTWLFWLL  649
                 ED+ + F +LTS++       + F    LRDT +   +  G  TTSS LTW  WL+
Sbjct  269   TKLKEDNEEGFDLLTSYI---LDDGLNFDDKSLRDT-ILNLMIAGRDTTSSGLTWFIWLV  324

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             + +P VE K+  E++ +     +++   F+  E  + +YLHAA CESLRL+PP+P  HK 
Sbjct  325   STHPEVEKKIREELMAIISVTESQKWRLFRANELKNAIYLHAALCESLRLYPPVPFQHKT  384

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
               E   LPSGH V P  R++ S Y+MGRME+IWG+D  EFKPERW+SD  G +KH PS K
Sbjct  385   PREPGILPSGHHVHPNMRVMFSLYAMGRMESIWGKDASEFKPERWISD-RGTVKHEPSYK  443

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++ F   K VAA+II  Y  E+++ H  V P+ +++L ++HG K +
Sbjct  444   FLAFNAGPRTCLGKEVAFTQMKAVAAAIIHNYQVEVIKGHK-VYPNVSIILYMQHGFKAR  502

Query  108   LTKR  97
             + KR
Sbjct  503   IKKR  506



>ref|XP_010027339.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62202.1| hypothetical protein EUGRSUZ_H04860 [Eucalyptus grandis]
Length=507

 Score =   388 bits (996),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 207/483 (43%), Positives = 301/483 (62%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLPAL  N   +HD+AT  L+++   F  +   F+  DML+T+DPAN+ YI 
Sbjct  30    PNNWPLVGMLPALWLNLSHVHDWATGILERSCCNFLFRFHWFSGMDMLVTADPANVHYIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG  F+++F++ GDGI N+DS++W + R+     MN   F   L +T    V
Sbjct  90    STNFENFPKGPEFKRVFDVLGDGIFNSDSDMWRMQRRVAQVFMNDQRFHRFLAKTTRDKV  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL  VLD  +QRG   DLQ++F+R +FD   +     +PGSL VE P + PF +A+ D
Sbjct  150   ENGLLRVLDELSQRGVAVDLQDLFQRFTFDSACRFVTGFDPGSLSVEFP-EVPFSRALDD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD---QD  805
             A   I Y+H+ P  F  LQ+W  G+  E+K   AW+  D+ +   +  K  +L +   + 
Sbjct  209   AEEVIFYRHLYPAWFGTLQRW-LGLGVEEKLRRAWEVMDQIVGRYIEMKKAELREGTSKV  267

Query  804   EDDSQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             + D     +LTS+M   +         +FLRDT +   +  G  TTS ALTW FW L+ N
Sbjct  268   KGDENGADLLTSYMVENETLGALECNDKFLRDT-ILNLMIAGKDTTSLALTWFFWALSTN  326

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKV-EECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             P VE K+  EI K       +  + FK+ E   ++VYLH A CESLRL+PPIP  HK  +
Sbjct  327   PSVEMKIREEI-KSAILEEEQNLKVFKIGEHVHNMVYLHGALCESLRLYPPIPFEHKCPV  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV P T+IL   Y+MGRM+++WGEDC EF+PERW+S+  GGI+H PS KF 
Sbjct  386   KPDVLPSGHKVNPSTKILILLYAMGRMKSVWGEDCFEFRPERWISE-RGGIRHEPSYKFL  444

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++ F   K++AA++I+ Y   L+E H  V PS++++L +KHG++VK  
Sbjct  445   AFNAGPRTCLGKEVAFTQMKMIAAAMIYNYEVHLVESHP-VRPSNSIILHIKHGLRVKFA  503

Query  102   KRK  94
             +R+
Sbjct  504   RRR  506



>ref|XP_008440138.1| PREDICTED: cytochrome P450 86B1-like [Cucumis melo]
Length=511

 Score =   384 bits (986),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 208/478 (44%), Positives = 295/478 (62%), Gaps = 10/478 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GM P ++ + HR HD  TE L+Q   TF  KG  F+  D L T DP+NI +I 
Sbjct  36    PWNWPIVGMTPTVIAHFHRPHDRVTEVLQQTAFTFFFKGIWFSGTDFLFTVDPSNIHHIL  95

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF  YPKG  F+ +FE+ GDGI N+DS++W   RKT + L+ H  F   LE+     V
Sbjct  96    SANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKSQRKTAHHLVRHESFLQFLEKITLNKV  155

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL PVLD   + G+  DLQ++F+R SFD    +    +  SL +E P + PF KA+ D
Sbjct  156   KTGLVPVLDSVCENGSVLDLQDLFQRFSFDSTCMMVTGFDLHSLSLESP-EVPFSKAMDD  214

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL----NQLHDQ  808
             A   I  +H  P+  W+ QK    I + K+  +AW+  D+ I  +++ K     NQ+ ++
Sbjct  215   AEEVIFLRHFFPKTIWEFQK-KLQIGQPKRLKQAWEIIDETIAKLIASKRKSLKNQMKEE  273

Query  807   DEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVE  628
               DD +   ++TS++   +    +FLRDT V   +  G  T SSAL+W F+ ++ NP V 
Sbjct  274   GGDDKEGVDLITSYITNIEYDD-EFLRDT-VLNFMIAGRDTLSSALSWFFFCVSNNPTVV  331

Query  627   AKLFNEILKVKPQNHA-KQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
              K+  E+    P N A  Q   F +EE  +LVYLH   CE+LRL+PP+P+ HK+S + D 
Sbjct  332   EKIREELRTSIPTNEAYDQRRIFSLEEVDNLVYLHGTLCEALRLYPPVPLQHKVSTQHDI  391

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH +KPKT+IL S Y++GRM  +WG+DC+EFKPERW++   G IKHVPS KF  F+ 
Sbjct  392   LPSGHHIKPKTKILFSLYALGRMSEVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNA  451

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPRTC+G+ + F   KIVAA+II  Y+      H  VVPS +++L +KHG KVK+TKR
Sbjct  452   GPRTCLGKHVAFTELKIVAAAIIHNYNIIQQTGHE-VVPSASIILHMKHGFKVKVTKR  508



>gb|KDP46408.1| hypothetical protein JCGZ_10248 [Jatropha curcas]
Length=510

 Score =   384 bits (986),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 204/494 (41%), Positives = 297/494 (60%), Gaps = 15/494 (3%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             +W  +  RS     WPV GM+P LL NA R+HDF+T  L+  GGTF +KGP F++ D L+
Sbjct  19    LWVWARNRSSPIIYWPVFGMIPQLLWNASRIHDFSTYVLQCYGGTFLVKGPWFSDLDFLV  78

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             TSD  NI Y  NKNF NYPKG   +++FE  GDGILN+D + W   R+  ++      F 
Sbjct  79    TSDSMNIHYTLNKNFPNYPKGAESKEIFEPLGDGILNSDCDSWRTQRRIIHSFFKDKRFE  138

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
              +++ ++ Q +  GLFPVL++ ++     D+QE+F+R +FD   Q+ L  +P SL +E P
Sbjct  139   LAIKTSIEQKILKGLFPVLENASKLRNEIDIQEVFQRFTFDNSCQLVLGFDPNSLSIELP  198

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPI----  841
              + P  K +  A  A+LY+H  P   WKL+KW   I  EK   +AWD  D F+       
Sbjct  199   -EVPIEKVLGGAEEALLYRHFYPTSLWKLKKW-LQIGTEKNLKKAWDILDDFLQQSITRK  256

Query  840   ---LSEKLNQLHDQDEDDSQNFSMLTSHMKAYKG---KPMQFLRDTFVsltisggggtts  679
                LS+  NQ+ ++D D       ++   +   G   K  +FLRD      +  G  T S
Sbjct  257   QKQLSQSRNQIQEEDFDLLTYILTISDEQEDQNGILIKSNRFLRD-ITLSLLLAGRDTIS  315

Query  678   salTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRL  499
             ++LTWL W++A +P VE K+  E+ +    +   ++  F   E   LVYLHA  CE LRL
Sbjct  316   ASLTWLIWVVATHPCVEKKILEELKEYLQVDTKGKSRLFNFGELSKLVYLHAVVCEVLRL  375

Query  498   FPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCG  319
             +PP+P NHK+S+E D LPSGH +    RI+ S YSMGRM+ IWGEDC+EFKPERW+S+  
Sbjct  376   YPPLPFNHKVSIEPDILPSGHHIPKNMRIIYSLYSMGRMKEIWGEDCLEFKPERWISET-  434

Query  318   GGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLV  139
             G IKHVP+ KF  F  GPR+C+G+ M  M  K++A ++I+ Y  ++ E H  + P  +++
Sbjct  435   GQIKHVPAYKFIAFGTGPRSCLGKHMALMELKVIACAVIWNYSLQIAENHP-ISPDISVI  493

Query  138   LEVKHGVKVKLTKR  97
             L +K+G+KVK+++R
Sbjct  494   LHIKNGLKVKVSER  507



>ref|XP_010681071.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=486

 Score =   382 bits (982),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 209/487 (43%), Positives = 303/487 (62%), Gaps = 23/487 (5%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W     +S  PTNWP++GML  LL+N +R+HD+ +E L+ +  +F  KGP F N +ML+T
Sbjct  17    WNIFRNKSGTPTNWPLVGMLLPLLRNVNRIHDWVSEILETSQLSFLFKGPWFTNMEMLVT  76

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
              DPANI +I  KNF+NYPKGT F ++F++ GDGI N D +LW  HR   +  + H  FR 
Sbjct  77    VDPANIHHIMTKNFSNYPKGTKFNEIFDVMGDGIFNVDFDLWKYHRSMAHTFIAHPRFRH  136

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
              L   + + VE GL PVLDH A      DLQ+IF R +FD    + +  + GSL ++ P 
Sbjct  137   FLVVKIQEKVEKGLIPVLDHAANERLVVDLQDIFARFTFDNICTLVMGHDVGSLSIDWPH  196

Query  1005  DHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL  826
               PF KA+ D    ILY+H++P   WK+ +W   I +E+K+  AW+  D+FIY  +++K 
Sbjct  197   -VPFSKALDDVEEVILYRHVVPMSVWKILRW-LRIGKERKYKRAWEILDEFIYKCIAKKR  254

Query  825   NQLHDQDEDDSQNFSMLTSHMKA-----YKGKPMQFLRDTFVsltisggggttssalTWL  661
              +L    +++     +LT +M        K    +FLRDT +      G  TTS AL+W 
Sbjct  255   AEL---GKNEGVGVDLLTLYMDKSQNVNVKDASDKFLRDT-ILSYFIAGRDTTSLALSWF  310

Query  660   FWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPM  481
             F+LL KNP V +K+ +E+ K       K T   K+++  +LVYLH A CE+LRL+PP+  
Sbjct  311   FYLLIKNPRVVSKIRDELEK-------KMT---KIDDFNNLVYLHGALCEALRLYPPVVF  360

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
               K   + DTLPSGH+V P  +I+ S Y+M RM++IWG DC EFKPERW+S+  G I+H 
Sbjct  361   QAKGPTKPDTLPSGHEVNPNMQIIFSMYAMARMKSIWGNDCYEFKPERWISE-SGKIRHE  419

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             PS K+ +F+ GPRTC+G+ M F   K+VAA+I+  Y  + +E H LVVP  +++L VK+G
Sbjct  420   PSYKYLVFNAGPRTCLGKDMAFTQMKVVAATIVKNYEFQALEGH-LVVPDISIMLRVKYG  478

Query  120   VKVKLTK  100
             +KV+++K
Sbjct  479   LKVQVSK  485



>ref|XP_002306257.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
 gb|EEE93253.2| hypothetical protein POPTR_0005s06540g [Populus trichocarpa]
Length=517

 Score =   382 bits (982),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 212/501 (42%), Positives = 320/501 (64%), Gaps = 32/501 (6%)
 Frame = -3

Query  1530  RRSMDP-TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             R ++ P TNWPV+GMLP LL  A  +H++AT  LKQ+GGTFE KGP FAN ++ LT+DP 
Sbjct  24    RNTVSPVTNWPVVGMLPGLLFKAQNIHEYATRLLKQSGGTFEFKGPWFANMNIFLTADPL  83

Query  1353  NIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLER  1174
             N+ +I   NF NYPKG  ++K+FE +GDG+LN+D E W   RK  ++++    F+ SLER
Sbjct  84    NVRHISTTNFVNYPKGPEYKKIFEPYGDGVLNSDFESWKSFRKLIHSMIKDNKFQVSLER  143

Query  1173  TVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPF  994
             ++ + +  GL PVL+H +++    D+Q++F+R +FD    + L  +P SL V+ P +  +
Sbjct  144   SLREKIVEGLIPVLEHASRQEIELDMQDVFQRFTFDNICLLVLGFDPQSLSVDLP-EIAY  202

Query  993   RKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK-----  829
             + A  D   A+ Y+HI+PE  WKLQKW   +  EKK ++A DT D F+   +S K     
Sbjct  203   KTAFDDVEEAVFYRHIVPESIWKLQKW-LNVGEEKKLSQAMDTIDNFLEQCISSKKEEIR  261

Query  828   ------LNQLHDQDEDDSQNFSMLTSHMKAYKG--------KPMQFLRDTFVsltisggg  691
                   + Q+ D D+DD   + ++T+ +K  +         +  ++LRD      I+ G 
Sbjct  262   QRKAQNMVQVEDNDQDD---YDLITACIKEGEAAEQMDASKRTDKYLRD-IGFNFIAAGK  317

Query  690   gttssalTWLFWLLAKNPLVEAKLFNEI---LKVKPQNHAKQTETFKVEECCDLVYLHAA  520
              T ++ALTW FWL+A +  VE K+  EI   +K K  +H      F +EE   LVYLH A
Sbjct  318   DTVNAALTWFFWLVATHHEVEEKIVEEIRANMKSKG-DHTINGMFFNLEELNKLVYLHGA  376

Query  519   FCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPE  340
              CE+LRL+P +P N+++S+E DTLPSGH VK  T+++ S YSMG ME IWG+DC+ FKPE
Sbjct  377   ICETLRLYPAVPFNYRVSVEADTLPSGHLVKENTKVMFSLYSMGSMEEIWGDDCLAFKPE  436

Query  339   RWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLV  160
             RW+S+  GGI HVPS K+  F+ GPR+C+G+++ F+  K +A +I+  +H +++E H  V
Sbjct  437   RWISE-RGGIIHVPSYKYIAFNTGPRSCLGKEITFIQMKTIATAILLNFHLQVVEGHP-V  494

Query  159   VPSDTLVLEVKHGVKVKLTKR  97
              P  +++L +KHG+K+++TKR
Sbjct  495   SPGLSVMLHMKHGLKLRVTKR  515



>ref|XP_006427987.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
 ref|XP_006464489.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 ref|XP_006495173.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|ESR41227.1| hypothetical protein CICLE_v10025412mg [Citrus clementina]
Length=508

 Score =   382 bits (981),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 211/481 (44%), Positives = 305/481 (63%), Gaps = 13/481 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P N+PV+G LP LL N HR+HD++TE L++   TF  KGP FAN D+L T DPAN+ +I 
Sbjct  30    PKNFPVVGTLPHLLLNVHRIHDYSTEVLEKTQCTFLFKGPWFANMDILATVDPANVHHIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+N+PKG  F+++F+I GDGI N+DS+LW   R+   ALMN   F   L ++    +
Sbjct  90    SSNFSNFPKGPEFKRIFDILGDGIFNSDSDLWKNQRRFAQALMNRHSFYKFLVKSNQAKL  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH +++GT  DLQ++F+R +FD         +PG L +E P       A+ D
Sbjct  150   EKGLIPILDHMSKQGTTVDLQDLFQRFTFDSTSLFVTGYDPGCLSIEFPEVR-LLMALED  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD-ED  799
             A  +I Y+H++PE  WKLQ+W  GI  EKK  +A +T D  I+ ++  K  +++++    
Sbjct  209   AEESIFYRHVVPESLWKLQRW-LGIGEEKKLKKAKETLDSVIFELIQRKRREINEEILSK  267

Query  798   DSQNFSMLTSHM---KAYKGKPMQ----FLRDTFVsltisggggttssalTWLFWLLAKN  640
             +     +L S+M   K   G+  +    FLRDT V   +  G  TTSSALTW FWL++KN
Sbjct  268   EIDGVDLLASYMHENKTIMGELQRADDNFLRDT-VLNFMIAGRDTTSSALTWFFWLISKN  326

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P  E K+  E+  + P     +   F  ++   LVYLH A CE+LRL+PP+P  HK+ L 
Sbjct  327   PKAETKIREELSSIVPAEKLGKWWDFDTQKLNQLVYLHGALCEALRLYPPVPFQHKVPLV  386

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              DTLPSGH+  P+T+IL S Y+MGRM++IWGEDC+EF+PERW+S+  GGIK  PS KF  
Sbjct  387   PDTLPSGHRAVPRTKILFSLYAMGRMKSIWGEDCLEFRPERWISE-SGGIKWEPSYKFFS  445

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC+G+++ F   K VAA +I  Y  +++E      P+ +++L +KHG+KV++  
Sbjct  446   FNAGPRTCLGKEVAFTQMKAVAAGVIHNYDIQVVEGQR-PGPNVSIILYMKHGLKVRVHD  504

Query  99    R  97
             R
Sbjct  505   R  505



>gb|KGN48432.1| hypothetical protein Csa_6G487530 [Cucumis sativus]
Length=511

 Score =   382 bits (981),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 204/478 (43%), Positives = 296/478 (62%), Gaps = 10/478 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GM P ++ + HR HD  TE L+Q   TF  KG  F+  D L T DP+NI +I 
Sbjct  36    PWNWPIVGMTPTVIAHIHRPHDRVTEVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHIL  95

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF  YPKG  F+ +FE+ GDGI N+DS++W   RKT + L+ H  F   LE+     V
Sbjct  96    SANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNKV  155

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL P+LD   + G+  DLQ++F+R SFD    +    +  SL +E P + PF KA+ D
Sbjct  156   KTGLVPILDSVCENGSVLDLQDLFQRFSFDSTCMMVTGFDLNSLSLEFP-EVPFSKAMDD  214

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL----NQLHDQ  808
             A   I  +H  P+  W+ QK    I + K+  +AW+  D+ I  +++ K     N++ ++
Sbjct  215   AEEVIFVRHFFPKTIWEFQKKL-QIGQPKRLKQAWEIIDETIAKLIASKRKSLKNEMKEE  273

Query  807   DEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVE  628
             D++  +   ++TS++   +    +FLRDT V   +  G  T SSAL+W F+ L+ +P V 
Sbjct  274   DDNGKEGVDLITSYITNIENDD-EFLRDT-VLNFMIAGRDTLSSALSWFFFCLSNHPTVV  331

Query  627   AKLFNEILKVKPQNHA-KQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
              K+  E+    P N A  Q   F +EE  +LVY H   CE+LRL+PP+P+ HK+S++ D 
Sbjct  332   EKIREELRTTIPTNEAYDQRRIFSIEEVDNLVYFHGTLCEALRLYPPVPLQHKVSIQHDI  391

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH +KPKT+IL S Y++GRM  +WG+DC+EFKPERW++   G IKHVPS KF  F+ 
Sbjct  392   LPSGHHIKPKTKILFSLYALGRMSEVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNA  451

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPRTC+G+ + F   KIVAA+II  Y+      H  VVPS +++L +KHG KVK+TKR
Sbjct  452   GPRTCLGKHVAFTELKIVAAAIIHNYNIIQQAGHE-VVPSASIILHMKHGFKVKVTKR  508



>ref|XP_002521476.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40966.1| cytochrome P450, putative [Ricinus communis]
Length=505

 Score =   382 bits (981),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 205/479 (43%), Positives = 298/479 (62%), Gaps = 14/479 (3%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+GM+P L  N +  HDF T  L Q+ GTF  KGP F+  + L+T+DP  + +  +K
Sbjct  30    NWPVVGMIPGLFSNLYHAHDFLTSRLLQSEGTFLFKGPWFSGMNFLVTADPMIVHHTLSK  89

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF NY KG  F+++ E+ GDGI N DS+ W   R+T + L+    F+ ++ERT+   V  
Sbjct  90    NFANYVKGADFKQILEVLGDGIFNADSDSWRFQRRTIHFLLKQPSFQMAVERTMKLKVSK  149

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GLF VLD+ ++ G   D+Q++F+R +FD    + L  +P  L VE P + PF KA     
Sbjct  150   GLFSVLDNASKLGCEVDIQDVFQRFTFDSICMLVLSFDPECLSVEFP-NVPFEKAFDCIE  208

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED--D  796
               I Y++I+P   WKLQ+W   I +E+   +AW+TFD F+   L+ K  QL DQ ++  +
Sbjct  209   EVIFYRYIVPISIWKLQRW-LQIGQERTMRKAWETFDFFVEQCLARKREQL-DQRKNTVE  266

Query  795   SQNFSMLTSHMKAYKG------KPMQFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
             S+NF +LT  +    G      K  +F+RD      +  G  T  + L WLFWL+A +P 
Sbjct  267   SENFDLLTYFLVEDGGEDGVFTKSNKFVRD-MTFNLLLAGRDTVGAGLVWLFWLVAAHPF  325

Query  633   VEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETD  454
             VE K+  EI +   +N  ++   F VEE   LVYLHA  CE+LRL+PP+P   K+ +E+D
Sbjct  326   VEQKILEEIREHLGENTGEKWRLFNVEELSKLVYLHAVVCETLRLYPPVPFEVKVPVESD  385

Query  453   TLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFS  274
              LP GH V    +IL S YSMGRME IWG+DC++F+PERW+S+  G IK VPS KF  F+
Sbjct  386   ILPGGHHVNRDIKILYSLYSMGRMEDIWGKDCLKFRPERWISE-AGKIKQVPSYKFTAFN  444

Query  273   VGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
              GPRTC+G+++ F+  K+VA++II+ Y  +++E H  V PS +L+L +K G+KV++ KR
Sbjct  445   AGPRTCLGKELGFVEMKLVASAIIWNYSIKVVEDHP-VSPSLSLILYMKDGLKVRVAKR  502



>ref|XP_011095705.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=507

 Score =   382 bits (980),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 212/483 (44%), Positives = 295/483 (61%), Gaps = 15/483 (3%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             +S  PTNWP++GM+PALL+N  RLH   TE L+Q+GGT   KGP FAN DM++TSD AN+
Sbjct  31    KSSLPTNWPILGMIPALLKNIGRLHQVTTEVLEQSGGTIWFKGPWFANMDMMVTSDRANV  90

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              YI  KNF N+ KG  F+K+F+IFGDGI   + E W+  R++T ALM   GF+  +  T 
Sbjct  91    HYILTKNFPNFSKGPEFKKIFDIFGDGIFAAEHESWESQRRSTKALMMQPGFQELVATTS  150

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
                VE+ L P+++  ++ GT  D+QE+F+R +FD    + L  +P SL  E P   P  K
Sbjct  151   WNKVETSLIPIMELVSETGTEVDVQELFQRFAFDCSCILVLGHDPTSLSKELP-HLPHEK  209

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ  808
                D   A+LY+HILP+  WKLQ+W   + +E+K  E  + FD+F+    S K       
Sbjct  210   VFADVGEAVLYRHILPQIVWKLQRW-LQVGKERKLKEGMEHFDRFLCHCFSLKQQGDTAA  268

Query  807   DEDDSQNFSMLTSHMKAYK-------GKPMQFLRDTFVsltisggggttssalTWLFWLL  649
              E   Q+F +L+S M+A +              RD  +   I  G  T S+ LTW FWLL
Sbjct  269   TEPGRQDFDILSSTMRAVEVNGDDAPNISQVSWRDN-MFNLIGAGKDTISATLTWFFWLL  327

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             A +P  E K+  EI         K T    ++E   L+YLH A CE+LRLFPP+ + HK 
Sbjct  328   ATHPAEEEKIRLEICTNFQVGKWKFT---NMKELRKLIYLHGALCEALRLFPPVAIQHKA  384

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
              +E D LP+GH +KP T  L SFYSMGRME+IWG+DC++FKP RW+S+  G IK  PS K
Sbjct  385   PVEHDILPTGHHIKPNTITLLSFYSMGRMESIWGKDCLQFKPGRWISET-GSIKIEPSYK  443

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPR+C+G++M F   KIVAA+II R+  ++   H  V P+ +++L +K G+KVK
Sbjct  444   FTAFNAGPRSCLGKEMSFTQMKIVAAAIISRFKVQVAAGHP-VCPNASIILHMKRGLKVK  502

Query  108   LTK  100
             ++K
Sbjct  503   VSK  505



>gb|EYU24048.1| hypothetical protein MIMGU_mgv1a026886mg [Erythranthe guttata]
Length=509

 Score =   382 bits (980),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 209/483 (43%), Positives = 299/483 (62%), Gaps = 17/483 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP+L  + HR+H    + LK  GGTF LKGP+FAN D+++T+DPANI +I 
Sbjct  32    PWNWPVVGMLPSLFCHLHRVHHRCVDILKLAGGTFHLKGPSFANSDIIITADPANIHFIM  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG HF+++F++ GDGI N DS+ W   RK   AL+ H  FR  L RT  + V
Sbjct  92    SSNFANFPKGPHFKEIFDVLGDGIFNADSDSWARQRKQARALITHDSFRRFLIRTTSEKV  151

Query  1155  ESGLFPVLDHYA--QRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAI  982
                L PVL+      RG   DLQ++F+R +FD    +    +PG L V  P D PF +A+
Sbjct  152   RHSLIPVLEQVCNNSRGIVVDLQDLFQRFTFDTTCVLVTGYDPGCLSVGLP-DVPFSRAL  210

Query  981   IDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-----  817
              +A  AI  +H LPE  WKLQ+ F G   EK+ + A    D  I   +S K  ++     
Sbjct  211   DEAEEAIFMRHCLPESLWKLQR-FLGFGHEKQLSRARVVLDSVIEKYISAKREEIMAGKS  269

Query  816   ---HDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLA  646
                H+  +++  +  +L+S++   +      LRDT +   +  G  TTSSALTW  WL++
Sbjct  270   GGPHELGQEN--DLDLLSSYINESENDNDSSLRDT-ILNFMIAGRDTTSSALTWFVWLVS  326

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
              +P VE K+ +E+  V P++   +   F+ +E  +LVYLHAA CESLRL+PP+P  HK  
Sbjct  327   THPEVEKKIRDELNSVIPEDSRTKLRLFEADEVRNLVYLHAALCESLRLYPPVPFQHKAP  386

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
                  LPSGH   P+ ++L S Y+MGRME IWG+D  EFKPERW+++  G +KH PS KF
Sbjct  387   ARPVVLPSGHYAGPEMKLLFSLYAMGRMEYIWGKDSGEFKPERWITE-RGTVKHEPSYKF  445

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+++ F   K VAA+II  Y  E++E H  V P+ +++L +K+G+KV++
Sbjct  446   LAFNAGPRTCLGKEVAFTQLKCVAAAIIHNYQIEVVEGHN-VSPNVSIILYMKYGLKVRV  504

Query  105   TKR  97
             TKR
Sbjct  505   TKR  507



>ref|XP_004160508.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86B1-like [Cucumis 
sativus]
Length=511

 Score =   382 bits (980),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 204/478 (43%), Positives = 295/478 (62%), Gaps = 10/478 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GM P ++ + HR HD  TE L+Q   TF  KG  F+  D L T DP+NI +I 
Sbjct  36    PWNWPIVGMTPTVIAHIHRPHDRVTEVLQQTAFTFFFKGIWFSGMDFLFTVDPSNIHHIL  95

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF  YPKG  F+ +FE+ GDGI N+DS++W   RKT + L+ H  F   LE+     V
Sbjct  96    SANFERYPKGPDFKYIFEVLGDGIFNSDSDVWKNQRKTAHYLVRHHNFLQFLEKITLNKV  155

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL P+LD   + G+  DLQ++F+R SFD    +    +  SL +E P + PF KA+ D
Sbjct  156   KTGLVPILDSVCENGSVLDLQDLFQRFSFDSTCMMVTGFDLNSLSLEFP-EVPFSKAMDD  214

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL----NQLHDQ  808
             A   I  +H  P+  W+ QK    I + K+   AW+  D+ I  +++ K     N++ ++
Sbjct  215   AEEVIFVRHFFPKTIWEFQKKL-QIGQPKRLKRAWEIIDETIAKLIASKRKSLKNEMKEE  273

Query  807   DEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVE  628
             D++  +   ++TS++   +    +FLRDT V   +  G  T SSAL+W F+ L+ +P V 
Sbjct  274   DDNGKEGVDLITSYITNIENDD-EFLRDT-VLNFMIAGRDTLSSALSWFFFXLSNHPTVV  331

Query  627   AKLFNEILKVKPQNHA-KQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
              K+  E+    P N A  Q   F +EE  +LVY H   CE+LRL+PP+P+ HK+S++ D 
Sbjct  332   EKIREELRTTIPTNEAYDQRRIFSIEEVDNLVYFHGTLCEALRLYPPVPLQHKVSIQHDI  391

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH +KPKT+IL S Y++GRM  +WG+DC+EFKPERW++   G IKHVPS KF  F+ 
Sbjct  392   LPSGHHIKPKTKILFSLYALGRMSEVWGKDCLEFKPERWINSENGKIKHVPSYKFLAFNA  451

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPRTC+G+ + F   KIVAA+II  Y+      H  VVPS +++L +KHG KVK+TKR
Sbjct  452   GPRTCLGKHVAFTELKIVAAAIIHNYNIIQQAGHE-VVPSASIILHMKHGFKVKVTKR  508



>gb|KHN19680.1| Cytochrome P450 86B1 [Glycine soja]
Length=572

 Score =   384 bits (985),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 206/480 (43%), Positives = 308/480 (64%), Gaps = 8/480 (2%)
 Frame = -3

Query  1542  KKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTS  1363
             K+  R  + P ++P+IGMLP +L N  R HD  ++ LKQ+GGT E  GP F   + L++S
Sbjct  24    KRCCRHPLFP-DYPIIGMLPPVLCNLWRAHDLISDVLKQHGGTGEFTGPWFTIMNCLISS  82

Query  1362  DPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPS  1183
             DP N+ ++ +KNF+NY KG  F+ +F+ FGDGI   DSE W  +R   ++L  +  F   
Sbjct  83    DPINVHHVMSKNFHNYVKGPVFRDIFQAFGDGIFTADSEAWKYNRDLFHSLFKNRSFEFF  142

Query  1182  LERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSD  1003
             LE+T+   V++ L P+LDH  Q+    DLQ++F R +FD    + L  +P  L V+ P +
Sbjct  143   LEKTIQNKVQNSLLPMLDHMHQQRKVVDLQDVFGRFTFDNICSLVLGYDPNCLSVDIP-E  201

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLN  823
                 KA  +A  +I Y+H +P+  WKLQKW   I +EKK  EA  T D+FI+  ++ K  
Sbjct  202   VAIEKAFNEAEESIFYRHTVPKCVWKLQKW-LQIGQEKKMTEACKTLDQFIHACIASKRV  260

Query  822   QLHDQDE-DDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLA  646
             +L + +E  ++ +  ++T+ M+  +    +F+RD  V      G  T +SALTW FWL+A
Sbjct  261   ELSNDNEMGEAHHVDLITALMREKQTHDDRFIRDA-VFNLFVAGRDTITSALTWFFWLVA  319

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
              NPLVEAK+  EI K K + + K      VE+   LVYLH A CE+LRLFPPIP   K++
Sbjct  320   TNPLVEAKILEEI-KEKLETNEKTLGVLSVEKVKKLVYLHGAICETLRLFPPIPFERKLA  378

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             ++ D LPSGH+V P+T IL S Y+MGR+E  WG+DC+EFKPERW+S+  GGI +VPS KF
Sbjct  379   IKADMLPSGHRVNPRTMILISLYAMGRLEETWGKDCLEFKPERWISE-KGGIVYVPSYKF  437

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+ + F+  K+VAA+I+++YH +++E + +  PS ++VL +K G+K+++
Sbjct  438   IAFNAGPRTCLGKDLSFIQMKMVAAAILYKYHVQVVEDY-VATPSLSIVLLIKDGLKMEI  496



>ref|XP_006446605.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
 gb|ESR59845.1| hypothetical protein CICLE_v10017795mg [Citrus clementina]
Length=509

 Score =   381 bits (978),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 203/488 (42%), Positives = 297/488 (61%), Gaps = 28/488 (6%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             ML  L+ NAH+LH+FAT  L+++ GT E KGP FA  D ++TSDP N+ YI +KNF+NYP
Sbjct  24    MLSTLVLNAHQLHEFATRVLQKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYP  83

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG   + + E FGDG+   D  LW + RK  +++M H  F  +LE+T+ Q +E+GL PVL
Sbjct  84    KGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHNKFESALEKTIYQKLENGLIPVL  143

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             DH ++ G   DLQ++F+R +FD      L  +P  L  E P    +  A      A+ Y+
Sbjct  144   DHASEVGIKVDLQDVFQRFTFDNICMSVLGIDPNYLSFEFPQV-AYANAFNATEQAVFYR  202

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS---EKLNQLHDQDEDDSQNFS  781
             HI+P+ +WKLQKW   I +EKK ++A  TFD+F+Y  +S   E+L        ++ + F 
Sbjct  203   HIVPKSWWKLQKWLH-IGKEKKLSKAMKTFDRFLYECISLKRERLQISRKASTEEEEEFD  261

Query  780   MLTSHMKAYKGKPM--------------QFLRDTFVsltisggggttssalTWLFWLLAK  643
             +LT+ M   + +                +FLRDT     ++ G  T SS L W FWL+A 
Sbjct  262   VLTAFMVEGEEEEEMNEDRKIGALRRNDKFLRDT-AFNLLAAGKETVSSGLVWFFWLVAT  320

Query  642   NPLVEAKLFNE------ILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPM  481
             +P VE  +  E      + K + + H  +   F  +E   +VYLHAA CE+LRL+PP+P 
Sbjct  321   HPSVENNILEEMKANMVMQKEEEEEHRDKRLLFDAKEVNRMVYLHAALCETLRLYPPVPY  380

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
             NHK++ + D LPSGH++     IL S+Y+MGRME IWG+DC+EFKPERW+++  G I HV
Sbjct  381   NHKIAAQADVLPSGHRINKNHSILISYYAMGRMEVIWGKDCLEFKPERWITE-KGSIVHV  439

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             PS KF  F  GPR C+G+   F+  K+VAA I+  Y  ++++ H  V P +++VL +K+G
Sbjct  440   PSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGNYQVKIVQGHP-VSPCNSMVLHMKYG  498

Query  120   VKVKLTKR  97
             +KV+L+KR
Sbjct  499   LKVQLSKR  506



>ref|XP_011100903.1| PREDICTED: cytochrome P450 86B1-like [Sesamum indicum]
Length=515

 Score =   381 bits (979),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 204/484 (42%), Positives = 296/484 (61%), Gaps = 18/484 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFL-KQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             NWPVIGMLP LL +  R+HD  TE + K   GTF  +GP  A+ DM+ T+DP N+ YI +
Sbjct  31    NWPVIGMLPTLLLHVSRIHDNCTEIMGKSRRGTFHFRGPWLADMDMMGTADPENVHYIMS  90

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF N+PKG  F+++F++ GDGI N DSE W   R+   AL++H GF   L +   + VE
Sbjct  91    ANFQNFPKGPKFREIFDVLGDGIFNADSESWRDQRRVARALISHHGFLRFLAKISREKVE  150

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL PVL+         DLQ++F+RL+FD         +PG L V+ P D PF KA+ DA
Sbjct  151   KGLIPVLETVCLENRVVDLQDLFQRLTFDTTCTFVTGYDPGCLSVDLP-DVPFSKALDDA  209

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ----D  805
               AI  +H++PE+ WKLQ+WF G+  E+K ++A +  D  I   ++ K  ++  +    D
Sbjct  210   EEAIFMRHVVPEKIWKLQRWF-GVGSERKLSKAREVLDSVIGRYIALKRGEMRSRGISID  268

Query  804   EDDSQNFSMLTSHMKAYKGKPM--------QFLRDTFVsltisggggttssalTWLFWLL  649
              ++     +LTS+M                +FLRDT +   +  G  TTSSALTW  WL+
Sbjct  269   CENEDGVDLLTSYMTVGDDGTQTHDLKCDDKFLRDT-ILNLMIAGRDTTSSALTWFIWLV  327

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             + +  VE ++ +E+    P    ++   F VEE   LVY+H A CE+LRL+PP+P  HK 
Sbjct  328   STHAEVEKRIRDELKSFLPAGEREKWRVFGVEETKKLVYMHGAICEALRLYPPVPFQHKE  387

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
              +E D LPSGH V+P  +++ S Y+MGRME++WGEDC+EFKPERW+SD  G IKH PS K
Sbjct  388   PVEPDILPSGHFVEPTMKVMFSLYAMGRMESVWGEDCLEFKPERWISD-RGSIKHEPSYK  446

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+ + F   K VAA++I  Y   + + H  V+P+ +++L +++G+KV+
Sbjct  447   FLAFNAGPRTCLGKDVAFAQVKAVAATLIHNYQVHVADGHR-VLPNCSIILYMRNGLKVR  505

Query  108   LTKR  97
             +  R
Sbjct  506   VANR  509



>ref|XP_009397903.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   381 bits (979),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 203/496 (41%), Positives = 298/496 (60%), Gaps = 23/496 (5%)
 Frame = -3

Query  1530  RRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPAN  1351
             RRS  P NWPV GMLP LL    R++D+    +++ G TF  +GP     + +LT DPAN
Sbjct  31    RRSNVPVNWPVAGMLPGLLLRCRRIYDWGACLVREVGCTFVFRGPWLLGMNYVLTCDPAN  90

Query  1350  IDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERT  1171
             + +I +  F+NYPKG  F ++F++ GDGI N+D ELW   R   + L++   FR  +  +
Sbjct  91    LQHIFSAGFSNYPKGEEFSEIFDVLGDGIFNSDGELWKKQRMRAHGLISSRSFRSFVAGS  150

Query  1170  VCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFR  991
               + VE GL P+LD  A++GT  DLQ++F RL+FD    +    +P  L +E P+  PF 
Sbjct  151   SRRKVEQGLIPLLDGIARQGTVVDLQDVFLRLTFDNTCHLVFGVDPCCLSIEFPT-IPFA  209

Query  990   KAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK------  829
             +A+ DA+ A+  +HI+P  +WKL +W  GI  EKK A AW   D+FI    +EK      
Sbjct  210   RALDDAMGALFLRHIVPPAWWKLMRW-LGIGEEKKLAMAWKEMDRFIAERTAEKKKQRSL  268

Query  828   -LNQLHDQDEDDSQNFSMLTSH-------MKAYKGKPMQFLRDTFVsltisggggttssa  673
               N++HD +E      S +  H        +    K  +FLRDT     +  G  TT + 
Sbjct  269   DKNRIHDGEEKVDLLSSYIDDHDDEEQHMSQQESSKFDKFLRDT-TMNFMLAGRDTTGAG  327

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTE----TFKVEECCDLVYLHAAFCESL  505
             LTW FWLL  NP+VE+K+  E+ KV    + + +      F  EE   LVYLHAA CESL
Sbjct  328   LTWFFWLLCNNPMVESKILEELKKVASLRNERSSSDDLVVFDAEELSKLVYLHAALCESL  387

Query  504   RLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD  325
             RLFPP+P   K +L  + LPSGH V P T+IL   ++M R+E IWGEDC+EFKPERW+S+
Sbjct  388   RLFPPVPFELKAALRHEVLPSGHGVGPGTKILVPLHAMARLEGIWGEDCLEFKPERWISE  447

Query  324   CGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDT  145
               G ++H PS KF  F+ GPRTC+G+++ F   K V A++++ +H E+++ H +V P  +
Sbjct  448   -KGRVRHEPSYKFLSFNSGPRTCLGKEVAFTQMKAVVAAMVYNFHVEVLQGH-VVEPKLS  505

Query  144   LVLEVKHGVKVKLTKR  97
             ++L +K+G++V++ +R
Sbjct  506   IILHMKNGLRVRIKRR  521



>ref|XP_010911437.1| PREDICTED: cytochrome P450 86B1-like [Elaeis guineensis]
Length=523

 Score =   381 bits (978),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 211/494 (43%), Positives = 308/494 (62%), Gaps = 16/494 (3%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             ++K+ +    P NWP +GM PALL + H LHD+ T  LK++G TF  +GP F+  DML T
Sbjct  32    YQKTKKGPGIPVNWPFVGMFPALLAHLHHLHDWGTMVLKESGCTFFFRGPWFSGMDMLFT  91

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
              DPAN+ ++ N NF NYPKG  F ++F+I GDGI N+D+E W   R   ++L++   FR 
Sbjct  92    CDPANVHHVFNANFLNYPKGDDFSEIFDILGDGIFNSDAESWRSQRMKAHSLISDQRFRS  151

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
              + ++    VE G+ P+LD  A++    DLQ++F RL+FD    +    +PG L +  P+
Sbjct  152   FVSQSSRNKVEKGVIPLLDQLAKQEVAVDLQDVFLRLTFDATCYLVFGVDPGCLSIGFPT  211

Query  1005  DHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL  826
               PF KA+ DA  A+L++H +P  +WKLQ+W F I  EKK A AW+  D+FI   ++EK 
Sbjct  212   -VPFAKAMDDATAALLFRHTVPPAWWKLQRW-FRIGEEKKLALAWEVIDQFIAQRIAEKK  269

Query  825   NQLHDQDEDDSQNFSMLTSHMKAYKG-------KPMQ---FLRDTFVsltisggggttss  676
              + +     +     +L+S++             PM+   FLRDT     +  G  TT +
Sbjct  270   EERNKSRSHEEAPRDLLSSYIDNCDDLHVVDVENPMELNKFLRDT-AMNFMIAGRDTTGA  328

Query  675   alTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTET-FKVEECCDLVYLHAAFCESLRL  499
             ALTW FWLL+KNP VE K+  E+  ++ +       T F  EE   LVYLHAA CESLRL
Sbjct  329   ALTWFFWLLSKNPRVELKILEELKSLRKERSCSDGMTLFDAEELKGLVYLHAALCESLRL  388

Query  498   FPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCG  319
             +PP+P  HK  L+++ LPSGHK +P T+IL   YSMGRME +WG+DC+EFKPERW+S+  
Sbjct  389   YPPVPFEHKGVLQSEALPSGHKAQPGTKILFVLYSMGRMEGVWGKDCLEFKPERWISE-K  447

Query  318   GGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLV  139
             G ++H PS KF  F+ GPRTC+G+ M F   K VAA+++  +H +++E H +V P  +++
Sbjct  448   GKLRHEPSYKFLSFNSGPRTCLGKDMAFTQMKAVAAAMVCNFHVDVVEGH-VVEPKLSII  506

Query  138   LEVKHGVKVKLTKR  97
             L +K+G+ V++ KR
Sbjct  507   LHMKNGLMVRIRKR  520



>ref|XP_010554002.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=525

 Score =   380 bits (977),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 204/479 (43%), Positives = 296/479 (62%), Gaps = 13/479 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GMLPALLQ  H+++D++ + L+ +  TF LKGP FA  DML+T DPANI +I 
Sbjct  49    PTNWPFLGMLPALLQMLHQIYDYSADLLESSNMTFLLKGPWFAGIDMLITVDPANIHHIM  108

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NY KG  F ++FE+FG+ I NTDS+LW   RK+   ++NH GF+     T    +
Sbjct  109   SSNFLNYTKGPEFNEVFEVFGEAIFNTDSDLWKDKRKSAQVMLNHHGFQRFTLSTTVNKI  168

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             + GL P+LDH A+     DLQ++F+R +FD  F +    +  SL +E P +    +A+ D
Sbjct  169   KKGLVPLLDHAAKLNVALDLQDVFQRFAFDTTFFLVSGFDAKSLSIEMP-EVELARALDD  227

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
             A  AI+Y+H+ P+  W++Q W  G   EKK   A +TFD+     +S K  ++      +
Sbjct  228   AEEAIVYRHVKPKFLWRMQNW-IGFGSEKKIRRARETFDRVCRRYISVKREEIRTGFHSE  286

Query  795   SQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNP  637
              ++  +LTS+M       K    K  QFL+D  +   +  G  T +SAL+WLFW+L+KNP
Sbjct  287   GESMDLLTSYMNLDTTKYKLLNPKEDQFLQD-IILTFMVAGTNTIASALSWLFWILSKNP  345

Query  636   LVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
                AK+  EI   K  +      +F   E   LVYLH A CE+LRL+PP+P   K  ++ 
Sbjct  346   NAVAKIREEI-STKLPSTGNLEHSFDPAELNKLVYLHGALCETLRLYPPVPFQRKSPIKP  404

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGHKV  K +I+ + Y++GR  A+WG+D  EFKPERW+SD  GG+KHVPS KF  F
Sbjct  405   DILPSGHKVDAKLKIIFAVYALGRARAVWGDDASEFKPERWISD-NGGLKHVPSFKFYSF  463

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
               GPRTC+G+ + F+  K+VA  ++  Y  +++E H LV P  +++L++KHG+KV +TK
Sbjct  464   GTGPRTCLGRDVAFVQMKLVAMELLQNYDFKVVEGH-LVEPVVSMILQMKHGLKVTVTK  521



>gb|KGN48434.1| hypothetical protein Csa_6G487550 [Cucumis sativus]
Length=509

 Score =   380 bits (975),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 207/487 (43%), Positives = 302/487 (62%), Gaps = 8/487 (2%)
 Frame = -3

Query  1548  IWK-KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             IW+  S+     P NWP++GM+P L+ + HR+HD   E L ++   F  KG  F++ D L
Sbjct  26    IWRWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFL  85

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             LT+DP+N+++I + +F  YPKG  F  +F+I GDGI N+DS++W   RKT  +L+ H  F
Sbjct  86    LTADPSNVNHILSVHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESF  145

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
                LE+   + V+ GL PVL    + G+  DLQ++F+R SFD         +  SL +E 
Sbjct  146   HKFLEKITLKKVKEGLVPVLQSACENGSVLDLQDLFQRFSFDSTCLFVTGFDFHSLSLEF  205

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   PF +A+ +A   IL +H+ P+  W  ++  F I + KK  +AW   D+ I  +++ 
Sbjct  206   PQV-PFSRAVDEAEEVILIRHVFPKMLWDFEE-KFQIGQAKKMKQAWKIIDQVIAELIAS  263

Query  831   KLNQL-HDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFW  655
             K   L  +  E + +   ++TS+MK YK    + LRDT V   +  G  T S+AL+W F+
Sbjct  264   KRESLKKNLKEKEDEGADLITSYMKDYKENDDKVLRDT-VLNFMVAGRDTLSAALSWFFF  322

Query  654   LLAKNPLVEAKLFNEILKVKPQNHA-KQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
              L+KNP+V  K+  E+    P N A  Q   F +EE   LVY H + CESLRL+PP+P+N
Sbjct  323   CLSKNPIVVEKIREELRTTVPTNEACDQWRIFSIEEVDKLVYFHGSLCESLRLYPPVPVN  382

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
             HK++++ D LPSGH +KPKT+IL S Y++GRM  +WG+DC+EFKPERW+S+  G IKH P
Sbjct  383   HKVAVQPDILPSGHHIKPKTKILLSIYALGRMSDVWGKDCLEFKPERWISE-NGKIKHFP  441

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KF  F+ GPRTC+G+++ F   KIVAA+II  Y+      H  V+P  ++VL +KHG 
Sbjct  442   SYKFLSFNAGPRTCLGKQVAFTELKIVAAAIIHNYNIIQQTGHQ-VIPKTSVVLHMKHGF  500

Query  117   KVKLTKR  97
             KVK+TKR
Sbjct  501   KVKVTKR  507



>ref|XP_004173396.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   379 bits (974),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 207/487 (43%), Positives = 302/487 (62%), Gaps = 8/487 (2%)
 Frame = -3

Query  1548  IWK-KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             IW+  S+     P NWP++GM+P L+ + HR+HD   E L ++   F  KG  F++ D L
Sbjct  26    IWRWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFL  85

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             LT+DP+N+++I + +F  YPKG  F  +F+I GDGI N+DS++W   RKT  +L+ H  F
Sbjct  86    LTADPSNVNHILSIHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESF  145

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
                LE+   + V+ GL PVL    + G+  DLQ++F+R SFD         +  SL +E 
Sbjct  146   HKFLEKITLKKVKEGLVPVLQSACENGSVLDLQDLFQRFSFDSTCLFVTGFDFHSLSLEF  205

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   PF +A+ +A   IL +H+ P+  W  ++  F I + KK  +AW   D+ I  +++ 
Sbjct  206   PQV-PFSRAVDEAEEVILIRHVFPKMLWDFEE-KFQIGQAKKMKQAWKIIDQVIAELIAS  263

Query  831   KLNQL-HDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFW  655
             K   L  +  E + +   ++TS+MK YK    + LRDT V   +  G  T S+AL+W F+
Sbjct  264   KRESLKKNLKEKEDEGADLITSYMKDYKENDDKVLRDT-VLNFMVAGRDTLSAALSWFFF  322

Query  654   LLAKNPLVEAKLFNEILKVKPQNHA-KQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
              L+KNP+V  K+  E+    P N A  Q   F +EE   LVY H + CESLRL+PP+P+N
Sbjct  323   CLSKNPIVVEKIREELRTTVPTNEACDQWRIFSIEEVDKLVYFHGSLCESLRLYPPVPVN  382

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
             HK++++ D LPSGH +KPKT+IL S Y++GRM  +WG+DC+EFKPERW+S+  G IKH P
Sbjct  383   HKVAVQPDILPSGHHIKPKTKILLSIYALGRMSDVWGKDCLEFKPERWISE-NGKIKHFP  441

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KF  F+ GPRTC+G+++ F   KIVAA+II  Y+      H  V+P  ++VL +KHG 
Sbjct  442   SYKFLSFNAGPRTCLGKQVAFTELKIVAAAIIHNYNIIQQTGHQ-VIPKTSVVLHMKHGF  500

Query  117   KVKLTKR  97
             KVK+TKR
Sbjct  501   KVKVTKR  507



>ref|XP_003525679.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   379 bits (973),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 208/475 (44%), Positives = 298/475 (63%), Gaps = 8/475 (2%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             T++P++GMLP LL N  R HD++T+ LKQ GGT E  GP F   + L+T DP N+ ++ +
Sbjct  33    TDFPILGMLPQLLFNLWRAHDYSTQVLKQRGGTAEFTGPWFTKMNCLVTGDPINVHHVMS  92

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
             K+F NY KG  F+++F+ FGDGI   DSE W  +R   ++L  H  F   LE+T+   V+
Sbjct  93    KSFPNYVKGPVFREIFQAFGDGIFTADSEAWKYNRNLFHSLFKHRSFEVFLEKTIHNKVQ  152

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             + L P+LD+  Q+G   DLQ++F R +FD    + L  +P  L ++ P +    KA   A
Sbjct  153   NTLLPMLDNLQQQGRVVDLQDVFNRFTFDNICSMVLGYDPSCLSIDFP-EVEIEKAFNQA  211

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL--HDQDED  799
               +I Y+ I+P  FWKLQKW   I +EKK  EA  T ++FI+  ++ K  +L  + ++E 
Sbjct  212   EESIFYRQIVPICFWKLQKW-LQIGQEKKMTEACKTLNQFIHACIASKREELNKYKENEM  270

Query  798   DSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKL  619
                +  +LT+ M+  K     FLRD+ V      G  T +SALTW FWL+A NPLVEAK+
Sbjct  271   GEAHKDLLTALMREGKAHDDGFLRDS-VFNLFVAGRDTITSALTWFFWLVATNPLVEAKI  329

Query  618   FNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSG  439
               EI K + + + K      VEE   LVYLH A CE+LRLFPPIP   K++++ D LPSG
Sbjct  330   LEEI-KEQFETNEKMLGVLTVEEVKKLVYLHGAICEALRLFPPIPFERKLAIKADVLPSG  388

Query  438   HKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRT  259
             H V  +T IL S Y+MGR E  WG+DC+EFKPERW+S+    I +VPS KF  F+ GPRT
Sbjct  389   HSVNSRTMILFSLYAMGRFEETWGKDCLEFKPERWISE-KRSIVYVPSYKFIAFNAGPRT  447

Query  258   CIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK  94
             C+G+ + F   K+VAA+I+  Y  +++E + +  PS ++VL +K G+KVK+TKR+
Sbjct  448   CLGKDLSFFQMKMVAAAILSNYRVQVVEGY-VATPSLSIVLLMKDGLKVKITKRE  501



>gb|EYU27556.1| hypothetical protein MIMGU_mgv1a021423mg [Erythranthe guttata]
Length=507

 Score =   379 bits (973),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 211/488 (43%), Positives = 294/488 (60%), Gaps = 21/488 (4%)
 Frame = -3

Query  1539  KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSD  1360
             K S  +  PT+WP+ GMLP LL N  R+H F TE L+ +GGTF LKG  FAN  ML+TSD
Sbjct  29    KKSSPAPPPTDWPIFGMLPGLLLNCGRVHTFMTELLESSGGTFYLKGAWFANMSMLITSD  88

Query  1359  PANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSL  1180
             PAN+ YI  KNF N+ KG  F+KMF++ GDGI N +SE W++ ++T  +LM++  F   +
Sbjct  89    PANVHYILAKNFPNFEKGPQFKKMFDVLGDGIFNAESESWEIQKRTAKSLMHNTSFPDFI  148

Query  1179  ERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDH  1000
              RT    VE+ L P+L+  ++ GT  DLQE+F+R +FD      L  +P SL  E P   
Sbjct  149   ARTSWSKVENALIPILELASETGTEVDLQELFQRFAFDCSCITVLGHDPVSLCKELPH-L  207

Query  999   PFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQ  820
             P  KA  DA  A+LY+H+LPE  WKLQ W   I +E +  +A D   +F+   +S K   
Sbjct  208   PHEKAFADAEQAVLYRHMLPEFTWKLQSWLH-IGKENELTKAKDVIHRFVSDCISMKHQD  266

Query  819   LHDQDEDDSQNFSMLTSHMKAYKGKPM---------QFLRDTFVsltisggggttssalT  667
              +     D     MLTS M+A   + +         +  +DT +   I  G  T S+AL 
Sbjct  267   FNLTGPKD-DGLDMLTSCMRARADEGINAAPNNYSDEVWKDTLL-NLIFAGKDTISAALA  324

Query  666   WLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPI  487
             W FWL+A NP  + K+  EI      N    T    +EE   LVYLH A CE+LRLFPP+
Sbjct  325   WFFWLVATNPAEQEKIRREI---DDTNWRFTT----IEESKKLVYLHGALCETLRLFPPV  377

Query  486   PMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIK  307
             P  HK  +E D LPSGH++ P T+ + SFYSMGRME+IWG DC++FKP RW+    G ++
Sbjct  378   PFQHKAPVEHDILPSGHRISPNTKTVLSFYSMGRMESIWGNDCLDFKPGRWIDPETGRVR  437

Query  306   HVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVK  127
               PS KF  F+ GPR+C+G+ + F+  KIVAA+I+ R++  +    + V PS +++L +K
Sbjct  438   TEPSFKFTAFNAGPRSCLGKDVSFIQLKIVAAAIVSRFNIRVARGFS-VTPSISVILHMK  496

Query  126   HGVKVKLT  103
             HG+KVK++
Sbjct  497   HGLKVKVS  504



>ref|XP_010681072.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=526

 Score =   380 bits (975),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 199/482 (41%), Positives = 292/482 (61%), Gaps = 25/482 (5%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP++GMLPALL+N HR+H+F  E  +++  TF   GP F N  +LLT DPANI ++ 
Sbjct  30    PTNWPLLGMLPALLKNIHRIHNFLIEIFEKSHLTFLFDGPWFTNMQILLTIDPANIHHVM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             +KNF NYPKGT F +MF++ GDGI N D  +W  HRK     + H  F   L +   + +
Sbjct  90    SKNFGNYPKGTKFNEMFDVLGDGIFNADFLVWQYHRKMAQYFLGHPKFHHFLVKKTREKL  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL PVLDH +  G   DLQ++F R +FD+G  + +D +P SL V+ P++    KA+ D
Sbjct  150   ENGLIPVLDHVSLHGIEVDLQDLFARFTFDVGCTIMMDHDPKSLVVDLPTNAS-SKALDD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
                AI ++H++P   WKLQ+W   + +E K+ +AW+T D FIY  ++EK  ++  + +  
Sbjct  209   VEEAIFHRHVVPTFVWKLQRW-LNVGKEYKYRKAWETLDSFIYQCIAEKRKEVSSKVQQP  267

Query  795   SQNFSMLTSHMKAY--------------KGKPMQFLRDTFVsltisggggttssalTWLF  658
             S+   + T  +  Y                +  +F+RDT V      G    S  L+W F
Sbjct  268   SKENEVCTDLLTLYIKEDESDKYPTILSTNQRNKFIRDT-VLTNFIAGRDAISITLSWFF  326

Query  657   WLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
             +LL+ NPLV +++  E+  V           FK E    LVYLH A CE+LRL+ P+   
Sbjct  327   YLLSVNPLVASRIKKELDSV-----MIDWRNFK-EANSKLVYLHGALCETLRLYAPVAFE  380

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
              K  +E D LPSGH+V P  +I+ + Y+MGRM++IWG+DC EFKPERW+S   G I+H P
Sbjct  381   AKAPMEPDILPSGHRVNPNMQIIFNLYAMGRMKSIWGDDCNEFKPERWIS-AQGNIRHEP  439

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KF +F+ GPRTC+G++M F   K+VAA++I +Y  E+++    V+P+ ++ L +KHG 
Sbjct  440   SYKFFVFNAGPRTCLGKEMAFTQMKVVAATMIQKYVIEVVDERQ-VIPNMSIFLRMKHGF  498

Query  117   KV  112
             KV
Sbjct  499   KV  500



>ref|XP_004142037.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=509

 Score =   378 bits (971),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 206/487 (42%), Positives = 302/487 (62%), Gaps = 8/487 (2%)
 Frame = -3

Query  1548  IWK-KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDML  1372
             IW+  S+     P NWP++GM+P L+ + HR+HD   E L ++   F  KG  F++ D L
Sbjct  26    IWRWNSNGMETLPWNWPILGMIPHLIAHHHRVHDRIAEVLIESSQNFFFKGVWFSSTDFL  85

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
             LT+DP+N+++I + +F  YPKG  F  +F+I GDGI N+DS++W   RKT  +L+ H  F
Sbjct  86    LTADPSNVNHILSVHFERYPKGPDFNYIFDILGDGIFNSDSDVWKNQRKTALSLVGHESF  145

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
                LE+   + V+ GL PVL    + G+  DLQ++F+R SFD         +  SL +E 
Sbjct  146   HKFLEKITLKKVKEGLVPVLQSACENGSVLDLQDLFQRFSFDSTCLFVTGFDFHSLSLEF  205

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P   PF +A+ +A   IL +H+ P+  W  ++  F I + KK  +AW   D+ I  +++ 
Sbjct  206   PQV-PFSRAVDEAEEVILIRHVFPKMLWDFEE-KFQIGQAKKMKQAWKIIDQVIAELIAS  263

Query  831   KLNQL-HDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFW  655
             K   L  +  E + +   ++TS+MK YK    + LRDT V   +  G  T S+AL+W F+
Sbjct  264   KRESLKKNLKEKEDEGADLITSYMKDYKENDDKVLRDT-VLNFMVAGRDTLSAALSWFFF  322

Query  654   LLAKNPLVEAKLFNEILKVKPQNHA-KQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
              L+KNP+V  K+  E+    P N A  Q   F +EE   LVY H + CESLRL+PP+P+N
Sbjct  323   CLSKNPIVVEKIREELRTTVPTNEACDQWRIFSIEEVDKLVYFHGSLCESLRLYPPVPVN  382

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
             HK++++ D LPSGH +KPKT+I+ S Y++GRM  +WG+DC+EFKPERW+S+  G IKH P
Sbjct  383   HKVAVQPDILPSGHHIKPKTKIVFSLYALGRMSDVWGKDCLEFKPERWISE-NGKIKHFP  441

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KF  F+ GPRTC+G+++ F   KIVAA+II  Y+      H  V+P  ++VL +KHG 
Sbjct  442   SYKFLSFNAGPRTCLGKQVAFTELKIVAAAIIHNYNIIQQTGHQ-VIPKTSVVLHMKHGF  500

Query  117   KVKLTKR  97
             KVK+TKR
Sbjct  501   KVKVTKR  507



>gb|EPS72790.1| hypothetical protein M569_01963, partial [Genlisea aurea]
Length=491

 Score =   377 bits (967),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 210/484 (43%), Positives = 292/484 (60%), Gaps = 11/484 (2%)
 Frame = -3

Query  1539  KSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSD  1360
             + ++R  D  N P +GM P L Q  +R+HD   E L+  GGTF LKGP F N D+L T D
Sbjct  15    RIAKRDFDWRNMPFVGMFPILYQKLNRIHDACVEVLELFGGTFLLKGPWFVNLDILATVD  74

Query  1359  PANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSL  1180
             P N+ +I ++NFNN+PKGT F+K+F++ GDGI N+D E W + RK   AL+ H  FR  L
Sbjct  75    PENVHFIMSQNFNNFPKGTEFKKIFDVLGDGIFNSDGEAWRVQRKQARALIAHERFRRFL  134

Query  1179  ERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDH  1000
               T    +E GL P+L+  A  G   DLQ++F+R +FD    +    +PG L V+ P D 
Sbjct  135   VETNAGKLEKGLIPILERAAGNGGALDLQDVFQRFTFDTTCMLITGYDPGCLSVDLP-DV  193

Query  999   PFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQ  820
             PF  A+  A  AI  +HILPE  WK+ + F  I  E++   A    D+ I   ++ K ++
Sbjct  194   PFSAAMDTAEEAIFIRHILPETLWKIGR-FLRIGYEQRLKRAHGVLDRVIGDYIAMKKSE  252

Query  819   LHDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             L D    +S +  +LTS++        +FLRDT V   +  G  TTSSALTW  WL++ +
Sbjct  253   LSDPTRKNSDD--LLTSYISESDVTD-KFLRDT-VLNLMIAGRDTTSSALTWFIWLVSSH  308

Query  639   PLVEAKLFNEILKV---KPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             P VE+K+  E+  +      + A     FK EE  +LVYLH A CESLRL+PP+P  HK 
Sbjct  309   PDVESKILTELASLPNPPAGSPAAACRLFKPEELHNLVYLHCALCESLRLYPPVPFQHKS  368

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
                   LPSGH V PK ++L S Y+M RM  IWGEDC EF+PERW++   G + + PS K
Sbjct  369   PAAPAVLPSGHYVHPKMKVLFSLYAMARMAYIWGEDCKEFRPERWING-RGKVNYEPSYK  427

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTCIG+++ F   K VAA++I+ Y  EL+E H  V P+ +++L +KHG KV+
Sbjct  428   FMAFNAGPRTCIGKEVAFTQLKAVAAAVIYNYRVELVEGHD-VSPNVSVILYMKHGFKVR  486

Query  108   LTKR  97
             +TKR
Sbjct  487   VTKR  490



>ref|NP_001031814.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
 gb|AEE87078.1| cytochrome P450, family 96, subfamily A, polypeptide 10 [Arabidopsis 
thaliana]
Length=519

 Score =   377 bits (968),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 215/500 (43%), Positives = 301/500 (60%), Gaps = 23/500 (5%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             I KK+ R  + PTNWP  GM+P LL   HR++DF TE L+    T+   GP FAN DML+
Sbjct  24    INKKTHR--LCPTNWPFFGMIPGLLVEIHRVYDFITEILEVTNLTYPCTGPCFANLDMLV  81

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T DPANI +I + NF NYPKG  F+K+F+I GDGI N DSELW   RK+  ++M +  F+
Sbjct  82    TVDPANIHHIMSSNFANYPKGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQ  141

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
                  T  + +E GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P
Sbjct  142   KFSLATSLKKLEKGLVPLLDHVAKEKLAVDLQDMFQRFTFDTTFVLATGYDPGCLSVEMP  201

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
              +  F +A+ DA  AI ++H+ PE FW+LQ    G+  EKK  +A  T D+     ++ K
Sbjct  202   -EVEFARALDDAEEAIFFRHVKPEIFWRLQG-LLGLGDEKKMTKARSTLDRVCSKYIAIK  259

Query  828   LNQL-HDQDEDDSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssa  673
              +++    +  DS +  +LTS+M       K       +FLRDT +   +  G  TT S 
Sbjct  260   RDEVSRGTNNVDSHSKDLLTSYMNLDTTKYKLLNPSDERFLRDT-ILTFMLAGRDTTGSG  318

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQ--------NHAKQTETFKVEECCDLVYLHAAF  517
             LTW FWLL KNP V AK+  EI     Q        ++   +++F  +E   LVYLH A 
Sbjct  319   LTWFFWLLIKNPEVIAKIRQEINTALFQRSKVDDDASNNNDSDSFSPQELKKLVYLHGAI  378

Query  516   CESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPER  337
             CESLRL+PP+P  HK   + D LPSGHKV   ++IL   YS+GRM+++WGED +EFKPER
Sbjct  379   CESLRLYPPVPFQHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPER  438

Query  336   WLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVV  157
             W+S+ G  + H PS KF  F+ GPRTC+G+++  M  K VA  II  Y  +++E    + 
Sbjct  439   WISESGNSV-HEPSYKFLSFNAGPRTCLGKEVAMMQMKSVAVKIIQNYEMKIVEGQQ-IE  496

Query  156   PSDTLVLEVKHGVKVKLTKR  97
             P+ +++L +KHG+KV +TKR
Sbjct  497   PAPSVILHMKHGLKVTVTKR  516



>ref|XP_003525678.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=500

 Score =   376 bits (965),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 203/476 (43%), Positives = 295/476 (62%), Gaps = 10/476 (2%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             T +P+IGMLP LL N  R HD++T+ L+++GGT E  GP F N D L+T DP N+ ++ +
Sbjct  31    TEYPIIGMLPQLLFNLWRAHDYSTQVLQRHGGTGEFIGPWFTNMDYLVTCDPINVHHMLS  90

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
             KNF+NY KG  F+ +F+ FGDGI   DSE W   R   ++L     F   + +T+   V 
Sbjct  91    KNFHNYVKGPEFRHIFQAFGDGIFAADSEAWKYSRDLFHSLFKQKSFEVFVAKTIHNKVH  150

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             +GL P+LDH  Q+G   DLQ++F R +FD    + L  +P  L ++  S+    KA  + 
Sbjct  151   NGLLPILDHVQQQGRVVDLQDVFNRFTFDNICSIVLGNDPNCLSID-FSEVAIEKAFNEV  209

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS---EKLNQLHDQDE  802
               +I Y+H+LP   WK+Q+W   I +EKK  EA  T D+FI+  ++   EKL++ ++ + 
Sbjct  210   EESIFYRHVLPRCVWKIQRW-LQIGQEKKMTEACKTLDQFIHACIASKREKLSKYNENEM  268

Query  801   DDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAK  622
              ++ +   LT+ M+       +FLRD  V      G  T +SALTW FWL+A NP VEAK
Sbjct  269   GEAHHVDFLTALMREETAHDDKFLRDA-VFNLFVAGRDTITSALTWFFWLVATNPSVEAK  327

Query  621   LFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPS  442
             +  E +K K     K      VEE   LVYLH A CE+LRLFPPIP   K +++ D LPS
Sbjct  328   ILEE-MKEKLGTKEKTLGVLSVEEVKRLVYLHGAICEALRLFPPIPFETKQAIKADMLPS  386

Query  441   GHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPR  262
             GH+V   T+IL   Y+MGR E  WG+DC+EFKPERW+S+  GGI +VPS KF  F+ GPR
Sbjct  387   GHRVNSGTKILFILYAMGRSEETWGKDCLEFKPERWISE-KGGIVYVPSYKFIAFNAGPR  445

Query  261   TCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK  94
             TC+G+++ F+  K+VAA+I+ +Y   +++   +  PS ++VL +K G+KV++ KR+
Sbjct  446   TCLGKEISFIQMKMVAAAILHKYRVRVVD--HVATPSPSIVLLMKDGLKVQIAKRE  499



>ref|XP_010417073.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Camelina sativa]
 ref|XP_010417074.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Camelina sativa]
Length=514

 Score =   377 bits (967),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 211/492 (43%), Positives = 294/492 (60%), Gaps = 16/492 (3%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             I KK  R  M  T+WP++GMLP LL    R++D+ TE L+ +  T+  KGP     DML+
Sbjct  25    ISKKPHRSFM--TDWPIVGMLPGLLVEIPRIYDYLTELLEASNLTYPFKGPCSGGLDMLV  82

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T DPANI YI + NF NYPKG+ F+K+F++ GDGI N DSELW   RK+   +M+H  F+
Sbjct  83    TIDPANIHYIMSSNFANYPKGSEFRKLFDVLGDGIFNADSELWKDLRKSAEGMMSHPDFQ  142

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
                 RT    +E GL P+LD  AQ+    DLQ++F+R +FD  F +    +PG L  E P
Sbjct  143   RFTVRTSMSKLEKGLVPLLDCVAQKKLVVDLQDVFQRFTFDNSFVLATGVDPGCLSTEMP  202

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
                 F +A+ +A  AI ++H+ PE  WK+Q+W  G   E K  +A  TFD+     ++ K
Sbjct  203   KIE-FARALDEAEEAIFFRHVKPEMVWKMQRW-IGFGDELKMTKAHSTFDRVCSKCIASK  260

Query  828   LNQL-HDQDEDDSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssa  673
              +++       DS +  +L S+M     K         +FLRD  +   +  G  TT SA
Sbjct  261   RDEISRGVINTDSSSKDLLMSYMNVDTSKYKLLNPSDDKFLRD-MILSFMLAGRDTTGSA  319

Query  672   lTWLFWLLAKNPLVEAKLFNEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLF  496
             LTW FWLL+KNP V  K+  EI  K+ P+      ++F  +E   LVYLH A CESLRL+
Sbjct  320   LTWFFWLLSKNPEVITKIRQEINTKLSPRTSGSDFDSFNPQELNKLVYLHGALCESLRLY  379

Query  495   PPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGG  316
             PP+P  HK   + D LPSGHKV   ++I+   YS+GRME++WGED  EFKPERW+S+ G 
Sbjct  380   PPVPFQHKSPTKPDVLPSGHKVDASSKIVFCLYSLGRMESVWGEDASEFKPERWVSESGR  439

Query  315   GIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVL  136
              I HVPS KF  F+ GPRTC+G+++     K VA  +I  Y  E++E H  + P  +++L
Sbjct  440   LI-HVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKMIQNYEIEVVEGHK-IEPVPSIIL  497

Query  135   EVKHGVKVKLTK  100
              +KHG+KV +TK
Sbjct  498   HMKHGLKVTVTK  509



>ref|XP_011025646.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=503

 Score =   376 bits (965),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 198/478 (41%), Positives = 292/478 (61%), Gaps = 14/478 (3%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWP++GMLP L  N HR   ++TE  ++N G++ ++GP F N D+L T +PAN+ +I + 
Sbjct  31    NWPLVGMLPNLFLNVHRFLPWSTELAERNNGSYLIRGPWFFNMDILATIEPANVHHIMST  90

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+NY KG  FQKMF+IFGDG+   DS+ W   RK   AL  H  F   L +T    VE 
Sbjct  91    NFSNYHKGPEFQKMFDIFGDGLFIADSDSWKNQRKIAMALTTHRKFYQFLVKTTQDKVEK  150

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL PVL+H +++G   DLQ +  R S D+GF++    +   L +E   D  F +A+ DA 
Sbjct  151   GLIPVLEHVSKQGLVVDLQSLIHRFSLDVGFKLVTGHDRELLSIENRED-TFSRALDDAE  209

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDSQ  790
               I ++++ PE  WKLQ    G   E+K  EAW+  D+     +S+K  +L   +    +
Sbjct  210   EVIYFRYLKPEILWKLQG-LLGFGPEQKMKEAWEIIDQVAATSISKKREELRGGNISKRE  268

Query  789   NFSMLTSHMKA----YKGKPM--QFLRDTFVsltisggggttssalTWLFWLLAKNPLVE  628
                +LTS++K     + G     +F+RDT V    +       + L W FWL+ KNP VE
Sbjct  269   GEDLLTSYIKMEGEIFIGSKSRDEFMRDTIV----NFLIAGRENCLAWFFWLVFKNPRVE  324

Query  627   AKLFNEILKVKPQNHAK-QTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
             A++  E+  + P+  AK Q   F  EE  +LVYL AA  E+LRL+P +P+ HK  ++ D 
Sbjct  325   ARIREELQSIIPEKEAKDQWWLFHTEELKNLVYLQAALFETLRLYPAVPVEHKKPIQPDI  384

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH V PK +I+   Y+MGRM +IWG+DC+EFKPER++S+  GG+KHVP+NKF  F+ 
Sbjct  385   LPSGHHVNPKMKIVFLAYAMGRMTSIWGKDCLEFKPERFISE-RGGMKHVPTNKFVAFNT  443

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPRTCIG+ +     K +AA+II+ YH ++ME H +V   ++++L +KHG+ V++ +R
Sbjct  444   GPRTCIGKNIALTQMKAMAANIIYNYHVQVMEGHPVVPAGNSILLHMKHGLMVRIARR  501



>ref|XP_007031599.1| Cytochrome P450, family 96, subfamily A, polypeptide 1, putative 
[Theobroma cacao]
 gb|EOY02525.1| Cytochrome P450, family 96, subfamily A, polypeptide 1, putative 
[Theobroma cacao]
Length=508

 Score =   375 bits (964),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/487 (40%), Positives = 300/487 (62%), Gaps = 13/487 (3%)
 Frame = -3

Query  1533  SRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             +R+S   TNWP++GMLP +L NA R+  F+ + ++Q+GGTFE++GP F + D ++T+D  
Sbjct  25    NRKSPPITNWPIVGMLPGILYNARRIFAFSNDCVRQSGGTFEIRGPCFPSLDFIVTADHT  84

Query  1353  NIDYIHNKNFNNYPKGTHFQKMF-EIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLE  1177
             N ++I  KNF+NY KG+ F ++F +  G+GI N++S  W   RK    LM    F     
Sbjct  85    NANHILCKNFDNYEKGSEFNEIFFDCLGEGIFNSNSHSWKSQRKVMLLLMKDDKFVLHFH  144

Query  1176  RTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHP  997
             R +   +E  L  VL+H+ + G   DLQ++ +R S+D+   + +  +P SL VE  S+ P
Sbjct  145   RILRGKLEKSLIVVLEHFMKLGIEVDLQDVLQRFSYDVVCLLAVGFDPCSLSVEL-SEVP  203

Query  996   FRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL  817
              + A+I A   +LY+H++P R WKLQ+W   I  EKK ++A  T D F+Y  ++ K  + 
Sbjct  204   IKTALIQAEERLLYRHLMPMRLWKLQRWL-QIGEEKKLSKALKTIDTFLYQCIASKREKF  262

Query  816   HDQDEDDSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLF  658
               +       +  +T+ M        +  GK  +FLRD  V++  +G    ++S   W F
Sbjct  263   RCKLLGKEDQYDFITAFMVQEEGEITSVDGKSDKFLRDVAVNIMSAGKDTISASLS-WFF  321

Query  657   WLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
             WL+A NP VE+KL  E+    P  + ++   F VE     VYL A  CE+LRL+P +P+N
Sbjct  322   WLVAMNPSVESKLLQEMRANSPSINDEKNMFFSVEGLNRFVYLDAVLCETLRLYPAVPIN  381

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
             HK +++ D LPSGH +   TR+L +FY+MGRME IWGEDC+EFKPERW+S+  G + HVP
Sbjct  382   HKTAIQPDILPSGHHINRNTRVLINFYAMGRMEEIWGEDCLEFKPERWISE-RGDVVHVP  440

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S+KF  F+ GPR+CIG+ + F+  K+VA S+++ Y  + ++ H  V   +T+VL +K+G+
Sbjct  441   SHKFIAFNAGPRSCIGRNISFIQMKLVAISVLWNYQIQAVQGHH-VSLGNTIVLHMKNGL  499

Query  117   KVKLTKR  97
             KV++ KR
Sbjct  500   KVRIKKR  506



>ref|XP_004160509.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48433.1| hypothetical protein Csa_6G487540 [Cucumis sativus]
Length=511

 Score =   375 bits (964),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 202/489 (41%), Positives = 299/489 (61%), Gaps = 10/489 (2%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             IW+++   ++ P NWP++GM P+++ + HR HD  TE +++ G TF  KG  F+  D LL
Sbjct  26    IWRRNFHGAV-PWNWPIVGMTPSVVTHIHRSHDRITEVIQEVGSTFFFKGVWFSGMDFLL  84

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T+DP+NI +I + NF  YPKG  F+ +FE+ GDGI N+DS  W   RKT  +L++   F 
Sbjct  85    TADPSNIHHILSANFERYPKGPDFKYIFEVLGDGIFNSDSYAWKDQRKTARSLVHDEKFL  144

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
               LE+     V++G+ PVLD   + G+  DLQ++F+R SFD    +    +  SL +E P
Sbjct  145   QFLEKITLNKVKTGIVPVLDGVCENGSVLDLQDLFQRFSFDSTCMMVTGFDLQSLSLESP  204

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
             +  PF KA+ D    I  +H  P++ W+ QK    I +  +  +AW   D+ I  +++ K
Sbjct  205   AV-PFSKAMDDVEEVIFLRHFFPKKIWEFQKKL-QIGQPMRLKQAWKIIDETIAKLIALK  262

Query  828   L----NQLHDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWL  661
                  NQ++ + ++  +   ++ S+M     K  +F RDT V   +  G  T SSAL+W 
Sbjct  263   RGSLKNQVNKEGDEQGRGVDLIASYMINNTNKDDKFFRDT-VLNFMIAGRDTLSSALSWF  321

Query  660   FWLLAKNPLVEAKLFNEILKVKPQNHA-KQTETFKVEECCDLVYLHAAFCESLRLFPPIP  484
             F+ L+KNP V   +  E+    P N A  Q   F +EE   LVY HA  CE+LRL+PP+P
Sbjct  322   FFCLSKNPTVVKMIREELKTTIPSNEACDQLRIFSMEEVNKLVYFHATLCEALRLYPPVP  381

Query  483   MNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKH  304
               HK++ + D LPSGH +KPKT+I+ S Y++GRM  +WG+DC+EFKPERW++   G IKH
Sbjct  382   FQHKVATQHDILPSGHHIKPKTKIVFSLYALGRMSEVWGKDCLEFKPERWINSENGKIKH  441

Query  303   VPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKH  124
             VPS KF  F+ GPRTC+G+ + F+  KIVAA+II  Y+      H  VVP+ +++L +KH
Sbjct  442   VPSYKFLAFNAGPRTCLGKHVAFIELKIVAAAIIHNYNIIQQTGHQ-VVPNASIILHMKH  500

Query  123   GVKVKLTKR  97
             G KVK+TKR
Sbjct  501   GFKVKVTKR  509



>ref|XP_010681074.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   376 bits (965),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 212/494 (43%), Positives = 296/494 (60%), Gaps = 27/494 (5%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             R   P NWP +GMLP++L + HR H    + L+ N  +F  KGP FAN D L+T DPANI
Sbjct  25    RHGIPWNWPFLGMLPSILIHLHRTHHRCVDILQGNNCSFLFKGPWFANMDFLMTVDPANI  84

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              +I + NF NYPKG  F K+F+I G+GI N+D ELW L RK T AL+NH  F   L +  
Sbjct  85    QHIMSSNFTNYPKGEEFLKIFDILGNGIFNSDGELWKLQRKITRALINHRSFIRFLVKIT  144

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
                V+ GL P+L H  + G   DLQ++F+RL+FD    +    +PG L +E P   PF +
Sbjct  145   YNKVQKGLVPILQHAYKDGLVIDLQDVFQRLTFDTTCLLVSGHDPGCLSLEFPHV-PFSQ  203

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ  808
             A+ DA  AI ++H+LP  FW+L KW  G+ + KK ++AW   D FI  I+S K   L   
Sbjct  204   ALDDAEEAIAFRHLLPHNFWELLKW-LGLGQPKKLSQAWKVLDHFIDYIISMKREGLRGG  262

Query  807   DED---------DSQNFSMLTSHM--------KAYKGKPMQFLRDTFVsltisggggtts  679
              +          + +   +LTS +             K  +FLRDT +   +  G  TTS
Sbjct  263   KKSPFKLEQEEEEEEGIDLLTSFLNEETRDVTNGINTKDDKFLRDT-ILNLMLAGRDTTS  321

Query  678   salTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRL  499
             SALTW  WL+ ++P+VE K+ NE+  +     A +   F++EE   L YLHAA CE LRL
Sbjct  322   SALTWFTWLITQHPIVEEKIRNELKGI-----ANEWHVFQIEETNKLTYLHAALCECLRL  376

Query  498   FPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCG  319
             +PP+P  HK  ++ +TLPSGH V PKT++L S Y+MGRM+ IWGEDC EFKPERW++   
Sbjct  377   YPPVPFQHKSPIQPETLPSGHHVNPKTKVLFSLYAMGRMKGIWGEDCFEFKPERWITK-E  435

Query  318   GGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLV  139
             G IK+ P  KF  F+ GPRTC+G+++ F   K+V+A++I  Y   ++       P  ++V
Sbjct  436   GKIKYEPPYKFLSFNAGPRTCLGKEVAFTQLKMVSATLIHNYKFHVVHGQH-AEPDMSIV  494

Query  138   LEVKHGVKVKLTKR  97
             L +KHG+KVK++ R
Sbjct  495   LHMKHGLKVKVSNR  508



>ref|XP_010683407.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=501

 Score =   375 bits (962),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 209/489 (43%), Positives = 299/489 (61%), Gaps = 34/489 (7%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP++GML  LL N  R+HD+ TE L+++   F  KGP FAN +M +T DPAN+ YI 
Sbjct  28    PTNWPIVGMLLPLLANVPRIHDWITEVLEKSQLNFLFKGPWFANMEMFVTLDPANVHYIM  87

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             +KNF NYPKG+ F +MF++FGDGI N DS+LW+ HRK  +  + H  F   L   V + V
Sbjct  88    SKNFKNYPKGSKFNEMFDVFGDGIFNVDSKLWEYHRKMAHTFIGHPKFHQFLHEKVWEKV  147

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL PVLD  +++G   DLQ++F R +FD    + +  +   L V+ P++ PF KA+ D
Sbjct  148   EKGLIPVLDDASKQGLVVDLQDLFSRFTFDTICTLIVGSDLRCLSVDWPNE-PFLKALDD  206

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLN-QLHDQDE-  802
                 I  +H++P   WK  +W  G+ +E+K+ EAW+  D+FIY  +SEK + +L  Q+E 
Sbjct  207   IEEVIFRRHVVPMSVWKFFRW-LGVGKERKYKEAWEILDEFIYKRISEKRSEELFKQEEL  265

Query  801   ---DDSQNFSMLTSHMKAYKGKPM----------QFLRDTFVsltisggggttssalTWL  661
                + S    +LT +M   +G             + LRDT +      G  TTS+AL W 
Sbjct  266   KHKEASVGVDLLTLYMDEAQGLSSINNVKNNLSDKLLRDT-ILNFFIAGRDTTSTALAWF  324

Query  660   FWLLAKNPLVEAKLFNEILKVKP--QNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPI  487
             F+LL+KNP VE+K+  E+  +    Q+H K            LVY+H A CE+LRL+PP+
Sbjct  325   FYLLSKNPRVESKIREELDTIMDINQDHDK------------LVYVHGALCEALRLYPPV  372

Query  486   PMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIK  307
                 K S+E+D LPSG  V P  +I+ + Y+MGRM++IWG+DC EFKPERW+S+  G IK
Sbjct  373   AFEQKASMESDILPSGQHVYPNMQIIFNLYAMGRMKSIWGDDCNEFKPERWISE-RGNIK  431

Query  306   HVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVK  127
             H PS KF  F+ GPR+C+G+ M F   K V A+I+  Y  + ++   LVVP  +L+L +K
Sbjct  432   HEPSYKFLTFNAGPRSCLGKNMAFTQMKAVVATIVQNYKFQAIQGQ-LVVPDISLMLRMK  490

Query  126   HGVKVKLTK  100
             +G KVK+ K
Sbjct  491   NGFKVKVCK  499



>ref|XP_007150923.1| hypothetical protein PHAVU_004G006000g [Phaseolus vulgaris]
 gb|ESW22917.1| hypothetical protein PHAVU_004G006000g [Phaseolus vulgaris]
Length=494

 Score =   375 bits (962),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 206/457 (45%), Positives = 281/457 (61%), Gaps = 13/457 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             T++P++GMLP LL N  R HDF TE LK+ GGT E  GP F N + L TSDP N+ ++ +
Sbjct  34    TDYPILGMLPQLLFNLSRFHDFFTEILKEKGGTGEFTGPWFTNMNYLFTSDPLNVRHVMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              +F+NY KG  F+ +FE+ G+GI  TDSE W  +R   + L     F   LE+T+ + ++
Sbjct  94    TSFHNYVKGPVFRDIFEVLGEGIAATDSEAWKYNRDLIHYLFKQKKFEVFLEKTIHKKIK  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             + L PVLDH  Q+G+  DLQ++F R +FD         +P  L V+ P +    KA  DA
Sbjct  154   NSLLPVLDHVHQQGSVVDLQDLFNRFTFDNLCYSVNGHDPNCLSVDFP-EVEIEKAFNDA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL----HDQD  805
                I  +H++P+  WKLQKW   I +EKK  EA    D+FIY  ++ K   L       +
Sbjct  213   GETIFRRHVVPKCVWKLQKW-LQIGQEKKMTEACKNLDEFIYACIASKRKNLSKCIEKNE  271

Query  804   EDDSQNFSMLTSHMKAYKGKPMQ----FLRDTFVsltisggggttssalTWLFWLLAKNP  637
              +++ +  +LT+ M+  K K  +    FLRDT V      G    +SALTW FWL+A NP
Sbjct  272   TEETSDVDLLTTLMREGKEKGEEHDDIFLRDT-VFNFFVAGRDAVTSALTWFFWLVATNP  330

Query  636   LVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
             LVEAK+  EI +   +N  K+ E   VEE   LVYLH A CESLRLFPPIP+  K +L++
Sbjct  331   LVEAKILEEIKETFGRNE-KKAEVLSVEEVKKLVYLHGAICESLRLFPPIPLERKEALKS  389

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGH V P T I+   YSMGR E IWGEDCMEFKPERW+S+  GGI +VPS KF  F
Sbjct  390   DVLPSGHGVNPSTVIMFFLYSMGRSEEIWGEDCMEFKPERWISE-KGGIVYVPSYKFVAF  448

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHT  166
             + GPRTC+G+ + F+  K+VA +I+ +Y  +++E H 
Sbjct  449   NTGPRTCLGKGVSFIQIKMVATAILHKYRLQVVEGHV  485



>ref|XP_003524561.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=504

 Score =   374 bits (961),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 206/476 (43%), Positives = 293/476 (62%), Gaps = 9/476 (2%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             T++P++GMLP LL N  R HDF TE LK++G T E  GP F + D L+T DP N+ ++ +
Sbjct  34    TDYPILGMLPQLLFNLWRAHDFFTEILKRHGPTGEFTGPWFTSMDYLVTCDPINVHHMLS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
             KNF+NY KG  F+ +F+ FGDGI   D E W  +R   ++L     F   L +T+   V 
Sbjct  94    KNFHNYVKGPEFRHIFQAFGDGIFTADFEAWKYNRDLFHSLFKQKSFEVFLVKTIHNKVH  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             +GL P+LDH  Q+G   DLQ++F R +FD    + L  +P  L ++  S+    KA  +A
Sbjct  154   NGLLPILDHVQQQGRVVDLQDVFNRFTFDNICSIVLGNDPNCLSID-FSEVAIEKAFNEA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED--  799
               +I Y+H++P   WK+Q+W   I +EKK  EA  T D+FI+  ++ K  +L   +E+  
Sbjct  213   EESIFYRHVVPRCVWKIQRW-LQIGQEKKMTEACKTLDQFIHARIASKREELSKYNENEM  271

Query  798   -DSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAK  622
              ++ +  +LT+ M+  K    +FLRD  V      G  T +SALTW FWL+A NP VEAK
Sbjct  272   GEAHHVDLLTALMREGKAHDDKFLRDA-VFNLFVAGRDTITSALTWFFWLVATNPSVEAK  330

Query  621   LFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPS  442
             +  E +K K     K      VEE   LVYLH A CE+LRLFPPIP   K ++ +D LPS
Sbjct  331   ILEE-MKEKLGTKEKSLGVLSVEEVKRLVYLHGAICEALRLFPPIPFERKQAISSDMLPS  389

Query  441   GHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPR  262
             GH+V   T IL S Y+MGR E  WG+DC EFKPERW+S+  GGI +VPS KF  F+ GPR
Sbjct  390   GHRVNSGTMILFSLYAMGRFEETWGKDCFEFKPERWISE-KGGIVYVPSYKFIAFNAGPR  448

Query  261   TCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK  94
             TC+G+   F+  K+VA +I+ +Y  +++E   +  PS ++VL +K G+KV++TKR+
Sbjct  449   TCLGKDSSFIQMKMVATAILHKYRVQVVEGF-VATPSLSIVLLMKDGLKVQITKRE  503



>gb|KCW62190.1| hypothetical protein EUGRSUZ_H04847 [Eucalyptus grandis]
Length=502

 Score =   374 bits (960),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 204/483 (42%), Positives = 295/483 (61%), Gaps = 20/483 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLPAL  N  R+HD+ T FL+++ G F  +   F+  DML+T+DPAN+ YI 
Sbjct  30    PKNWPLVGMLPALFLNLGRVHDWVTGFLERSHGNFLFRFHWFSGMDMLVTADPANVHYIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG  F+++F++ GDGILN+DS++W + R+     MN   F   L +T    V
Sbjct  90    STNFENFPKGAEFKRVFDVLGDGILNSDSDMWRMQRRVAQVFMNDRRFCRFLAKTTRDKV  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL  VLD  +Q+G   DLQ++F+R +FD   +         L VE P + PF KA+ D
Sbjct  150   ENGLLRVLDELSQKGVAVDLQDLFQRFTFDAACRFVT-----GLSVEFP-EVPFSKALDD  203

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD---QD  805
             A   I Y+H+ PE F  L++W  G+  E+K   AW   D+ +   +  K  +L +   + 
Sbjct  204   AEEVIFYRHMYPEWFGTLRRW-LGLGVEEKLRSAWKVMDQVVGSYIEMKRVELREGTSKA  262

Query  804   EDDSQNFSMLTSHM--KAYKGK---PMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             E D     + T +M  K   G      +FLRD  +   +  G  TTS  LTW FW L+ N
Sbjct  263   ERDENGADLFTLYMVEKETTGALECNEKFLRDA-ILNLMIAGKDTTSLVLTWFFWALSTN  321

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKV-EECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
               VE K+  EI  V P+   +  + FK+ E+  +LVYLH A CESLRL+PPIP  HK  +
Sbjct  322   RSVEMKIREEIRSVIPEEE-QNLKVFKIGEQVHNLVYLHGALCESLRLYPPIPFEHKCPV  380

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV P  +IL   Y+MGRM+++WGE C EF+PERW+S   GG++H PS KF 
Sbjct  381   KPDVLPSGHKVDPGKKILIHLYAMGRMKSVWGEYCFEFRPERWISK-SGGVRHEPSYKFL  439

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++ F   K++AA +I  Y   ++E H  V PS++++L +KHG++VKL 
Sbjct  440   AFNAGPRTCLGKQVAFTQMKMIAAVVIHNYEVHVVEGHP-VRPSNSIILHMKHGLRVKLA  498

Query  102   KRK  94
             +R+
Sbjct  499   RRR  501



>ref|XP_006470473.1| PREDICTED: cytochrome P450 86B1-like [Citrus sinensis]
 gb|KDO37420.1| hypothetical protein CISIN_1g043945mg [Citrus sinensis]
Length=518

 Score =   374 bits (960),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 202/488 (41%), Positives = 295/488 (60%), Gaps = 28/488 (6%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             ML  L+ N H+LH+FAT  LK++ GT E KGP FA  D ++TSDP N+ YI +KNF+NYP
Sbjct  33    MLSTLVLNTHQLHEFATRVLKKSRGTLEFKGPWFAKMDFIITSDPMNVHYISSKNFSNYP  92

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG   + + E FGDG+   D  LW + RK  +++M H  F  +LE+T+ Q +E+GL PVL
Sbjct  93    KGPDLRMILEPFGDGVFAADGNLWKMQRKMIHSVMKHKKFESALEKTIYQKLENGLIPVL  152

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             DH ++ G   DLQ++F+R +FD      L  NP  L  E P    +  A      A+ Y+
Sbjct  153   DHASEVGIKVDLQDVFQRFTFDNICMSVLGINPNYLSFEFPQV-AYANAFNATEQAVFYR  211

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL--HDQDEDDSQNFSM  778
             HI+P+ +WKLQKW   I +EK+ ++A  TFD+F+Y  +S K  +L    +   + + F +
Sbjct  212   HIVPKSWWKLQKWLH-IGKEKELSKAMKTFDRFLYECISLKRERLLTSRKASTEEEEFDV  270

Query  777   LTSHMKAYKGKPM--------------QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             LT+ M   + +                +FLRDT     ++ G  T +S L W FWL+A +
Sbjct  271   LTAFMVEGEEEEEMNEDREIGALKRNDKFLRDT-AFNLLAAGKETVNSGLVWFFWLVATH  329

Query  639   PLVEAKLFNEILKVKPQNHAKQTET-------FKVEECCDLVYLHAAFCESLRLFPPIPM  481
             P VE K+  E+         ++ E        F  ++   +VYLHAA  E+LRL+PP+P 
Sbjct  330   PSVENKILEEMKANMVMQKQEEEEDDGEKRLFFDAKQVNRMVYLHAALRETLRLYPPVPY  389

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
             NHK+S + D LPSGH++     IL S+Y+MGRME IWG+DC+EFKPERW+S+  G I HV
Sbjct  390   NHKISAQADVLPSGHRINKNHSILISYYAMGRMEEIWGKDCLEFKPERWISE-RGSIVHV  448

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             PS KF  F  GPR C+G+   F+  K+VAA I+ +Y  ++++ H  V P +++VL +K+G
Sbjct  449   PSYKFTAFHAGPRNCLGKDTAFIQMKMVAALILGKYQVKIVQGHP-VSPCNSMVLHMKYG  507

Query  120   VKVKLTKR  97
             +KV+L+KR
Sbjct  508   LKVQLSKR  515



>ref|XP_006404644.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
 gb|ESQ46097.1| hypothetical protein EUTSA_v10000679mg [Eutrema salsugineum]
Length=513

 Score =   374 bits (959),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 192/487 (39%), Positives = 298/487 (61%), Gaps = 22/487 (5%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLP ++   HR++ +  E L+ +  TF  KGP F+  +ML+T+DPAN+ ++ 
Sbjct  32    PRNWPLLGMLPGVVVMLHRINGYLAEILEVSNLTFVFKGPWFSGMNMLITADPANVQHVF  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG+ F++MF+  G+GI   DS+LW+  R+++  +++H GF+    +T+   +
Sbjct  92    SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSLVMLSHQGFQSFSLKTIASKI  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL PVLDH+A+  T FDLQ++F+RL+FD+   +    +  SL +E P +  + KA+ D
Sbjct  152   KNGLAPVLDHFAEANTVFDLQDVFQRLAFDVTLTLVTGYDSNSLSIEMPKND-YAKAMDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-------  817
             A   ++ +H+ P   WK+Q W  G+  EKK  +A  TFD+     +S K  ++       
Sbjct  211   AEEVVVVRHVKPMILWKMQNW-IGLGGEKKMTKANATFDRSCAEYISAKREEIISQRIHQ  269

Query  816   HDQDEDDSQNFSML-------TSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLF  658
             H   E+ + +  +L       TS  +    K   FL+D  +   +  G    ++ LTW F
Sbjct  270   HSTIEEKAHDVDLLSFYMNLDTSKYELLNPKDDNFLKD-IIKSFMLAGRDAIATTLTWFF  328

Query  657   WLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
             WLL+KNP    K+  EI      N  +  ++F  ++   +VYLH A CE+LRL+ PIP  
Sbjct  329   WLLSKNPEAVTKIREEI----KNNQPRSGKSFDPDKISKMVYLHGALCEALRLYAPIPFE  384

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
              K  ++ D LPSGHKV    +IL S Y++GRM+A+WGED  EFKPERW+S+  GG+KH P
Sbjct  385   RKSPIKQDVLPSGHKVDANWKILFSVYALGRMKAVWGEDASEFKPERWVSERNGGLKHEP  444

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KF +F+ GPR C+G+K+ F+  KIVAA II  Y  ++ E HT + P+ ++VL +KHG+
Sbjct  445   SFKFFVFNSGPRNCLGKKLSFLQMKIVAAEIIQNYDIKVAEGHT-IEPASSIVLHMKHGL  503

Query  117   KVKLTKR  97
             KV + KR
Sbjct  504   KVTVAKR  510



>emb|CDY46088.1| BnaA09g42120D [Brassica napus]
Length=516

 Score =   373 bits (958),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 207/484 (43%), Positives = 292/484 (60%), Gaps = 16/484 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GMLP LL    R++D+ TEFL+ +  TF  KGP F   DML T DPANI +I 
Sbjct  34    PTNWPFLGMLPGLLVEIPRVYDYVTEFLEASNLTFPFKGPRFGGLDMLFTVDPANIHHIM  93

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG+ F+K+F++ GDGI N DS+LW   RK+  ++M+   F+    RT    +
Sbjct  94    SSNFANYPKGSEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNMSKL  153

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH+A++   FDLQ++F+R +FD  F +    +PG L +E P +  F KA+ +
Sbjct  154   EKGLVPILDHFAEKKLVFDLQDVFQRFTFDTTFVLATGIDPGCLSIEMP-EIEFAKALDE  212

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
             A  AI ++H  PE  WK+Q+   G   E K + A  TFD+     ++ K +++       
Sbjct  213   AEEAIFFRHFKPEIVWKMQR-LLGFGDELKMSIAHSTFDRVCSKCIASKRDEITRGVTSI  271

Query  798   DSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +L S+M     K         +FLRD  +   +  G  TT SALTW FWLL+KN
Sbjct  272   DSSSKDLLMSYMDVDTTKYKLLNPGDDKFLRD-MILSFMLAGRDTTGSALTWFFWLLSKN  330

Query  639   PLVEAKLFNEI---LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             P V  K+  EI   L  +  N      +F  +E   LVYLH A CE+LRL+PP+P  HK 
Sbjct  331   PEVTTKIRQEINTKLSPRTDNDPVHFSSFNPQELNKLVYLHGALCEALRLYPPVPFQHKS  390

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
               + D LPSGH+V P T+I+   YS+GRM+++WGED  EFKPERW+S+ G  I HVPS K
Sbjct  391   PTKPDVLPSGHRVDPSTKIVFCLYSLGRMKSVWGEDASEFKPERWISETGRLI-HVPSFK  449

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++     K VA  II  Y  +++E H  + P  +++L +K G++V 
Sbjct  450   FLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEVKIVEGHK-IEPVPSIILHMKQGLRVM  508

Query  108   LTKR  97
             +TKR
Sbjct  509   VTKR  512



>gb|KFK32767.1| hypothetical protein AALP_AA6G286100 [Arabis alpina]
Length=515

 Score =   373 bits (958),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 205/484 (42%), Positives = 297/484 (61%), Gaps = 17/484 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GMLP LL   HR++D+ TE L+ +  T+  +GP F   DML+T DPANI +I 
Sbjct  34    PTNWPFLGMLPGLLVEIHRVYDYMTEVLEASNLTYPFRGPCFGGLDMLITVDPANIHHIM  93

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG+ F+K+F++ GDGI N DSELW   RK+  ++M+H  F+    RT    +
Sbjct  94    SSNFANYPKGSEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMSHPEFQRFTLRTSISKL  153

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+L+  A++    DLQ++F+R +FD  F +    +PG L +E P +  F +A+ +
Sbjct  154   EKGLIPLLNLVAEKKLVVDLQDVFQRFTFDTTFVLATGFDPGCLSIEMP-EIEFSRALDE  212

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED-  799
             A  AI ++H+ PE FWK+Q+   G+  E K  +A  TFD+     ++ K +++     + 
Sbjct  213   AEEAIFFRHVKPEMFWKMQR-LIGVGDELKMKKAHSTFDRVCSKCIASKRDEITRGAVNI  271

Query  798   DSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             D  +  +LTS+M       K       +FLRD  +   +  G  TT SALTW FWLL+KN
Sbjct  272   DPSSEDLLTSYMHVDTIKYKLLNPSDDRFLRD-MILSFMLAGRDTTGSALTWFFWLLSKN  330

Query  639   PLVEAKL---FNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             P    K+   FN  L  +P N +   ++F  +E   LVYLH A CE+LRL+PP+P  HK 
Sbjct  331   PKATTKIRQEFNTKLSPRPNNDS-YFDSFNPQELNKLVYLHGALCEALRLYPPVPFQHKS  389

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
               + D LPSGH+V   ++I+   YS+GRM+++WGED  EFKPERW+S+ G  I HVPS K
Sbjct  390   PTKPDVLPSGHRVGASSKIVFCLYSLGRMKSVWGEDASEFKPERWISESGKLI-HVPSFK  448

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++     KIVA  II  Y   ++E H  + P  +++L +KHG+KV 
Sbjct  449   FLSFNAGPRTCLGKEVAMTQMKIVAVKIIQNYEINIVEGHK-IEPVPSVILHMKHGLKVL  507

Query  108   LTKR  97
             +TKR
Sbjct  508   VTKR  511



>ref|XP_010437069.1| PREDICTED: cytochrome P450 86B1 isoform X1 [Camelina sativa]
 ref|XP_010437071.1| PREDICTED: cytochrome P450 86B1 isoform X2 [Camelina sativa]
Length=513

 Score =   373 bits (957),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 206/483 (43%), Positives = 290/483 (60%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GM+P LL   HR++DF T+ L+    T+   GP F+  DML+T DPANI +I 
Sbjct  33    PTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYPCVGPLFSGLDMLVTVDPANIHHIM  92

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG  F+K+F++ GDGI N DS+LW   RK+  ++M +  F+     T    +
Sbjct  93    SSNFANYPKGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMMNPEFQKFSLATSLNKL  152

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P +  F KA+ D
Sbjct  153   EKGLVPLLDHVAKEKLAVDLQDVFQRFTFDTTFVLATGYDPGCLSVEMP-EVEFAKALDD  211

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
             A  AI Y+H+ PE FW++Q    G+  EKK  +A  T D+     ++ + +++    D  
Sbjct  212   AEEAIFYRHVKPEIFWRIQG-LLGLGDEKKMTKARMTLDRVCSECIASRRDEISRGIDNV  270

Query  798   DSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +LTS+M       K       +FLRDT V   +  G  TT S LTW FWLL K 
Sbjct  271   DSPSKDLLTSYMNLDTTKYKLLNPSDDRFLRDT-VLTFMLAGRDTTGSGLTWFFWLLCKT  329

Query  639   PLVEAKLFNEILKVKPQNHAKQTE--TFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             P + AK+  EI K          +  +F  +E   LVYLH A CE+LRL+PP+P  HK  
Sbjct  330   PEIMAKIRQEINKNLTDGSESDVDSGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSP  389

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
              E D LPSGHKV   ++IL   YS+GRM+++WG+D +EFKPERW+S+ G  + H PS KF
Sbjct  390   TEADVLPSGHKVDANSKILFCLYSLGRMKSVWGDDALEFKPERWISESGRSV-HEPSYKF  448

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+++  M  K VA  II  Y  +++E    + P+ +++L +KHGVKV +
Sbjct  449   LSFNAGPRTCLGKEVALMQMKTVAVKIIQNYEMKIVEGQK-IEPAPSVILHMKHGVKVTV  507

Query  105   TKR  97
             TKR
Sbjct  508   TKR  510



>ref|XP_009117361.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
 emb|CDY63371.1| BnaA09g55910D [Brassica napus]
Length=510

 Score =   372 bits (956),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 191/482 (40%), Positives = 296/482 (61%), Gaps = 16/482 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP +L   H+++ +  E L+ +  TF  KGP F+  +ML+T+DP N+ ++ 
Sbjct  32    PRNWPVLGMLPGVLVMLHKINGYLVEVLEVSNLTFVFKGPWFSGMNMLITADPENVQHVF  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG+ F++MF+  G+GI   DS+LW+  R+++  +++H GF+    +T+   +
Sbjct  92    SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSMVMLSHQGFQSFSLKTIASKI  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL PVLDH+A+    FDLQ++F+RL+FD+   +    +  SL +E P +  + KA+ D
Sbjct  152   KNGLVPVLDHFAKENMVFDLQDVFQRLAFDVTLTLVTGYDSNSLSIEMPKNE-YAKAMDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD--E  802
             A   ++ +H+ P   WKLQ W  G+  EKK  +A   FD+     +S K  ++H      
Sbjct  211   AEEVVVVRHVKPMFLWKLQNW-LGLGEEKKMTQANAAFDRSCAKYISAKREEIHQHSIIG  269

Query  801   DDSQNFSML-------TSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAK  643
             + + +  +L       T+  +    K   FL+D  +   +  G    ++ LTW FWLL+K
Sbjct  270   EKAHDVDLLKFYMNLDTTKYELLNPKDDSFLKD-IIKSFMLAGRDAIATTLTWFFWLLSK  328

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             NP    K+  EI    P++  K    F  ++   +VYLH A CE+LRL+ PIP   K  +
Sbjct  329   NPQALTKIRQEINTYLPRSSDK---GFDQDKISKMVYLHGALCEALRLYAPIPFERKSPI  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV  K +IL S Y++GRM+A+WGED  EFKPERW+S+  GG+KH PS KF 
Sbjct  386   KQDVLPSGHKVDAKWKILFSVYALGRMKAVWGEDASEFKPERWISERNGGLKHEPSFKFF  445

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
             +F+ GPR C+G+K+ F+  KIVAA II  Y  +++E H  + P+ ++VL +KHG+KV +T
Sbjct  446   VFNSGPRNCLGKKLSFLQMKIVAAEIIQNYDIKVLEGHK-IEPASSIVLHMKHGLKVTVT  504

Query  102   KR  97
             KR
Sbjct  505   KR  506



>ref|XP_003556827.2| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=509

 Score =   372 bits (955),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 208/497 (42%), Positives = 308/497 (62%), Gaps = 18/497 (4%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             I+ +   R    TNWP+IGMLP++LQN   +H   TE LK  GGT   KGP F N + +L
Sbjct  16    IFFRKHNRDEPITNWPIIGMLPSVLQNLSNIHYLTTEALKHYGGTLMFKGPWFTNTNFIL  75

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDS-ELWDLHRKTTNALMNHIGF  1192
             TSDP N+ +I +KNF NY KG++F ++FE+ G GI+N+D    W   R   ++L+    F
Sbjct  76    TSDPMNVHHITSKNFGNYGKGSNFNEIFEVLGGGIINSDDLHAWKQERTMLHSLLKRESF  135

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSL---F  1021
             +  L++T+ + +E+ L P LDH ++ G   DLQ+ F+R +FD    +    +P  L   F
Sbjct  136   KIFLQKTIQKKLENCLIPFLDHASKAGAEVDLQDAFQRFTFDNACCMAFGYDPNCLPNKF  195

Query  1020  VEPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPI  841
                 S   ++KA+I   +   ++HI P   WKLQ+W   I +EKK  EA + FDKF++  
Sbjct  196   STKLSHFAYQKALIVLEDVAFHRHITPRCLWKLQEWL-QIGKEKKFKEAIEAFDKFLFER  254

Query  840   LSEKLNQL-----HDQDEDDSQNFSMLTSHMK--AYKGKPM--QFLRDTFVsltisgggg  688
             ++ K  +      H + EDD+ +  ++   M+  A KGK M  ++LRDT     +S G G
Sbjct  255   IASKREEQSRCNNHTKKEDDNTHSDLIRVLMEEGAEKGKIMDDKYLRDT-AFTLVSAGSG  313

Query  687   ttssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCES  508
             T S+ L+W FWL++ +P VEAK+F EI K    N         VEE   LVYLH A CE+
Sbjct  314   TVSAGLSWFFWLVSTHPDVEAKIFQEI-KDNCVNQDGDWIASSVEEFGKLVYLHGAICEA  372

Query  507   LRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLS  328
             LRLFP IP +HK ++++D LPSGH V P T IL S YSMGRME IWG+D ++FKPERW+S
Sbjct  373   LRLFPSIPFDHKCAIKSDILPSGHHVSPNTMILYSLYSMGRMEQIWGDDYLDFKPERWIS  432

Query  327   DCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSD  148
             +  G I H+PS KF  F+ GPR+C+G+ +  +  K+VA ++++R+H +++E H  + P  
Sbjct  433   E-RGNIIHIPSYKFIAFNAGPRSCLGKDVTLIEMKMVAVALLWRFHMQVVEGHP-ITPRL  490

Query  147   TLVLEVKHGVKVKLTKR  97
             +++L ++HG+KVK+T+R
Sbjct  491   SMILAMEHGLKVKVTER  507



>ref|XP_002866853.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43112.1| CYP96A10 [Arabidopsis lyrata subsp. lyrata]
Length=519

 Score =   372 bits (954),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 210/489 (43%), Positives = 293/489 (60%), Gaps = 21/489 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GM+P LL   HR++DF TE L+    T+   GP FAN DML+T DPANI +I 
Sbjct  33    PTNWPFLGMIPGLLVEIHRVYDFITEILEVTNLTYPCIGPCFANLDMLVTVDPANIHHIM  92

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG  F+K+F+I GDGI N DSELW   RK+  ++M +  F+     T    +
Sbjct  93    SSNFANYPKGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSSNKL  152

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P +  F +A+ D
Sbjct  153   EKGLVPLLDHVAKEKLVVDLQDMFQRFTFDTTFVLATGYDPGCLSVEMP-EVEFARALDD  211

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
             A  AI ++HI PE  W+LQ    G+  EKK  +A  T D+     ++ K +++    +  
Sbjct  212   AEEAIFFRHIKPEILWRLQG-LLGLGDEKKMTKARATLDRVCSKYIATKRDEVSRGTNNV  270

Query  798   DSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +LTS+M       K       +FLRDT +   +  G  TT S LTW FWLL K 
Sbjct  271   DSHSKDLLTSYMNLDTTKYKLLNPSDERFLRDT-ILTFMLAGRDTTGSGLTWFFWLLIKT  329

Query  639   PLVEAKLFNEI-------LKVKPQ-NHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIP  484
             P V AK+  EI        KV    +    +++F  +E   LVYLH A CE+LRL+PP+P
Sbjct  330   PEVIAKIRQEINTNLFQRSKVNADASDNNDSDSFNPQELKKLVYLHGAICEALRLYPPVP  389

Query  483   MNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKH  304
               HK   + D LPSGHKV   ++IL   YS+GRM+++WGED +EFKPERW+S+ G  + H
Sbjct  390   FQHKSPTKPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGNSV-H  448

Query  303   VPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKH  124
              PS KF  F+ GPRTC+G+++  M  K VA  II  Y  +++E    + P+ +++L +KH
Sbjct  449   EPSYKFLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNYEMKIVEGQQ-IEPAPSVILHMKH  507

Query  123   GVKVKLTKR  97
             G+KV +TKR
Sbjct  508   GLKVTVTKR  516



>ref|XP_010446495.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   371 bits (952),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 204/483 (42%), Positives = 289/483 (60%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GM+P +L   HR++DF T+ L+    T+   GP F+  DML+T DPANI +I 
Sbjct  33    PTNWPFLGMIPGMLAEIHRVYDFVTDILEVTNLTYPCVGPLFSGLDMLVTVDPANIHHIM  92

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG  F+K+F++ GDGI N DS+LW   RK+   +M +  F+     T    +
Sbjct  93    SSNFANYPKGPEFKKLFDVLGDGIFNADSDLWKDLRKSAQNMMMNPEFQKFSLATSLNKL  152

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH A      DLQ++F+R +FD  F +    +PG L +E P +  F +A+ D
Sbjct  153   EKGLVPLLDHAANEKLAVDLQDMFQRFTFDTTFVLATGYDPGCLSLEMP-EVEFARALDD  211

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ-DED  799
             A  AI Y+H+ PE FW++Q    G+  EKK  +A  T D+     ++ + +++    +  
Sbjct  212   AEEAIFYRHVKPEIFWRIQG-LLGLGDEKKMTKARKTLDRVCSECIASRRDEISSGINNV  270

Query  798   DSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +LTS+M     K         +FLRDT V   +  G  TT S LTWLFWLL + 
Sbjct  271   DSPSKDLLTSYMNLDTAKYKLLNPSDDRFLRDT-VLTFMLAGRDTTGSGLTWLFWLLCQT  329

Query  639   PLVEAKLFNEILK--VKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             P V AK+  EI K           + +F  +E   LVYLH A CE+LRL+PP+P  HK  
Sbjct  330   PEVMAKIRQEINKNLTDGSESGVDSGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSP  389

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
              E D LPSGHKV   ++IL   YS+GRM+++WGED +EFKPERW+S+ G  + H PS KF
Sbjct  390   TEADVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGRSV-HEPSYKF  448

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+++  M  K VA  II  Y  +++E    + P+ +++L +KHGVKV +
Sbjct  449   LSFNAGPRTCLGKEVALMQMKTVAVKIIQNYEMKIVEGQK-IEPAPSVILHMKHGVKVTV  507

Query  105   TKR  97
             TKR
Sbjct  508   TKR  510



>ref|XP_002878665.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54924.1| CYP96A1 [Arabidopsis lyrata subsp. lyrata]
Length=514

 Score =   371 bits (952),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 201/481 (42%), Positives = 294/481 (61%), Gaps = 14/481 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP +GMLP LL    R++D+ TE L+ +  T+  KGP F   DML+T DPANI +I +
Sbjct  35    TNWPFLGMLPGLLVEIPRVYDYVTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMS  94

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF NYPKG+ F+K+F++ GDGI N DSELW   RK+  ++M H  F+    RT    +E
Sbjct  95    SNFANYPKGSEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQRFTLRTSMSKLE  154

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LD+ A++    DLQ++F+R +FD  F +    +PG L  E P    F +A+ +A
Sbjct  155   KGLVPLLDYVAEKKLVVDLQDVFQRFTFDTSFILATGVDPGCLATEMPQIE-FARALDEA  213

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED-D  796
               AI ++H+ PE  WK+Q+ F G   E K  +A  TFD+     ++ K +++ +   + D
Sbjct  214   EAAIFFRHVKPEMVWKMQR-FIGFGDEMKMRKAHSTFDRVCSKCIASKRDEITNGVINID  272

Query  795   SQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKNP  637
             S +  +L S+M     K         +FLRD  +   +  G  TT SALTW FWLL+KNP
Sbjct  273   SSSKDLLMSYMSVDTTKYKLLNPSDDKFLRD-MILSFMIAGRDTTGSALTWFFWLLSKNP  331

Query  636   LVEAKLFNEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
                 K+  EI  K+ P+ +   +++F  +E   LVYLH A CE+LRL+PP+P  HK   +
Sbjct  332   KAITKIRQEINTKLSPRTNDFDSDSFSSQELNKLVYLHGALCEALRLYPPVPFQHKSPTK  391

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              D LPSGH+V   ++I+   YS+GRM+++WGED  EFKPERW+S+ G  I H+PS KF  
Sbjct  392   PDVLPSGHRVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWISESGRLI-HMPSFKFLS  450

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC+G+++     K VA  II  Y  ++++ H  + P  +++L +KHG+KV +TK
Sbjct  451   FNAGPRTCLGKEVAMTQLKTVAVKIIQNYEIKIVDGHK-IEPVPSIILHMKHGLKVTVTK  509

Query  99    R  97
             R
Sbjct  510   R  510



>ref|XP_010027341.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62208.1| hypothetical protein EUGRSUZ_H04869 [Eucalyptus grandis]
Length=505

 Score =   370 bits (950),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 200/481 (42%), Positives = 289/481 (60%), Gaps = 13/481 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLPALL N    HD+AT  ++++ G F  +   F+  ++LLT+DPAN+ YI 
Sbjct  30    PRNWPLVGMLPALLLNLSHFHDWATGVVERSQGNFFFRFHWFSGMEILLTADPANVHYIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG  F+++F+I GDGI N+DS LW   R+     M    F   L  T+    
Sbjct  90    STNFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQVFMKDQRFHQFLSLTIRDKA  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL  VLD  ++RG   DLQ++F R +FD   +     +PGSL VE P + P  KA  D
Sbjct  150   ENGLLRVLDELSKRGVTVDLQDLFHRFTFDSACRFLTGIDPGSLSVEFP-EVPMSKAFGD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD-----  811
             A   I Y+H+ PE F  LQ+   GI  E+K   AW   D+ +   ++ K  +L +     
Sbjct  209   AEEVIFYRHLYPEWFGTLQR-LLGIGMEEKLRRAWKDIDQILGNYIAMKRVELREGTSKV  267

Query  810   -QDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
               DE+ +   +++ +          +FL+DT +   ++ G  +TSS LTW FW L+ NP 
Sbjct  268   KGDENGADLLTLVENETLGALECNDKFLKDT-ILNFMTAGIESTSSTLTWFFWALSMNPS  326

Query  633   VEAKLFNEILKVKPQNHAKQTETFKVEE-CCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
             +E ++  EI  V P+   +    F + E    +VYLH A CESLRL+PP+P  HK     
Sbjct  327   IEMRIREEIRSVIPKEE-QNLRVFNISEHMHKMVYLHGAICESLRLYPPVPFQHKCPANP  385

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGH+V P T+I+   Y+MGRM++IWGEDC+EF+PERW+S+  GGI+H PS KF  F
Sbjct  386   DVLPSGHEVDPSTKIIVVMYAMGRMKSIWGEDCLEFRPERWISE-RGGIRHEPSYKFIAF  444

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+ + F   K  AA++I  Y   ++E H  V PS+++VL +KHG+KVKL +R
Sbjct  445   NAGPRTCLGKDVAFTQIKTAAATVIHNYEVYVVEDHP-VRPSNSIVLHMKHGLKVKLARR  503

Query  96    K  94
             +
Sbjct  504   R  504



>ref|XP_010025513.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62205.1| hypothetical protein EUGRSUZ_H04866 [Eucalyptus grandis]
Length=507

 Score =   370 bits (950),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 204/483 (42%), Positives = 288/483 (60%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P  WP++GMLP LL N    HD+AT  ++++ G F  + P F+  DML+T+DPAN+ YI 
Sbjct  30    PRKWPLVGMLPTLLLNLSHFHDWATGVVERSHGNFFFRLPWFSGMDMLVTADPANVHYIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG  F+++F+I GDGI N+DS LW   R+     M    F   L  T     
Sbjct  90    SANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQVFMKDQRFHRFLSSTTRDKA  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL  VLD  +QRG   DLQ++F R +FD   +     +PGSL VE P + P  KA+ D
Sbjct  150   ENGLLMVLDELSQRGVTVDLQDLFHRFTFDSACRFVTGFDPGSLSVEFP-EVPISKAMGD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD---  805
             A   I Y+H+ PE F  LQ+   GI  E+K   AW+  D+ +   ++ K  +L ++    
Sbjct  209   AEEVIFYRHLYPEWFGTLQR-LLGIGVEEKLRRAWEATDQILGNYIAMKRVELRERTSKV  267

Query  804   EDDSQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             + D     +LT +M   +         +FLRDT +   ++ G  TT S LTW FW L+ N
Sbjct  268   KGDENGADLLTLYMVENETLGALECNDKFLRDT-ILNFMTAGIETTGSTLTWFFWALSMN  326

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEE-CCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             P VE ++  EI  V P+   +    F + E    +VYLH A CESLRL+PP+P  HK   
Sbjct  327   PSVEMRIREEIRSVIPKEE-QNLRVFNISEHMHKMVYLHGAICESLRLYPPVPFLHKCPA  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
               D LPSGHKV P  +I+   Y+MGRM++IWGEDC+EF+PERW+S+  GGI+H PS KF 
Sbjct  386   NPDVLPSGHKVDPSAKIVVHTYAMGRMKSIWGEDCLEFRPERWISE-RGGIRHQPSYKFI  444

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F  GPRTC+G+ + F   K+V A++I  Y   ++E H  V PS++++L +KHG+KVKL 
Sbjct  445   AFGDGPRTCLGKDVAFTQIKMVTATVIHNYEVHVVEHHP-VRPSNSVILNMKHGLKVKLA  503

Query  102   KRK  94
             +R+
Sbjct  504   RRR  506



>ref|XP_010027335.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62199.1| hypothetical protein EUGRSUZ_H04857 [Eucalyptus grandis]
Length=507

 Score =   370 bits (950),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 212/490 (43%), Positives = 295/490 (60%), Gaps = 15/490 (3%)
 Frame = -3

Query  1536  SSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDP  1357
             S R    P NWP++GMLPALL N    H++AT FL+++ G F L+   F+  DML T+DP
Sbjct  23    SKRDDGLPKNWPLVGMLPALLLNLSHFHEWATGFLERSRGNFFLRFHWFSGMDMLFTADP  82

Query  1356  ANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLE  1177
             AN+ YI + NF N+PKG  F+++F+I GDGI N+DS LW   R+     M  + F   L 
Sbjct  83    ANVHYILSANFGNFPKGPEFKRVFDILGDGIFNSDSNLWSTQRRVAQVFMKDLRFHRFLL  142

Query  1176  RTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHP  997
              T    +E+GL  VLD  +QRG   DLQ++F+R + D   +     +PGSL VE P + P
Sbjct  143   MTTRDKLENGLLRVLDELSQRGVTVDLQDLFQRFALDSACRFVTGFDPGSLSVEFP-EVP  201

Query  996   FRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL  817
               KA+ DA   + Y+H  PE F  LQ+   GI  EKK   AW+  D+ +   +++K  +L
Sbjct  202   ISKALADAEEVLFYRHFYPEWFGTLQR-LLGIGVEKKLRRAWEDGDQILGYYIAKKRVEL  260

Query  816   HD---QDEDDSQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWL  661
              +   + + D     +LT +M   +         +FLRDT +   IS G  TT SALTW 
Sbjct  261   REGTGKVKGDENGADLLTLYMVENETLGALECNDKFLRDT-ILNFISAGIETTGSALTWF  319

Query  660   FWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEE-CCDLVYLHAAFCESLRLFPPIP  484
             FW L+ NP VE ++  EI  V P+   +    F + E    LVYLH A CESLRL+PP+P
Sbjct  320   FWALSMNPSVEMRIREEIRSVIPKEE-QNLRVFNISEHMHKLVYLHGAVCESLRLYPPLP  378

Query  483   MNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKH  304
                K   + D LPSGH+V P T+I+   Y+MGR+++IWGED +EFKPERW+S+  GGI+H
Sbjct  379   FQRKCPAKPDVLPSGHEVDPGTKIIVVMYAMGRIKSIWGEDFLEFKPERWISE-RGGIRH  437

Query  303   VPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKH  124
              PS KF  F+ GPRTC+G+ + F   K VAA++I  Y   ++E H  V PS+ +VL +KH
Sbjct  438   EPSYKFVAFNAGPRTCLGKDVAFTQIKTVAATVIHNYEVHVVEDHP-VRPSNFIVLHMKH  496

Query  123   GVKVKLTKRK  94
             G+KVKL +R+
Sbjct  497   GLKVKLARRR  506



>ref|XP_010680693.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=503

 Score =   369 bits (948),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 206/483 (43%), Positives = 293/483 (61%), Gaps = 19/483 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP++GMLPALL+NA+R+H+F  E ++++  TF  KGP F+N ++LLT DP NI ++ 
Sbjct  24    PTNWPLLGMLPALLKNAYRIHEFLIELMERSNLTFHFKGPWFSNMNLLLTIDPTNIHHVL  83

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             +K F NY KG    ++ E  GDGIL TDS LW  HR   ++  NH  F  SL     + V
Sbjct  84    SKRFENYVKGPKLYEILEPLGDGILTTDSTLWLYHRNVAHSFFNHPKFHQSLVDVTWKKV  143

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL PVL+H ++     DLQ++F R S+D    + +D +P SL V+ P D P  KA+ D
Sbjct  144   KNGLIPVLEHVSKHNIVIDLQDLFLRFSYDTMCTIMMDHDPTSLSVDSP-DFPLLKAVAD  202

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL----------  826
               +    +H +P   WKLQ+W   +  EKK  + W   D FIY  +  K           
Sbjct  203   MAHGAFIRHAVPTWIWKLQRW-LNVGEEKKFRQGWKILDNFIYKCIDRKREAKAKGASIP  261

Query  825   NQLHDQDEDDSQNFSMLTSHM-KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLL  649
             ++ +++D+D   ++ +LT  M    K    +FLRDT ++     GG TTS+AL+W F+L+
Sbjct  262   SKTNNKDQDFEVSYDLLTFFMDNEDKNTNDKFLRDT-ITNFFLAGGETTSTALSWFFYLI  320

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFK--VEECCDLVYLHAAFCESLRLFPPIPMNH  475
             + +P V  K+  E+  +  QN       F+   E    LVYLHAA CE+LRL+P I  N 
Sbjct  321   SNHPKVSHKIKQELNSIMIQNDDNYEMIFRNFKEISSKLVYLHAALCETLRLYPSIVFNP  380

Query  474   KMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPS  295
             K  +E   LPSGH+V   T I+ + Y+MGRM++IWG+DC EFKPERW+ + G  IKH PS
Sbjct  381   KTPVEPQILPSGHRVNSNTEIIFNTYAMGRMKSIWGDDCNEFKPERWILE-GRMIKHEPS  439

Query  294   NKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVK  115
              KF +FS GPR+CIG++M F   KIVAA II  YH E +E +   VP+ ++VL +KHG K
Sbjct  440   YKFSVFSAGPRSCIGKQMAFTQMKIVAAIIIQNYHIEAVEKYH--VPTMSMVLHMKHGFK  497

Query  114   VKL  106
             V++
Sbjct  498   VRI  500



>emb|CDP12889.1| unnamed protein product [Coffea canephora]
Length=489

 Score =   369 bits (946),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 209/489 (43%), Positives = 299/489 (61%), Gaps = 38/489 (8%)
 Frame = -3

Query  1527  RSMDPTNW--PVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             RS     W  P++G  P L+ N HR+HD   E L++  GT+ LKGP+FAN D+L T DPA
Sbjct  25    RSFKRLAWKLPILGTFPYLIMNIHRIHDKCAEVLEKTRGTYHLKGPSFANMDILGTVDPA  84

Query  1353  NIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLER  1174
             N+ YI + NF N+PKG  F+K+FE+ GDGI N+D +LW   RK   AL+NH  F      
Sbjct  85    NVHYIMSSNFVNFPKGPEFKKIFEVLGDGIFNSDLDLWKCQRKLARALLNHQSF------  138

Query  1173  TVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPF  994
                            H   +G   DLQ++F+RL+FD   +     +PG L ++ P   PF
Sbjct  139   ---------------HKFLQGLMVDLQDVFQRLTFDTTCKFVTGYDPGCLSIDFPGV-PF  182

Query  993   RKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH  814
              KA+ +   AI  +HILPE   KL++W  GI +EKK +++W   D+ I   +S K  +L 
Sbjct  183   SKAMDEVEEAIFMRHILPEIVLKLERW-LGIGQEKKLSKSWKILDEVICKYISVKQEELK  241

Query  813   D--QDEDDSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWL  661
                +  +D + F +LTS++     +         +FLRDT +   +  G  TTSSALTW 
Sbjct  242   KGTKSTNDEEGFDLLTSYINLGDNEITTGLKRDDKFLRDTII-NFMIAGRDTTSSALTWF  300

Query  660   FWLLAKNPLVEAKLFNEILKVKPQN-HAKQTETFKVEECCDLVYLHAAFCESLRLFPPIP  484
              WL++ +P V  K+  E+  V   N  A+    FKV+E  +LVY+HAA CES+RL+PP+P
Sbjct  301   IWLVSTHPTVLNKIREELKSVIQVNEEAENFRLFKVDELKNLVYIHAALCESMRLYPPVP  360

Query  483   MNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKH  304
               HK  L+ DTLPSGH+V PK +++ S Y+MGRM+ IWG+D  EFKPERW+S+  G IKH
Sbjct  361   FQHKFPLQPDTLPSGHRVHPKIKVIFSLYAMGRMKFIWGKDSWEFKPERWISE-RGTIKH  419

Query  303   VPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKH  124
              PS KF  F+ GPRTC+G+++ F   K VAA++I  Y+ E++E H  VVP+ +++L +KH
Sbjct  420   EPSYKFLAFNAGPRTCLGKEVAFTQMKAVAAAMIHNYNVEMVEGHP-VVPNLSVILYMKH  478

Query  123   GVKVKLTKR  97
             G+KV+++KR
Sbjct  479   GLKVRVSKR  487



>ref|XP_006405740.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
 gb|ESQ47193.1| hypothetical protein EUTSA_v10027725mg [Eutrema salsugineum]
Length=516

 Score =   369 bits (947),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 204/484 (42%), Positives = 293/484 (61%), Gaps = 17/484 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+GMLP LL   HR++DF  E L+ +  TF+ KG  FA  DML+T DPANI YI + 
Sbjct  34    NWPVLGMLPDLLMALHRVYDFLAEILEMSNLTFQFKGLWFAGMDMLITVDPANIHYILSS  93

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+NY KG  F+++F++F D I NTDSELW   RK   + +NH GF+          +++
Sbjct  94    NFSNYTKGPEFKEVFDVFKDVIFNTDSELWKNLRKAAQSRLNHQGFQRFSVTATRSKLKN  153

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+ DH+A+ GT  +LQ++F+R +FD    +    +P SL +E P D+ F KAI DA 
Sbjct  154   GLVPLFDHFAKEGTTVNLQDVFRRFTFDTTMVLITGSDPISLSIEMP-DNEFAKAITDAG  212

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED---  799
              AI+Y+HI P   WKLQ W  G+  EKK  EA   FD+     +S K  ++  Q      
Sbjct  213   EAIMYRHIKPRLLWKLQSW-MGLGLEKKLLEADAVFDRVCAKYISTKREEVRLQGISNHP  271

Query  798   -DSQNFSMLTSHMKAYKGK-------PMQFLRDTFVsltisggggttssalTWLFWLLAK  643
              + +   +LTS++K    K         QFL++  +   I  G  T +SALTW FWLL+K
Sbjct  272   INGEGEDLLTSYIKLDTTKYELLNPSKDQFLKEV-ILNFIIAGRDTVASALTWFFWLLSK  330

Query  642   NPLVEAKLFNEILKVKPQN-HAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             NP V AK+  EI  V P++ + ++  +F   +   LVYLH A  ES+RL+PPIP   K +
Sbjct  331   NPQVVAKIHQEINTVLPRSKYGQEKLSFDSTQLNKLVYLHGALYESMRLYPPIPFERKSA  390

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD-CGGGIKHVPSNK  289
             ++ D LPSGHKV   ++++   Y++GRM A+WGED +EFKPERW+S  CGG ++H PS K
Sbjct  391   IKPDVLPSGHKVDANSKVIIVLYALGRMRAVWGEDALEFKPERWVSKTCGGSLRHEPSFK  450

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPR+C+G+++  ++ K V   I+  Y  + ++    V     L+L +KHG +V 
Sbjct  451   FLPFNAGPRSCLGKQLAMILMKTVVMEILQSYDIKAIKGQK-VESLPGLILRMKHGFEVT  509

Query  108   LTKR  97
             +TKR
Sbjct  510   ITKR  513



>ref|NP_179899.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
 gb|AAK43908.1|AF370589_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAB87111.1| putative cytochrome P450 [Arabidopsis thaliana]
 dbj|BAC42368.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07426.1| cytochrome P450, family 96, subfamily A, polypeptide 1 [Arabidopsis 
thaliana]
Length=516

 Score =   369 bits (947),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 203/485 (42%), Positives = 295/485 (61%), Gaps = 20/485 (4%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP +GMLP LL    R++DF TE L+ +  T+  KGP F   DML+T DPANI +I +
Sbjct  35    TNWPFLGMLPGLLVEIPRVYDFVTELLEASNLTYPFKGPCFGGLDMLITVDPANIHHIMS  94

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF NYPKGT F+K+F++ GDGI N DSELW   RK+  ++M H  F+    RT+   +E
Sbjct  95    SNFANYPKGTEFKKIFDVLGDGIFNADSELWKDLRKSAQSMMTHQDFQRFTLRTIMSKLE  154

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LD+ A++    DLQ++F+R +FD  F +    +PG L  E P    F +A+ +A
Sbjct  155   KGLVPLLDYVAEKKQVVDLQDVFQRFTFDTSFVLATGVDPGCLSTEMPQIE-FARALDEA  213

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED-D  796
               AI ++H+ PE  WK+Q+ F G   E K  +A  TFD+     ++ K +++ +   + D
Sbjct  214   EEAIFFRHVKPEIVWKMQR-FIGFGDELKMKKAHSTFDRVCSKCIASKRDEITNGVINID  272

Query  795   SQNFSMLTSHM-----------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLL  649
             S +  +L  +M           K       +FLRD  +   +  G  TTSSALTW FWLL
Sbjct  273   SSSKDLLMCYMNVDTICHTTKYKLLNPSDDKFLRD-MILSFMLAGRDTTSSALTWFFWLL  331

Query  648   AKNPLVEAKLFNEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             +KNP    K+  EI  ++ P+ +    ++F  +E   LVY+H A CE+LRL+PP+P  HK
Sbjct  332   SKNPKAITKIRQEINTQLSPRTN--DFDSFNAQELNKLVYVHGALCEALRLYPPVPFQHK  389

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
                ++D LPSGH+V   ++I+   YS+GRM+++WGED  EFKPERW+S+ G  I HVPS 
Sbjct  390   SPTKSDVLPSGHRVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWISESGRLI-HVPSF  448

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTC+G+++     K VA  II  Y  +++E H  + P  +++L +KHG+KV
Sbjct  449   KFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIKVVEGHK-IEPVPSIILHMKHGLKV  507

Query  111   KLTKR  97
              +TKR
Sbjct  508   TVTKR  512



>ref|XP_003554824.1| PREDICTED: cytochrome P450 86B1-like [Glycine max]
Length=502

 Score =   369 bits (946),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 198/476 (42%), Positives = 294/476 (62%), Gaps = 13/476 (3%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             ++P++GMLP +L N  R+HDF TE LK+ GGT E KGP F     L+T D  N+ ++  K
Sbjct  34    DYPILGMLPPILFNLWRIHDFCTEVLKKQGGTGEFKGPWFTKMHYLITCDSLNVQHMLCK  93

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             +F+NY KG  F+++FE FGDG++  DSE W   R   ++L+    F   +++TV + V +
Sbjct  94    SFDNYIKGPEFREIFEPFGDGVVTADSETWKYFRTVLHSLIKQRRFETFVDKTVQKKVHT  153

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
              L P+LDH  Q+G   DLQ++F R +FD      +  +P  L ++ P +    +A  ++ 
Sbjct  154   SLLPILDHVQQQGEMVDLQDVFNRFTFDNICSTIVGHDPKCLSIDFP-EVAIERAFNESE  212

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK---LNQLHDQDED  799
              +I Y+H +P   WK QKW   I +EKK  EA  TFD+FIY  ++ K   L++   ++ D
Sbjct  213   ESIFYRHTVPSSVWKFQKW-LQIGQEKKMTEACKTFDEFIYSCIASKRQELSKCSREEMD  271

Query  798   DSQNFSMLTSHMKAYKGKPM--QFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
             +   F +LT+ +   +G+    +FLRD         G  T +SALTW FWL+ K+PLVEA
Sbjct  272   NEAPFDLLTALITEERGRVHDDKFLRDA-AFNFFVAGRETMTSALTWFFWLVTKHPLVEA  330

Query  624   KLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLP  445
             K+  EI   K    A       +EE   LVYLH A CE+LRLFPP+P+  K +++ DTLP
Sbjct  331   KILEEI---KDNFEANYEGVVGIEEVKKLVYLHGALCEALRLFPPVPIERKQAIKDDTLP  387

Query  444   SGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGP  265
             SGH+V   T IL S Y+MGR E IWG+DC+EFKPERW+S+  G + + P+ KF  F+ GP
Sbjct  388   SGHRVNGNTMILFSLYAMGRCEEIWGKDCLEFKPERWISE-RGEVVYAPAYKFIAFNAGP  446

Query  264   RTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             R C+G+ + F+  K+VAASI+ +Y  +++E H+   PS ++VL +K+G+K ++ KR
Sbjct  447   RICLGKDLAFVQMKMVAASILRKYRFQVVEGHS-PTPSHSIVLLMKNGLKARIMKR  501



>ref|XP_006405739.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
 gb|ESQ47192.1| hypothetical protein EUTSA_v10028064mg [Eutrema salsugineum]
Length=516

 Score =   369 bits (946),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 204/484 (42%), Positives = 293/484 (61%), Gaps = 17/484 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+GMLP LL   HR++DF  E L+ +  TF+ KG  FA  DML+T DPANI YI + 
Sbjct  34    NWPVLGMLPDLLMALHRVYDFLAEILEMSNLTFQFKGLWFAGMDMLITVDPANIHYILSS  93

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+NY KG  F+++F++F D I NTDSELW   RK   + +NH GF+          +++
Sbjct  94    NFSNYTKGPEFKEVFDVFKDVIFNTDSELWKNLRKAAQSRLNHQGFQRFSVTATRSKLKN  153

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+ DH+A+ GT  +LQ++F+R +FD    +    +P SL +E P D+ F KAI DA 
Sbjct  154   GLVPLFDHFAKEGTTVNLQDVFQRFTFDTTMVLITGSDPISLSIEMP-DNEFAKAITDAG  212

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED---  799
              AI+Y+HI P   WKLQ W  G+  EKK  EA   FD+     +S K  ++  Q      
Sbjct  213   EAIMYRHIKPRLLWKLQSW-MGLGLEKKLLEADAVFDRVCAKYISTKREEVRLQGISNHP  271

Query  798   -DSQNFSMLTSHMKAYKGK-------PMQFLRDTFVsltisggggttssalTWLFWLLAK  643
              + +   +LTS++K    K         QFL++  +   I  G  T +SALTW FWLL+K
Sbjct  272   INGEGEDLLTSYIKLDTTKYELLNPSKDQFLKEV-ILNFIIAGRDTVASALTWFFWLLSK  330

Query  642   NPLVEAKLFNEILKVKPQN-HAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             NP V AK+  EI  V P++ + ++  +F   +   LVYLH A  ES+RL+PPIP   K +
Sbjct  331   NPQVVAKIHQEINTVLPRSKYGQEKLSFDSTQLNKLVYLHGALYESMRLYPPIPFERKSA  390

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD-CGGGIKHVPSNK  289
             ++ D LPSGHKV   ++++   Y++GRM A+WGED +EFKPERW+S  CGG ++H PS K
Sbjct  391   IKPDVLPSGHKVDANSKVIIVLYALGRMRAVWGEDALEFKPERWVSKTCGGSLRHEPSFK  450

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPR+C+G+++  ++ K V   I+  Y  + ++    V     L+L +KHG +V 
Sbjct  451   FLPFNAGPRSCLGKQLAMILMKTVVMEILQSYDIKAIKGQK-VESLPGLILRMKHGFEVT  509

Query  108   LTKR  97
             +TKR
Sbjct  510   ITKR  513



>ref|XP_006285710.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
 gb|EOA18608.1| hypothetical protein CARUB_v10007181mg [Capsella rubella]
Length=513

 Score =   369 bits (946),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 205/483 (42%), Positives = 288/483 (60%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GM+P LL   HR++DF TE L+    T+   GP FA  DML+T DPANI +I 
Sbjct  33    PTNWPFLGMIPGLLVEIHRVYDFVTEVLEVTNLTYPCVGPCFAGLDMLITVDPANIHHIM  92

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG  F+K+F++ GDGI N DSELW   RK+  ++M +  F+     T    +
Sbjct  93    SSNFANYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSLNKL  152

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P +  F +A+ D
Sbjct  153   EKGLVPLLDHVAKEKLVLDLQDMFQRFTFDTTFVLATGYDPGCLSVEMP-EVEFARALDD  211

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
             A  AI Y+HI PE  W++Q    G+  EKK  +A  T D+     +S +  ++    +  
Sbjct  212   AEEAIFYRHIKPEILWRMQG-LVGLGDEKKMTKARTTLDRVCSECISSRRGEVSRGINNV  270

Query  798   DSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +LTS+M       K       +FLRDT +   +  G  TT S LTW FWLL K 
Sbjct  271   DSPSKDLLTSYMNLDTTKYKLLDPSDDRFLRDT-ILTFMLAGRDTTGSGLTWFFWLLCKT  329

Query  639   PLVEAKLFNEILK--VKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             P V AK+  +I             +++F  +E   LVYLH A CE+LRL+PP+P  HK  
Sbjct  330   PEVMAKIRQDINTNLTDGWGSGVDSDSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSP  389

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
              + D LPSGHKV   ++IL   YS+GRM+++WGED +EFKPERW+S+ G  + H PS KF
Sbjct  390   TKPDVLPSGHKVDANSKILLCLYSLGRMKSVWGEDALEFKPERWISESGRSV-HEPSYKF  448

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+++  M  K VA  II  Y  +++E    + P+ +++L +KHGVKV +
Sbjct  449   LSFNAGPRTCLGKEVALMQMKTVAVKIIQNYELKIVEGQK-IEPAPSVILHMKHGVKVTV  507

Query  105   TKR  97
             TK+
Sbjct  508   TKK  510



>ref|XP_010429263.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=513

 Score =   369 bits (946),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 203/481 (42%), Positives = 290/481 (60%), Gaps = 14/481 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             T+WP++GMLP LL    R++D+ TE L+ +  T+  KGP F   DML+T DPANI YI +
Sbjct  35    TDWPILGMLPGLLVEIPRIYDYLTELLEASNLTYPFKGPCFGGLDMLVTVDPANIHYIMS  94

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF NYPKG+ F+K+F++ GDGI N DSELW   RK+   +M+H  F+    RT    +E
Sbjct  95    SNFANYPKGSEFRKLFDVLGDGIFNADSELWKDLRKSAEGMMSHPDFQRFTVRTSMSKLE  154

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LD  A++    DLQ++F+R +FD  F +    +PG L  E P +  F +A+ +A
Sbjct  155   KGLVPLLDCVAEKKLVVDLQDVFQRFTFDNSFVLATGVDPGCLSTEMP-EIKFARALDEA  213

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDEDD  796
               AI ++H+ PE  WK+Q+W  G   E K  +A  TFD+     ++ K +++       D
Sbjct  214   EEAIFFRHVKPEMVWKMQRW-IGFGDELKMTKAHLTFDRVCSKCIASKRDEITRGVINID  272

Query  795   SQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKNP  637
             S +  +L S+M     K         +FLRD  +   +  G  TT SALTW FWLL+KN 
Sbjct  273   SSSKDLLISYMNVDTSKYKLLNPSDDKFLRD-MILSFMLAGRDTTGSALTWFFWLLSKNS  331

Query  636   LVEAKLFNEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
              V  K+  EI  K+ P+      ++F   E   LVYLH A CESLRL+P +P  HK   +
Sbjct  332   EVITKIRQEINTKLSPRTSGSDFDSFNPHELNKLVYLHGALCESLRLYPSVPFQHKSPTK  391

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
             +D LPSGHKV   ++I+   YS+GRM+++WGED  EFKPERW+S+  G + HVPS KF  
Sbjct  392   SDVLPSGHKVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWVSE-NGRLIHVPSFKFLS  450

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC+G+++     KI A  II  Y  +++E H  + P  +++L +KHG+KV +TK
Sbjct  451   FNAGPRTCLGKEVAMTQMKITAVKIIQNYDIKVVEGHK-IEPVPSIILHMKHGLKVTVTK  509

Query  99    R  97
             R
Sbjct  510   R  510



>emb|CDX76962.1| BnaC08g35480D [Brassica napus]
Length=510

 Score =   368 bits (945),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/482 (39%), Positives = 293/482 (61%), Gaps = 16/482 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLP +L   H+++ +  E L+ +  TF  KGP F+  +ML+T+DPAN+ ++ 
Sbjct  32    PRNWPILGMLPGVLVMLHKINGYLVEVLEVSNLTFVFKGPWFSGMNMLITADPANVQHVF  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG+ F++MF+  G+GI   DS+LW+  R+++  +++H GF+    +T+   +
Sbjct  92    SSNFSNYDKGSEFKEMFDFLGEGIFTADSKLWEEMRRSSMVMLSHQGFQSFSLKTIASKI  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL PVLDH+A+    FDLQ++F+RL+FD+   +    +  SL +E P +  + KA+ D
Sbjct  152   KNGLVPVLDHFAKENMVFDLQDVFQRLAFDVTLTLVTGYDSNSLSIEMPKNE-YAKAMDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD--E  802
             A   ++ +H+ P   WKLQ W  G+  EKK  +A   FD+     +S K  ++H      
Sbjct  211   AEEVVVVRHVKPMFVWKLQNW-LGLGEEKKMTQAKAAFDRSCAKYISAKREEIHQHSIIG  269

Query  801   DDSQNFSML-------TSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAK  643
             + + +  +L       TS  +    K   FL+D  +   +  G    ++ LTW FWLL+K
Sbjct  270   EKAHDVDLLKFYMNLDTSKYELLNPKDDSFLKD-IIKSFMLAGRDAIATTLTWFFWLLSK  328

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             NP    K+  EI     ++  K  +  K+ +   +VYLH A CE+LRL+ PIP   K  +
Sbjct  329   NPEALTKIRQEINTYLTRSSDKNLDQDKLSK---MVYLHGALCEALRLYAPIPFERKSPI  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV  K +IL S Y++GRM A+WGED  EFKPERW+S+  GG+KH PS KF 
Sbjct  386   KQDVLPSGHKVDAKWKILFSVYALGRMRAVWGEDASEFKPERWISERNGGLKHEPSFKFF  445

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
             +F+ GPR C+G+K+ F+  KIVA  II  Y   ++E H  + P+ ++VL +KHG+KV + 
Sbjct  446   VFNSGPRNCLGKKLSFLQMKIVATEIIQNYDINVLEGHK-IEPASSIVLHMKHGLKVTVA  504

Query  102   KR  97
             KR
Sbjct  505   KR  506



>ref|XP_010416946.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   368 bits (945),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 191/484 (39%), Positives = 292/484 (60%), Gaps = 18/484 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP +L   HR++D+  E L+ +  TF  KGP F+  +ML+T+DPANI ++ 
Sbjct  32    PRNWPVLGMLPGVLIMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHVF  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NY KG  F+++F+  G+GI   DS+LW+  RK+   +++H GF+    RT+ + +
Sbjct  92    SSNFTNYDKGPEFKEIFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITRKI  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++G+ PVLDH+A+    FDLQ++F+RL+FD+   +    +  SL +E P +  + KA+ D
Sbjct  152   KNGVVPVLDHFAEANMIFDLQDVFQRLAFDVTLTLVAGYDSNSLSIEMPMNE-YAKAMDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFD----KFIYPILSEKLNQLHDQ  808
             A   ++Y+H+ P   WKLQ W  G+  EKK  +A   FD    K+I     E +++    
Sbjct  211   AEEVVVYRHVKPMILWKLQNW-IGVGEEKKMTKANAAFDRSCAKYISAKREELISRCRSN  269

Query  807   DEDDSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLL  649
               +++ +  +L+ +M       +  K     FL+D  +   +  G    ++ LTW FWLL
Sbjct  270   IGEEAHDVDLLSVYMNLDASKYELLKPTDDNFLKD-IIKSFMLAGRDAIATTLTWFFWLL  328

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             +KNP    K+  EI      N      +   ++   +VYLHAA CESLRL+ PIP   K 
Sbjct  329   SKNPEAVTKIRQEI---NNTNLPSSGMSLDADKLNKMVYLHAALCESLRLYAPIPFERKS  385

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
              ++ D LPSGHKV    +IL S Y++GRM+A+WGED  EFKPERW+S+  GG+KH PS K
Sbjct  386   PIKQDVLPSGHKVDANWKILFSVYALGRMKAVWGEDASEFKPERWISERNGGLKHEPSFK  445

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F +F+ GPR C+G+ + F+  K VA  II  Y  +++E H  + P+ ++VL +KHG+KV 
Sbjct  446   FFVFNSGPRNCLGKNLSFLQMKTVAVEIIRNYDIKVVEGHK-IEPASSIVLHMKHGLKVT  504

Query  108   LTKR  97
             + KR
Sbjct  505   VAKR  508



>ref|XP_006294050.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
 gb|EOA26948.1| hypothetical protein CARUB_v10023041mg [Capsella rubella]
Length=508

 Score =   368 bits (944),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 195/487 (40%), Positives = 294/487 (60%), Gaps = 24/487 (5%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP +L   HR++D+  E L+ +  TF  KGP F+  +ML+T+DPANI ++ 
Sbjct  32    PRNWPVLGMLPGVLIMLHRINDYVAEVLEVSSLTFVFKGPWFSGMNMLITADPANIQHVF  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG  F++MF+  G+GI   DS+LW+  RK++  +++H GF+    RT+ + +
Sbjct  92    SSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSSLVVLSHQGFQSFSLRTITRKI  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             + G+ PVLDH+A+    FDLQ++F+RL+FD+   +       SL +E P++  + KA+ D
Sbjct  152   KYGVVPVLDHFAEENKIFDLQDVFQRLAFDVTLTLVTGSESNSLSIEMPNNE-YAKAMDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL----HDQ  808
             A   ++Y+H+ P   WKLQ W  G+  EKK  EA   FD+     +S K  ++    H  
Sbjct  211   AEEVVVYRHVKPMILWKLQNW-IGVGEEKKMKEANAAFDRSCAKYISSKREEIISTHHSS  269

Query  807   DEDDSQNFSMLTSHMKAYKGK-----PM--QFLRDTFVsltisggggttssalTWLFWLL  649
               +++    +L+  MK    K     P    FL+D  +   +  G    ++ LTW FWL+
Sbjct  270   IGEEAHGEDLLSVFMKLDTSKYELLNPTDDNFLKD-IIKSFMLAGRDAIATNLTWFFWLI  328

Query  648   AKNPLVEAKLFNEILKVKPQNHA---KQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
             +KNP    K+  EI      NH    +   +   ++   +VYLH A CESLRL+ PIP  
Sbjct  329   SKNPDALTKIRQEI------NHTSLPRSGMSLDADKLNKMVYLHGALCESLRLYAPIPFE  382

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
              K  ++ D LPSGHKV    +IL S Y++GRM+A+WG+D  EFKPERW+S+  GGIKH P
Sbjct  383   RKSPIKEDVLPSGHKVDENWKILFSVYALGRMKAVWGKDASEFKPERWISERHGGIKHEP  442

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KF +F+ GPR C+G+ + F+  KIVA  II  Y  +++E H  + P+ ++VL +KHG+
Sbjct  443   SFKFFVFNSGPRNCLGKNLSFLQMKIVAVEIIRNYDIKVVEGHK-IEPASSIVLHMKHGL  501

Query  117   KVKLTKR  97
             KV + KR
Sbjct  502   KVTVAKR  508



>ref|NP_001048917.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|ABF93893.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10831.1| Os03g0140100 [Oryza sativa Japonica Group]
 gb|EAZ25523.1| hypothetical protein OsJ_09347 [Oryza sativa Japonica Group]
Length=508

 Score =   368 bits (944),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 198/485 (41%), Positives = 290/485 (60%), Gaps = 10/485 (2%)
 Frame = -3

Query  1542  KKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTS  1363
             K   +  + P  WP++GMLPALL N + LH++ T  L      F   GP  ++  + +TS
Sbjct  27    KSKQKNPVIPLQWPLVGMLPALLANCNHLHEWITSVLTVTPLNFRFIGPPSSDMRLFITS  86

Query  1362  DPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPS  1183
             DPANI ++ N NF+NYPKG  FQ++F+I GDGI + D E W   R     LM+   FR  
Sbjct  87    DPANIRHVFNTNFSNYPKGREFQEIFDILGDGIFSADGESWRRQRTKAQLLMSSPRFRAF  146

Query  1182  LERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSD  1003
             + R     VE  L P+L H A  G   +LQ++F RL+FD    +    +PGS+ ++ P +
Sbjct  147   VARYSRDKVEKALLPLLAHVAGTGDACNLQDVFLRLTFDTTTTLVFGVDPGSVAIDLP-E  205

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLN  823
              PF +A+ DA+  +L +HI+P  +W+L +   GI  E+K   AW T D+F+   ++++  
Sbjct  206   VPFARAMDDAMTMLLLRHIVPLSWWRLARR-LGIGYERKMPVAWRTMDRFVADTIAKRRA  264

Query  822   QLHDQDEDDSQNFSMLTSHM---KAYKGKPMQFLRDTFVsltisggggttssalTWLFWL  652
             +      DDS +  +L+S++   +   G    FLRDT +   +  G  TT SAL+W F+L
Sbjct  265   EKARTGIDDSAD--LLSSYINDDEEDAGTVDAFLRDTTI-NLMLAGRDTTGSALSWFFYL  321

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             L KNP V  KL  E+  VK    A     F  +E   LVYLHAA CESLRL+PP+PM HK
Sbjct  322   LTKNPRVLHKLLQELDSVKSTTAADGMVIFDPDETGRLVYLHAALCESLRLYPPVPMEHK  381

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
                  D LPSGH+V+P  +I+ S Y+MGRME++WG DCMEF+PERW+SD  G +++VPS 
Sbjct  382   GPAAADVLPSGHEVRPGDKIVVSLYAMGRMESVWGSDCMEFRPERWISD-DGKLRYVPSY  440

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTC+G+ M F+  K  AA+++  +  E +  H +V P  +++L +K+G  V
Sbjct  441   KFMSFNSGPRTCLGKDMAFVQLKTAAAAVMKNFEIEAVAGH-VVEPKLSIILHMKNGFMV  499

Query  111   KLTKR  97
             ++ +R
Sbjct  500   RVKRR  504



>ref|XP_010027344.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62209.1| hypothetical protein EUGRSUZ_H04870 [Eucalyptus grandis]
Length=507

 Score =   368 bits (944),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 203/482 (42%), Positives = 288/482 (60%), Gaps = 13/482 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLPAL  N  R+HD+AT  ++++ G F  +   F++ DML+T+DPAN  YI 
Sbjct  30    PRNWPLVGMLPALFLNLSRVHDWATGLVERSHGNFFFRSLWFSSMDMLVTADPANFHYIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG  F+++F+I GDGI+N+DS LW   R+     M    F   L  T     
Sbjct  90    SANFGNFPKGPEFKRVFDILGDGIINSDSNLWSTQRRVAQVFMKDQRFHRFLLSTTRDKA  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL  VLD  +QRG   DLQ++F R +FD   +     +PGSL VE P + P  KA+ D
Sbjct  150   ENGLLRVLDELSQRGVTVDLQDLFHRFTFDSACRFVTGFDPGSLSVEFP-EVPISKALGD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD---QD  805
             A   I Y+H+ PE F  LQ+   GI  E+K   AW   D+ +   ++ K  +L +   + 
Sbjct  209   AEEVIFYRHLYPEWFGTLQR-LLGIGVEEKLRRAWKDIDQILGNYIAMKRVELREGTNKV  267

Query  804   EDDSQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             + D     +LT +M   +         +FLRD  +   +S G  TT S LTW FW L+ N
Sbjct  268   KGDENGADLLTLYMVENETLGALECNDKFLRD-MIMNFMSAGIETTGSTLTWFFWALSMN  326

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P V+ ++  EI  V P+           E    +VYLH A CESLRL+PPIP+  K    
Sbjct  327   PSVDMRIREEIRSVIPKEEQNLMVFNISEHMHKMVYLHGAICESLRLYPPIPLLPKCPTN  386

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              D LPSGHKV P  +I+   Y+MGRM++IWGEDC+EF+PERW+ +  GGI+H PS KF  
Sbjct  387   PDVLPSGHKVDPGAKIVVHMYAMGRMKSIWGEDCLEFRPERWILE-RGGIRHQPSYKFVA  445

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC+G+ + F   K+VAA++I  Y   ++E H  V PS++++L +KHG+KVK+T+
Sbjct  446   FNAGPRTCLGKDVAFTQIKMVAATVIHNYEVHVVEDHP-VRPSNSIILHMKHGLKVKVTR  504

Query  99    RK  94
             R+
Sbjct  505   RR  506



>emb|CDY53181.1| BnaA06g40600D [Brassica napus]
Length=510

 Score =   367 bits (943),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 204/480 (43%), Positives = 290/480 (60%), Gaps = 14/480 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP +GMLP LL    R++DF TE L+     +  KGP     DML T DPANI +I +
Sbjct  34    TNWPFLGMLPGLLLEIPRVYDFITEVLEHGNLNYLFKGPFLGGLDMLFTVDPANIHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF+NYPKGT F+K+F++ GDGI N DSELW   RK+  ++M +  F+     T    +E
Sbjct  94    SNFSNYPKGTEFKKLFDVLGDGIFNVDSELWKDLRKSAQSMMMNPEFQSFSIATSLNKLE  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P +  F +A+ DA
Sbjct  154   KGLVPLLDHVAKEKLVVDLQDVFQRFTFDSTFVLATGYDPGCLSVEMP-EIEFARALDDA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDS  793
               AI Y+H+ PE  WK+Q+  FG+  E K   A +  D+  +  +S K + +  +  ++S
Sbjct  213   EEAIFYRHVKPEMVWKMQR-LFGLGDELKLKRAHNILDRACFKCISSKRDDI-SRGTNNS  270

Query  792   QNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
              +  +LT+++     K         +FLRDT V   +  G  TT SALTW FWLL KN  
Sbjct  271   GSKDLLTAYLNVDTTKYKLLNPNDDRFLRDT-VLSFMLAGRDTTGSALTWFFWLLCKNEE  329

Query  633   VEAKLFNEILK-VKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
                K+  EI K + P+       +F  +E   LVYLH A CE+LRL+PP+P  HK   +T
Sbjct  330   AITKILQEINKNISPRTKTDDYGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKT  389

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGHKV   ++IL   YS+GRM+++WGED +EFKPERW+++ G  + H PS KF  F
Sbjct  390   DVLPSGHKVDAGSKILFCLYSLGRMKSVWGEDALEFKPERWITENGTSV-HEPSYKFLSF  448

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+++  M  K VA  II  Y  +++E H  V P+ +++L +KHG+KV ++KR
Sbjct  449   NAGPRTCLGKEVAMMQMKTVAVKIIQNYDIKVVEGHK-VEPAPSIILHMKHGLKVTVSKR  507



>ref|XP_010555338.1| PREDICTED: cytochrome P450 86B1-like [Tarenaya hassleriana]
Length=564

 Score =   369 bits (948),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 204/491 (42%), Positives = 290/491 (59%), Gaps = 14/491 (3%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             ++KKS+R  +  TNWP++GMLP+L+    R++D++ + L+ +  TF  KGP  A  D+L+
Sbjct  78    LFKKSNRDVL--TNWPILGMLPSLVVQIPRVYDWSVDVLEASNLTFLFKGPWLAGMDLLV  135

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T DPANI +I + NF NYPKG  F+K+F++ GDGI N DS+LW   RK+   + NH  F+
Sbjct  136   TVDPANIHHIMSSNFKNYPKGHEFKKIFDVLGDGIFNVDSDLWKDLRKSAQTMFNHQDFQ  195

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
                 RT    +E GL P+LDH +      DLQ++F+R +FD  F +    +PG L +E P
Sbjct  196   TFTVRTSISKLEKGLLPLLDHVSGHDIVVDLQDVFQRFTFDTTFILMTGYDPGCLSLEMP  255

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
              +  F KA+ DA  AI ++HI PE  WKLQ  + G+  EKK   A  TFD+     +S K
Sbjct  256   -EIEFAKALDDAEEAIFFRHIKPEFVWKLQN-YVGLGVEKKMRRAQATFDRLCAKYISTK  313

Query  828   LNQLHDQDEDDSQNFSMLTSHMKAYKGK-------PMQFLRDTFVsltisggggttssal  670
               ++            +LTS+M     K         +FLRDT +   +  G  TT SAL
Sbjct  314   REEISLGIHSKGDAKDLLTSYMSVDTTKYELLNPGDDKFLRDT-ILTFMIAGRDTTGSAL  372

Query  669   TWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPP  490
             TW FWLL  NP    K+  EI    P+   +   +    +   LVYLH A CE+LRL+PP
Sbjct  373   TWFFWLLCNNPEAVTKIRQEIRTKLPRTENRNENSLDSTDLNKLVYLHGALCEALRLYPP  432

Query  489   IPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGI  310
             +P  HK     D LPSGH+V   ++IL S Y++GRM ++WGED  EF+PERW+S+  GG+
Sbjct  433   VPFQHKSPARPDVLPSGHRVDAGSKILFSLYALGRMRSVWGEDASEFRPERWISE-RGGL  491

Query  309   KHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEV  130
             +H PS KF  F+ GPRTC+G+++ FM  K VA  II  Y  +++E H  V P  +++L +
Sbjct  492   RHEPSFKFLSFNAGPRTCLGKEVAFMQMKTVAVKIIQNYDIKIVEGHR-VDPVPSIILHM  550

Query  129   KHGVKVKLTKR  97
             +HG  V +TKR
Sbjct  551   RHGFNVTVTKR  561



>ref|XP_009101871.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=510

 Score =   367 bits (943),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 204/480 (43%), Positives = 290/480 (60%), Gaps = 14/480 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP +GMLP LL    R++DF TE L+     +  KGP     DML T DPANI +I +
Sbjct  34    TNWPFLGMLPGLLLEIPRVYDFITEVLEHGNLNYLFKGPFLGGLDMLFTVDPANIHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF+NYPKGT F+K+F++ GDGI N DSELW   RK+  ++M +  F+     T    +E
Sbjct  94    SNFSNYPKGTEFKKLFDVLGDGIFNVDSELWKDLRKSAQSMMMNPEFQSFSIATSLNKLE  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P +  F +A+ DA
Sbjct  154   KGLVPLLDHVAKEKLVVDLQDVFQRFTFDSTFVLATGYDPGCLSVEMP-EIEFARALDDA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDS  793
               AI Y+H+ PE  WK+Q+  FG+  E K   A +  D+  +  +S K + +  +  ++S
Sbjct  213   EEAIFYRHVKPEMVWKMQR-LFGLGDELKLKRAHNILDRACFKCISSKRDDI-SRGTNNS  270

Query  792   QNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
              +  +LT+++     K         +FLRDT V   +  G  TT SALTW FWLL KN  
Sbjct  271   GSKDLLTAYLNVDTTKYKLLNPNDDRFLRDT-VLSFMLAGRDTTGSALTWFFWLLCKNEE  329

Query  633   VEAKLFNEILK-VKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
                K+  EI K + P+       +F  +E   LVYLH A CE+LRL+PP+P  HK   +T
Sbjct  330   AIIKILQEINKNISPRTKTDDYGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKT  389

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGHKV   ++IL   YS+GRM+++WGED +EFKPERW+++ G  + H PS KF  F
Sbjct  390   DVLPSGHKVDAGSKILFCLYSLGRMKSVWGEDALEFKPERWITENGTSV-HEPSYKFLSF  448

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+++  M  K VA  II  Y  +++E H  V P+ +++L +KHG+KV ++KR
Sbjct  449   NAGPRTCLGKEVAMMQMKTVAVKIIQNYDIKVVEGHK-VEPAPSIILHMKHGLKVTVSKR  507



>gb|KHN27468.1| Cytochrome P450 86B1 [Glycine soja]
Length=464

 Score =   365 bits (938),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 204/469 (43%), Positives = 285/469 (61%), Gaps = 9/469 (2%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             MLP LL N  R HDF TE LK +G T E  GP F N D L+T DP N+ ++ +KNF+NY 
Sbjct  1     MLPQLLFNLWRAHDFFTEILKLHGPTGEFTGPWFTNMDYLVTCDPINVHHMLSKNFHNYV  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  F+ +F+ FGDGI   D E W  +R   ++L     F   L +T+   V +GL P+L
Sbjct  61    KGPEFRHIFQAFGDGIFTADFEAWKYNRDLFHSLFKQKSFEVFLVKTIHNKVHNGLLPIL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             DH  Q+G   DLQ++F R +FD    + L  +P  L ++  S+    KA  +A  +I Y+
Sbjct  121   DHVQQQGRVVDLQDVFNRFTFDNICSIVLGNDPNCLSID-FSEVAIEKAFNEAEESIFYR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED---DSQNFS  781
             H++P   WK+Q+W   I +EKK  EA  T D+FI+  ++ K  +L   +E+   ++ +  
Sbjct  180   HVVPRCVWKIQRW-LQIGQEKKMTEACKTLDQFIHARIASKREELSKYNENEMGEAHHVD  238

Query  780   MLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLFNEILK  601
             +LT+ M+  K    +FLRD  V      G  T +SALTW FWL+A NP VEAK+  E +K
Sbjct  239   LLTALMREGKAHDDKFLRDA-VFNLFVAGRDTITSALTWFFWLVATNPSVEAKILEE-MK  296

Query  600   VKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPK  421
              K     K      VEE   LVYLH A CE+LRLFPPIP   K ++ +D LPSGH+V   
Sbjct  297   EKLGTKEKSLGVLSVEEVKRLVYLHGAICEALRLFPPIPFERKQAISSDMLPSGHRVNSG  356

Query  420   TRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKM  241
             T IL S Y+MGR E  WG+DC EFKPERW+S+  GGI +VPS KF  F+ GPRTC+G+  
Sbjct  357   TMILFSLYAMGRFEETWGKDCFEFKPERWISE-KGGIVYVPSYKFIAFNAGPRTCLGKDS  415

Query  240   FFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK  94
              F+  K+VA +I+ +Y  +++E   +  PS ++VL +K G+KV++TKR+
Sbjct  416   SFIQMKMVATAILHKYRVQVVEGF-VATPSLSIVLLMKDGLKVQITKRE  463



>gb|EAY88476.1| hypothetical protein OsI_09947 [Oryza sativa Indica Group]
Length=508

 Score =   367 bits (942),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 198/485 (41%), Positives = 289/485 (60%), Gaps = 10/485 (2%)
 Frame = -3

Query  1542  KKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTS  1363
             K   +  + P  WP++GMLPALL N + LH++ T  L      F   GP  ++  + +TS
Sbjct  27    KSKQKNPVIPLQWPLVGMLPALLANCNHLHEWITSVLTVTPLNFRFIGPPSSDMRLFITS  86

Query  1362  DPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPS  1183
             DPANI ++ N NF+NYPKG  FQ++F+I GDGI + D E W   R     LM+   FR  
Sbjct  87    DPANIRHVFNTNFSNYPKGREFQEIFDILGDGIFSADGESWRRQRTKAQMLMSSPRFRAF  146

Query  1182  LERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSD  1003
             + R     VE  L P+L H A  G   +LQ++F RL+FD    +    +PGS+ ++ P +
Sbjct  147   VARYSRDKVEKALLPLLAHVAGTGDACNLQDVFLRLTFDTTTTLVFGVDPGSVAIDLP-E  205

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLN  823
              PF +A+ DA+  +L +HI+P  +W+L +   GI  E+K   AW T D+F+   ++++  
Sbjct  206   VPFARAMDDAMTVLLLRHIVPLSWWRLAR-RLGIGYERKMPVAWRTMDRFVADTIAKRRA  264

Query  822   QLHDQDEDDSQNFSMLTSHM---KAYKGKPMQFLRDTFVsltisggggttssalTWLFWL  652
             +      DDS +  +L+S++   +   G    FLRDT +   +  G  TT SAL+W F+L
Sbjct  265   EKARTGIDDSAD--LLSSYINDDEEDAGTVDAFLRDTTI-NLMLAGRDTTGSALSWFFYL  321

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             L KNP V  KL  E+  VK    A     F  +E   LVYLHAA CESLRL+PP+PM HK
Sbjct  322   LTKNPRVLHKLLQELDSVKSTTTADGMVIFDPDETGRLVYLHAALCESLRLYPPVPMEHK  381

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
                  D LPSGH+V+P  +I+ S Y+MGRME++WG DCMEF+PERW+SD  G +++VPS 
Sbjct  382   GPAAADVLPSGHEVRPGDKIVVSLYAMGRMESVWGSDCMEFRPERWISD-DGKLRYVPSY  440

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTC+G+ M F+  K  AA+++  +  E +  H +V P  +++L +K+G  V
Sbjct  441   KFMSFNSGPRTCLGKDMAFVQLKTAAAAVMKNFEIEAVAGH-VVEPKLSIILHMKNGFMV  499

Query  111   KLTKR  97
              + +R
Sbjct  500   TVKRR  504



>ref|XP_009400927.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=541

 Score =   368 bits (945),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 205/501 (41%), Positives = 303/501 (60%), Gaps = 23/501 (5%)
 Frame = -3

Query  1530  RRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPAN  1351
             RRS  P +WP+ GMLP LL N   LHD+ T+ L+  G  F  +GP F   D L+T DPAN
Sbjct  44    RRSSFPVDWPLAGMLPGLLLNLDHLHDWCTDLLRVVGCNFFFRGPWFLGMDYLVTCDPAN  103

Query  1350  IDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERT  1171
             + ++ + NF+NYPKG  F ++F+I GDGI N+D E W   R   + LMN   FR  +  +
Sbjct  104   LQHVFSANFSNYPKGGEFSEIFDILGDGIFNSDGESWKKQRMKAHGLMNGRRFRSFVASS  163

Query  1170  VCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFR  991
             +   VE GL P++D   +RG   DLQ++F RL+FD    +    +P  L +  P+  PF 
Sbjct  164   IRNKVEKGLIPLVDDVVRRGAVVDLQDVFMRLTFDATSYLVFGVDPCCLSIGLPT-VPFA  222

Query  990   KAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE--KLNQL  817
             +AI DA+ A+L +H +P  +WKL +W   I  EKK A +W   D++I   ++E  KL  L
Sbjct  223   RAIDDAMGALLLRHTVPPAWWKLARW-LRIGDEKKLAMSWKVIDRYIAESIAEKKKLRSL  281

Query  816   HDQDEDDSQ-NFSMLTSHMKAYKGKPM------------QFLRDTFVsltisggggttss  676
              ++ +  S+    +L+S++     +              +F+RDT     +  G  TT +
Sbjct  282   RNKKDVGSEAKADLLSSYINDDDDEEQQDSHRQGSTEFDKFVRDT-AMNFMLAGRDTTGA  340

Query  675   alTWLFWLLAKNPLVEAKLFNEILKV---KPQNHAKQTETFKVEECCDLVYLHAAFCESL  505
             ALTW FWLL KNPLVE+K+  E+      K ++ +     F  EE   LVYLHAA CESL
Sbjct  341   ALTWFFWLLCKNPLVESKILEELSSTPLRKQRSSSNDMTIFDTEELSKLVYLHAALCESL  400

Query  504   RLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD  325
             RLFPP+P  HK +L  + LPSGH+V+  T+IL S YSMGRME IWG+DC+EF+PERW+S+
Sbjct  401   RLFPPVPFEHKAALRHEILPSGHRVEAGTKILVSLYSMGRMEGIWGKDCLEFRPERWISE  460

Query  324   CGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDT  145
               G ++H PS KF  F+ GPRTC+G+++ F   K V A++++ +  +++  H +V P  +
Sbjct  461   -KGRVRHEPSYKFMPFNSGPRTCLGKEVAFTQMKAVVAAMVYNFQVQVLPGH-VVEPKLS  518

Query  144   LVLEVKHGVKVKLTKRK*NHQ  82
             ++L +K+G++VK+ +R  + Q
Sbjct  519   IILHLKNGLRVKIKRRAGDDQ  539



>ref|XP_009117295.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=534

 Score =   368 bits (944),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 205/484 (42%), Positives = 290/484 (60%), Gaps = 16/484 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GMLP LL    R++D+ TEFL+ +  TF  KGP F   DML T DPANI +I 
Sbjct  52    PTNWPFLGMLPGLLVEIPRVYDYVTEFLEASNLTFPFKGPRFGGLDMLFTVDPANIHHIM  111

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG+ F+K+F++ GDGI N DS+LW   RK+  ++M+   F+    RT    +
Sbjct  112   SSNFANYPKGSEFKKLFDVLGDGIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNMSKL  171

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH+A++   FDLQ++F+R +FD  F +    +PG L +E P +  F +A+ +
Sbjct  172   EKGLVPILDHFAEKKLVFDLQDVFQRFTFDTTFVLATGIDPGCLSIEMP-EIEFARALDE  230

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
             A  AI ++H  PE  WK+Q+   G   E K   A  TFD+     ++ K +++       
Sbjct  231   AEEAIFFRHFKPEIVWKMQR-LLGFGVELKMRIAHSTFDRVCSKCIASKRDEIARGVTSI  289

Query  798   DSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +L S+M     K         +FLRD  +   +  G  TT SALTW FWLL+KN
Sbjct  290   DSSSKDLLMSYMDVDTTKYKLLNPGDDKFLRD-MILSFMLAGRDTTGSALTWFFWLLSKN  348

Query  639   PLVEAKLFNEI---LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             P V  K+  EI   L  +  N +    +F  +E   LVYLH A CE+LRL+PP+P  HK 
Sbjct  349   PEVTTKIRQEINTKLSPRTNNDSDHFSSFNPQELNKLVYLHGALCEALRLYPPVPFQHKS  408

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
               + D LPSGH V   T+I+   YS+GRM+++WGED  EFKPERW+S+ G  I HVPS K
Sbjct  409   PTKPDVLPSGHIVDVSTKIVFCLYSLGRMKSVWGEDASEFKPERWISETGRLI-HVPSFK  467

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++     K VA  II  Y  +++E H  + P  +++L +K G++V 
Sbjct  468   FLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEVKIVEGHK-IEPVPSIILHMKQGLRVM  526

Query  108   LTKR  97
             +TKR
Sbjct  527   VTKR  530



>ref|XP_009108130.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=513

 Score =   367 bits (942),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 205/482 (43%), Positives = 292/482 (61%), Gaps = 15/482 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GMLP LL    R++D+ TEFL+ +  TF  KGP F   +ML T DPANI +I 
Sbjct  34    PTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVDPANIHHIM  93

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG+ F+K+F++ GDGI N D +LW   RK+  ++M+   F+    RT  + +
Sbjct  94    SSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRFTLRTNMRKL  153

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH+A++    DLQ++F+R +FD  F +    +PG L +E P +  F +A+ +
Sbjct  154   EKGLVPILDHFAEKKLVLDLQDVFQRFTFDTTFVLATGVDPGCLSIEMP-EIEFARALDE  212

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
             A+  I ++HI PE   K+Q+   G   E K   A  T D+     ++ K +++       
Sbjct  213   AMEVIFFRHIKPEIVCKIQR-LLGFGDELKMKIAHSTLDRICSKCIASKRDEITRGVTSI  271

Query  798   DSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +LTS+M       K+      +FLRD  +   +  G  TT SALTW FWLL KN
Sbjct  272   DSSSKDLLTSYMDVDTTKYKSLNPGDDKFLRD-MILSFMIAGRDTTGSALTWFFWLLTKN  330

Query  639   PLVEAKLFNEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             P V  K+  EI  K+ P+ +   ++ F  +E   LVYLH A CE+LRL+PP+P  HK   
Sbjct  331   PEVTTKIRQEINTKISPRTN-NDSDHFSSQELNKLVYLHGALCEALRLYPPVPFQHKSPT  389

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV P T+IL   YS+GRM++ WGED   FKPERW+S+ G  I HVPS KF 
Sbjct  390   KPDVLPSGHKVAPITKILFCLYSLGRMKSAWGEDASGFKPERWISETGSSI-HVPSFKFL  448

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++     K VA  II  Y  +++E HT + P  +++L +K G+KV +T
Sbjct  449   SFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIKIIEGHT-IEPVPSVILRMKQGLKVMVT  507

Query  102   KR  97
             KR
Sbjct  508   KR  509



>gb|KEH22137.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   366 bits (940),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 198/480 (41%), Positives = 291/480 (61%), Gaps = 8/480 (2%)
 Frame = -3

Query  1536  SSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDP  1357
             S  R+   T WPV+GMLP LL N   +HD+    LKQNGGTF  +GP   N ++L TSDP
Sbjct  23    SLNRNTPITKWPVLGMLPGLLYNMSNIHDYLNLVLKQNGGTFIFEGPWLTNMNILCTSDP  82

Query  1356  ANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLE  1177
              N+ +I +  F NY KG  F ++FEI GDGI  +DS +W  +R   +++     F+  + 
Sbjct  83    MNVQHITSTKFENYGKGNDFSEIFEILGDGIFRSDSHIWKYNRTLLHSIFKKESFQVFIH  142

Query  1176  RTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHP  997
             +T+ + + SGL   LDH  ++G   DLQ+IF+RL+FD    + L  +P  L +E P +  
Sbjct  143   KTIEKKLFSGLLVFLDHACKKGMQVDLQDIFQRLTFDNICYIVLGFDPNCLSIELP-EIA  201

Query  996   FRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL  817
               +A   A + +  +H+ P  +WKLQKW F +  EK+  +     D+ +Y  +  K  ++
Sbjct  202   CERAFTHAEDTLFSRHVKPRFWWKLQKW-FQVGEEKQFIKNQKIIDEMLYSEIKSK-REM  259

Query  816   HDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNP  637
               + + D  N  M T           +FLRDT +   ++ G  T SS LTW FWL+A +P
Sbjct  260   QGERKFDLLNIIM-TEAGNGENPIDYEFLRDTSI-NLLAAGRDTISSGLTWFFWLVATHP  317

Query  636   LVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
              VEAK+  EI +  P       +    +    L+YLH A CE+LRL+PP+P+ HK +L++
Sbjct  318   FVEAKILEEIKENLPSREHSWKD-LGAKGLSKLIYLHGALCEALRLYPPVPLEHKSALKS  376

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGH+VKP T I+ S YS+GR+E IWGEDC++FKPERW+S   GGI HVPS KF  F
Sbjct  377   DVLPSGHRVKPNTMIVYSLYSVGRVEEIWGEDCLKFKPERWISK-KGGIIHVPSYKFIAF  435

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPR+C+G+ + F+  K+VA +I+  YH +++E H  ++PS ++VL +KHG+KV + KR
Sbjct  436   NAGPRSCLGKDISFIEMKMVAIAILLNYHIQVVEDHP-IIPSLSVVLHMKHGLKVNVKKR  494



>gb|EPS67771.1| hypothetical protein M569_06997, partial [Genlisea aurea]
Length=490

 Score =   366 bits (939),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 207/488 (42%), Positives = 299/488 (61%), Gaps = 13/488 (3%)
 Frame = -3

Query  1551  NIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLK-QNGGTFELKGPAFANFDM  1375
              +W   +RR M   NWP++GM+P L  NA R+H+  TE L      TF  KGP F+  ++
Sbjct  12    GLWMWRNRRRMT-WNWPIVGMMPKLAMNAGRVHEICTEVLAGSRRETFWFKGPWFSGMEI  70

Query  1374  LLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIG  1195
             L TS+ AN+ Y+ + NF N+PKG  F++MF++FGDGI N+DS+ W   RKT  AL+NH G
Sbjct  71    LGTSNAANVHYVMSANFGNFPKGAKFKEMFDVFGDGIFNSDSDSWQRQRKTARALINHRG  130

Query  1194  FRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVE  1015
             F+  +     + +E+GL PV++   ++ T  DLQEIF+RL+FD    V    +P  L  E
Sbjct  131   FQGFVSEITRRKIETGLIPVMEMACRKTTPIDLQEIFQRLTFDTTCAVITGYDPLCLSPE  190

Query  1014  PPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS  835
              P + PF  A+  A ++I  +HILPE  WKLQ+W  GI  EK+  +A    D  I   ++
Sbjct  191   LP-EVPFSAAMDAAEDSIFMRHILPETIWKLQRW-IGIGSEKRLKQAKQILDTVIAEYIT  248

Query  834   EKLNQLHDQDEDDSQNFSMLTSH-MKAYKGKP-MQFLRDTFVsltisggggttssalTWL  661
              K  +L   +   S    +LTS+ + +    P  +FLRDT +   +  G  TTSSALTWL
Sbjct  249   RKREELLTGNSGGSD---LLTSYILDSENNDPDDKFLRDT-ILNLMIAGRDTTSSALTWL  304

Query  660   FWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPM  481
              WL++ +  V+ ++  E+    P+  +     F  EE  + VYLHAA CESLRL+PP+P 
Sbjct  305   LWLVSTHSHVQNRIRAELKSALPEKTSPPW-IFTEEETRNTVYLHAAVCESLRLYPPVPF  363

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
              HK   E DTLPSGH+V  +T+++   Y+MGRME+IWG+DC EFKPERW+S+  G I+H 
Sbjct  364   QHKEPAEDDTLPSGHRVSRRTKVVLFLYAMGRMESIWGKDCGEFKPERWISE-RGTIRHQ  422

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             PS KF  F+ GPRTC+G++      K+VAA+II  Y   L E H +  P+ +++L +K+G
Sbjct  423   PSYKFLAFNAGPRTCLGREAALSQIKMVAAAIIQNYEVGLAEGH-VAAPNCSVILYMKNG  481

Query  120   VKVKLTKR  97
             +KV + +R
Sbjct  482   LKVWIRRR  489



>gb|KHN27469.1| Cytochrome P450 86B1 [Glycine soja]
Length=463

 Score =   365 bits (937),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 198/469 (42%), Positives = 290/469 (62%), Gaps = 10/469 (2%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             MLP LL N  R HD++T+ L+++GGT E  GP F N D L+T DP N+ ++ +KNF+NY 
Sbjct  1     MLPQLLFNLWRAHDYSTQVLQRHGGTGEFIGPWFTNMDYLVTCDPINVHHMLSKNFHNYV  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  F+ +F+ FGDGI   DSE W   R   ++L     F   + +T+   V +GL P+L
Sbjct  61    KGPEFRHIFQAFGDGIFAADSEAWKYSRDLFHSLFKQKSFEVFVAKTIHNKVHNGLLPIL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             DH  Q+G   DLQ++F R +FD    + L  +P  L ++  S+    KA  +   +I Y+
Sbjct  121   DHVQQQGRVVDLQDVFNRFTFDNICSIVLGNDPNCLSID-FSEVAIEKAFNEVEESIFYR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS---EKLNQLHDQDEDDSQNFS  781
             H++P   WK+Q+W   I +EKK  EA  T D+FI+  ++   EKL++ ++ +  ++ +  
Sbjct  180   HVVPRCVWKIQRW-LQIGQEKKMTEACKTLDQFIHACIASKREKLSKYNENEMGEAHHVD  238

Query  780   MLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLFNEILK  601
              LT+ M+       +FLRD  V      G  T +SALTW FWL+A NP VEAK+ +E +K
Sbjct  239   FLTALMREETAHDDKFLRDA-VFNLFVAGRDTITSALTWFFWLVATNPSVEAKILDE-MK  296

Query  600   VKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPK  421
              K     K      VEE   LVYLH A CE+LRLFPPIP   K +++ D LPSGH+V   
Sbjct  297   EKLGTKEKTLGVLSVEEVKRLVYLHGAICEALRLFPPIPFETKQAIKADMLPSGHRVNSG  356

Query  420   TRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKM  241
             T+IL   Y+MGR E  WG+DC+EFKPERW+S+  GGI +VPS KF  F+ GPRTC+G+++
Sbjct  357   TKILFILYAMGRSEETWGKDCLEFKPERWISE-KGGIIYVPSYKFIAFNAGPRTCLGKEI  415

Query  240   FFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK  94
              F+  K+VAA+I+ +Y   +++   +  PS ++VL +K G+KV++ KR+
Sbjct  416   SFIQMKMVAAAILHKYRVRVVD--HVATPSPSIVLLMKDGLKVQIAKRE  462



>ref|XP_010446494.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=519

 Score =   366 bits (940),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 206/488 (42%), Positives = 290/488 (59%), Gaps = 21/488 (4%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP++GMLP LL    R++DF TE L+     F  KGP     DML T DPANI +I +
Sbjct  34    TNWPILGMLPGLLPELPRVYDFITELLEDGNLNFLFKGPTLGGLDMLFTVDPANIHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF NYPKGT F+K+F++ GDGI N DSELW   RK + ++M+H  F+     T    +E
Sbjct  94    SNFANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKFSQSMMSHPEFQRFSLATSLSKLE  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P +  F +A+ DA
Sbjct  154   KGLVPLLDHVAKEKIVVDLQDVFQRFTFDTTFVLATGYDPGCLSVEMP-EIEFARALDDA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD-  796
               AI Y+HI PE  WK+Q+W  G+  E K   A   FD+     ++ K +++     D+ 
Sbjct  213   EEAIFYRHIKPEMVWKMQRW-IGVGDELKLKRAHAVFDRVCSECIASKRDEISRGRTDNI  271

Query  795   ----SQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAK  643
                 S++  M + ++   K K +     +FLRDT +   +  G  TT SALTW FWLL K
Sbjct  272   SSSSSKDLLMSSINVDTTKYKLLNPSDDRFLRDT-ILSFMLAGRDTTGSALTWFFWLLCK  330

Query  642   NPLVEAKLFNEI-LKVKPQNHAK-----QTETFKVEECCDLVYLHAAFCESLRLFPPIPM  481
             N    AK+  EI   + P N         +++F  ++   LVYLH A CE+LRL+PP+P 
Sbjct  331   NQEAVAKIRQEINTNLFPGNKTAGSVSYDSDSFNPQDVKKLVYLHGAICEALRLYPPVPF  390

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
              HK   E D LPSGHKV   ++IL   YS+GRM+++WGED  EFKPERW+S+ G  + H 
Sbjct  391   QHKSPTEPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDAFEFKPERWISESGRSL-HE  449

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             PS KF  F+ GPRTC+G+++     K VA  II  Y  +++E H  + P+ +++L +KHG
Sbjct  450   PSYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEFQVVEGHK-IEPAPSVILHMKHG  508

Query  120   VKVKLTKR  97
             +KV ++KR
Sbjct  509   LKVTVSKR  516



>emb|CDY27160.1| BnaA08g07980D [Brassica napus]
Length=513

 Score =   366 bits (939),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 203/482 (42%), Positives = 293/482 (61%), Gaps = 15/482 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GMLP LL    R++D+ TEFL+ +  TF  KGP F   +ML T DPANI +I 
Sbjct  34    PTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVDPANIHHIM  93

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG+ F+K+F++ GDGI N D +LW   RK+  ++M+   F+    RT  + +
Sbjct  94    SSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQSMMSRPEFQRFTLRTNMRKL  153

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH+A++    DLQ++F+R +FD  F +    +PG L +E P +  F +A+ +
Sbjct  154   EKGLVPILDHFAEKKLVLDLQDVFQRFTFDTTFVLATGIDPGCLSIEMP-EIEFARALDE  212

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
             A+  I ++HI PE   K+Q+   G   E K   A  T D+     ++ K +++       
Sbjct  213   AMEVIFFRHIKPEIVCKIQR-LLGFGDELKMKIAHSTLDRICSKCIASKRDEITRGVTSI  271

Query  798   DSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +L S+M       K+      +FLRD  +   +  G  TT SALTW FWLL KN
Sbjct  272   DSSSKDLLMSYMDVDTTKYKSLNPDDDKFLRD-MILSFMIAGRDTTGSALTWFFWLLTKN  330

Query  639   PLVEAKLFNEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             P V  K+  EI  K+ P+ +   ++ F  +E   LVYLH A CE+LRL+PP+P  HK   
Sbjct  331   PEVTTKIRQEINTKISPRTN-NDSDHFSSQELNKLVYLHGALCEALRLYPPVPFQHKSPT  389

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV+P T+I+   YS+GRM+++WGED  +FKPERW S+ G  I HVPS KF 
Sbjct  390   KPDVLPSGHKVEPSTKIVFCLYSLGRMKSVWGEDASDFKPERWNSETGSSI-HVPSFKFL  448

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++     K VA  II  Y  +++E HT + P  +++L +K G+KV +T
Sbjct  449   SFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIKIVEGHT-IEPVPSVILRMKQGLKVMVT  507

Query  102   KR  97
             KR
Sbjct  508   KR  509



>ref|XP_004489209.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=511

 Score =   365 bits (937),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 209/484 (43%), Positives = 288/484 (60%), Gaps = 20/484 (4%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP IGMLP  L+N   +H+F+ + L   GGT E  GP F N   ++T+DP N+ +I +
Sbjct  34    TNWPFIGMLPQFLRNLSNIHEFSAKLLNSKGGTIEFIGPWFTNMKGVITTDPMNVHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
             K+F NY KG  F++MF+ FG GI  TDS LW  +R     +     F    ER +   VE
Sbjct  94    KSFTNYVKGDLFREMFKPFGVGIFTTDSHLWKFNRNLLQYIFKQRSFEDLQERIIHNKVE  153

Query  1152  SGLFPVLDHYAQ-RGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             + L P+L+H  Q +G   DLQ+IF R +FD    + L  +P  L ++ P +    KA   
Sbjct  154   TSLIPLLNHVQQQKGLIVDLQDIFNRFTFDNICSIILGHDPNCLSIDFP-EIECEKAFNQ  212

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
             A  +I Y+H +P   W+LQKW   I  EKK  +A   FD F+Y  ++ K  +L  ++ + 
Sbjct  213   AEESIFYRHTVPLCVWRLQKWL-QIGEEKKMTDACKVFDHFLYDCIASKREEL-TKNSNK  270

Query  795   SQNFSMLTSHM-----------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLL  649
             +QN     SH+           K  +    +FLRD         G  T +S+LTWLF+L+
Sbjct  271   NQNIETDESHVDLLTYLITEEEKKGESNDDKFLRDA-AFNLFVAGRDTITSSLTWLFYLV  329

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             A +PLVEAK+  EI   +   H ++     V+E  +LVYLH A CE+LRLFPPIP   K 
Sbjct  330   ATHPLVEAKILEEI--KEKFGHKEKPWILNVDEVKNLVYLHGAICEALRLFPPIPFERKE  387

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
             S+E D LPSGH V P T IL S Y+MGR E IWGEDC+EFKPERW+S+  GGI + PS K
Sbjct  388   SVEKDVLPSGHHVHPNTMILFSLYAMGRSENIWGEDCLEFKPERWISE-RGGIVYAPSYK  446

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+ + F+  K+VAASI++ Y   ++E +  V PS ++VL +KHG+KVK
Sbjct  447   FFSFNAGPRTCLGKDLAFIQIKMVAASILWNYGIHVVEGNC-VTPSLSIVLLMKHGLKVK  505

Query  108   LTKR  97
             +TKR
Sbjct  506   ITKR  509



>ref|XP_010473744.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=512

 Score =   365 bits (937),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/483 (40%), Positives = 289/483 (60%), Gaps = 18/483 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP +L   HR++D+  E L+ +  TF  KGP F+  +ML+T+DPANI ++ 
Sbjct  32    PRNWPVLGMLPGVLAMLHRINDYVAEILELSNLTFVFKGPWFSGMNMLITADPANIQHVF  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NY KG  F++MF+  G+GI   DS+LW+  RK+   +++H GF+    RT+ + +
Sbjct  92    SSNFTNYDKGPEFKEMFDFLGNGIFTADSKLWENMRKSALVVLSHQGFQSFSLRTITRKI  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+G+ PVLDH+A+    FDLQ++F+RL+FD+   +    +  SL +E P +  + KA+ D
Sbjct  152   ENGVVPVLDHFAEANMIFDLQDVFQRLAFDVTLTLVAGYDSNSLSIEMPMNE-YAKAMDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFD----KFIYPILSEKLNQLHDQ  808
             A   ++Y+H+ P   WKLQ W  G+  EKK  +A   FD    K+I     E +++    
Sbjct  211   AEEVVVYRHVKPMILWKLQNW-IGVGEEKKMTKANAAFDRSCAKYISAKREEIISRRRSN  269

Query  807   DEDDSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLL  649
               +++ +  +L+ +M       +  K     FL+D  +   +  G    ++ LTW FWLL
Sbjct  270   IGEEAHDMDLLSVYMNLDASKYELLKPTDDNFLKD-IIKSFMLAGRDAIATTLTWFFWLL  328

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             +KNP    K+  EI      N      +   ++   +VYLHAA CESLRL+ PIP   K 
Sbjct  329   SKNPEAVTKIRQEI---NNTNLPSSGMSLDADKLNKMVYLHAALCESLRLYAPIPFERKS  385

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
              ++ D LPSGHKV    +IL S Y++GRM+A+WGED  EFKPERW+S+  GG+KH PS K
Sbjct  386   PIKQDVLPSGHKVDANWKILFSVYALGRMKAVWGEDATEFKPERWISERNGGLKHEPSFK  445

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F +F+ GPR C+G+ + F+  K VA  II  Y   ++E H  + P+ ++VL +KHG+ V 
Sbjct  446   FFVFNSGPRNCLGKNLSFLQMKKVAVEIIRTYDIIVVEGHK-IEPASSIVLHMKHGLIVT  504

Query  108   LTK  100
             + K
Sbjct  505   VAK  507



>ref|XP_006283543.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
 gb|EOA16441.1| hypothetical protein CARUB_v10004594mg [Capsella rubella]
Length=518

 Score =   365 bits (937),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 205/486 (42%), Positives = 292/486 (60%), Gaps = 19/486 (4%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP +GMLP LL    R++DF TE L+     +  KGP     DML T DPANI +I +
Sbjct  35    TNWPFLGMLPGLLTQLPRVYDFLTEVLEDANLNYLFKGPFLGGIDMLFTVDPANIHHIMS  94

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF NYPKGT F+K+F++ GDGI N DSELW   RK++ ++M+H  F+     T    +E
Sbjct  95    SNFANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQRFTLDTSLSKLE  154

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P +  F +A+ DA
Sbjct  155   KGLVPLLDHVAKEKLVVDLQDVFQRFTFDTTFVLATGYDPGCLSVEMP-EIEFARALDDA  213

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS---EKLNQLHDQDE  802
               AI Y+H+ PE  WK+Q+   G+  E K   A    D+     ++   E++++  D   
Sbjct  214   EEAIFYRHVKPEMVWKMQR-LIGVGGELKLKRAHAILDRVCSECIASKREEISRGSDNIS  272

Query  801   DDSQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKNP  637
               S++  M + H+   K K +     +FLRDT +   +  G  TT SALTW FWLL KN 
Sbjct  273   SSSKDLLMSSIHVDTSKYKLLNPSDDRFLRDT-ILSFMLAGRDTTGSALTWFFWLLCKNQ  331

Query  636   LVEAKLFNEI-LKVKPQNH-----AKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNH  475
                AK+  EI   + P N      +  +++F  +E   LVYLH A CESLRL+PP+P  H
Sbjct  332   EAMAKIRQEINTNLFPGNKIDGSVSYDSDSFNPQEIKKLVYLHGAICESLRLYPPVPFQH  391

Query  474   KMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPS  295
             K   + D LPSGHKV+ K++IL   YS+GRM+++WGED +EFKPERW+S+ G  I H PS
Sbjct  392   KSPTKPDVLPSGHKVEAKSKILFCLYSLGRMKSVWGEDALEFKPERWISESGRSI-HEPS  450

Query  294   NKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVK  115
              KF  F+ GPRTC+G+++     K VA  II  Y  +++E H  + P+ +++L +KHG+K
Sbjct  451   YKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIQVVEGHK-IEPAPSVILHMKHGLK  509

Query  114   VKLTKR  97
             V ++K+
Sbjct  510   VTVSKK  515



>emb|CDX76867.1| BnaC08g34530D [Brassica napus]
Length=516

 Score =   365 bits (937),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 203/484 (42%), Positives = 289/484 (60%), Gaps = 16/484 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GMLP LL    R++D+ TEFL+ +  TF  KGP F   DML T DPANI +I 
Sbjct  34    PTNWPFLGMLPGLLVEIPRVYDYVTEFLEASNLTFPFKGPCFGGLDMLFTVDPANIHHIM  93

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG+ F+K+F + GDGI N DS+LW   RK+  ++M+   F+    RT    +
Sbjct  94    SSNFANYPKGSEFKKLFSVLGDGIFNADSDLWKDLRKSAQSMMSRPEFQRFTLRTNMSKL  153

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH+A++   FDLQ++F+  +FD  F +    +PG L +E P    F KA+ +
Sbjct  154   EKGLVPILDHFAEKKLVFDLQDVFQSFTFDTTFVLATGIDPGCLSIEMPKIE-FAKALDE  212

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK-------LNQL  817
             A  AI ++H  PE  WK+Q+   G   E K + A  TFD+     ++ K       +  +
Sbjct  213   AEEAIFFRHFKPEIVWKMQR-LLGFGDELKMSRAHSTFDRVCSECIASKRDEITRGVTSI  271

Query  816   HDQDEDDSQNF-SMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             H   +D   ++  + T+  K       +FLRD  +   +  G  TT SALTW FWLL+KN
Sbjct  272   HSSSKDLLMSYMDVDTTKYKLLNPGDDKFLRD-MILSFMLAGRDTTGSALTWFFWLLSKN  330

Query  639   PLVEAKLFNEI-LKVKPQ--NHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             P V  K+  EI  K+ P+  N +    +F  ++   LVYLH A CE+LRL+PP+P  HK 
Sbjct  331   PEVTTKIRQEINTKLSPRINNDSDHFSSFNPQDLNKLVYLHGALCEALRLYPPVPFQHKS  390

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
               + D LPSGH+V   T+I+   YS+GRM+++WGED  EFKPERW+S+ G  I HVPS K
Sbjct  391   PTKPDVLPSGHRVDASTKIVFCLYSLGRMKSLWGEDASEFKPERWISETGRLI-HVPSFK  449

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+ +++     K VA  +I  Y  E++E H  + P  +++L +K G+KV 
Sbjct  450   FLSFNAGPRTCLRKEVAMTQMKTVAVKVIQNYEIEIVEGHK-IEPVPSIILHMKQGLKVM  508

Query  108   LTKR  97
             +TKR
Sbjct  509   VTKR  512



>ref|XP_006649380.1| PREDICTED: cytochrome P450 86B1-like [Oryza brachyantha]
Length=507

 Score =   364 bits (935),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 194/486 (40%), Positives = 289/486 (59%), Gaps = 9/486 (2%)
 Frame = -3

Query  1542  KKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTS  1363
             K   +  + P  WP++GMLPALL N + LH++ T  L  +   F   GP  ++  + +TS
Sbjct  25    KSKQKNPVIPLQWPLVGMLPALLANCNHLHEWITSLLTASPLNFRFIGPPRSDMRLFVTS  84

Query  1362  DPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPS  1183
             DPANI ++ N NF+NYPKG  FQ++F++ GDGI + D E W   R     LM+   FR  
Sbjct  85    DPANIRHVFNTNFSNYPKGREFQEIFDVLGDGIFSADGESWRRQRTKAQLLMSSPRFREF  144

Query  1182  LERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSD  1003
             + R     VE  L P+L H+A  G   +LQ++F RL+FD    +    +PGS+ V  P +
Sbjct  145   VSRYSRAKVERALLPLLAHFAGTGEACNLQDVFLRLTFDTTTTLVFGVDPGSVAVGLP-E  203

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLN  823
              PF +A+ DA++ +L +HI+P  +WKL +   GI  E+K   AW T D+F+   ++++  
Sbjct  204   VPFARAMDDAMSVLLLRHIIPLSWWKLARRL-GIGYERKMPVAWRTMDRFVADTIAKRRA  262

Query  822   QLHDQDEDDSQNFSMLTSHMK---AYKGKPMQFLRDTFVsltisggggttssalTWLFWL  652
             +      D S +  +L+S++       G    FLRDT V+L ++G   T S+   W F+L
Sbjct  263   EKAKTGIDASAD--LLSSYIDDDDEDAGTVDAFLRDTTVNLMLAGRDTTGSALS-WFFYL  319

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             L KNPLV  KL  E+  +K          F  +E   LVYLHAA C+SLRL+PP+PM HK
Sbjct  320   LTKNPLVLRKLLQELDSIKSSTTPDGMVVFDPDEVGRLVYLHAALCDSLRLYPPVPMEHK  379

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
               +  D LPSG +V P  +I+ S Y+MGRME++WG DC EFKPERW+SD G  +++VPS 
Sbjct  380   GPVAADVLPSGDEVLPGDKIVVSLYAMGRMESVWGSDCSEFKPERWISDDGKKLRYVPSY  439

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTC+G+ M F+  K  AA+++  +  E +  H +V P  +++L +K+G  V
Sbjct  440   KFMSFNSGPRTCLGKDMAFVQLKTAAAAVMKNFEVEAVPGH-VVEPKLSIILHMKNGFMV  498

Query  111   KLTKRK  94
             ++ +R+
Sbjct  499   RVKRRQ  504



>ref|XP_010432764.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   364 bits (935),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 200/482 (41%), Positives = 290/482 (60%), Gaps = 21/482 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+ MLPALL+  HR++D++ + L+ +  TF  KGP FA  DML+T DPANI +I   
Sbjct  35    NWPVLRMLPALLRALHRIYDYSVKILEISNLTFPFKGPRFAGMDMLVTVDPANIHHIMTS  94

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+NY KG  FQ +F++FGDGI+ TD ELW   RK+  A+++   F+     T+ + ++ 
Sbjct  95    NFSNYIKGPAFQDVFDVFGDGIITTDLELWKTLRKSYQAILHRQEFQRYSMSTMTRKLKD  154

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+LDH+A++GT  DLQ++F R +FDI   +    +P SL VE P D  F KA+ D  
Sbjct  155   GLVPLLDHFAEKGTTVDLQDVFGRFTFDIILILVTGSDPRSLSVELPEDE-FAKALDDVG  213

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ----DE  802
               ILY+H+ P   WKLQ W  G   E+K  +A   FD+     +S K  ++       D 
Sbjct  214   EGILYRHVKPRFLWKLQNW-VGFGEERKMTKANAIFDRVCAKYISAKREEMKRSQGVIDI  272

Query  801   DDSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAK  643
              + ++  +LTS +K    K         +FLRDT +   I  G  TT+SAL+W FWLL++
Sbjct  273   SNVESEDILTSFIKLDTTKYKLLNPSDDKFLRDT-ILTFILAGRDTTASALSWFFWLLSE  331

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             NP V AK+  E++           E         LVYLH A CE+LRL+PP+    K  +
Sbjct  332   NPKVVAKIRQEVINTDLSRTGNSQENLD-----KLVYLHGALCEALRLYPPVCYGRKSPI  386

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             ++D LPSGHKV   + I+   Y++GRM A+WGED ++FKPERW+++  GGIKH PS KF 
Sbjct  387   KSDVLPSGHKVDANSNIVICLYALGRMRAVWGEDALQFKPERWITE-NGGIKHEPSFKFL  445

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+ +     KIVA  I+ +Y  +++E    + P   ++L +KHG+++ +T
Sbjct  446   SFNAGPRTCLGKHIALNQMKIVAVEILQKYDIKVVEGQK-IEPVLGIILSMKHGLRITVT  504

Query  102   KR  97
             KR
Sbjct  505   KR  506



>emb|CDY12435.1| BnaC08g09240D [Brassica napus]
Length=513

 Score =   364 bits (935),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 202/482 (42%), Positives = 292/482 (61%), Gaps = 15/482 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GMLP LL    R++D+ TEFL+ +  TF  KGP F   +ML T DPANI +I 
Sbjct  34    PTNWPFLGMLPGLLVEIPRVYDYITEFLEASNLTFLFKGPCFVGVNMLFTVDPANIHHIM  93

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG+ F+K+F++ GDGI N D +LW   RK+   +M+   F+    RT  + +
Sbjct  94    SSNFTNYPKGSEFKKIFDVLGDGIFNADFDLWMDLRKSAQCMMSRPEFQRFTLRTNMRKL  153

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH+A++    DLQ++F+R +FD    +    +PG L +E P +  F +A+ +
Sbjct  154   EKGLVPILDHFAKKKLVLDLQDVFQRFTFDTTLVLATGIDPGCLSIEMP-EIEFARALDE  212

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
             A+  I ++HI PE   K+Q+   G   E K   A  T D+     ++ K +++       
Sbjct  213   AMEVIFFRHIKPEIVCKIQR-LLGFGDELKMKIAHSTLDRVCSKCIASKRDEITRGVTSI  271

Query  798   DSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +L S+M       K+      +FLRD  +   +  G  TT SALTW FWLL KN
Sbjct  272   DSSSKDLLMSYMDVDTTKYKSLNPGDDKFLRD-MILSFMIAGRDTTGSALTWFFWLLTKN  330

Query  639   PLVEAKLFNEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             P V  K+  EI  K+ P+ +   ++ F  +E   LVYLH A CE+LRL+PP+P  HK   
Sbjct  331   PEVTTKIRQEINTKISPRTN-NDSDHFSSQELNKLVYLHGAMCEALRLYPPVPFQHKSPT  389

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV+P T+I+   YS+GRM+++WGED  +FKPERW+S+ G  I HVPS KF 
Sbjct  390   KPDVLPSGHKVEPSTKIVFCLYSLGRMKSVWGEDASDFKPERWISETGSSI-HVPSFKFL  448

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++     K VA  II  Y  +++E HT + P  +++L +K G+KV +T
Sbjct  449   SFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIKIVEGHT-IEPVPSVILRMKQGLKVMVT  507

Query  102   KR  97
             KR
Sbjct  508   KR  509



>dbj|BAD94304.1| cytochrome p450 - like protein [Arabidopsis thaliana]
Length=506

 Score =   363 bits (933),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 201/482 (42%), Positives = 289/482 (60%), Gaps = 19/482 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+ MLPA+L+  HR++D++ E L+ +  TF  KGP F   DMLLT DPANI +I 
Sbjct  32    PRNWPVLRMLPAMLKALHRIYDYSVEILETSDLTFPFKGPRFTGMDMLLTVDPANIHHIM  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG  FQ +F++ GD  + TDSELW   RK+  A+++   F+     T+   +
Sbjct  92    SSNFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAMLHSQEFQRFSMSTMTSKL  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             + GL P+L+H+A+ GT  DLQ +F R +FD  F +    +P SL +E P D  F KA+ D
Sbjct  152   KYGLVPLLNHFAEEGTTLDLQSVFGRFTFDTIFILVTGSDPRSLSIEMPEDE-FAKALDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
                 ILY+H  P   WKLQ W  G  +EKK  EA  TFD+     +S K  ++   Q   
Sbjct  211   VGEGILYRHFKPRFLWKLQNW-IGFGQEKKLTEANATFDRVCAKYISAKREEIKRSQGTS  269

Query  798   DSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             +  +  +LTS +K    K         +FLRD  +   I  G  TT++AL+W FWLL++N
Sbjct  270   NGGSQDLLTSFIKLDTTKYKLLNPSDDKFLRDN-ILAFILAGRDTTATALSWFFWLLSEN  328

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCD-LVYLHAAFCESLRLFPPIPMNHKMSL  463
             P V AK+  EI       +   + T   +E  D LVYLH A CE++RL+PP+    K  +
Sbjct  329   PHVVAKIHQEI-----NINTDLSRTGNSQENVDKLVYLHGALCEAMRLYPPVSFGRKSPI  383

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             ++D LPSGHKV   ++I+   Y++GRM A+WGED  +FKPERW+S+  GGIKH PS KF 
Sbjct  384   KSDVLPSGHKVDANSKIIICLYALGRMRAVWGEDASQFKPERWISE-NGGIKHEPSFKFL  442

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+ +     KIVA  I+  Y  ++++    +VP+   +L +KHG+++ +T
Sbjct  443   SFNAGPRTCLGKHLAMTQMKIVAVEILRNYDIKVLQGQK-IVPALGFILSMKHGLQITVT  501

Query  102   KR  97
             KR
Sbjct  502   KR  503



>ref|XP_002869292.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45551.1| CYP96A2 [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   363 bits (933),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 200/480 (42%), Positives = 292/480 (61%), Gaps = 19/480 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+ MLPALL+  HR++D++ + L+ +  TF  KGP FA  DML+T DPANI +I + 
Sbjct  34    NWPVLRMLPALLKALHRIYDYSVKILETSDLTFPFKGPRFAGIDMLITVDPANIHHIMSS  93

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             +F+NY KG  FQ +F++ GD  + TDSELW   RK+  A+++   F+     T+   ++ 
Sbjct  94    SFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAMLHTQEFQRFSMSTMTSKLKD  153

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+L+H+A+ GT  DLQ +F R +FD    +    +P SL +E P D  F KA+ D  
Sbjct  154   GLVPLLNHFAEEGTTLDLQGVFGRFTFDTICILVTGSDPRSLSIEMPGDE-FAKALDDVG  212

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDEDDS  793
              AILY+H+ P   WKLQ W  G  +EKK  EA  TFD+     +S K  ++   Q   + 
Sbjct  213   EAILYRHVKPRFLWKLQNW-MGFGQEKKLIEANATFDRVCAKYISAKREEIKRSQGVSNG  271

Query  792   QNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
             ++  +LTS +K    K         +FLRD  +   I  G  TT++AL+W FWLL++NP 
Sbjct  272   ESEDLLTSIIKLDTTKYKLLNPSDDKFLRDN-ILAFILAGRDTTATALSWFFWLLSENPQ  330

Query  633   VEAKLFNEILKVKPQNHAKQTETFKVEECCD-LVYLHAAFCESLRLFPPIPMNHKMSLET  457
             V AK+  EI      N+   + T   +E  D LVYLH A CE++RL+PP+    K  +++
Sbjct  331   VVAKIRQEI-----NNNTDLSRTGNSQENVDKLVYLHGALCEAMRLYPPVSFGRKSPIKS  385

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGHKV   ++I+   Y++GRM A+WGED  +FKPERW+S+  GGIKH PS KF  F
Sbjct  386   DVLPSGHKVDANSKIIICLYALGRMRAVWGEDATQFKPERWISE-NGGIKHEPSYKFLAF  444

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+ +     KI+A  I+  Y  ++++    +VP+   +L +KHG+K+ +TKR
Sbjct  445   NAGPRTCLGKHLAMTQMKIMAVVILRNYDIKVLQGQK-IVPALGFILSMKHGLKITVTKR  503



>emb|CAB44684.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB80612.1| cytochrome P450-like protein [Arabidopsis thaliana]
Length=479

 Score =   362 bits (930),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 206/481 (43%), Positives = 290/481 (60%), Gaps = 21/481 (4%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             M+P LL   HR++DF TE L+    T+   GP FAN DML+T DPANI +I + NF NYP
Sbjct  1     MIPGLLVEIHRVYDFITEILEVTNLTYPCTGPCFANLDMLVTVDPANIHHIMSSNFANYP  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  F+K+F+I GDGI N DSELW   RK+  ++M +  F+     T  + +E GL P+L
Sbjct  61    KGPEFKKLFDILGDGIFNADSELWKDLRKSAQSMMMNPEFQKFSLATSLKKLEKGLVPLL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             DH A+     DLQ++F+R +FD  F +    +PG L VE P +  F +A+ DA  AI ++
Sbjct  121   DHVAKEKLAVDLQDMFQRFTFDTTFVLATGYDPGCLSVEMP-EVEFARALDDAEEAIFFR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDEDDSQNFSML  775
             H+ PE FW+LQ    G+  EKK  +A  T D+     ++ K +++    +  DS +  +L
Sbjct  180   HVKPEIFWRLQG-LLGLGDEKKMTKARSTLDRVCSKYIAIKRDEVSRGTNNVDSHSKDLL  238

Query  774   TSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLF  616
             TS+M       K       +FLRDT +   +  G  TT S LTW FWLL KNP V AK+ 
Sbjct  239   TSYMNLDTTKYKLLNPSDERFLRDT-ILTFMLAGRDTTGSGLTWFFWLLIKNPEVIAKIR  297

Query  615   NEI-----LKVKPQNHAKQ---TETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
              EI      + K  + A     +++F  +E   LVYLH A CESLRL+PP+P  HK   +
Sbjct  298   QEINTALFQRSKVDDDASNNNDSDSFSPQELKKLVYLHGAICESLRLYPPVPFQHKSPTK  357

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              D LPSGHKV   ++IL   YS+GRM+++WGED +EFKPERW+S+ G  + H PS KF  
Sbjct  358   PDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGNSV-HEPSYKFLS  416

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC+G+++  M  K VA  II  Y  +++E    + P+ +++L +KHG+KV +TK
Sbjct  417   FNAGPRTCLGKEVAMMQMKSVAVKIIQNYEMKIVEGQQ-IEPAPSVILHMKHGLKVTVTK  475

Query  99    R  97
             R
Sbjct  476   R  476



>ref|XP_004492144.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=500

 Score =   363 bits (932),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 197/479 (41%), Positives = 283/479 (59%), Gaps = 18/479 (4%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP+ GMLP++  N    H+++   LKQNGGT   +GP   N  ++ TS+  N+ +I +
Sbjct  31    TNWPIFGMLPSISLNISNFHEYSNSILKQNGGTIIFEGPWLTNMKIVFTSNAMNVQHITS  90

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
               F NY KG  F+++FE+ GDGI  +DS  W  +R   +++   + F+  + +T    V+
Sbjct  91    TKFENYGKGDDFKEIFEVLGDGIFRSDSHKWKYNRTLLHSVFKQVSFQTFIHKTFEAKVD  150

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             S L   LDH  ++G   DLQ++ +RL+FD    + L  +P  L ++ P +    KA    
Sbjct  151   SCLLVFLDHACKKGLQVDLQDVLQRLTFDNICSIVLGFDPICLSIDLP-EIASEKAFNQL  209

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDS  793
              + +L +HI P   WKLQKW   I  EKK  E     D+ +Y  +  K+N      +D  
Sbjct  210   EDILLTRHIKPRFLWKLQKW-LQIGDEKKFVENQKIIDQMLYAEIKSKINM-----QDKL  263

Query  792   QNFSMLTSHMKAYKGKPMQ-------FLRDTFVsltisggggttssalTWLFWLLAKNPL  634
             Q F +LT+ M     K  Q       FLRDT +   ++ G  T SS+L W FWL+A +P 
Sbjct  264   QQFDLLTTIMNTEVEKKEQPNSIDDKFLRDTAI-NLLAAGRDTISSSLAWFFWLMATHPF  322

Query  633   VEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETD  454
             VEAK+  EI +  P   +   E  K E    LVYLH A CE+LRL+PPIP  HK +++ D
Sbjct  323   VEAKILEEIKENLPSKESNWKELGK-EGLSKLVYLHGALCETLRLYPPIPFEHKCAMKFD  381

Query  453   TLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFS  274
              LPSGHK+K  T I+ S YSMGR+E IWGEDC+EFKPERW+S+  GGI HVPS KF  F+
Sbjct  382   VLPSGHKIKSNTMIVYSLYSMGRVEEIWGEDCLEFKPERWISN-KGGIIHVPSYKFIAFN  440

Query  273   VGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
              GPR+C+G+ + F   K+V  +I+  YH +L+E H  +VPS +++L +KHG+K+ + KR
Sbjct  441   AGPRSCLGKDISFTEMKMVVVAILLNYHIQLVEEHP-IVPSLSVILHMKHGLKIMVKKR  498



>ref|NP_179782.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
 gb|AAD20408.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|AEC07237.1| cytochrome P450, family 96, subfamily A, polypeptide 5 [Arabidopsis 
thaliana]
Length=510

 Score =   363 bits (932),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 193/494 (39%), Positives = 294/494 (60%), Gaps = 20/494 (4%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             I KKS +  + P NWPV+GMLP +L   HR++D+  E L+ +  TF  KGP F+  +ML+
Sbjct  23    IHKKSHQ--ITPRNWPVLGMLPGVLVMLHRINDYVAEILEVSNLTFAFKGPWFSGMNMLI  80

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T+DP+NI ++ + NF+NY KG  F++MF+  G+GI   DS+LW+  RK+   +++H GF+
Sbjct  81    TADPSNIQHVFSSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQ  140

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
                 RT+   +++GL PVLDH+A+  T FDLQ++F+RL+FD+   +    +  SL +E P
Sbjct  141   SFSLRTITCKIKNGLVPVLDHFAEANTVFDLQDVFQRLAFDVTLTLVTGCDSSSLSIEMP  200

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
              +  + KA+ DA   ++Y+H+ P   WKLQ W  G+  EKK  EA   FD+     +S K
Sbjct  201   KNE-YAKAMDDAEEVVVYRHVKPVVLWKLQNW-IGLGEEKKMKEANAAFDRSCAKYISAK  258

Query  828   LNQL---HDQDEDDSQNFSMLTSHMKAYKGK-------PMQFLRDTFVsltisggggtts  679
               ++   H     ++    +L+ +M     K          FL+D  +   +  G    +
Sbjct  259   REEIISHHSNIGGEAHAEDLLSVYMNLDISKYELLNPNDDNFLKD-IIKSFMLAGRDAIA  317

Query  678   salTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRL  499
             + LTW FWLL+KNP    K+  EI      N      +   ++   +VYLH A CESLRL
Sbjct  318   TTLTWFFWLLSKNPEAVTKIRQEI----NTNLPGSGMSLDADKLNKMVYLHGALCESLRL  373

Query  498   FPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCG  319
             + PIP   K  ++ D LPSGH V    +IL S Y++GRM ++WG+D  EFKPERW+S+  
Sbjct  374   YAPIPFERKTPIKQDVLPSGHMVDKNWKILFSVYALGRMRSVWGQDASEFKPERWISERN  433

Query  318   GGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLV  139
             GG+KH PS KF +F+ GPR C+G+ + F+  K VA  II  Y  +++E H  + P+ +++
Sbjct  434   GGLKHEPSFKFFVFNSGPRNCLGKNLSFLQMKTVAVEIIRNYDIKVVEGHK-IEPASSII  492

Query  138   LEVKHGVKVKLTKR  97
             L +KHG+KV ++KR
Sbjct  493   LHMKHGLKVTVSKR  506



>ref|XP_009795090.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=513

 Score =   363 bits (932),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 202/491 (41%), Positives = 292/491 (59%), Gaps = 13/491 (3%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W   + ++  P N+P +GM P LL N HR+H+  TE L + GGTF LKGP F N DML T
Sbjct  26    WAIGNTKNDLPRNYPFLGMFPTLLLNIHRIHEKITEVLSKTGGTFLLKGPWFTNMDMLGT  85

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
              DP N+ YI + N +N+PKG  F+K+F+ FGDGI N+D +LW    K    L+ +  +  
Sbjct  86    VDPVNVHYIMSTNSSNFPKGPEFKKIFDAFGDGIFNSDFDLWKKQSKYAKELVINQKYHK  145

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
              L +T+   V+ GL P+LD  A+    FDLQ+IFKRL+FD   +V    +PG L +E P 
Sbjct  146   CLIKTINDKVKDGLIPILDFMAKEDKIFDLQDIFKRLTFDTICKVVTGFDPGCLSLEFPC  205

Query  1005  DHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL  826
               PF KA+ D    I+ +H+LPE  WKLQKW  G+  EKK ++A +  D+ I   +  K 
Sbjct  206   V-PFVKAMEDIDYVIVIRHLLPESIWKLQKW-LGVGPEKKLSKAVEVVDQIIEKFILMKR  263

Query  825   NQLHDQDEDDSQ--NFSMLTSHMKAYKGKPM------QFLRDTFVsltisggggttssal  670
              +L +  +   Q   F +LT  +     +        +FLRDT +   +  G    +S L
Sbjct  264   EELSNGAKSKQQEVGFDLLTLCIVNDGERTTGLKFDNKFLRDT-IFSFLFAGRDGVNSCL  322

Query  669   TWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPP  490
             TW  WL+  +P VE  +  E+  + P    ++ + F  E+  +++YLHAA CE++RL+PP
Sbjct  323   TWFIWLVFAHPEVERNIREELKAIIPVEETEKWKFFTAEDLKNMIYLHAALCETMRLYPP  382

Query  489   IPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGI  310
             +P  HK   + D LPSGH V PK R++ + Y+MGRME IWG++  EFKPERW+S+C G I
Sbjct  383   VPFQHKRPQKHDILPSGHHVHPKMRVMFNLYAMGRMEFIWGKEASEFKPERWISEC-GTI  441

Query  309   KHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEV  130
             KH  S KF  F  GPR CIG +  F   K++AA+II  Y  ++++ H  V P+ +++L +
Sbjct  442   KHEASYKFLTFGAGPRKCIGIETSFTQLKVMAAAIIHNYEIKMVKDHD-VSPNCSIILHM  500

Query  129   KHGVKVKLTKR  97
             KHG KV++ KR
Sbjct  501   KHGFKVRVKKR  511



>ref|XP_009101866.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=505

 Score =   363 bits (931),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 202/481 (42%), Positives = 295/481 (61%), Gaps = 18/481 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP LL + HRL+D++ E L+ +  TF LKGP F   DML+T DPANI +I 
Sbjct  32    PRNWPVLGMLPGLLVSLHRLYDYSVEILEISDLTFLLKGPRFFGMDMLVTVDPANIHHIM  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG  F  +F++FGDGIL  DSELW   R++  A+++H GF+     T+   +
Sbjct  92    SSNFSNYIKGPEFHDVFDVFGDGILTADSELWRNLRRSYQAMVHHQGFQKFSVSTMTSKL  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             + GL P+L+H+A+ GT  DLQ++F R +FD    +    +P SL +E   D    KA+ D
Sbjct  152   KDGLVPLLNHFAEEGTTVDLQDLFGRFTFDTILILITGSDPKSLSIEMHEDE-LAKALED  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQ-------L  817
                 + Y+HI P   WKLQ W  G+ +EKK ++A  TFD+     +S K  +       L
Sbjct  211   VGEGVFYRHIKPRFMWKLQNW-MGLGQEKKMSQANATFDRVCSRYISAKREEIIRSQGVL  269

Query  816   HDQDEDDSQNFSML-TSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             + + ED   +F  L T+  K  K    +FLRDT +   I  G  TT+SAL+W FWLL++N
Sbjct  270   NGEGEDLLTSFMKLDTAKYKLLKPSDDKFLRDT-ILAFILAGRDTTASALSWFFWLLSEN  328

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P+V AK+  EI+     N   +T   + E    LVYL AA  E++RL+PP+    K S+E
Sbjct  329   PIVVAKIRQEII----DNDLPRTGNGQ-ENLDKLVYLQAALFEAMRLYPPVSFERKSSVE  383

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
             +D LPSGHKV   ++I+   Y++GRM+A+WGED ++FKPERW+++  GG KH PS+KF  
Sbjct  384   SDVLPSGHKVDANSKIIICLYALGRMKAVWGEDALQFKPERWITE-NGGPKHEPSSKFLA  442

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC+G+ +     K V   I+ +Y  ++++    + P    +L +KHG++V +TK
Sbjct  443   FNSGPRTCLGKHLAITQMKTVVVEILQKYDIKVIQGQK-IEPGLGFILSMKHGLRVTITK  501

Query  99    R  97
             R
Sbjct  502   R  502



>ref|XP_006411749.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
 gb|ESQ53202.1| hypothetical protein EUTSA_v10026828mg [Eutrema salsugineum]
Length=517

 Score =   363 bits (932),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 208/500 (42%), Positives = 295/500 (59%), Gaps = 23/500 (5%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             I KK  R  + PTNWP +GM+P LL   HR++DF T+ L+    T+   GP FA  DML+
Sbjct  24    IIKKPHR--LCPTNWPFLGMIPGLLVEIHRVYDFVTDILEVTNLTYPCIGPCFAGLDMLV  81

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T DPANI +I + NF+NYPKG  F+K+F++ GDGI N DSELW   RK+  ++M +  F+
Sbjct  82    TVDPANIHHIMSSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMNPEFQ  141

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
                  T    +E GL P+LDH A      DL+++F R +FD    +    +PG L VE P
Sbjct  142   RFSLATSLSKLEKGLVPLLDHVANEKLVVDLEDVFSRFTFDTTCVLATGYDPGCLSVEMP  201

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
              +  F +A+ DA  AI ++HI PE  WK+Q    G+  EKK  +A  TFD+     ++ K
Sbjct  202   -EIEFARALDDAEEAIFFRHIKPEILWKMQS-LIGLGDEKKMTKARATFDRVCSKYIASK  259

Query  828   LNQLHDQDED-DSQNFSMLTSHMKAYKGK-------PMQFLRDTFVsltisggggttssa  673
              +++     + DS +  +LTS+M     K         +FLRDT +   +  G  TT SA
Sbjct  260   RDEISRGISNVDSPSQDLLTSYMNLDTTKYRLLNPSDERFLRDT-ILTFMLAGRDTTGSA  318

Query  672   lTWLFWLLAKN--------PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAF  517
             LTW  WLL KN          + A LF E       N  + +++F  +E   LV+LH A 
Sbjct  319   LTWFLWLLCKNQDAIAKIRQEINANLFAETKTEHASNSDEVSDSFNPQELKKLVFLHGAI  378

Query  516   CESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPER  337
             CE+LRL+PP+P  HK   +TD LPSGHKV   ++IL   YS+GRM+++WGED +EFKPER
Sbjct  379   CEALRLYPPVPFQHKSPTKTDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPER  438

Query  336   WLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVV  157
             W+S+ G  + H PS KF  F+ GPRTC+G+++  M  K VA  II  Y  +++E  T + 
Sbjct  439   WISESGKPV-HEPSYKFLSFNAGPRTCLGKEVALMQMKSVAVKIIQNYEMKIVEGQT-IE  496

Query  156   PSDTLVLEVKHGVKVKLTKR  97
             P+ +++L +KHG KV ++KR
Sbjct  497   PAPSVILHMKHGFKVTVSKR  516



>ref|XP_010027329.1| PREDICTED: cytochrome P450 86B1-like [Eucalyptus grandis]
 gb|KCW62193.1| hypothetical protein EUGRSUZ_H04851 [Eucalyptus grandis]
Length=507

 Score =   363 bits (931),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 206/483 (43%), Positives = 292/483 (60%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLPALL N    H++AT FL+++ G F L+   F+  D+L T+DP N+ YI 
Sbjct  30    PKNWPLVGMLPALLLNLSHFHEWATGFLERSHGNFFLRFHWFSGMDILFTADPVNVHYIL  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG  F+++F++ GDGI N+DS LW   R+     M  + F   L  T    +
Sbjct  90    SANFGNFPKGPEFKRVFDVLGDGIFNSDSNLWSTQRRVAQVFMKDLRFHRFLLMTTRDKL  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL  VLD  +Q G   DLQ +F+R + D   +     +PGSL VE P +    KA+ D
Sbjct  150   ENGLLRVLDELSQSGVTVDLQVLFQRFALDSACRFVTGFDPGSLSVEFP-EVLISKALDD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD---QD  805
             A   + Y+H  PE F  LQ+   GI  EKK  +AW+  D+ +   ++ K  +L +   + 
Sbjct  209   AEEVLFYRHFYPEWFGTLQR-LLGIGVEKKLRKAWEDGDQILGNCIAMKRVELREGTGKV  267

Query  804   EDDSQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             ++D     +LT +M   +         +FLRDT +   IS G  TT SALTW FW L+ N
Sbjct  268   KEDENGADLLTLYMVENETLGALECNDKFLRDT-ILNFISAGIETTGSALTWFFWALSMN  326

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEE-CCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             P VE ++  EI  V P+   +    F + E    LVYLH A CESLRL+PP+P   K   
Sbjct  327   PSVEMRIREEIRSVIPKEE-QNLRVFNISEHMHKLVYLHGAVCESLRLYPPLPFQRKSPA  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGH+V P T+I+   Y+MGRM++IWGEDC+EFKPERW+S+  GGI+H PS KF 
Sbjct  386   KPDVLPSGHEVDPGTKIIVVMYAMGRMKSIWGEDCLEFKPERWISE-RGGIRHEPSYKFV  444

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+ + F   K VAA++I  Y   ++E H  V PS+++VL +K+G+KVKL 
Sbjct  445   AFNAGPRTCLGKDVAFTQIKTVAATVIHNYEVHVVEDHP-VRPSNSIVLHMKYGLKVKLA  503

Query  102   KRK  94
             +R+
Sbjct  504   RRR  506



>ref|XP_010437945.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=509

 Score =   363 bits (931),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 200/482 (41%), Positives = 289/482 (60%), Gaps = 21/482 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+ MLPALL+  HR++D++ + L+ +  TF  KGP FA  DML+T DPANI +I   
Sbjct  35    NWPVLRMLPALLRALHRIYDYSVKILEISNLTFPFKGPRFAGMDMLVTVDPANIHHIMTS  94

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+NY KG  FQ +F++FGDGI+ TD ELW   RK+  A+++   F+     T+ + ++ 
Sbjct  95    NFSNYIKGPAFQDVFDVFGDGIITTDLELWKTLRKSYQAVLHRQEFQRFSMSTMTRKLKD  154

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+LDH+A++GT  DLQ++F R +FDI   +    +P SL +E P D  F KA+ D  
Sbjct  155   GLVPLLDHFAEKGTTVDLQDVFGRFTFDIILILVTGSDPRSLSIEMPEDE-FSKALDDVG  213

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ----DE  802
               ILY+H+ P   WKLQ W  G   EKK  +A  TFD+     +S K  ++       D+
Sbjct  214   EGILYRHVKPRFLWKLQNW-VGFGEEKKMTKANATFDRVCAKYISGKREEMKRSQGVIDK  272

Query  801   DDSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAK  643
              + ++  +LTS +K    K         +FLRD  +   I  G  TT+SAL+W FWLL++
Sbjct  273   SNVESEDILTSFIKLDTTKYKLLNTSDDKFLRDN-ILTFIIAGRDTTASALSWFFWLLSE  331

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             NP V AK+  E++           E         LVYL  A CE+LRL+PP+    K  +
Sbjct  332   NPKVVAKIRQEVINTDLSRTGNGQENLD-----KLVYLQGALCEALRLYPPVCFGRKSPI  386

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             ++D LPSGHKV   + I+   Y++GRM A+WGED +EFKPERW+++  GGIKH PS KF 
Sbjct  387   KSDVLPSGHKVDANSNIVICLYALGRMRAVWGEDALEFKPERWITES-GGIKHEPSFKFL  445

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+ +     KIVA  I+  Y  +++E    + P   ++L +KHG+++ +T
Sbjct  446   SFNAGPRTCLGKHIALNQMKIVAVEILQNYDIKVVEGQK-IEPVLGIILSMKHGLRITVT  504

Query  102   KR  97
             KR
Sbjct  505   KR  506



>ref|XP_003629932.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04408.1| cytochrome P450 family protein [Medicago truncatula]
Length=493

 Score =   362 bits (929),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 197/481 (41%), Positives = 289/481 (60%), Gaps = 15/481 (3%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             R+   T WP +GMLP  L+N    HD+    LKQNGGTF  +G    N +++ TSDP N+
Sbjct  22    RNTPITKWPFMGMLPGFLRNVSNFHDYTNSLLKQNGGTFIFEGAWLTNMNIVFTSDPLNV  81

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              +I + +F NY KG  F ++FE+ GDGI  +DS  W  +R   +++     F+  L +T+
Sbjct  82    QHITSTSFENYGKGNEFTEIFEVLGDGIFRSDSHTWKYNRTLLHSIFKQESFKVFLHKTI  141

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
              + + S L   LDH  ++G   DLQ++F+RL+FD    V L  +P  L ++ P +    K
Sbjct  142   EKKISSCLLMFLDHACKKGMQVDLQDVFQRLTFDNICCVVLGFDPACLSIDLP-EISCEK  200

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYP-ILSEKLNQLHD  811
             A   A N + Y+H+ P  FWKLQKW   +  EKK +E     D+++Y  I S++  Q H 
Sbjct  201   AFTQAENTLFYRHVRPRFFWKLQKW-LQVGEEKKFSENIKIIDQWLYSEIKSKRETQGHK  259

Query  810   QDEDDSQNFSMLTSHMKAYKGKPM---QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             Q +       + T   +   G+ +   +FLRDT +   ++ G  T SSALTW FWL+A +
Sbjct  260   QLD------LLNTLTFEVGDGQNLIDDKFLRDTAI-NLLAAGRDTISSALTWFFWLVATH  312

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P VEAK+  E+ +          +   +E    L+YLH A CE+LRL+PPIP  HK +L+
Sbjct  313   PFVEAKILEEVRENLSSREDNNWKDLGMEGLSKLIYLHGALCEALRLYPPIPFEHKSNLK  372

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
             +D LPSGH +K  T IL S YS+GR+E IWGEDC+EFKPERW+S  GG I HVPS KF  
Sbjct  373   SDVLPSGHVIKSNTMILYSLYSIGRVEEIWGEDCLEFKPERWVSKKGGTI-HVPSYKFIA  431

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPR+ +G+ + F+  K+VA +I+  YH +++E H  ++PS ++VL +KHG+K+ + K
Sbjct  432   FNAGPRSRLGKDISFIELKMVAIAILLNYHIQVVEGHP-IIPSLSVVLHMKHGLKINVKK  490

Query  99    R  97
             R
Sbjct  491   R  491



>emb|CDX72695.1| BnaC07g47170D [Brassica napus]
Length=510

 Score =   362 bits (929),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 201/480 (42%), Positives = 289/480 (60%), Gaps = 14/480 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP +GMLP L+    R++DF TE L+     +  KGP     DML T DPANI +I +
Sbjct  34    TNWPFLGMLPGLILEIPRVYDFITEVLEHGNLNYLFKGPFLGGLDMLFTVDPANIHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF+NYPKG  F+K+F++ GDGI N DSELW   RK+  ++M +  F+     T    +E
Sbjct  94    SNFSNYPKGAEFKKLFDVLGDGIFNVDSELWKDLRKSAQSMMMNPEFQSFSIATSLSKLE  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LDH A+     DL++IF+R +FD  F +    +PG L V  P +  F +A+ DA
Sbjct  154   KGLVPLLDHVAKEKLVVDLEDIFQRFTFDTTFVLATGYDPGCLSVGMP-EIEFARALDDA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDS  793
               AI Y+H+ PE  WK+Q+  FG+  E K   A +  D+  +  +S K +++  +  ++ 
Sbjct  213   EEAIFYRHVKPEMVWKMQR-LFGLGDELKLKRAHNILDRACFKCISSKRDEI-SRGTNNI  270

Query  792   QNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
              +  +LTS++     K         +FLRDT V   +  G  TT SALTW FWLL KN  
Sbjct  271   GSKDLLTSYLNVDTTKYKLLNPNDDRFLRDT-VLSFMLAGRDTTGSALTWFFWLLCKNEE  329

Query  633   VEAKLFNEILK-VKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
                K+  EI K + P+       +F  +E   LVYLH A CE+LRL+PP+P  HK   +T
Sbjct  330   AITKILQEINKNISPRTKTDDYGSFNPQELKKLVYLHGAICEALRLYPPVPFQHKSPTKT  389

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGHKV   ++IL   YS+GRM+++WGED +EFKPERW+++ G  + H PS KF  F
Sbjct  390   DVLPSGHKVDAGSKILFCLYSLGRMKSVWGEDALEFKPERWITENGTSV-HEPSYKFLSF  448

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+++  M  K VA  II  Y+ +++E H  V P+ +++L +KHG+KV ++KR
Sbjct  449   NAGPRTCLGKEVAMMQMKTVAVKIIQNYNIKVVEGHK-VEPAPSIILHMKHGLKVTVSKR  507



>ref|NP_194944.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
 emb|CAA16973.1| cytochrome p450 - like protein [Arabidopsis thaliana]
 emb|CAA16572.1| cytochrome P450-like protein [Arabidopsis thaliana]
 emb|CAB79935.1| cytochrome p450-like protein [Arabidopsis thaliana]
 gb|AEE86013.1| cytochrome P450, family 96, subfamily A, polypeptide 2 [Arabidopsis 
thaliana]
Length=506

 Score =   362 bits (928),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 200/482 (41%), Positives = 289/482 (60%), Gaps = 19/482 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+ MLPA+L+  HR++D++ + L+ +  TF  KGP F   DMLLT DPANI +I 
Sbjct  32    PRNWPVLRMLPAMLKALHRIYDYSVKILETSDLTFPFKGPRFTGMDMLLTVDPANIHHIM  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG  FQ +F++ GD  + TDSELW   RK+  A+++   F+     T+   +
Sbjct  92    SSNFSNYIKGPEFQDVFDVLGDSFITTDSELWKNMRKSYQAMLHSQEFQRFSMSTMTSKL  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             + GL P+L+H+A+ GT  DLQ +F R +FD  F +    +P SL +E P D  F KA+ D
Sbjct  152   KYGLVPLLNHFAEEGTTLDLQSVFGRFTFDTIFILVTGSDPRSLSIEMPEDE-FAKALDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDED  799
                 ILY+H  P   WKLQ W  G  +EKK  EA  TFD+     +S K  ++   Q   
Sbjct  211   VGEGILYRHFKPRFLWKLQNW-IGFGQEKKLTEANATFDRVCAKYISAKREEIKRSQGTS  269

Query  798   DSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             +  +  +LTS +K    K         +FLRD  +   I  G  TT++AL+W FWLL++N
Sbjct  270   NGGSQDLLTSFIKLDTTKYKLLNPSDDKFLRDN-ILAFILAGRDTTATALSWFFWLLSEN  328

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCD-LVYLHAAFCESLRLFPPIPMNHKMSL  463
             P V AK+  EI       +   + T   +E  D LVYLH A CE++RL+PP+    K  +
Sbjct  329   PHVVAKIHQEI-----NINTDLSRTGNSQENVDKLVYLHGALCEAMRLYPPVSFGRKSPI  383

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             ++D LPSGHKV   ++I+   Y++GRM A+WGED  +FKPERW+S+  GGIKH PS KF 
Sbjct  384   KSDVLPSGHKVDANSKIIICLYALGRMRAVWGEDASQFKPERWISE-NGGIKHEPSFKFL  442

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+ +     KIVA  I+  Y  ++++    +VP+   +L +KHG+++ +T
Sbjct  443   SFNAGPRTCLGKHLAMTQMKIVAVEILRNYDIKVLQGQK-IVPALGFILSMKHGLQITVT  501

Query  102   KR  97
             KR
Sbjct  502   KR  503



>ref|XP_004166589.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=507

 Score =   362 bits (928),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 197/478 (41%), Positives = 297/478 (62%), Gaps = 10/478 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P N P  GM   +L+N HR+ D  T  L+ +  TF  KG  FA+ D   TSDP+NI +I 
Sbjct  33    PWNLPFFGMTLTILRNLHRIQDHFTHILRLSSFTFFFKGAWFADLDFYFTSDPSNIHHIL  92

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF  YPKG  F+ +FEI GDGI N+DS++W   RKT ++L++   +   +E+   + V
Sbjct  93    STNFERYPKGPDFKYIFEILGDGIFNSDSDVWKSLRKTAHSLVHDHKYVQFVEKITLKKV  152

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL PVLD   + G+  DLQ++F+R SFD         +  SL +E P + PF KA+ +
Sbjct  153   KAGLVPVLDSVCENGSVLDLQDLFQRFSFDSTCMFVTGFDLQSLSLELP-EVPFSKAMDE  211

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK----LNQLHDQ  808
             A   I  +H +P++ WK Q     I    +  +AW+T D+ I  +++ K     NQ+ ++
Sbjct  212   AEEVIFLRHFIPKKIWKFQN-KLQIGPPTRLKQAWETIDETIGKLIASKRESLRNQMKEE  270

Query  807   DEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVE  628
              ++  +   ++TS++     K  +FLRDT V   +  G  T SSAL+W F+ L+ NP V 
Sbjct  271   GDEQREGVDLITSYITNDTNKDDKFLRDT-VLNFMIAGRDTLSSALSWFFFCLSNNPTVV  329

Query  627   AKLFNEILKVKPQNHAK-QTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
              K+  E+    P + ++ Q   F ++E   LVY H A+CE+LRL+PP+P  HK++++ DT
Sbjct  330   EKIREELKTAIPADESRDQWRIFSIDELKKLVYFHGAWCEALRLYPPVPFQHKVAMQHDT  389

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH +KPKT+I+ S Y++GRM  +WG+DC+EFKPERW+S+  G IKHVPS KF  F+ 
Sbjct  390   LPSGHHIKPKTKIVFSLYALGRMSEVWGKDCLEFKPERWISE-KGSIKHVPSYKFLAFNA  448

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPRTC+G+++ F   K+VAA++I  Y+      H  VVP+ +++L +KHG KVK+TKR
Sbjct  449   GPRTCLGKEVAFTEMKLVAAAMIHNYNITQQIGHK-VVPNPSIILHMKHGFKVKVTKR  505



>gb|KGN48435.1| hypothetical protein Csa_6G487560 [Cucumis sativus]
Length=507

 Score =   361 bits (927),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 197/478 (41%), Positives = 297/478 (62%), Gaps = 10/478 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P N P  GM   +L+N HR+ D  T  L+ +  TF  KG  FA+ D   TSDP+NI +I 
Sbjct  33    PWNLPFFGMTLTILRNLHRIQDHFTHILRLSSFTFFFKGAWFADLDFYFTSDPSNIHHIL  92

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF  YPKG  F+ +FEI GDGI N+DS++W   RKT ++L++   +   +E+   + V
Sbjct  93    STNFERYPKGPDFKYIFEILGDGIFNSDSDVWKSLRKTAHSLVHDHKYVQFVEKITLKKV  152

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL PVLD   + G+  DLQ++F+R SFD         +  SL +E P + PF KA+ +
Sbjct  153   KAGLVPVLDSVCENGSVLDLQDLFQRFSFDSTCMFVTGFDLQSLSLEFP-EVPFSKAMDE  211

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK----LNQLHDQ  808
             A   I  +H +P++ WK Q     I    +  +AW+T D+ I  +++ K     NQ+ ++
Sbjct  212   AEEVIFLRHFIPKKIWKFQN-KLQIGPPTRLKQAWETIDETIGKLIASKRESLRNQMKEE  270

Query  807   DEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVE  628
              ++  +   ++TS++     K  +FLRDT V   +  G  T SSAL+W F+ L+ NP V 
Sbjct  271   GDEQREGVDLITSYITNDTNKDDKFLRDT-VLNFMIAGRDTLSSALSWFFFCLSNNPTVV  329

Query  627   AKLFNEILKVKPQNHAK-QTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
              K+  E+    P + ++ Q   F ++E   LVY H A+CE+LRL+PP+P  HK++++ DT
Sbjct  330   EKIREELKTAIPADESRDQWRIFSIDELKKLVYFHGAWCEALRLYPPVPFQHKVAMQHDT  389

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH +KPKT+I+ S Y++GRM  +WG+DC+EFKPERW+S+  G IKHVPS KF  F+ 
Sbjct  390   LPSGHHIKPKTKIVFSLYALGRMSEVWGKDCLEFKPERWISE-KGSIKHVPSYKFLAFNA  448

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPRTC+G+++ F   K+VAA++I  Y+      H  VVP+ +++L +KHG KVK+TKR
Sbjct  449   GPRTCLGKEVAFTEMKLVAAAMIHNYNITQQIGHK-VVPNPSIILHMKHGFKVKVTKR  505



>ref|XP_004151610.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
 gb|KGN48431.1| hypothetical protein Csa_6G487520 [Cucumis sativus]
Length=521

 Score =   362 bits (928),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 196/480 (41%), Positives = 292/480 (61%), Gaps = 14/480 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GM P ++ + HR+HD  TE +++ G T+  KG  F+  D+L T D +NI++I 
Sbjct  46    PWNWPILGMTPTVIAHIHRVHDRLTEVIQEVGSTYLFKGVWFSGMDLLFTVDTSNINHIL  105

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF  YPKG  F+ +F+I GDGI N+DS++W   RKT  AL++   +   LE    + V
Sbjct  106   SVNFERYPKGPDFKYIFDILGDGIFNSDSDVWRALRKTAYALVHDHKYLKFLETITLKKV  165

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             +  L P+L   ++ G+  D Q++F+RLSFD+   +    +  SL +     H F KAI D
Sbjct  166   KEELVPILQTVSENGSVLDFQDLFQRLSFDVTCMLVTGSDLHSLSL--GFRHLFSKAIDD  223

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ----  808
                 IL +H  P++ W+LQK    I +  K  +AW+  D+ I  +++ K   L +Q    
Sbjct  224   VEEVILLRHFYPKKLWELQK-KLQIGQPVKLKQAWEIIDENISTLIASKRESLKNQMKEK  282

Query  807   --DEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
                +DD +   ++TS++     K  +FLRDT V   +  G    S+ L+W+F+ L+ NP+
Sbjct  283   EGGDDDEEGADLITSYITNM-NKDDKFLRDT-VLNFMIAGRDGLSATLSWIFFCLSNNPI  340

Query  633   VEAKLFNEILKVKPQNH-AKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
             V  K+  E+    P +    Q   F  EE   LVYLHA   E+LRL+PP+P  HK+S+  
Sbjct  341   VVEKIREELRTTIPTSEPCDQWRIFSTEEVDKLVYLHATLYETLRLYPPLPFQHKVSVHH  400

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGH +KPKT+IL S Y++GRM  +WG+DC EFKPERW+S+  G IKHVPS KF  F
Sbjct  401   DVLPSGHHIKPKTKILFSLYALGRMSEVWGKDCFEFKPERWISE-NGKIKHVPSYKFLAF  459

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+++  +  KIVAA+II+ Y+      H  VVPS +++L +K G+KV++TKR
Sbjct  460   NAGPRTCLGKQVALIGVKIVAAAIIYNYNVIQQSGHE-VVPSSSIILHMKRGLKVRVTKR  518



>ref|XP_004160507.1| PREDICTED: cytochrome P450 86B1-like [Cucumis sativus]
Length=521

 Score =   361 bits (927),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 197/480 (41%), Positives = 294/480 (61%), Gaps = 14/480 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GM P ++ + HR+HD  TE +++ G T+  KG  F+  D+L T D +NI++I 
Sbjct  46    PWNWPILGMTPTVIAHIHRVHDRLTEVIQEVGSTYLFKGVWFSGMDLLFTVDTSNINHIL  105

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF  YPKG  F+ +F+I GDGI N+DS++W   RKT  AL++   +   LE    + V
Sbjct  106   SVNFERYPKGPDFKYIFDILGDGIFNSDSDVWRALRKTAYALVHDHKYLKFLETITLKKV  165

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
                L P+L   ++ G+  D Q++F+RLSFD+   +    +  SL +     H F KAI D
Sbjct  166   TEELVPILQTVSENGSVLDFQDLFQRLSFDVTCMLVTGSDLHSLSL--GFRHLFSKAIDD  223

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL----NQLHDQ  808
                 IL +H  P++ W+LQK    I +  K  +AW+  D+ I  +++ K     NQ+ D+
Sbjct  224   VEEVILLRHFYPKKLWELQK-KLQIGQPVKLKQAWEIIDENISTLIASKRESLKNQMKDK  282

Query  807   D--EDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
             +  +DD +   ++TS++     K  +FLRDT V   +  G    S+ L+W+F+ L+ NP+
Sbjct  283   EGGDDDEEGADLITSYITNM-NKDDKFLRDT-VLNFMIAGRDGLSATLSWIFFCLSNNPI  340

Query  633   VEAKLFNEILKVKPQNH-AKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
             V  K+  E+    P +    Q   F  EE   LVYLHA   E+LRL+PP+P  HK+S+  
Sbjct  341   VVEKIREELRTTIPTSEPCDQWRIFSTEEVDKLVYLHATLYETLRLYPPLPFQHKVSVHH  400

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGH +KPKT+IL S Y++GRM  +WG+DC EFKPERW+S+  G IKHVPS KF  F
Sbjct  401   DVLPSGHHIKPKTKILFSLYALGRMSEVWGKDCFEFKPERWISE-NGKIKHVPSYKFLAF  459

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+++  +  KIVAA+II+ Y+      H  VVPS +++L +K G+KV++TKR
Sbjct  460   NAGPRTCLGKQVALIGVKIVAAAIIYNYNVIQQSGHE-VVPSSSIILHMKRGLKVRVTKR  518



>gb|KEH40835.1| cytochrome P450 family protein [Medicago truncatula]
Length=508

 Score =   361 bits (926),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 197/492 (40%), Positives = 301/492 (61%), Gaps = 16/492 (3%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W+++   S+ P N P+IGMLP+LL++  + HD+ T  LK+NGGTF  +G  F N   ++T
Sbjct  22    WRRNRYGSL-PINLPIIGMLPSLLRHLFKFHDYLTLILKRNGGTFRFEGAWFTNTSFIVT  80

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDP N+D+I  KNF NY +G++F+++F+ FGDGILN++S +W   R   ++ +    F+ 
Sbjct  81    SDPLNVDHIAGKNFGNYGRGSNFKEIFDFFGDGILNSNSNVWKQQRTMFHSFLKRKTFKN  140

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSL---FVE  1015
               ++T+ + +E+ L P LD  ++ G   DL++   R +FD    +    +P  L   F E
Sbjct  141   FFQQTMKKKLENYLLPFLDDVSEIGAQLDLEDALSRFTFDSICTIAFGFDPNCLPNKFNE  200

Query  1014  PPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS  835
               ++  ++KA+      I+Y+H +P   WKLQKW   + +EKK  EA +  D+F+Y  ++
Sbjct  201   -LTEIAYQKALTVIDEVIMYRHFIPSFLWKLQKWLH-VGQEKKLREAEENLDRFLYESIT  258

Query  834   ---EKLNQLHDQDEDDSQNFSMLTSHMKAYKGK---PMQFLRDTFVsltisggggttssa  673
                ++  + +  +E D   F    +  K   GK     +FLRD         G G  SS 
Sbjct  259   FSKQEQRKYNGSEEMDECYFVREKARTKEGYGKEEMSGKFLRDD-TLSLFLAGSGPASSG  317

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFP  493
             L+W FWL++ +P+VEAK+  EI    P     Q  + + E    LVYLH A CE+LRL+P
Sbjct  318   LSWFFWLVSTHPIVEAKIIQEIKDNCPTQEENQIPS-RDEYLDKLVYLHGAICEALRLYP  376

Query  492   PIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGG  313
             P+P  H  ++++D LPSG +V P TR+L S Y+MGRME IWGEDCMEFKPERW+S+  G 
Sbjct  377   PVPFEHICAIKSDILPSGERVSPNTRLLYSLYAMGRMEQIWGEDCMEFKPERWVSET-GH  435

Query  312   IKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLE  133
             I HVPS KF  F+ GPR+C+G+ + F+  K+VAA+++  +H +++E H  V P  + VL 
Sbjct  436   IIHVPSYKFIAFNTGPRSCLGKDLSFIQMKMVAAALLQNFHIKIVEGHP-VTPKISFVLH  494

Query  132   VKHGVKVKLTKR  97
             +K+G+KVK+TKR
Sbjct  495   MKYGLKVKVTKR  506



>ref|XP_002878579.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54838.1| CYP96A5 [Arabidopsis lyrata subsp. lyrata]
Length=510

 Score =   360 bits (925),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 191/483 (40%), Positives = 287/483 (59%), Gaps = 18/483 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP +L   H ++D+  E L+ +  TF  KGP F   +ML+T+DPANI ++ 
Sbjct  32    PRNWPVLGMLPGVLFMLHMINDYVAEILEVSNLTFAFKGPWFTGMNMLITADPANIQHVF  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
               NF+NY KG  F++MF+  G+GI   DS+LW+  RK+   +++H GF+    RT+ + +
Sbjct  92    CSNFSNYDKGPEFKEMFDFLGNGIFTADSKLWEDMRKSALVVLSHQGFQSFSLRTITRKI  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++GL PVLDH+++  T FDLQ++F+RL+FD+   +    +  SL +E P +  + KA+ D
Sbjct  152   KNGLVPVLDHFSEANTVFDLQDVFQRLAFDVTLTLVTGYDSSSLSIEMPKNE-YAKAMDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL---HDQD  805
             A   ++Y+H+ P   WKLQ W FG+ +EKK  +A   FD+     +S K  ++   H   
Sbjct  211   AEEVVVYRHVKPLILWKLQNW-FGLGQEKKMTKANAAFDRSCAKYISAKREEIISHHSNI  269

Query  804   EDDSQNFSMLTSHMKAYKGK-------PMQFLRDTFVsltisggggttssalTWLFWLLA  646
                ++   +L+ +M     K          FL+D  +   +  G    ++ LTW  WLL+
Sbjct  270   GGKAREEDLLSVYMNLDTSKYELLNPEDDNFLKD-IIKSFMLAGRDAIATTLTWFCWLLS  328

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             KNP    K+  EI      N      +   +    +VYLH A CESLRL+ PIP   K  
Sbjct  329   KNPEAVTKIRQEI----NTNLPGSGMSLDADMLNKMVYLHGALCESLRLYAPIPFERKTP  384

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             ++ D LPSGHKV    +IL S Y++GRM+A+WGED  EFKPERW+S+  GG+KH PS KF
Sbjct  385   IKQDVLPSGHKVDANWKILFSVYALGRMKAVWGEDACEFKPERWISERNGGLKHEPSFKF  444

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
              +F+ GPR C+G+ + F+  K VA  II  Y  +++E H  + P+ ++VL +KHG+KV +
Sbjct  445   FVFNSGPRNCLGKSLSFLQMKTVAIEIIRNYDIKVVEGHK-IEPASSIVLHMKHGLKVTV  503

Query  105   TKR  97
              KR
Sbjct  504   AKR  506



>ref|XP_006604019.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Glycine max]
Length=530

 Score =   361 bits (926),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 196/476 (41%), Positives = 287/476 (60%), Gaps = 12/476 (3%)
 Frame = -3

Query  1506  WPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKN  1327
             WP++GMLP +  N   + D+ T  LK+ GGTF  +GP  +N +++ TSDP N+ +I +  
Sbjct  33    WPILGMLPGVFLNMPTIFDYITSVLKREGGTFMFEGPCLSNMNIMFTSDPMNVQHITSTK  92

Query  1326  FNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESG  1147
             F NY KG  F+++FEI GDGI  +DS+LW+ +R   +++     F+  + +T+   +ES 
Sbjct  93    FQNYGKGNDFREIFEILGDGIFRSDSQLWNYNRTILHSVFRKASFQLFVHQTIMNKIESC  152

Query  1146  LFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVN  967
             L P LD   + G   DLQ++F+RL+FD    + L  +P  L +E P +    KA  +A +
Sbjct  153   LLPFLDRGWKEGMEVDLQDVFQRLTFDNICSIVLGFDPNCLSMEFP-EVACEKAFTEAED  211

Query  966   AILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED----  799
             A+LY+H  P+  WKL KW   + +EKK  E+    D+ +Y  +  K     + +      
Sbjct  212   ALLYRHFRPKCLWKLMKWLH-VGKEKKLEESQKIVDQMLYTEIRSKCKVQGESNNSSTPV  270

Query  798   DSQNFSMLTSHM-KAYKGKP-MQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
             D   FS+L   + +  KGK    FLRDT +   ++ G  T SS L+W FWL+A +P VE+
Sbjct  271   DESQFSLLNVLINEVGKGKADDNFLRDTAI-NLLAAGRDTISSGLSWFFWLVATHPSVES  329

Query  624   KLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLP  445
             K+  EI K  P       +   VE    L YLHAA  E+LRL+PPIP+ HK +L++D LP
Sbjct  330   KILEEIRKNLPAREGNW-KNLGVESISRLTYLHAAISEALRLYPPIPIEHKCALKSDMLP  388

Query  444   SGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGP  265
             SGH +   T IL S Y+MGR E IWGEDC++F PERW+S   GGI H+PS KF  F+ GP
Sbjct  389   SGHWINSNTMILYSLYTMGRAEEIWGEDCLKFIPERWISK-QGGIIHIPSYKFIAFNAGP  447

Query  264   RTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             R+C+G+ + +   K+VA SI+  YH  L+E HT + P  ++VL +KHG+KV++TKR
Sbjct  448   RSCLGKDISYTEMKMVAVSILSNYHVHLVEGHT-ISPGVSIVLHMKHGLKVRVTKR  502



>ref|XP_008440139.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Cucumis melo]
Length=510

 Score =   360 bits (924),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 201/490 (41%), Positives = 296/490 (60%), Gaps = 12/490 (2%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             IW+++   ++ P NWP+IGM P+++ + +R HD  TE +++ G TF  KG  F+  D LL
Sbjct  26    IWRRNFHGAV-PWNWPIIGMTPSVVTHFYRSHDRITEVIQEAGSTFFFKGVWFSGMDFLL  84

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T DP+NI +I + NF  YPKG  F+ +FE+ GDGI N+DS  W   RKT  +L++   F 
Sbjct  85    TVDPSNIHHILSANFERYPKGPDFKYIFEVLGDGIFNSDSYAWKDQRKTARSLVHDENFL  144

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
               LE+   + V++ L PVL    + G+  DLQ++F+R SFD    +    +  SL +E P
Sbjct  145   QFLEKITLKKVKTALVPVLQSVCENGSVLDLQDLFQRFSFDSTCMMVTGFDLQSLSLEFP  204

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
              + PF KA+ DA   I  +H  P++ W+ QK    I +  +  +AW+  D+ I  +++ K
Sbjct  205   -EVPFSKAMDDAEEVIFLRHFFPKKIWEFQK-KLQIGQPMRLKQAWEIIDETIAKLIALK  262

Query  828   LNQLHDQ-----DEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTW  664
                L +Q     DE  +    ++ S+M     K  +FLRDT V   +  G  T SSAL+W
Sbjct  263   RGSLKNQVNKEGDEQGAGGVDLIKSYMINNTNKDDKFLRDT-VLNFMIAGRDTLSSALSW  321

Query  663   LFWLLAKNPLVEAKLFNEILKVKPQNHA-KQTETFKVEECCDLVYLHAAFCESLRLFPPI  487
              F+ L+ NP V  K+  E+    P +    Q   F ++E   LVY H A CE+LRL+PP+
Sbjct  322   FFFCLSNNPTVIEKIREELKLTIPTDEPHDQWRIFSIDELKKLVYFHGALCEALRLYPPV  381

Query  486   PMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIK  307
             P  HK++ + D LPSGH +KPKT+I+ S Y++GR   +WG+DC+EFKPERW+S+  G IK
Sbjct  382   PFQHKVATQHDKLPSGHHIKPKTKIVFSLYALGRTSEVWGKDCLEFKPERWISE-KGSIK  440

Query  306   HVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVK  127
             HVPS KF  F+ GPRTC+G+++ F   KIVAA+II  Y+      H  VVP+ +++L +K
Sbjct  441   HVPSYKFLAFNAGPRTCLGKEVAFTEMKIVAATIIHNYNIIQQIGHK-VVPNPSIILHMK  499

Query  126   HGVKVKLTKR  97
             HG KV +TKR
Sbjct  500   HGFKVNVTKR  509



>gb|KFK33664.1| hypothetical protein AALP_AA5G043500 [Arabis alpina]
Length=511

 Score =   360 bits (924),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 201/484 (42%), Positives = 289/484 (60%), Gaps = 16/484 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +GMLP LL    R++DF TEFL+     F  KGP +   DML+T DPANI +I 
Sbjct  30    PTNWPFLGMLPGLLVEIPRVYDFVTEFLEDANLNFLFKGPFWGGLDMLVTVDPANIHHIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKGT F+K+F+I GDGI N DSELW+  RK+  ++M +  F+     T    +
Sbjct  90    SSNFANYPKGTEFKKLFDILGDGIFNADSELWNDLRKSAQSMMMNPKFQKFSLATSLSKL  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH A+     DL+++F+R +FD    +    +PG L VE P +  F +A+ D
Sbjct  150   EKGLLPLLDHVAKEKLVVDLEDVFQRFTFDTTCVLATGYDPGCLSVEMP-EIEFARALDD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
             A  AI ++H++PE  WK+Q+   G   E K   A  T D+     ++ + + +  + +  
Sbjct  209   AEEAIFFRHVMPELVWKMQR-LVGFGDELKLKRARATVDRVCSTYIASRRDMVSREIDSS  267

Query  795   SQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNP  637
             S    +LTS+M       K       +FLRDT +   +  G    SSALTW FWLL KN 
Sbjct  268   SPTQDLLTSYMNLDTTKYKLLNPSDDRFLRDT-ILTFMLAGRDPISSALTWFFWLLYKNQ  326

Query  636   LVEAKLFNEI----LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
              V AK+  EI     ++   + +  +E+F  +E   LVYLH A  E LRL+PP+P NHK 
Sbjct  327   DVIAKIRQEINTNLFQITKTDVSDDSESFNPQELKKLVYLHGAIYEVLRLYPPLPFNHKS  386

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
               +++ LPSGHKV   ++I+   YS+GRM+++WGED  EFKPERW+S+ G  I H PS K
Sbjct  387   PTKSEVLPSGHKVDANSKIVLCLYSLGRMKSVWGEDAFEFKPERWISETGKLI-HEPSYK  445

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++  M  K VA  II  Y  +++E    + P+ +++L +KHG+KV 
Sbjct  446   FLSFNAGPRTCLGKELAMMQIKTVAVKIIQNYEIKVVEGQK-IEPAPSVILHMKHGLKVT  504

Query  108   LTKR  97
             ++KR
Sbjct  505   VSKR  508



>ref|XP_006294031.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
 gb|EOA26929.1| hypothetical protein CARUB_v10023023mg [Capsella rubella]
Length=514

 Score =   360 bits (923),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 208/481 (43%), Positives = 298/481 (62%), Gaps = 14/481 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP++GMLP LL    R++D+ TE L+ +  T+ LKGP F   DML+T DPANI YI +
Sbjct  35    TNWPLLGMLPGLLVEIPRVYDYVTELLEASNLTYPLKGPCFGGLDMLVTIDPANIHYIMS  94

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF NYPKG+ F+K+F++ GDGI N DSELW   RK+T ++M+H  F+    RT    +E
Sbjct  95    SNFENYPKGSEFKKIFDVLGDGIFNADSELWKDLRKSTQSMMSHHDFQRFTLRTSMSKLE  154

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LD+ A++    DLQ++F+R +FD  F +    +PG L ++ P D  F +A+ +A
Sbjct  155   KGLVPLLDYVAEKKLVIDLQDVFQRFTFDTSFVLATGVDPGCLSIDLP-DIEFARALNEA  213

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDEDD  796
               AI ++H+ PE  WK+Q+W  GI  E K  +A  TFD+     ++ K +++       D
Sbjct  214   EEAIFFRHVKPEMVWKMQRW-IGIGDELKMKKAHSTFDRVCSKCIASKRDEITRGVINID  272

Query  795   SQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNP  637
             S +  +L S++       K       +FLRD  +   +  G  TT SALTW FWLL+KNP
Sbjct  273   SSSKDLLMSYINVDTTKYKLLNPSDEKFLRD-MILSFMLAGRDTTGSALTWFFWLLSKNP  331

Query  636   LVEAKLFNEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
                 K+  EI  K+ P+ +  + ++F  +E   LVYLH A  ESLRL+PP+P  HK   +
Sbjct  332   KAIIKIRQEINTKLTPRTNGSKFDSFNPQELNKLVYLHGALYESLRLYPPVPFQHKSPTK  391

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              D LPSGHKV   ++I+   YS+GRM+++WGED  EFKPERW+S+ G  I HVPS KF  
Sbjct  392   PDVLPSGHKVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWVSESGRLI-HVPSFKFLS  450

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC+G+++     K VA  II  Y  +++E H  V P  +++L +KHG+KV +TK
Sbjct  451   FNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIKVVEGHK-VEPVPSIILHMKHGLKVTVTK  509

Query  99    R  97
             R
Sbjct  510   R  510



>ref|XP_010437068.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=518

 Score =   359 bits (922),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 202/487 (41%), Positives = 289/487 (59%), Gaps = 20/487 (4%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP++GMLP LL    R++DF T+ L+     F  KGP     DML T DPANI +I +
Sbjct  34    TNWPILGMLPGLLPELPRVYDFITDVLEGGNLNFLFKGPTLGGLDMLFTVDPANIHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF NYPKGT F+K+F++ GDGI N DSELW   RK++ ++M+H  F+     T    +E
Sbjct  94    SNFANYPKGTEFKKLFDVLGDGIFNADSELWKDLRKSSQSMMSHPEFQKFSLATSLSKLE  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P +  F +A+ DA
Sbjct  154   KGLVPLLDHVAKEKLVVDLQDVFQRFTFDTTFVLATGYDPGCLSVEMP-EIEFARALDDA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDS  793
               AI Y+H+ PE  WK+Q+   G+  E K   A   FD+     ++ K +++    ++ S
Sbjct  213   EEAIFYRHLKPEMVWKMQR-LIGVGGELKLKRAHAVFDRVCSECIASKRDEISRGSDNIS  271

Query  792   QN---------FSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
              +          ++ T+  K       +FLRDT +   +  G  TT SALTW FWLL KN
Sbjct  272   SSSSKDLLMSFINVDTTKYKLLNPSDDRFLRDT-ILSFMLAGRDTTGSALTWFFWLLCKN  330

Query  639   PLVEAKLFNEI-LKVKPQNH-----AKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
                 A++  EI   + P N      +  +++F  +E   LVYLH A CESLRL+PP+P  
Sbjct  331   QEAVARIRQEINTNLLPGNKTDGSVSYDSDSFNPQEVKKLVYLHGAICESLRLYPPVPFQ  390

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
             HK   E D LPSGHKV   ++IL   YS+GRM+++WGED +EFKPERW+S+ G  + H P
Sbjct  391   HKSPTEPDVLPSGHKVDANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGRSL-HEP  449

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KF  F+ GPRTC+G+++     K VA  II  Y  +++E H  + P+ +++L +KHG+
Sbjct  450   SYKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEFQVVEGHK-IEPAPSVILHMKHGL  508

Query  117   KVKLTKR  97
             KV ++KR
Sbjct  509   KVTVSKR  515



>emb|CDY53179.1| BnaA06g40580D [Brassica napus]
Length=515

 Score =   359 bits (921),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 200/484 (41%), Positives = 289/484 (60%), Gaps = 17/484 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +G++P LL   HR++DF TE L+    T+  KGP +A  DML+T DP+NI +I 
Sbjct  33    PTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYFCKGPCYAGLDMLVTVDPSNIHHIM  92

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NYPKG  F+K+F++ GDGI N DSELW   RK+  ++M H  F+     T    +
Sbjct  93    SSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMHPEFQKFSLATSMSKL  152

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH A      +L+++F+R +FD    +    +PG L VE P +  F +A+ D
Sbjct  153   EKGLVPLLDHVANEKLVVNLEDVFQRFTFDTTCVLATGYDPGCLSVEMP-EIEFARALDD  211

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
             A  AI ++H+ PE  WK++  F G+  EKK  +A  TFD+     ++ K +++    +  
Sbjct  212   AEEAIFFRHVKPEILWKMES-FIGLGDEKKMTKARATFDRVCSKYIASKRDEVITNIDSP  270

Query  795   SQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKNP  637
               +  +LTS+M     K         +FLRDT +   +  G  TT S LTWLFWLL K P
Sbjct  271   PASQDLLTSYMNLETTKYKLLDPSDDRFLRDT-ILTFMLAGRDTTGSGLTWLFWLLLKFP  329

Query  636   LVEAKLFNEIL-----KVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
                 K+  EI      K K  +    +++F  +E   LVYLH A CE+LRL+PP+P  HK
Sbjct  330   EAMDKIRQEIKTVLSPKTKTDDDDDDSDSFNPQELKKLVYLHGAICEALRLYPPVPFQHK  389

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
                +TD LPSGHKV+  ++IL   YS+GRM+ +WGED +EFKPERW+S+ G  + H PS 
Sbjct  390   SPTKTDVLPSGHKVEANSKILFCLYSLGRMKTVWGEDALEFKPERWVSESGKSV-HEPSY  448

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTC+G+++     K VA  II  Y  +++E    + P+ +++L  KHG+KV
Sbjct  449   KFLSFNAGPRTCLGKEVALTQMKSVAVKIIQNYEIKMVEGQK-IEPAPSVILHTKHGLKV  507

Query  111   KLTK  100
              +TK
Sbjct  508   TVTK  511



>ref|XP_007134108.1| hypothetical protein PHAVU_010G019500g [Phaseolus vulgaris]
 gb|ESW06102.1| hypothetical protein PHAVU_010G019500g [Phaseolus vulgaris]
Length=504

 Score =   358 bits (920),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 193/483 (40%), Positives = 291/483 (60%), Gaps = 12/483 (2%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             R    TNWPV+GMLP LL N   + D+ T  LK +GG F  KGP  +N ++  TSDP N+
Sbjct  26    RHAQITNWPVLGMLPGLLLNVSIIFDYLTMLLKHHGGNFMFKGPWLSNMNVFFTSDPMNV  85

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              +I +  F NY KG  F+++FE+ GDGI  +DS+LW  +R   ++    + F+  + +T+
Sbjct  86    QHITSTKFENYGKGDDFREIFEVLGDGIFRSDSQLWKYNRSILHSTFKQVSFQLFIHKTI  145

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
                +ES L P LDH  ++G   DLQE F+RL+FD+   + L  +P  L ++ P +    +
Sbjct  146   NNKIESCLLPFLDHACKQGMEVDLQEAFQRLTFDVICSIVLGFDPTCLSIDFP-EVACER  204

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL----NQ  820
             A  +   A+LY+H+LP   WKL  W   + +E+K  E  +  DK +Y  ++ K       
Sbjct  205   AFTEYEEALLYRHVLPRCLWKLLHW-LQLGKERKTKENQEIVDKMLYKEIASKSKVQGQS  263

Query  819   LHDQDEDDSQNFSMLTSHM-KAYKGK-PMQFLRDTFVsltisggggttssalTWLFWLLA  646
             + +   ++   FS+L   + +  KGK   +FLRDT +   ++ G  T S+ LTW FWL+A
Sbjct  264   IGNSTPEEEPRFSLLDVLISEVGKGKLDDKFLRDTAI-NLLAAGRDTISACLTWFFWLVA  322

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
              +P VE+K+  EI +  P       +   VE    L YLHAA  E+LRL+PP+P+ HK +
Sbjct  323   THPSVESKILEEIREKLPAREGNGKD-LGVEWLSQLTYLHAAISETLRLYPPVPLEHKCA  381

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             L++D LPSGH +K    I+ S YSMGR E IWGEDC++F+PERW+S+   GI H+PS KF
Sbjct  382   LKSDFLPSGHFIKSNAMIVYSLYSMGRAEEIWGEDCLKFRPERWISN-RRGIIHIPSYKF  440

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPR+C+G+ + +   K++AA+I++ Y  +L+E    + P  ++VL +KHG+KV L
Sbjct  441   IAFNAGPRSCLGKDISYTEIKMIAAAILWNYRIQLVEGQA-ISPGVSVVLHMKHGLKVTL  499

Query  105   TKR  97
             TKR
Sbjct  500   TKR  502



>ref|XP_010447431.1| PREDICTED: cytochrome P450 86B1 [Camelina sativa]
Length=508

 Score =   358 bits (920),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 197/482 (41%), Positives = 288/482 (60%), Gaps = 21/482 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+ MLPALL+  HR++D++ + L+ +  TF  +GP FA  DML+T DPANI +I   
Sbjct  34    NWPVLRMLPALLRALHRIYDYSVKILEISNLTFPFEGPQFAGMDMLVTVDPANIHHIMTS  93

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF NY KG  FQ +F++FGDGI+ TD ELW   RK+  A+++   F+     T+ + ++ 
Sbjct  94    NFTNYIKGPAFQDVFDVFGDGIITTDLELWKTLRKSYQAILHRQEFQRFSMSTMTRKLKD  153

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+LDH+A++GT  DLQ++F R +FD    +    +P SL VE P D  F KA+ D  
Sbjct  154   GLVPLLDHFAEKGTTVDLQDVFGRFTFDTILILATGSDPRSLSVEMPEDE-FAKALDDVG  212

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ----DE  802
               ILY+H+ P   WKLQ W  G+  EKK  +A   FD+     +S K  ++       D+
Sbjct  213   EGILYRHVKPRFLWKLQNW-VGLGEEKKMTKANAIFDRVCAKYISGKREEMKRSQGVIDK  271

Query  801   DDSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAK  643
              + ++  +LTS +K    K         +FLRD  +   I  G  TT+SAL+W FWLL++
Sbjct  272   SNVESEDILTSFIKLDTTKYKLLNTSDDKFLRDN-ILTFILAGRDTTASALSWFFWLLSE  330

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             NP V AK+  E++           E         LVYLH A CE+LRL+PP+    K  +
Sbjct  331   NPKVVAKIRQEVINTDLSRTGNSQENLD-----KLVYLHGALCEALRLYPPVCFGRKSPI  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             ++D LPSGHKV   + I+   Y++GRM A+WGED ++FKPERW+++  GG+KH PS KF 
Sbjct  386   KSDVLPSGHKVDANSNIVICLYALGRMRAVWGEDALQFKPERWITE-NGGMKHEPSFKFL  444

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+ +     KIVA  I+  Y  +++E    + P   ++L +KHG+++ +T
Sbjct  445   SFNAGPRTCLGKHIALNQMKIVAVEILQNYDIKVVEGQK-IEPVLGIILSMKHGLRITVT  503

Query  102   KR  97
             KR
Sbjct  504   KR  505



>gb|KFK32856.1| hypothetical protein AALP_AA6G295800 [Arabis alpina]
Length=509

 Score =   358 bits (920),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 195/483 (40%), Positives = 293/483 (61%), Gaps = 19/483 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++GMLP +L   HR++D+  E L+ +  TF  KGP F+  +ML+T+DPANI ++ 
Sbjct  32    PRNWPILGMLPGVLVVFHRINDYVAEALEVSNMTFAFKGPWFSGMNMLVTADPANIQHVF  91

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF++Y KG+ F+++F+  G+GI   DS+LW+  RK+   +++H GF+    RT    +
Sbjct  92    SSNFSSYDKGSEFKEIFDFLGEGIFTADSKLWEELRKSALVMLSHQGFQSFSFRTFTSKI  151

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             ++ L PVLDH+A+  T FDLQ +F+RL+FD+   +    N  SL +E P ++ + KA+ D
Sbjct  152   KNRLIPVLDHFAEANTVFDLQGVFQRLAFDVTLTLVTGYNSNSLSIEMP-ENDYAKAMDD  210

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPIL---SEKLNQLHDQD  805
             A   I+Y+H  P  FWKLQ W  G+  EKK  +A   F++     +    E++ +  D +
Sbjct  211   AEEVIVYRHAKPMIFWKLQNW-IGLGEEKKMKKANAVFNRLCAEYIFSKREEIQRRQDSN  269

Query  804   EDDSQNFSMLTSHMK--AYKGKPMQFLRDTF----VsltisggggttssalTWLFWLLAK  643
             E+++Q+  +L+ +MK    K K M    D F    +   +  G    +S LTW FWLL+K
Sbjct  270   EEEAQDEDILSFYMKLDTSKYKLMNPNDDNFLKGIIKSFMLAGRDAIASTLTWFFWLLSK  329

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             NP    K+  EI     +N  +  ++   E    +VYLH A CESLRL+ PIP   K  +
Sbjct  330   NPEAVTKIRQEI----NENLPRSGKSLNPEMLNKMVYLHGALCESLRLYAPIPFERKSPI  385

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV    +I+ + Y++GRM A+WGED  EFKPERW+S+  GG+KH PS KF 
Sbjct  386   KQDVLPSGHKVDTNWKIVFAVYALGRMRAVWGEDASEFKPERWISE-NGGLKHEPSFKFF  444

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTL-VVPSDTLVLEVKHGVKVKL  106
             +F+ GPR C+G+ + F+  K VA  II  Y   ++E H +  VPS  +VL +KHG+K  +
Sbjct  445   VFNSGPRNCLGKNLSFLQMKTVAIEIIQNYDIRVVEGHKIEQVPS--MVLHMKHGLKATV  502

Query  105   TKR  97
              KR
Sbjct  503   AKR  505



>ref|XP_009389287.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=528

 Score =   358 bits (920),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 199/494 (40%), Positives = 298/494 (60%), Gaps = 28/494 (6%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             RS  P NWPV+GMLPALL N HRLHD+ T+ L++ G +F  +GP F   + LLT DPAN+
Sbjct  44    RSRIPVNWPVVGMLPALLVNLHRLHDWGTDVLREAGCSFWFRGPWFLGMNHLLTCDPANV  103

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              ++   NF+NYPKG  F ++F+I GDGI N+D + W   R   +++M+   FR  +  + 
Sbjct  104   HHVFGANFSNYPKGEAFLEIFDILGDGIFNSDEQSWKEQRTKAHSIMSGRRFRTFVADSA  163

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
                VE GL P++ H AQRG   DLQ++F RL+FD    +    +P  L VE P+  PF +
Sbjct  164   RSKVEKGLLPLIHHIAQRGVAVDLQDVFLRLTFDTTCNLVFGVDPRCLSVEFPT-IPFAR  222

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ  808
             A+ DA+ A+L +  +P  +WKL +W   +  EKK A AW   D FI   ++EK       
Sbjct  223   AMDDAMAALLTRQTVPPAWWKLMRW-LRVGEEKKLAMAWKEVDHFIAEHIAEKKRSGEAN  281

Query  807   DEDDSQNFSMLTSHM--------KAYKGKPM----QFLRDTFVsltisggggttssalTW  664
             D+       ML++++        +A  GK      +FLRDT V   +  G  TT +ALTW
Sbjct  282   DD-------MLSAYINDNDDDNDRAMDGKRSTEFDKFLRDTAV-NFMLAGRDTTGAALTW  333

Query  663   LFWLLAKNPLVEAKLFNEILKV----KPQNHAKQTETFKVEECCDLVYLHAAFCESLRLF  496
              FWLL++NP+VEAK+  E+ +     K +  + +   F  +E   +VYLHAA CESLR F
Sbjct  334   FFWLLSQNPMVEAKILKELEEATSLRKERPSSDELIVFGTDELGKMVYLHAALCESLRFF  393

Query  495   PPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGG  316
             PP+P  HK  L+++ LPSGH+V   T+IL S Y+MGRME +WG D  E +PERW+S+  G
Sbjct  394   PPVPFEHKSVLQSEVLPSGHRVGQGTKILVSAYAMGRMEGVWGGDWAEVRPERWISE-KG  452

Query  315   GIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVL  136
              +++ PS KF  F+ GPR C+G+ + F   K V A++++ +H E++    +  P  +++L
Sbjct  453   RMRYEPSYKFLAFNSGPRACLGKDVAFAQMKTVVAAMVYNFHVEVLR-GPVAAPKLSIIL  511

Query  135   EVKHGVKVKLTKRK  94
             ++K+G+  ++ +R+
Sbjct  512   QMKNGLMARIERRR  525



>gb|KEH24773.1| cytochrome P450 family protein [Medicago truncatula]
Length=517

 Score =   358 bits (919),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 204/488 (42%), Positives = 291/488 (60%), Gaps = 23/488 (5%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP +GMLP  L N  ++HDF+ + LK  GGT E  GP F     ++T+DP N+ YI +
Sbjct  35    TNWPFLGMLPQFLWNISQIHDFSAKLLKSKGGTIEFLGPWFTGMYGVITTDPLNVHYIMS  94

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
             K+F+N+ KG  F++MFE FG GI  TDS+ W  +R     L     F    E+ +   VE
Sbjct  95    KSFDNFVKGDLFREMFEPFGLGIFTTDSDQWKYNRNLLQYLFKQRSFEAFQEKIIHNKVE  154

Query  1152  SGLFPVLDHY-AQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
               L P+L+H   Q+G+  DLQ++F R +FD    + L  +P  L  + P + P  KA   
Sbjct  155   KSLIPILNHVLQQKGSVVDLQDVFNRFTFDNICLIILGHDPNCLSTDFP-EVPSEKAFNQ  213

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH------  814
             A  +I Y+H +P   WKLQ W   I  EKK  EA   FD+F++  ++ K  +L       
Sbjct  214   AEESIFYRHTVPICVWKLQSW-LQIGEEKKMTEACKVFDQFLFSCIASKREELKKNCNKN  272

Query  813   --DQDEDDSQNFSMLTSHMKAYKGKPMQ-------FLRDTFVsltisggggttssalTWL  661
               + + DD+ +  MLT+ ++  K K  +       FLRD         G  T +SALTWL
Sbjct  273   EINAESDDAHHVDMLTALIREEKNKGSESEALGDKFLRDA-AFNLFVAGRDTITSALTWL  331

Query  660   FWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPM  481
             F+L+A +PLVEAK+  EI   +   + ++     V++   LVYLH A CE+LRLFPPIP 
Sbjct  332   FYLVATHPLVEAKILEEI--KENFGYKEKPWILSVDDVKKLVYLHGAICEALRLFPPIPF  389

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
               K +++ D LPSGH V P   IL S Y+MGR E IWG+DC+EFKPERW+S+  GGI + 
Sbjct  390   ERKEAVKPDILPSGHHVYPNNMILFSLYAMGRDENIWGKDCLEFKPERWISE-RGGIVYA  448

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             PS KF  F+ GPRTC+G+++ F+  K+VAAS+++ Y   ++E H  V P+ ++VL ++HG
Sbjct  449   PSYKFFSFNAGPRTCLGRELAFIQVKMVAASVLWNYCVHVVEDHQ-VTPNLSIVLLMEHG  507

Query  120   VKVKLTKR  97
             +KVK+TKR
Sbjct  508   LKVKITKR  515



>ref|XP_009101870.1| PREDICTED: cytochrome P450 86B1 [Brassica rapa]
Length=515

 Score =   357 bits (917),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 200/484 (41%), Positives = 288/484 (60%), Gaps = 17/484 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP +G++P LL   HR++DF TE L+    T+  KGP +A  DML+T DP+NI +I 
Sbjct  33    PTNWPFLGVIPGLLVEIHRVYDFITEILEVTNLTYFCKGPCYAGLDMLVTVDPSNIHHIM  92

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NYPKG  F+K+F++ GDGI N DSELW   RK+  ++M H  F+     T    +
Sbjct  93    SSNFSNYPKGPEFKKLFDVLGDGIFNADSELWKDLRKSAQSMMMHPEFQKFSLATSMSKL  152

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH A      +L ++F+R +FD    +    +PG L VE P +  F +A+ D
Sbjct  153   EKGLVPLLDHAANEKLVVNLGDVFQRFTFDTTCVLATGYDPGCLSVEMP-EIEFARALDD  211

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
             A  AI ++H+ PE  WK++  F G+  EKK  +A  TFD+     ++ K +++    +  
Sbjct  212   AEEAIFFRHVKPEILWKMES-FIGLGDEKKMTKARATFDRVCSKYIASKRDEVITNIDSP  270

Query  795   SQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKNP  637
               +  +LTS+M     K         +FLRDT +   +  G  TT S LTWLFWLL K P
Sbjct  271   PASQDLLTSYMNLETTKYKLLDPSDDRFLRDT-ILTFMLAGRDTTGSGLTWLFWLLLKFP  329

Query  636   LVEAKLFNEIL-----KVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
                 K+  EI      K K  +    +++F  +E   LVYLH A CE+LRL+PP+P  HK
Sbjct  330   EAMDKIRQEIKTVLSPKTKTDDDDDDSDSFNPQELKKLVYLHGAICEALRLYPPVPFQHK  389

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
                +TD LPSGHKV+  ++IL   YS+GRM+ +WGED +EFKPERW+S+ G  + H PS 
Sbjct  390   SPTKTDVLPSGHKVEANSKILFCLYSLGRMKTVWGEDALEFKPERWVSESGKSV-HEPSY  448

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTC+G+++     K VA  II  Y  +++E    + P+ +++L  KHG+KV
Sbjct  449   KFLSFNAGPRTCLGKEVALTQMKSVAVKIIQNYEIKMVEGQK-IEPAPSVILHTKHGLKV  507

Query  111   KLTK  100
              +TK
Sbjct  508   TVTK  511



>ref|XP_006283561.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
 gb|EOA16459.1| hypothetical protein CARUB_v10004619mg [Capsella rubella]
Length=506

 Score =   357 bits (916),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 198/483 (41%), Positives = 292/483 (60%), Gaps = 23/483 (5%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+ MLPAL    HR++D++ + L+ +  TF  KGP FA  DML+T DPANI +I   
Sbjct  34    NWPVLRMLPALHMALHRIYDYSVKILEISNMTFPFKGPRFAGMDMLITVDPANIHHIMTS  93

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+NY KG  FQ +F++FGDGI+ TDSELW   RK+  A+++   F+     T+ + ++ 
Sbjct  94    NFSNYIKGPAFQDVFDVFGDGIITTDSELWKNLRKSYQAMIHRQEFQRFSMSTMTRKLKD  153

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             G+ P+LDH+A++GT  DLQ++F R +FD    +    +P SL +E P D    KA+ D  
Sbjct  154   GIVPLLDHFAEKGTSVDLQDVFGRFTFDTILILITGYDPRSLSIEMPEDE-LAKALDDVG  212

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ----DE  802
               ILY+H+ P   WKLQ W  G   EKK   A  TFD+     +S K  ++       D 
Sbjct  213   EGILYRHVKPRFLWKLQNW-VGFGEEKKMTRANATFDRVCAKYISAKREEIKRSQVVTDI  271

Query  801   DDSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAK  643
               +++  +LTS +K    K         +FLRDT +   I  G  TT+SAL+W FWLL++
Sbjct  272   SVAESGDLLTSFIKLNTTKYKLLNPSDDKFLRDT-ILTLILAGRDTTASALSWFFWLLSE  330

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCD-LVYLHAAFCESLRLFPPIPMNHKMS  466
             NP V AK+  E +      +   + T   +E  D LVYLH A CE++RL+PP+    K  
Sbjct  331   NPKVVAKIRQEAI------NTDISRTGNGQEHLDKLVYLHGALCEAVRLYPPVCFGRKSP  384

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             +++D LPSGHKV   ++I+   Y++GRM A+WGED ++FKPERW+++  GGIKH PS KF
Sbjct  385   IKSDVLPSGHKVDANSKIIICLYALGRMRAVWGEDALQFKPERWITE-NGGIKHEPSFKF  443

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+ +     KIVA  I+  Y  ++++    + P+  ++L +KHG+++ +
Sbjct  444   LSFNAGPRTCLGKHIAMAQMKIVAVEILQNYDIKVVQGQK-IEPALGIILSMKHGLRITV  502

Query  105   TKR  97
             TKR
Sbjct  503   TKR  505



>ref|XP_011005604.1| PREDICTED: cytochrome P450 86B1-like [Populus euphratica]
Length=508

 Score =   357 bits (916),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 192/485 (40%), Positives = 291/485 (60%), Gaps = 21/485 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+GMLP L +N+ R+H+F T  L+Q GGTF  KGP F   D L+TS+PAN+ +I  K
Sbjct  28    NWPVVGMLPGLFRNSSRVHEFVTYLLQQRGGTFVFKGPWFGGLDFLVTSNPANVHHILRK  87

Query  1329  NFNNYPKGTHFQKMF-EIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
                NY KG   +++F E FG+GI   D + W   R+T ++ + +  F  ++ER + + V 
Sbjct  88    KAFNYHKGLELKEIFAESFGNGIFCADGDRWKTQRRTIHSFIKNSKFEEAVERNIQRKVL  147

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              G+F +L+H++++    D+Q++ KR  FD    + L  +P SL +E P   P+ +A  D 
Sbjct  148   HGIFVILEHFSEQRKEVDMQDVLKRFMFDYSCLLLLGFDPNSLSIEFPQV-PYMQAYYDM  206

Query  972   VNAILYKHILPERFWKLQKWF-FGIDREKKHAEAWDTFDKFIYPILSEKLNQLH-DQDED  799
                IL +H+ P+R WKLQ W  FG +R+ K++   + FD+ +Y  +S K + L+  + + 
Sbjct  207   EEIILQRHLKPQRLWKLQNWLQFGEERKMKNSS--EIFDRLLYQCISRKKDLLNRSKIQM  264

Query  798   DSQNFSMLT-----------SHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWL  652
             D ++F  LT             M A+K    ++ RD      +S G    SS LTW  WL
Sbjct  265   DREDFDFLTFMLVEDNDQEEREMSAFKNSE-KYARD-MAFNLLSAGSEAVSSGLTWFLWL  322

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             +A +PLVE  +  EI         ++   F   E  +L YL AA CESLRL+PP+P  H 
Sbjct  323   VATHPLVEKSILEEIKTNLNAKGDEKGRYFSFGELSELNYLQAAICESLRLYPPVPFEHT  382

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
             +S+++D LPSGH++   TR++   YSMGRME IWGEDC+EFKPERW+S+  G IKHV   
Sbjct  383   VSIDSDALPSGHRIGKNTRVIYCPYSMGRMEEIWGEDCLEFKPERWISNT-GEIKHVSPY  441

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPRTCIG+ +  +  K V A++I+ Y  +++E H  ++P++ ++L +KHG+ V
Sbjct  442   KFIAFNAGPRTCIGKDLALVEMKAVGAAVIWNYSLKVVEDHP-ILPANAIILHMKHGLMV  500

Query  111   KLTKR  97
             ++ KR
Sbjct  501   RVLKR  505



>ref|XP_007150926.1| hypothetical protein PHAVU_004G006300g [Phaseolus vulgaris]
 gb|ESW22920.1| hypothetical protein PHAVU_004G006300g [Phaseolus vulgaris]
Length=503

 Score =   357 bits (915),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 198/477 (42%), Positives = 294/477 (62%), Gaps = 14/477 (3%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             ++ ++GMLP LL N  R+HDF T+ LK+NGGT E KGP F   +  LT D  N+ ++ +K
Sbjct  34    DYFILGMLPPLLFNLWRIHDFITDVLKKNGGTGEFKGPWFTKMNYFLTCDSLNVQHMLSK  93

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
              F+NY KG  F+++FE FGDG++  DSE W   R   ++L+    F   +++TV + V +
Sbjct  94    RFDNYIKGPAFREIFEPFGDGVVTADSETWKYFRTVLHSLIRQRRFEVFVDQTVQKKVHT  153

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
              L P+LDH  Q G   DLQ+IF R +FD      +  +P  L ++ P +    +A  ++ 
Sbjct  154   SLLPILDHAEQEGRVVDLQDIFNRFTFDNMCSTIVGHDPQCLSLDFP-EVAIERAFNESE  212

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH--DQDEDD  796
              +I Y+HI+P   W+ QKW   I +EKK  EA  TFD+FIY  ++ K  ++    ++E +
Sbjct  213   ESIFYRHIVPRSVWRFQKW-LQIGQEKKMTEACRTFDEFIYSRIASKREEMSKCSREEME  271

Query  795   SQNFSMLTS-HMKAYKGKPM--QFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
                F ++++  M   +G+    +FLRD         G  T +SALTWLFWL+  +PLVE 
Sbjct  272   EAPFDLVSALMMTEERGRVHDDKFLRDA-AFNFFVAGRETMTSALTWLFWLIGNDPLVEG  330

Query  624   KLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLP  445
             K+  EI K K +N   + E   +EE   LVYLH A CE+LRLFPP+P+  K +++ DTLP
Sbjct  331   KIVEEI-KEKFRN---EKEVIGMEEVKKLVYLHGALCEALRLFPPVPIERKQAVKADTLP  386

Query  444   SGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGP  265
             SGH+V   T I+ S Y+MGR E IWG+DCMEFKPERW+S+  G I + P  KF  F+ GP
Sbjct  387   SGHRVNGNTMIMFSLYAMGRCEEIWGKDCMEFKPERWISE-RGEIVYAPPYKFIAFNAGP  445

Query  264   RTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK  94
             R C+G+ + F+  K+VAA+I+  Y  +++E H +  PS ++VL + +G+K  +TKR+
Sbjct  446   RICLGKDLAFLQMKMVAAAILRSYRFKVVEGH-VATPSHSIVLLMNNGLKATITKRQ  501



>ref|XP_006411750.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
 gb|ESQ53203.1| hypothetical protein EUTSA_v10024958mg [Eutrema salsugineum]
Length=509

 Score =   357 bits (916),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 199/484 (41%), Positives = 291/484 (60%), Gaps = 24/484 (5%)
 Frame = -3

Query  1509  NWPVIGMLPALLQN-AHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             NWPV+ MLP LL    +R++D++ + L+    TF  KGP FA  DML+T DPANI +I +
Sbjct  34    NWPVLRMLPGLLVALQYRIYDYSVKILEIFDLTFLFKGPPFAGMDMLVTVDPANIHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF+NY KG+ FQ +F++FGDGI+ TDSELW   RK+  A+++H  F+     T+   ++
Sbjct  94    SNFSNYIKGSDFQDVFDVFGDGIITTDSELWKNLRKSYQAMLHHQDFQRFSMSTMTSKLK  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+L+H+A+ GT  DLQ++F RL+FD    +    +P SL +E   D    KA+ D 
Sbjct  154   DGLLPLLNHFAEEGTIVDLQDVFGRLTFDTILILITGSDPKSLSIEMHEDE-LAKALNDV  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ----D  805
                + Y+H+ P+  WKLQ W  G+ +EKK  EA  TFD+     +S K  +++      D
Sbjct  213   GEGVFYRHVKPKFLWKLQNW-MGLGQEKKMIEASATFDRVCAKYISAKREEINSSQGILD  271

Query  804   EDDSQNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLA  646
               D     +LTS MK    K         +FLRDT +   I  G  TT+SAL+W FWLL+
Sbjct  272   TSDGVTEDLLTSFMKLDTTKYKLLNPSDDKFLRDT-ILAFILAGRDTTASALSWFFWLLS  330

Query  645   KNPLVEAKLFNEILKVK-PQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
             +NP V AK+  EI+    P+    Q      E    +VYLH A CE++RL+PP+    K 
Sbjct  331   ENPHVVAKIRQEIISTDLPRTGNGQ------ENLDKMVYLHGALCEAMRLYPPVAFERKS  384

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
             S+E D LPSGHKV   ++I+   Y++GRM A+WGED ++FKPERW+++  GG+KH PS K
Sbjct  385   SIEPDVLPSGHKVDANSKIIICLYALGRMRAVWGEDALQFKPERWITE-NGGLKHEPSFK  443

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++     KIV   I+  Y  ++++    + P    +L +KHG++V 
Sbjct  444   FLAFNAGPRTCLGKQLAMTQMKIVVVEILQNYDIKVIKGQK-IEPVLGFILSMKHGLRVT  502

Query  108   LTKR  97
             +T+R
Sbjct  503   ITQR  506



>gb|KEH40821.1| cytochrome P450 family protein [Medicago truncatula]
Length=504

 Score =   356 bits (914),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 201/496 (41%), Positives = 304/496 (61%), Gaps = 24/496 (5%)
 Frame = -3

Query  1551  NIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANF-DM  1375
             NIW+++  +++   NWP+IGMLP++L N  ++HDFAT  LK +GGTF  KGP F N  + 
Sbjct  20    NIWRRN--KNVLVPNWPIIGMLPSVLHNQSKIHDFATLVLKHHGGTFHFKGPWFTNIANF  77

Query  1374  LLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIG  1195
             ++TSDP N+ +I +KNF+NY KG+ F ++FEI G GI N DS  W   R   ++L+    
Sbjct  78    MITSDPMNVHHITSKNFSNYGKGSDFHEIFEILGVGIFNLDSNEWKQERALFHSLLKRKS  137

Query  1194  FRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSL---  1024
             F   L + +   +E  L P LDH ++     DLQ+I +R +FDI        +P  L   
Sbjct  138   FEILLHQCIRNKLEIFLLPFLDHASKGVQILDLQDILERFTFDIICTSVFGFDPNCLPNN  197

Query  1023  FVEPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYP  844
             F E  SD  + KAI    + IL +H +P+  WKLQKW   I +EKK+  A +   +FIY 
Sbjct  198   FSEI-SDISYVKAISVTEDVILSRHYIPKCIWKLQKWL-QIGQEKKYKVAKENLHQFIYK  255

Query  843   ILSEKLNQLHDQDEDDSQNFSMLTSHMKA--YKGKPMQ-FLRDTFVsltisggggttssa  673
              L+   +   ++   D  +  +L   M+    KG+ ++ ++RDT ++L ++G G  ++  
Sbjct  256   CLNYYRSG--EEKRSDDSHLCLLKDLMEEGLEKGEMVERYIRDTTINLLVAGNGTISTGL  313

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETF----KVEECCDLVYLHAAFCESL  505
               W FWL++ +P V+ K+  EI      N  K  E F     VEE   LVYLH A CE+L
Sbjct  314   T-WFFWLVSTHPRVDGKIIQEI----KDNCLKHDENFIANLGVEELDKLVYLHGAICEAL  368

Query  504   RLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSD  325
             RL+P +   HK ++++D LPSG  V P T+++ S Y+MGRME IWGEDC+EFKPERW+SD
Sbjct  369   RLYPSVAFQHKCAIKSDKLPSGDHVSPNTKLIYSLYAMGRMEQIWGEDCLEFKPERWISD  428

Query  324   CGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDT  145
               G I  VPS KF  F+ GPR+C+G+ + F+  K+VAA+++F++H +++E H+ ++P  +
Sbjct  429   -RGQIIQVPSYKFIAFNAGPRSCLGKDISFLQMKMVAAAVLFKFHIQVVEGHS-IIPRVS  486

Query  144   LVLEVKHGVKVKLTKR  97
             ++L ++HG KVK+ KR
Sbjct  487   ILLRMEHGFKVKIRKR  502



>gb|EPS60696.1| hypothetical protein M569_14105, partial [Genlisea aurea]
Length=468

 Score =   355 bits (911),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 291/480 (61%), Gaps = 18/480 (4%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             R+    +WP++ MLP L +N HR+HDF  E L ++GGTF  +GP F N DML+TSDPAN+
Sbjct  3     RNSKIADWPIVAMLPGLARNVHRVHDFIAEVLAESGGTFVFRGPVFGNTDMLVTSDPANV  62

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              YI +KNF+N+ KG  F+K+F+I GDGI   + E W+  R+   A + ++ F   + RTV
Sbjct  63    HYILSKNFHNFGKGPDFKKIFDILGDGIFAAEFESWEKQRRAAKAAVGNLAFHQFVARTV  122

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
                V   L P+L   ++     DLQ  F+RL+FD      L  +P SL  E P      +
Sbjct  123   WGKVSETLVPMLRSASENEETIDLQTTFERLAFDTTCMQVLGHDPCSLSEEMPH-LGHER  181

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH-D  811
             A  DA  AILY+H +PE  W LQK    I  EK+ + A    D F+Y  +SE+  + + D
Sbjct  182   AFSDAEEAILYRHFIPEVVWNLQK-RLQIGTEKRLSAARMNLDAFLYRCISERERRPNTD  240

Query  810   QDEDDSQNFSMLTSHMKA-YKGKPM--QFLRDTFVsltisggggttssalTWLFWLLAKN  640
              D+D      +L  +M+   +G  +  + LRD+     ++ G  T S+ALTW FWL+A N
Sbjct  241   LDQD------VLARYMRGETEGMHLDKEMLRDS-ALSFLTAGKDTISAALTWFFWLVAMN  293

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P VE K+  EI   + +  A +     VEE    VYLHAA CE+LRL+PP+ + HK  L+
Sbjct  294   PDVEYKIRREI---RERFAAGEWSFAAVEEVRRFVYLHAALCETLRLYPPVGLQHKAPLK  350

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              D LPSGH+VK   R + SF+SMGRME+IWG+D  EF+P+RW+S   G IK VPS  FP 
Sbjct  351   DDVLPSGHRVKANARTVISFHSMGRMESIWGKDSGEFRPDRWISG-DGTIKLVPSFMFPA  409

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPR+C+G+++ FM  KIVAA++I R+     E +  V+P  +++L +K+G++V++ K
Sbjct  410   FNAGPRSCLGKEISFMQLKIVAAAVISRFTIRAAEGNR-VLPRASVILHMKYGLRVRVYK  468



>ref|XP_003555023.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Glycine max]
Length=509

 Score =   357 bits (915),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 194/476 (41%), Positives = 286/476 (60%), Gaps = 12/476 (3%)
 Frame = -3

Query  1506  WPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKN  1327
             WP++GMLP +  N   + D+ T  LK+ GGTF  +GP  +N +++ TSDP N+ +I +  
Sbjct  33    WPILGMLPGVFLNMPTIFDYITSVLKREGGTFMFEGPCLSNMNIMFTSDPMNVQHITSTK  92

Query  1326  FNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESG  1147
             F NY KG  F+++FEI GDGI  +DS+LW+ +R   +++     F+  + +T+   +ES 
Sbjct  93    FQNYGKGNDFREIFEILGDGIFRSDSQLWNYNRTILHSVFRKASFQLFVHQTIMNKIESC  152

Query  1146  LFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVN  967
             L P LD   + G   DLQ++F+RL+FD    + L  +P  L +E P +    KA  +A +
Sbjct  153   LLPFLDRGWKEGMEVDLQDVFQRLTFDNICSIVLGFDPNCLSMEFP-EVACEKAFTEAED  211

Query  966   AILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED----  799
             A+LY+H  P+  WKL KW   + +EKK  E+    D+ +Y  +  K     + +      
Sbjct  212   ALLYRHFRPKCLWKLMKWLH-VGKEKKLEESQKIVDQMLYTEIRSKCKVQGESNNSSTPV  270

Query  798   DSQNFSMLTSHM-KAYKGKP-MQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
             D   FS+L   + +  KGK    FLRDT +   ++ G  T SS L+W FWL+A +P VE+
Sbjct  271   DESQFSLLNVLINEVGKGKADDNFLRDTAI-NLLAAGRDTISSGLSWFFWLVATHPSVES  329

Query  624   KLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLP  445
             K+  EI K  P       +   VE    L YLHAA  E+LRL+PPIP+ HK +L++D LP
Sbjct  330   KILEEIRKNLPAREGNW-KNLGVESISRLTYLHAAISEALRLYPPIPIEHKCALKSDMLP  388

Query  444   SGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGP  265
             SGH +   T IL S Y+MGR E IWGEDC++F PERW+S   GGI H+PS KF  F+ GP
Sbjct  389   SGHWINSNTMILYSLYTMGRAEEIWGEDCLKFIPERWISK-QGGIIHIPSYKFIAFNAGP  447

Query  264   RTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             R+C+G+ + +   K+VA SI+  YH  L+E   ++ P  ++VL +KHG+KV++TKR
Sbjct  448   RSCLGKDISYTEMKMVAVSILSNYHVHLVEGQ-IISPRVSIVLHMKHGLKVRVTKR  502



>ref|XP_002322211.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
 gb|EEF06338.1| hypothetical protein POPTR_0015s09840g [Populus trichocarpa]
Length=508

 Score =   355 bits (912),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 194/491 (40%), Positives = 293/491 (60%), Gaps = 21/491 (4%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             RS    NWPV+GMLP L +N+ R+H+F T  L+Q GGTF  KGP F   D L+TS+PAN+
Sbjct  22    RSSVIINWPVVGMLPGLFRNSSRVHEFVTYVLRQCGGTFVFKGPWFGGLDFLVTSNPANV  81

Query  1347  DYIHNKNFNNYPKGTHFQKMF-EIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERT  1171
              +I  K   NY KG  F+++F E FG+GI   D + W   R+T ++ + +  F  + ER 
Sbjct  82    HHILRKKAFNYHKGLEFKEIFAESFGNGIFCADGDRWKTQRRTIHSFIKNSKFEEAAERN  141

Query  1170  VCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFR  991
             + + V  G+F +L+H++++    D+Q++ KR  FD    + L  +P SL +E     P++
Sbjct  142   IQRKVLHGIFVILEHFSEQRKEVDMQDVLKRFMFDYSCLLLLGFDPNSLSIEF-RQVPYK  200

Query  990   KAIIDAVNAILYKHILPERFWKLQKWF-FGIDREKKHAEAWDTFDKFIYPILSEKLNQLH  814
             +A  D    IL +H+ P+RFWKLQ W  FG +R+ K     + FD+ +Y  +S K + L+
Sbjct  201   QAYYDMEEVILQRHLKPQRFWKLQNWLQFGEERKMKKGS--EIFDRLLYQCISRKKDLLN  258

Query  813   -DQDEDDSQNFSMLT-----------SHMKAYKGKPMQFLRDTFVsltisggggttssal  670
               + + D ++F +LT             M A+K K  ++ RD      +S G    SS+L
Sbjct  259   RSKIQMDREDFDLLTFMLVEDNDQEEREMSAFK-KSDKYARD-MAFNLLSAGSEAVSSSL  316

Query  669   TWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPP  490
             TW  WL+A +PLVE  +  E+         ++   F   E   L YL AA CESLRL+PP
Sbjct  317   TWFLWLVATHPLVEKSILEEMKTNLNAKGDEKGRYFSFGELSKLNYLQAAICESLRLYPP  376

Query  489   IPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGI  310
             +P  H +S+++DTLPSGH++   TR++   YSMGRME IWG DC+EFKPERW+S+  G I
Sbjct  377   VPFEHTVSIDSDTLPSGHRIGKNTRVIYCPYSMGRMEEIWGADCLEFKPERWISN-NGEI  435

Query  309   KHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEV  130
              H+   KF  F+ GPRTCIG+ +  +  K V A++I+ Y  +++E H  ++P++++VL +
Sbjct  436   IHISPYKFIAFNAGPRTCIGKDLAMVEMKAVGAAVIWNYSLQVVEDHP-ILPANSIVLHM  494

Query  129   KHGVKVKLTKR  97
             KHG+ V+  KR
Sbjct  495   KHGLMVRALKR  505



>ref|XP_009101867.1| PREDICTED: cytochrome P450 86B1-like isoform X1 [Brassica rapa]
Length=517

 Score =   355 bits (912),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 198/480 (41%), Positives = 283/480 (59%), Gaps = 15/480 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP +L   HR++D + E L+ +  TF+ KGP FA  D+L+T  PANI YI 
Sbjct  41    PWNWPVLGMLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFAGMDILVTVYPANIHYIL  100

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG  FQ++FE FGDGI+N+D ELW   RK +  + +H  ++   + T    +
Sbjct  101   SSNFSNYIKGPEFQEIFEAFGDGIINSDLELWRNIRKASQVIFSHQKYQNFSKSTTRSKL  160

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             + GL P+L H+A      DLQ++F+R  FD  F      +P SL VE P +  F KA+ D
Sbjct  161   KDGLLPILSHFAFEEMVVDLQDVFQRFMFDTTFIFITGSDPRSLSVEMP-EVEFAKALDD  219

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
                AI+Y+HI P   WKLQKW FGI  EKK  +A    D+     +S K   +  Q+  D
Sbjct  220   VGEAIVYRHITPRFLWKLQKW-FGIGTEKKMVKANAVLDRVCAKYISAKREDIRSQEIAD  278

Query  795   SQNFSMLTSHMKAYKGK-------PMQFLRDTFVsltisggggttssalTWLFWLLAKNP  637
              ++  +LTSH+K    K         +FLRD F    ++ G  +T+  LTW FW+L++N 
Sbjct  279   EESEDLLTSHIKLDASKYELLNPEDDKFLRD-FTVGFMAAGRDSTACTLTWFFWILSENS  337

Query  636   LVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
              V +K+  EI +  P   + Q ++  + +   LVYLHAA  ES+RL+PPIP   K  ++ 
Sbjct  338   NVLSKILQEINENVPITRSDQDKSSYLNK---LVYLHAALSESMRLYPPIPFERKSPIKP  394

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGHKVK    I+   Y+MGRM+ +WGED  EFKPERW+S+  GG++H PS KF  F
Sbjct  395   DVLPSGHKVKSNINIMIFIYAMGRMKDMWGEDAAEFKPERWISET-GGLRHEPSYKFLSF  453

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC+G+ +   + K V   I+  Y   ++     +     L+L +KHG+KV + K+
Sbjct  454   NAGPRTCLGKNLAMDLMKTVIVEILQAYEINVVSGQK-IEAKPGLILHMKHGLKVTIAKK  512



>gb|KCW62191.1| hypothetical protein EUGRSUZ_H04849 [Eucalyptus grandis]
Length=496

 Score =   355 bits (910),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 201/483 (42%), Positives = 289/483 (60%), Gaps = 26/483 (5%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWP++ MLPAL  N  R HD+ T  L+Q+   F  + P F+  D+L+ +DPAN+ YI 
Sbjct  30    PKNWPLVRMLPALFLNLGRAHDWGTSVLEQSRCNFFFRSPWFSGMDVLVAADPANVHYIM  89

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF N+PKG  F+++F+I GDGILN+DS++W   R+     MN   F   L +T    V
Sbjct  90    STNFENFPKGPEFKRVFDILGDGILNSDSDMWRAQRRDAQVFMNDQRFCRFLAKTTRDKV  149

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+GL  VLD  +QRG   DLQ++F+R + D   +     +  S  +E P + PF KA+ D
Sbjct  150   ENGLLRVLDDLSQRGVEVDLQDLFQRFTLDSACRFVTGFDLSSFSIEFP-EVPFSKALDD  208

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD---QD  805
             A  AI Y+H+           + G+  E+K   A +  D+ I   +  K  +L D   + 
Sbjct  209   AEEAIFYRHL-----------WLGLGMEEKLKRAREVMDQIIGSYIEMKRVELRDGTSKV  257

Query  804   EDDSQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             + D     +LT +M   +   +      FLRDT +   +  G  TTS ALTWLFW L+ N
Sbjct  258   KGDENGADLLTLYMVENETLGVLECNDVFLRDT-ILTFMIAGNNTTSLALTWLFWALSTN  316

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEE-CCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             P VE K+  EI  V P+   +    FK++E    +VYLH A CESLRL+PPIP   K  +
Sbjct  317   PSVEMKI-REIKSVIPEEE-QNLRVFKMDEHMHKMVYLHGALCESLRLYPPIPFELKCPV  374

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKV P  RIL + Y+MGRM++IWGEDC EF+PERW+S+ GGG++H PS KF 
Sbjct  375   KPDILPSGHKVDPSKRILFNLYAMGRMKSIWGEDCFEFRPERWISE-GGGVRHEPSYKFL  433

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F+ GPRTC+G+++ F   K++AA +I  Y   ++E H +  PS+++VL +K G++VKL 
Sbjct  434   AFNAGPRTCLGKQVAFTQMKMIAAVVIHNYEVHVVEGHPM-RPSNSIVLHMKQGLRVKLA  492

Query  102   KRK  94
             +R+
Sbjct  493   RRR  495



>gb|KEH22136.1| cytochrome P450 family protein [Medicago truncatula]
Length=496

 Score =   354 bits (909),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 193/478 (40%), Positives = 290/478 (61%), Gaps = 10/478 (2%)
 Frame = -3

Query  1527  RSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANI  1348
             R+   T WPV+GMLP LL N   +H +    LKQNGGTF  +GP   N ++L TSDP N+
Sbjct  26    RNTPMTKWPVLGMLPGLLHNVSNIHGYVDLTLKQNGGTFIFEGPWLTNMNILCTSDPMNV  85

Query  1347  DYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTV  1168
              +I +  F NY KG  F+++FE+ G+GI  +DS +W  +RK  +++     F+  +++TV
Sbjct  86    QHITSTKFENYGKGNDFREIFEVLGEGIFRSDSHIWKYNRKLLHSIFKQGNFQVFIQKTV  145

Query  1167  CQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRK  988
              + + + L   LDH ++ G   DLQ+IF+RL+FD    V L  +P  L ++ P + P  +
Sbjct  146   EKKICNYLLVFLDHASKNGVQVDLQDIFQRLTFDNICSVVLGFDPKCLSIDLP-EIPCER  204

Query  987   AIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQ  808
             A   A + +  +H+ P+  WKLQ W F +  EK+  +     D+ +Y  +  K     +Q
Sbjct  205   AFTQAEDTLFIRHVKPKLLWKLQNW-FQVGEEKQFIKNNKFIDEMLYSEIKSKREMRGEQ  263

Query  807   DEDDSQNFSMLTSHMKAYKGK-PMQFLRDTFVsltisggggttssalTWLFWLLAKNPLV  631
               D      ++ + +   + K   +FLRDT +   ++ G  T SS LTW FWL+A +PL+
Sbjct  264   KVD---LLDIIINEVGDGENKIDDKFLRDTSI-NLLAAGRDTISSGLTWFFWLVATHPLI  319

Query  630   EAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
             EAK+  EI +  P       +    +    LVYLH A CE+LRL+PPIP  HK + ++D 
Sbjct  320   EAKILEEIKENLPSREHSWKD-LGAKGLSKLVYLHGALCEALRLYPPIPFEHKSAQKSDV  378

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH+V+  T I+ S YS+GR+E IWGEDC+EFKPERW+S   GGI +VPS KF  F+ 
Sbjct  379   LPSGHRVESNTMIVYSLYSVGRVEEIWGEDCLEFKPERWISQ-KGGIVYVPSYKFIAFNA  437

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPR+C+G+ + F+  K+VA +I+  YH +++E H  ++PS ++VL +KHG+KV L KR
Sbjct  438   GPRSCLGKDISFIEMKMVAIAILLNYHIQVVEDHP-IIPSLSVVLHMKHGLKVNLKKR  494



>gb|EPS57870.1| hypothetical protein M569_16947 [Genlisea aurea]
Length=505

 Score =   355 bits (910),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 196/492 (40%), Positives = 295/492 (60%), Gaps = 17/492 (3%)
 Frame = -3

Query  1542  KKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTS  1363
             ++  +R  +  + P +G  P L     R+HD   E L+   GT+ L GP FAN D+L+T+
Sbjct  16    RRIMKRDFNWRDMPFVGTFPVLFYKMRRIHDACVEVLETFHGTYLLNGPWFANLDILVTA  75

Query  1362  DPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPS  1183
             DPAN+ ++ ++NF N+PKG  F+K+F++ GDGI N+D E+W   RK   AL+ H  FR  
Sbjct  76    DPANVHFVMSENFANFPKGDEFRKIFDVLGDGIFNSDGEMWRRQRKQARALIAHDRFRKF  135

Query  1182  LERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSD  1003
             L  T  + +  GL PV++  A  GT  DLQ+IF+R +FD         +PG L ++ P +
Sbjct  136   LVETNRRKMAEGLIPVIERAAADGTVLDLQDIFQRFTFDTTCIFITGFDPGCLTLDLP-E  194

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLN  823
              PF  A+ DA  AI  +H+LPE  WK+++ F GI  E+K   A  T D  +   +  K +
Sbjct  195   VPFSSAMDDAEEAIFMRHVLPEFVWKIER-FLGIGHEEKLRRARATLDAAVQGYIDMKRD  253

Query  822   QLHDQDEDDSQNFSMLTSHMKAYKG----KPMQFLRDTFVsltisggggttssalTWLFW  655
             ++  +   ++    +LT+++   +     +  +FLRD+ +   +  G  TTSSALTW  W
Sbjct  254   EISRKVSGETPAVDLLTAYIDEGESITNERDDKFLRDS-ILNLMIAGRDTTSSALTWFTW  312

Query  654   LLAKNPLVEAKLFNEILKVKPQNHAKQTET----FKVEECCDLVYLHAAFCESLRLFPPI  487
             L++ +P V  K+  E+  + P   A+QT+     F  EE   LVYLHA+ CESLRL+PP+
Sbjct  313   LVSTHPEVRRKIRGELNSLPP---AEQTDDGWRYFTAEELSSLVYLHASLCESLRLYPPV  369

Query  486   PMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCG--GG  313
             P  HK   +   LPSGH   PKT++L S Y+MGRM+ +WG+D  E+KPERW+ + G  G 
Sbjct  370   PFQHKSPAKAVVLPSGHTAHPKTKVLFSVYAMGRMDYVWGKDSKEYKPERWIINSGERGT  429

Query  312   IKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLE  133
             IK+ PS KF  F+ GPRTC+G+++ F   K +AA+I++ Y    +E H  V P+ +++L 
Sbjct  430   IKYEPSYKFMAFNAGPRTCLGREVAFTQLKSLAAAIVYNYDVATVEGHD-VTPNVSVILY  488

Query  132   VKHGVKVKLTKR  97
             +KHG KVKL+KR
Sbjct  489   MKHGFKVKLSKR  500



>gb|KEH40805.1| cytochrome P450 family protein [Medicago truncatula]
Length=498

 Score =   354 bits (908),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 206/498 (41%), Positives = 303/498 (61%), Gaps = 33/498 (7%)
 Frame = -3

Query  1551  NIWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANF-DM  1375
             NIW+++    +   NWP+IGMLP++L N   +HDF T  LK  G TF  KGP F N  + 
Sbjct  19    NIWRRNKNELL--PNWPIIGMLPSVLHNQSNIHDFVTLLLKHYGSTFHFKGPWFTNIANF  76

Query  1374  LLTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIG  1195
              LTSDP N+ +I +KNF+NY +G+ F ++FE+ G  ++N DS  W   R   ++L+    
Sbjct  77    TLTSDPMNVHHITSKNFSNYGRGSDFPEIFEVLGISLINLDSNDWKQERTILHSLLKRKS  136

Query  1194  FRPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSL---  1024
             F+ SL++ + + +ES L P LDH  +     DLQ+I +R +FDI      + +P  L   
Sbjct  137   FKTSLQQIIQKKLESCLLPFLDHATKGLQVLDLQDILERFTFDIIGTSLFEFDPNCLPYK  196

Query  1023  FVEPPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYP  844
             F E  SD  + KAI    + IL++H +P+ FWKLQKW   I +EKK+  A +   KF+Y 
Sbjct  197   FNEF-SDIAYVKAISVIEDTILFRHYIPKCFWKLQKWL-QIGQEKKNNIAQENIHKFLYN  254

Query  843   ILS------EKLNQLHDQDEDDSQNFSMLTSHMKAYKGK---PMQFLRDTFVsltisggg  691
              +S      EK     ++D D+S +  +L   MK   GK     +++ +T     ++ G 
Sbjct  255   CISYYKDGEEKRTFKSNEDVDESHS-CLLKDLMKEGLGKGEMAEKYIINT-TLNLLAAGS  312

Query  690   gttssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCE  511
             GT SS L+W FWL++ +P+VE K+  EI      N  K  +         LVYLH A CE
Sbjct  313   GTVSSGLSWFFWLVSTHPIVETKIIQEI----KDNFLKGLD--------KLVYLHGAICE  360

Query  510   SLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWL  331
             +LRL+PPIP  HK ++++D LPSG  V P T+++ S Y+MGRME IWGEDC+EFKPERW+
Sbjct  361   ALRLYPPIPFEHKCAIKSDILPSGDHVSPNTKLIYSLYAMGRMEQIWGEDCLEFKPERWI  420

Query  330   SDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPS  151
             S+  G I  VPS KF  F+ GPR+CIG+ + F+  K+VAA++++++H E++E H  V P 
Sbjct  421   SN-RGEIIQVPSYKFIAFNAGPRSCIGKDISFVQMKMVAANVLWKFHIEVVEGH-FVTPR  478

Query  150   DTLVLEVKHGVKVKLTKR  97
               +VL +KHG+KVK+++R
Sbjct  479   VAMVLRMKHGLKVKVSQR  496



>ref|XP_010653011.1| PREDICTED: cytochrome P450 86B1-like [Vitis vinifera]
Length=478

 Score =   352 bits (903),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 196/477 (41%), Positives = 291/477 (61%), Gaps = 11/477 (2%)
 Frame = -3

Query  1521  MDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDY  1342
             M P NWP++GMLP +L + H +H+  T+ L+ + GT  +KG  FAN DML TS+P N+ +
Sbjct  1     MGPRNWPIVGMLPMILLHFHCMHEKYTKILELSKGTILIKGAWFANIDMLTTSNPDNVHH  60

Query  1341  IHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQ  1162
             + + NF+NYPKG  F+++F I G+G+ N+D + W   R      +NH  F   + +    
Sbjct  61    VLSTNFSNYPKGPKFRRIFNILGNGLFNSDFDEWRKIRGLAQGFVNHKQFHRFMAKINHD  120

Query  1161  TVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAI  982
              +E+ L PVLD+ +Q+    DLQ++F+RL  D         NP SL +  P + PF KA+
Sbjct  121   FLENKLVPVLDNASQQNLVVDLQDVFQRLMLDATCITATSYNPNSLCIGFP-EVPFLKAL  179

Query  981   IDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHD--Q  808
              +A  AI ++H++PE F K Q+W  GI +EKK ++A +  D  +   +S +  +L    +
Sbjct  180   DNAGEAIFFRHLVPEGFLKSQRWL-GIGKEKKLSKACEVLDHIVAKYISMRQEELGKGKR  238

Query  807   DEDDSQNFSMLTSHM---KAYKGKPM-QFLRDTFVsltisggggttssalTWLFWLLAKN  640
              E++  +F  L   +   + +   P  +++RD  +   I  G  +TS+ALTWLFWLL+KN
Sbjct  239   PEENKDSFDALKYQLTETEIFGTTPTNKYMRDA-ILGLIFAGQDSTSAALTWLFWLLSKN  297

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P VE  +  E+    P N A +   F  EE   LVYLH A  E+LRLFPP P+  +  + 
Sbjct  298   PSVETNIKEELKSKLPVNKANKLHIFTEEELNKLVYLHGALYETLRLFPPAPLQVRTCIH  357

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              DTLPSGHKV  K +I+ S Y+MGRM ++WG DC+EFKPERW+++  GGIKHVPS+KF  
Sbjct  358   PDTLPSGHKVNSKMKIVFSAYAMGRMTSVWGNDCLEFKPERWITE-KGGIKHVPSHKFLA  416

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             FSVGPR C+G++      K VAA I+  YH ++ME    V P  ++VL +K+G++V+
Sbjct  417   FSVGPRICLGKESAITRKKSVAAVILHNYHVQVMEGQ-FVTPKASIVLHMKNGLRVR  472



>ref|XP_006282055.1| hypothetical protein CARUB_v10028299mg [Capsella rubella]
 gb|EOA14953.1| hypothetical protein CARUB_v10028299mg [Capsella rubella]
Length=516

 Score =   353 bits (906),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 201/487 (41%), Positives = 296/487 (61%), Gaps = 22/487 (5%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             +WPV+GM+P LL   HRL+DFA E L+ NG TF  KGP FA  DMLLT DPANI ++ N 
Sbjct  36    SWPVLGMIPGLLFVLHRLYDFAVELLEINGLTFPFKGPWFAGMDMLLTVDPANIHHLLNS  95

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+N+ +G+ F++ F+ F D +L  DSE W   RK T ++++H G++     T    ++ 
Sbjct  96    NFSNFTRGSDFRETFDAFEDSLLAKDSEAWKKLRKATQSIIHHHGYQTLSISTTRSKIKD  155

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLD-KNPGSLFVEPPSDHPFRKAIIDA  973
             GL PVLDH A+ GT  DLQ++F RL++D          +P SL +E P +     A+ + 
Sbjct  156   GLVPVLDHVAEEGTTVDLQDVFWRLAYDTTIVTTTGCDDPRSLSIEMPENES-ATALNNI  214

Query  972   VNAILYKHILPERFWKLQKWF-FGIDREKKHAEAWDTFDKFIYPILSEKLNQL-----HD  811
                ++Y+H  P   WKLQKW  FGI  EKK  E    FD+     +S K  ++     ++
Sbjct  215   GEGLIYRHAKPIFLWKLQKWIGFGI--EKKMTEGGAIFDRVCAEYISAKREEIKKSQENN  272

Query  810   QDEDDSQNFSMLTSHMKAYKGK-----PM--QFLRDTFVsltisggggttssalTWLFWL  652
             QD  D +N  +L SH+K    K     P+  +FLRDT V   +  G  TT+SALTW FWL
Sbjct  273   QDHVDGENEDILASHIKLDTTKYQLLNPINDKFLRDTIV-GFLLAGRDTTASALTWFFWL  331

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQ-TETFKVEECCD-LVYLHAAFCESLRLFPPIPMN  478
             L++NP V  K+  EI  + P+  + Q + +    EC + LVYLH+A  E++RL+PP+P+ 
Sbjct  332   LSENPRVVTKIRQEIDTILPRGSSGQESSSNDPMECLNKLVYLHSALFETMRLYPPVPIE  391

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
                 ++TD LPSGHKV+  ++IL   Y++G+M  IWGED +EFKPERW+S+  G ++HVP
Sbjct  392   RVSPVKTDVLPSGHKVEANSKILIFIYAVGKMRTIWGEDALEFKPERWISET-GALRHVP  450

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             + KF  F+ GPR C+G+++  ++ KIV   I+  Y  ++ +    + P   ++L +KHG+
Sbjct  451   AFKFLAFNAGPRNCLGKQIAMILMKIVVVEILQNYDIKVAKGQK-IQPYANIILRMKHGL  509

Query  117   KVKLTKR  97
             KV + KR
Sbjct  510   KVTINKR  516



>gb|EEC74485.1| hypothetical protein OsI_09945 [Oryza sativa Indica Group]
Length=504

 Score =   352 bits (903),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 192/477 (40%), Positives = 284/477 (60%), Gaps = 10/477 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFA-NFDMLLTSDPANIDYI  1339
             P  WP++GMLP LL N H+LHD+ T FL  +   F   GP  + N     T DPAN+ +I
Sbjct  34    PVCWPLVGMLPDLLVNRHQLHDWITSFLTASQLNFRFIGPTMSSNMRFFFTCDPANVRHI  93

Query  1338  HNKNFNNYPKGTHFQKMFE-IFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQ  1162
                NF NYPKG  F ++F+   GDGI N D + W   R  T  LM +  F+  + R    
Sbjct  94    FTSNFANYPKGPDFAEIFDDTLGDGIFNVDGDSWRRQRAKTQLLMYNHRFQSFVSRCSSD  153

Query  1161  TVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDH-PFRKA  985
              VE+ L P+L H+A  G   +LQ++F RL+FD+   +   ++PG L +  P    PF +A
Sbjct  154   KVENALLPLLSHFAGTGERCNLQDVFMRLTFDMSTMLASGEDPGCLAISLPMPKVPFVRA  213

Query  984   IIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD  805
             +      +L +HI+P   WKL +   G+  E+K AEA  T ++FIY  + ++  +   + 
Sbjct  214   VDYTTRVLLVRHIIPLSLWKLARRL-GVGFERKMAEALRTINQFIYETIVKRRAKKATEG  272

Query  804   EDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
              +DS++  +L+S++K        FLRDT     I+ G  T  SAL+W F+LL KNP V +
Sbjct  273   IEDSED--LLSSYLKDDDENADTFLRDT-TMTLIAAGRDTIGSALSWFFYLLTKNPHVAS  329

Query  624   KLFNEILKV-KPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTL  448
             K+  E+  V +         TF  +E   LVYLHAA CESLRL+PP+P++HK  +  D +
Sbjct  330   KILEELDSVERATTTPDGMVTFDPDELKSLVYLHAAVCESLRLYPPVPLDHKGVVAADVM  389

Query  447   PSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVG  268
             PSGHKV+P  +I+ S Y+MGR E++WG DCMEF+PERW+SD  G +++VPS KF  F  G
Sbjct  390   PSGHKVRPGDKIVVSIYAMGRTESVWGSDCMEFRPERWISD-HGKLRYVPSYKFTPFITG  448

Query  267   PRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             PRTC+G+ M  +  K+VAA+++  +  E +  H +V P  ++VL +K+G+ V++ +R
Sbjct  449   PRTCLGKDMALVQLKVVAATVVKNFEAEAVPGH-IVEPKLSMVLHMKNGLMVRVKRR  504



>dbj|BAJ86572.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   352 bits (902),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 191/478 (40%), Positives = 283/478 (59%), Gaps = 12/478 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P  WP++GMLPALL N  RLHD+ T  L  +   F   GP  +  D+ LTSDPAN+ ++ 
Sbjct  34    PLEWPLVGMLPALLANLPRLHDWVTSLLTASPLNFRFVGPPRSGMDLFLTSDPANVRHVF  93

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
               NF+NYPKG  F ++ +I G GI N D + W   R     LM+   FR  + R   + V
Sbjct  94    TSNFSNYPKGPDFAEIMDILGGGIFNADGDSWRRQRAKAQLLMSGPRFRAFVTRCSRRKV  153

Query  1155  ESGLFPVLDHYAQRGTHF-DLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAII  979
             E  L P+L H A  GT   DLQ++F RL+FD    +    +PG L +  P + PF +A+ 
Sbjct  154   ERDLLPLLAHVAAAGTGVCDLQDVFLRLTFDTTTTLVFGVDPGCLAIGFP-EVPFARAMD  212

Query  978   DAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDE-  802
             DA++ +L +++LP  +WKL +W  G+  E+K A AW   D+FI   ++++   +  +   
Sbjct  213   DAMDVLLVRNVLPPSWWKLVRW-LGVGYERKMAVAWRDIDRFIGDTIAKRREVVKARGGI  271

Query  801   DDSQNFSMLTSHM-KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
             DDS +  +L+S++          FLRDT     +  G  TT S L+W F+LL +NP V +
Sbjct  272   DDSAD--LLSSYIHDDDDDVVDAFLRDT-TMNLMLAGRDTTGSGLSWFFYLLTRNPRVVS  328

Query  624   KLFNEILKVKPQ--NHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
             K+  E+  V       A    T+  EE   LVYLHAA CESLRL+PP+P  HK  +  + 
Sbjct  329   KILAELDTVSSSATRDADGMVTYDPEELGRLVYLHAALCESLRLYPPVPTEHKGVVAAEA  388

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH+V+P  +++ S Y+MGRMEA+WG+DC EF+PERW+ +  G  ++VPS KF  F+ 
Sbjct  389   LPSGHEVRPGEKVMVSLYAMGRMEAVWGKDCREFRPERWIGE-DGKPRYVPSYKFLSFNS  447

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPRTC+G+ M F+  K VAA+++  +  E +  H +V P  +++L +K+G K ++ +R
Sbjct  448   GPRTCLGKDMAFVQLKAVAAAVLSNFQVEAVPGH-VVEPKISIILHMKNGFKARIKRR  504



>ref|XP_009773631.1| PREDICTED: cytochrome P450 86B1-like [Nicotiana sylvestris]
Length=510

 Score =   352 bits (902),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 192/478 (40%), Positives = 289/478 (60%), Gaps = 12/478 (3%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWP +GM P+L+ + HR+H+ + E L +  GTF LKG  F N D+L T DPAN+ YI + 
Sbjct  36    NWPFLGMFPSLVFHIHRIHERSVEVLSRTRGTFLLKGLWFTNMDILGTVDPANVQYIMSA  95

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF N+PKG   +K+F++ GDGI ++D +LW   RK   AL+ H  F   L +     V++
Sbjct  96    NFTNFPKGRELRKIFDVLGDGIFSSDMDLWKNQRKLARALITHQRFHKCLTKISLDKVKN  155

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+L+  A+     DLQ++FKR +FD   ++        L +E P + PF KA+ DA 
Sbjct  156   GLIPILELIAKEDRIVDLQDVFKRFTFDTTCKLLTGFESCCLSLEFP-EVPFLKAMDDAK  214

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH--DQDEDD  796
               +  +++LPE  WKLQKW  G+  E +  +A D  D+ I   +  K  +L   ++ +++
Sbjct  215   YVVSIRYLLPESIWKLQKW-LGVGPEMQLRKASDVLDRVIGEYILMKREELSRVEKCKEN  273

Query  795   SQNFSMLTSHM-----KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLV  631
              + F +LT ++     +    K  +FLRDTF+   +  G  T SS LTW  WL++ +P V
Sbjct  274   EEGFDLLTPYIINDGERTSGLKFDKFLRDTFL-NFMFAGHDTVSSGLTWFIWLVSTHPEV  332

Query  630   EAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
             E  +  E+  + P   A++   F  +E  +++YLHAA CESLRL+PP+   HK  LE D 
Sbjct  333   EKNIREELRAIIPPEEAEKWRLFTADELKNVIYLHAALCESLRLYPPVAFQHKTPLEPDI  392

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH V P  R++   Y+MGRME+IWG+D  EFKP RW+SD  G I + PS KF  F+ 
Sbjct  393   LPSGHHVHPNMRVMIPLYAMGRMESIWGKDASEFKPHRWISD-RGTINYEPSYKFFSFNA  451

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPRTC+G++  F   K+V A+II  Y  E+++ H +V P+ +++L +KHG KV++ ++
Sbjct  452   GPRTCLGKEAAFTQMKVVVATIIHNYQIEMVKGH-VVYPNVSVMLYMKHGFKVRVKRK  508



>gb|KEH40819.1| cytochrome P450 family protein [Medicago truncatula]
Length=481

 Score =   350 bits (899),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 195/487 (40%), Positives = 287/487 (59%), Gaps = 33/487 (7%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W+++ R    P NWP+ GML AL+ N    HD AT  LK +GGTF   G  F N   + T
Sbjct  22    WRRN-RDEFVPINWPIFGMLLALMCNLSNFHDRATLILKHHGGTFRFGGAWFTNTSFIGT  80

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDP N+++I +KNF NY +G++F+++F+ FGDGILN++S +W   R   ++ +    F+ 
Sbjct  81    SDPMNVEHIASKNFGNYGRGSNFKEIFDFFGDGILNSNSHVWKQQRTMFHSFLKRKTFKN  140

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVE---  1015
               ++T+ + +E+ L P L+  ++ G   DL++   R +FD    +    +P  L  +   
Sbjct  141   FFQQTMKKKLENYLLPFLNDVSEIGAQVDLEDALSRFTFDSICTIAFGFDPNCLLNKFNE  200

Query  1014  -PPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPIL  838
                 D+    A+ID V  ILY+H +P   WKLQKW   + +EKK  EA +  D+F+Y  L
Sbjct  201   LTEIDYQKSLAVIDEV--ILYRHFIPSYLWKLQKWLH-VRQEKKLREAEENLDRFLYEAL  257

Query  837   SEKLNQLHDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLF  658
              ++       DE                     ++LRD         G GT +S L+W F
Sbjct  258   MKEEYGTRGMDE---------------------KYLRDN-ALSLFLAGNGTVTSGLSWFF  295

Query  657   WLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
             WL++ +P+VEAK+  EI    P     QT    V+   +LVYLH A CE+LRL+PP+P  
Sbjct  296   WLVSTHPIVEAKIIQEIKDNWPTQEENQTPWRDVD-LDNLVYLHGAICETLRLYPPVPFE  354

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
             H  ++++D LPSG +V P TR+L S Y+MGRME IWGEDCMEFKPERW+S+  G I HVP
Sbjct  355   HICAIKSDILPSGERVSPNTRLLYSLYAMGRMEQIWGEDCMEFKPERWVSET-GHIIHVP  413

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGV  118
             S KF  F+ GPR+C+G+ + F+  K+VAA+++ ++H +++E H  V P  + VL +KHG 
Sbjct  414   SYKFIAFNTGPRSCLGKDLSFIQMKMVAAALLQKFHIQVVEGHP-VTPKLSFVLHMKHGF  472

Query  117   KVKLTKR  97
             KVK+TKR
Sbjct  473   KVKVTKR  479



>ref|XP_007134103.1| hypothetical protein PHAVU_010G019100g [Phaseolus vulgaris]
 gb|ESW06097.1| hypothetical protein PHAVU_010G019100g [Phaseolus vulgaris]
Length=504

 Score =   351 bits (900),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 192/478 (40%), Positives = 288/478 (60%), Gaps = 12/478 (3%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWPV+GMLP LL N   + D+ T  LK + G F  +GP  +N  +  TSDP N+ +I +
Sbjct  31    TNWPVLGMLPGLLLNLSIIFDYLTMLLKHHRGNFMFEGPWLSNMKIFFTSDPMNVQHITS  90

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
               F NY KG  F+++FE+ GDGI  +DS+LW  +R   ++    + F+  + +T+   +E
Sbjct  91    TKFENYGKGDDFREIFEVLGDGIFRSDSQLWKYNRSILHSTFKQVSFQLFIHKTINNKIE  150

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             S L P LDH  ++GT  DLQE F+RL+FD+     L  +P  L ++ P +    KA  + 
Sbjct  151   SCLLPFLDHAWKQGTEVDLQEAFQRLTFDVICSTVLGFDPTCLSIDFP-EVACEKAFTEL  209

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE----KLNQLHDQD  805
              +AI Y+H  P   WKL +W   + +EK   E+ +  D+ +Y  ++     +   + +  
Sbjct  210   EDAIFYRHFTPRCSWKLLQW-LQLGKEKNLKESQEIVDQMLYKEIASMSKVQGESIGNST  268

Query  804   EDDSQNFSMLTSHM-KAYKGK-PMQFLRDTFVsltisggggttssalTWLFWLLAKNPLV  631
              ++   FS+L   + +  KGK   +FLRDT +   ++ G  T S+ LTW FWL+A +P V
Sbjct  269   PEEEPRFSLLDVLISEVGKGKLDDKFLRDTAI-NLLAAGRDTISACLTWFFWLVATHPSV  327

Query  630   EAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
             E+K+  EI +  P       +   VE    L YLHAA  E+LRL+PP+P+ HK  L++D 
Sbjct  328   ESKILEEIHEKLPAREGNGKD-LGVEWLSQLTYLHAAISETLRLYPPVPLEHKCPLKSDM  386

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH +K  T IL S YSMGR E IWGEDC++F+PERW+S+  GGI H+PS KF  F+ 
Sbjct  387   LPSGHWIKSNTMILYSLYSMGRAEEIWGEDCLKFRPERWISN-RGGIIHIPSYKFIAFNA  445

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             GPR+C+G+ + +   K++AA+I++ Y  +L+E    + P  ++VL +KHG+KV LTKR
Sbjct  446   GPRSCLGKAISYTEIKMIAAAILWNYRIQLVEGQA-ISPRVSVVLHMKHGLKVTLTKR  502



>ref|XP_009400643.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=520

 Score =   352 bits (902),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 190/491 (39%), Positives = 288/491 (59%), Gaps = 16/491 (3%)
 Frame = -3

Query  1533  SRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             SR++  P +WPV+GMLP LL   H +H++  E L  +  TF  KGP F   DML+T DPA
Sbjct  32    SRKNQLPVDWPVVGMLPGLLSRIHGVHEYGVEILTASNWTFMFKGPWFLGMDMLVTCDPA  91

Query  1353  NIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLER  1174
             N+++      +NYPKG  F ++F++FG+ ++NTD E W + R+ T++LM++  FR     
Sbjct  92    NVNHAFVAKCSNYPKGKEFTEIFDMFGNSLINTDGEEWKMQRRMTHSLMSNQNFRYYELN  151

Query  1173  TVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPF  994
             TV   VE  L P+L   A+RG   DLQ++F RL+FD+   + L  +PG L    P   PF
Sbjct  152   TVRDKVEGALLPLLRGVAERGNAVDLQDVFLRLTFDVSCSLILGVDPGCLAEGFPVV-PF  210

Query  993   RKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH  814
              KA+ DA+  I ++H +P   WK  +W  G+ +E+K A A    + F    ++++  +++
Sbjct  211   AKALDDALEVIFFRHTVPMSVWKAMRW-LGVGKERKMAVAQKVMNHFAASTIAKRKEKIN  269

Query  813   DQD-------EDDSQNFSMLTSHMKAYKGKPM----QFLRDTFVsltisggggttssalT  667
              +        E+      MLT +M    GK      +F+ D  +   +  G  TT++ LT
Sbjct  270   GERSHKDGGHEEGEAAGDMLTVYMHQPNGKNRLEFDRFIEDNAI-DLLLAGRDTTAAGLT  328

Query  666   WLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPI  487
             W FWLL  +P  E K+  E+    P+        F  +    LVYLHAA CESLRL+PP 
Sbjct  329   WFFWLLTLHPEAEQKILEELKANWPRTDLHANAPFDRDGLGKLVYLHAALCESLRLYPPG  388

Query  486   PMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIK  307
              + HK   E DTLPSG KV+P T++L   YSM RME IWG+DC EFKPERW+++  G ++
Sbjct  389   AIQHKGVAEPDTLPSGEKVRPGTKLLFHLYSMARMEGIWGKDCAEFKPERWITET-GELR  447

Query  306   HVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVK  127
             H P++KF  F+ GPR C+G+ M F + K VA +++  +  E+++ H +V P  ++VL +K
Sbjct  448   HEPAHKFFAFNCGPRICLGKDMAFTIMKTVAVAMLRSFRFEVVKGH-VVEPRLSIVLHMK  506

Query  126   HGVKVKLTKRK  94
             +G+ +K+ KR+
Sbjct  507   NGLMMKVRKRE  517



>ref|NP_175193.1| cytochrome P450, family 96, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
 gb|AAD46023.1|AC007519_8 Strong simlarity to gb|286426 F10M6.190 cytochrome p450 homolog 
from Arabidopsis thaliana BAC gb|AL021811 [Arabidopsis thaliana]
 gb|AAQ89636.1| At1g47620 [Arabidopsis thaliana]
 dbj|BAD44042.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD44086.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32195.1| cytochrome P450, family 96, subfamily A, polypeptide 8 [Arabidopsis 
thaliana]
Length=520

 Score =   351 bits (901),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 199/483 (41%), Positives = 282/483 (58%), Gaps = 18/483 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP +L    R++D + E L+ +  TF+ KGP F   D+L T DPANI +I 
Sbjct  41    PWNWPVLGMLPGVLLRLQRIYDCSVEVLENSNMTFQFKGPWFVGMDVLATVDPANIHHIM  100

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG  F ++FE FGDGI+NTD+ELW   R  +  + NH  ++     T    V
Sbjct  101   SSNFSNYIKGPIFHEIFEAFGDGIINTDAELWRDWRNASQLIFNHQRYQNFSASTTKTKV  160

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
               GL P+ +H+A      DL+++F+R  +DI F      +P SL +E P +  F KA+ D
Sbjct  161   NDGLVPLFNHFANEEIVVDLEDVFQRFMYDITFIFITGTDPRSLSIEMP-EVEFSKALDD  219

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD---  805
               +AI+++HI P   WKLQKW  GI  EKK  +A  TFD+    I++ K  +L  Q    
Sbjct  220   VGDAIVHRHITPRFVWKLQKW-IGIGTEKKMLKAHATFDRVCEKIIAAKREELGSQGITY  278

Query  804   EDDSQNFSMLTSHMK-------AYKGKPMQFLRDTFVsltisggggttssalTWLFWLLA  646
               + +   +LTS +K         K    +FLRD F    ++ G  +T+S LTW FW L+
Sbjct  279   NSNGEREDLLTSFIKLDATKYEVLKPSHDKFLRD-FTIGFMAAGRDSTASTLTWFFWNLS  337

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             KNP V  K+  EI    P+  + Q  +  + +   LVYLH A  ES+RL+PPIP   K  
Sbjct  338   KNPNVLTKILQEINTNLPRTGSDQDMSSYLNK---LVYLHGALSESMRLYPPIPFQRKSP  394

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             ++ D LPSGHKVK    I+   Y+MGRM+ IWGED MEFKPERW+S+  GG++H PS KF
Sbjct  395   IKEDVLPSGHKVKSNINIMIFIYAMGRMKTIWGEDAMEFKPERWISET-GGVRHEPSYKF  453

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+ +   + K V   I+  Y  +++     + P   L+L +KHG+KV +
Sbjct  454   LSFNAGPRTCLGKNLAMNLMKTVIVEILQNYEIKIVSGQK-IEPKPGLILHMKHGLKVTM  512

Query  105   TKR  97
             TK+
Sbjct  513   TKK  515



>gb|EAZ25521.1| hypothetical protein OsJ_09345 [Oryza sativa Japonica Group]
Length=504

 Score =   350 bits (899),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 191/477 (40%), Positives = 284/477 (60%), Gaps = 10/477 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFA-NFDMLLTSDPANIDYI  1339
             P  WP++GMLP LL N H+LHD+ T FL  +   F   GP  + N     T D AN+ +I
Sbjct  34    PVCWPLVGMLPDLLVNRHQLHDWITSFLTASQLNFRFIGPTMSSNMRFFFTCDSANVRHI  93

Query  1338  HNKNFNNYPKGTHFQKMFE-IFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQ  1162
                NF NYPKG  F ++F+   GDGI N D + W   R  T  LM +  F+  + R    
Sbjct  94    FTSNFANYPKGPDFAEIFDDTLGDGIFNVDGDSWRRQRAKTQLLMYNHRFQSFVSRCSSD  153

Query  1161  TVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDH-PFRKA  985
              VE+ L P+L H+A  G   +LQ++F RL+FD+   +   ++PG L +  P    PF +A
Sbjct  154   KVENALLPLLSHFAGTGERCNLQDVFMRLTFDMSTMLASGEDPGCLAISLPMPKVPFVRA  213

Query  984   IIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD  805
             +      +L +HI+P   WKL +   G+  E+K AEA  T ++FIY  + ++  +  ++ 
Sbjct  214   VDYTTRVLLVRHIIPLSLWKLARRL-GVGFERKMAEALRTINQFIYETIVKRRAKKANEG  272

Query  804   EDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
              +DS++  +L+S++K        FLRDT     I+ G  T  SAL+W F+LL KNP V +
Sbjct  273   IEDSED--LLSSYLKDDDENADTFLRDT-TMTLIAAGRDTIGSALSWFFYLLTKNPHVAS  329

Query  624   KLFNEILKV-KPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTL  448
             K+  E+  V +         TF  +E   LVYLHAA CESLRL+PP+P++HK  +  D +
Sbjct  330   KILEELDSVERATTTPDGMVTFDPDELKSLVYLHAAVCESLRLYPPVPLDHKGVVAADVM  389

Query  447   PSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVG  268
             PSGHKV+P  +I+ S Y+MGR E++WG DCMEF+PERW+SD  G +++VPS KF  F  G
Sbjct  390   PSGHKVRPGDKIVVSIYAMGRTESVWGSDCMEFRPERWISD-DGKLRYVPSYKFTPFITG  448

Query  267   PRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             PRTC+G+ M  +  K+VAA+++  +  E +  H +V P  ++VL +K+G+ V++ +R
Sbjct  449   PRTCLGKDMALVQLKVVAATVVKNFEIEAVPGH-IVEPKLSMVLHMKNGLMVRVKRR  504



>ref|XP_006306153.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
 gb|EOA39051.1| hypothetical protein CARUB_v10011665mg [Capsella rubella]
Length=518

 Score =   351 bits (900),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 200/483 (41%), Positives = 288/483 (60%), Gaps = 18/483 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP +L   HR++DF+ E L+ +  TF+ KGP F   D L T DPAN+ +I 
Sbjct  41    PWNWPVLGMLPGILLRLHRIYDFSVEVLENSNLTFQFKGPWFVAMDALATVDPANVHHIM  100

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF+NY KG  F ++FE +GDGI+N+DSELW   R +   + NH  ++     T    +
Sbjct  101   SSNFSNYIKGPIFHEIFEAYGDGIINSDSELWRNWRNSAQIIFNHQRYQNFSTSTTRSKL  160

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             + GL P+L+H+A      DLQ++F+R  FDI F      +P SL +E P +  F KA+ D
Sbjct  161   KDGLVPLLNHFADEEMVVDLQDVFQRFMFDITFIFVTGSDPRSLSIEMP-EVEFAKALDD  219

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
               +AI+++HI P   WKLQKW  GI  EKK  EA  T D+     ++ K  +L  Q    
Sbjct  220   VGDAIVHRHITPRFVWKLQKW-IGIGTEKKLLEAHATLDRVCAKFIAAKREELRTQGTTH  278

Query  795   SQNFS---MLTSH--MKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLA  646
             + N     +LTSH  + A K + +     +FLRD F    ++ G  +T+SALTW FW L+
Sbjct  279   NTNGESEDLLTSHIMLDATKYELLNPGDDKFLRD-FTVGFMAAGRDSTASALTWFFWNLS  337

Query  645   KNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             +NP V  K+  EI    P+  + Q  +  + +   LVYLH+   ESLRL+PPIP   K  
Sbjct  338   ENPNVLNKILQEINTNLPRTGSGQDMSSYMNK---LVYLHSVLSESLRLYPPIPFERKSP  394

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             ++ D LPSGHKVKP   I+   Y+MGRM+ +WGED MEFKPERW+++  GG++H PS KF
Sbjct  395   IKEDVLPSGHKVKPNINIMIFIYAMGRMKTVWGEDAMEFKPERWITET-GGLRHEPSYKF  453

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+ +   + K V   I+  Y  +++     + P   L+L +K+G+KV +
Sbjct  454   LSFNAGPRTCLGKNLAMNLMKTVIVEILQNYEIKVVGGQK-IEPKPGLILHMKYGLKVTM  512

Query  105   TKR  97
             TK+
Sbjct  513   TKK  515



>ref|XP_010482535.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=520

 Score =   351 bits (900),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 198/488 (41%), Positives = 290/488 (59%), Gaps = 22/488 (5%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             +WPV+GM+P L+   HR++DF  E  +    TF  KGP F   DMLLT+DPANI YI N 
Sbjct  35    SWPVVGMIPGLVLVLHRVYDFTVELFESTELTFLFKGPWFVGMDMLLTADPANIHYIVNS  94

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+N+ KG+ F+++F+ F   +L  DS  W   RK T+ ++NH GF+     T+   ++ 
Sbjct  95    NFSNFVKGSDFKEVFDAFEYALLTKDSVAWKNLRKATHVMINHQGFQRLSMSTMRGKLKD  154

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLD-KNPGSLFVEPPSDHPFRKAIIDA  973
             GL P  +H A+ GT  DLQE+F+R +FDI         +P SL ++ P      KA+ D 
Sbjct  155   GLVPFFNHTAEEGTTVDLQEVFRRFTFDITLVTVTGCDDPRSLSIDMPEVES-AKALDDI  213

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH-----DQ  808
             V  I Y+H+ P   WKLQKW  G+  EKK  EA   FD+     +S +  ++      D 
Sbjct  214   VEGIKYRHVKPRFLWKLQKW-TGVGIEKKMTEAGAIFDRVCAKYISARREEIKRSQGIDH  272

Query  807   DEDDSQNFSMLTSHMKAYKGK-----PM--QFLRDTFVsltisggggttssalTWLFWLL  649
             D  D ++  +LTSH+K    K     P+  +FLRD  V   I  G  T +SALTW FWLL
Sbjct  273   DHCDGESEDLLTSHIKLDTTKYQLLDPINDKFLRDN-VLALILAGRDTIASALTWFFWLL  331

Query  648   AKNPLVEAKLFNEILKVKPQNHA---KQTETFKVEECCD-LVYLHAAFCESLRLFPPIPM  481
             ++NP    K+  EI K+ P++ +   ++T ++   EC + L+YLHAA CE++RL+PP+P+
Sbjct  332   SENPKAMTKIRQEINKILPRSSSSSCQETPSYDPMECVNKLMYLHAALCETMRLYPPVPL  391

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
                  LE+D LPSGHKV+  + IL   Y +GRM A+WGED ++FKPERW+S+  G ++H+
Sbjct  392   ERVSPLESDVLPSGHKVEANSNILIFIYGVGRMRAVWGEDALDFKPERWISET-GELRHI  450

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             P+ KF  F+ GPR C+G+++  ++ K VA  I+  Y  ++        P  +L+L +KHG
Sbjct  451   PAFKFLAFNAGPRICLGKQLAMILMKNVAVEILQNYDIKVATGQKF-EPDTSLILRMKHG  509

Query  120   VKVKLTKR  97
              KV + KR
Sbjct  510   FKVTINKR  517



>ref|XP_002457224.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
 gb|EES02344.1| hypothetical protein SORBIDRAFT_03g003590 [Sorghum bicolor]
Length=511

 Score =   350 bits (898),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 192/487 (39%), Positives = 284/487 (58%), Gaps = 9/487 (2%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             ++ +  RR   PTNWPV+G+LPA+  NA R+H++ TEFL+  G ++ +KGP  +  D+++
Sbjct  27    LFHRLKRRDGLPTNWPVVGVLPAITINAGRIHEWLTEFLRAAGLSYVIKGPWGSPVDVIV  86

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T+DPAN+ ++   NF NYPKG  F ++F++ GDGI N D + W   R+  +AL++   FR
Sbjct  87    TADPANVAHVFTANFGNYPKGEEFAELFDVLGDGIFNADGDSWAFQRRKAHALLSDARFR  146

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGT--HFDLQEIFKRLSFDIGFQVFLDKNPGSLFVE  1015
               +  +  + +  GL P+LD  A  G+    DLQ++F RL+FD+        +PG L  +
Sbjct  147   AGVAASTARKLRDGLVPLLDGLAASGSGAAVDLQDVFVRLTFDLTAMFVFGFDPGCLAAD  206

Query  1014  PPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS  835
              P   PF  A+      + Y+H+ P    +LQK F  I   KK   A    D  I   +S
Sbjct  207   FPH-VPFAAAMDTIEEVLFYRHVTPVPCLRLQK-FLKIGHIKKMGNARRVLDASIAEFIS  264

Query  834   EKLNQLHDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFW  655
              +  +  + + D   ++      +        +FLRDT     +  G  TTSSALTW FW
Sbjct  265   LRRERAAEGEVDLLTSYLACQDEVGKSGADFHRFLRDT-TFNLMVAGRDTTSSALTWFFW  323

Query  654   LLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNH  475
             LL K+P VEAK+  E+    P + A    T    E   LVYLHAA  ESLRL+PP+P  H
Sbjct  324   LLTKHPDVEAKILEELRAHPPSSGADGHRT--AAELKQLVYLHAALSESLRLYPPVPFEH  381

Query  474   KMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPS  295
             K +   DTLPSG +V P  R++ SFYSMGRMEA+WG+DC EF+PERWL+   G  +H PS
Sbjct  382   KAAARPDTLPSGARVGPSRRVIVSFYSMGRMEAVWGKDCSEFRPERWLT-AAGRFRHEPS  440

Query  294   NKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVK  115
              KF  F+VGPRTC+G+ + +   K V A+++ R+  E ++   +V P  +++L +K G+K
Sbjct  441   YKFVAFNVGPRTCLGRDLAYSQMKAVVAAVLPRFRVE-VDAGAVVRPKLSIILHMKDGLK  499

Query  114   VKLTKRK  94
             V++ KR+
Sbjct  500   VRVHKRE  506



>gb|KEH40811.1| cytochrome P450 family protein [Medicago truncatula]
Length=504

 Score =   350 bits (898),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 197/492 (40%), Positives = 288/492 (59%), Gaps = 20/492 (4%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W+++ R    P NWP+IGMLP +L +    HD  T FLK +GGTF  +G  F N   + T
Sbjct  22    WRRN-RDEFAPINWPIIGMLPGILHHLSNFHDHTTLFLKHHGGTFRFEGAWFTNTSFIGT  80

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDP N+D+I +KNF NY +G++F+++F+ FGDGILN+ S +W   R   ++ +    F+ 
Sbjct  81    SDPMNVDHIASKNFGNYGRGSNFKEIFDFFGDGILNSSSHIWKQQRTMFHSFLKRKTFKN  140

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPS  1006
               ++T+ + VE+ L P L+  ++ G   DL++   R +FD    +    +P  L   P  
Sbjct  141   FFQQTMKKKVENCLLPFLNDVSEIGAQVDLEDALSRFTFDSICTIAFGFDPNCL---PNK  197

Query  1005  DHPFRKA-------IIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIY  847
              +  R+        +ID V  I+Y+H  P   WKLQKW   + +E+K  EA    D F+Y
Sbjct  198   FNELREIAYQKSLPVIDEV--IIYRHFKPRCLWKLQKW-LDVGQERKLKEAEKNLDSFLY  254

Query  846   P-ILSEKLNQLHDQDEDDSQNF-SMLTSHMKAYKGKPMQFLRDTFVsltisggggttssa  673
               I   K  Q      ++  +F   L        G   ++LRD  V      G GT SS 
Sbjct  255   ERITFSKQEQSKCSSSEEMDDFVKALMKEGAGNGGMDEKYLRDN-VLTLFLAGNGTISSG  313

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFP  493
             L+W FWL++ +P+VEAK+  EI    P     QT    V +   LVYLH A CE++RL+P
Sbjct  314   LSWFFWLVSTHPIVEAKIIQEIKDNWPTQEENQTPLRDV-DLDKLVYLHGALCEAMRLYP  372

Query  492   PIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGG  313
             P+P  H  ++ +D LPSG +V P TR+L S Y+MGRME IWGEDCMEFKPERW+S+  G 
Sbjct  373   PVPFEHICAINSDILPSGERVSPNTRLLYSLYAMGRMEQIWGEDCMEFKPERWVSE-RGH  431

Query  312   IKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLE  133
             I HVPS KF  F+ GPR+C+G+ + F+  K+VAA+++ ++H +++  H  + P  + VL 
Sbjct  432   IIHVPSYKFIAFNTGPRSCMGKDISFIQMKMVAAALLPKFHIKVVAGHP-ITPKLSFVLH  490

Query  132   VKHGVKVKLTKR  97
             +KHG+KVK+TKR
Sbjct  491   MKHGLKVKVTKR  502



>gb|KEH24772.1| cytochrome P450 family protein [Medicago truncatula]
Length=517

 Score =   350 bits (899),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 200/488 (41%), Positives = 281/488 (58%), Gaps = 23/488 (5%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP +GMLP  L N   +HDF+ + L   GGT E  GP F N   ++T+DP N+ YI +
Sbjct  35    TNWPFVGMLPQFLWNISDIHDFSAKLLTSKGGTMEFIGPWFTNMYAVITNDPLNVHYIMS  94

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
             K F+N+ KG  F++ F+ FG GI  TDS  W  +R     L     F    E+ +   VE
Sbjct  95    KRFDNFEKGERFRETFQPFGLGIFTTDSHQWKYNRNLLQYLFKQRSFEAFQEKIIHNKVE  154

Query  1152  SGLFPVLDHYAQR-GTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
               L P+L+H  Q+ G+  DLQ++F R +FD    + L  +P  L ++ P +    KA   
Sbjct  155   KSLIPLLNHVQQQNGSVVDLQDVFNRFTFDNICSIILGHDPNCLSIDFP-EVVCEKAFNQ  213

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLH------  814
             A  +I Y+H +P   WKLQ W   I  EKK  EA   FD+F+Y  ++ K  +L       
Sbjct  214   AEESIFYRHTVPACVWKLQSW-LQIGEEKKMTEACKVFDQFLYSCIASKCEELKKNGNKN  272

Query  813   --DQDEDDSQNFSMLTSHMKAYKGKPMQ-------FLRDTFVsltisggggttssalTWL  661
               +   +D+ +  +LT+ ++    K  +       FLRD         G  T +SALTWL
Sbjct  273   EINGQSNDAHHVDLLTALIREENSKGSESESIGNKFLRDA-AFNLFVAGRDTITSALTWL  331

Query  660   FWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPM  481
             F+L+A +PLVEAK+  EI   +   H ++     V+E   LVYLH A CE+LRLFPPIP 
Sbjct  332   FYLVATHPLVEAKIVEEI--KENFGHKEKPWILSVDEVKKLVYLHGAICEALRLFPPIPF  389

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
               K ++E D LPSGH V P   +  S YSMGR   IWGEDC+EFKPERW+S+  GGI + 
Sbjct  390   ERKQAIEADILPSGHHVFPNKMVFFSLYSMGRDANIWGEDCLEFKPERWISE-RGGIVYA  448

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             PS KF  F+ GPRTC+G+++  +  K++AASI++ Y   ++  H  V PS ++VL +KHG
Sbjct  449   PSYKFFSFNAGPRTCLGRELALIQVKMIAASILWNYCVHVVGDHQ-VTPSLSIVLLMKHG  507

Query  120   VKVKLTKR  97
             +KVK++KR
Sbjct  508   LKVKISKR  515



>gb|KDP46411.1| hypothetical protein JCGZ_10251 [Jatropha curcas]
Length=468

 Score =   348 bits (893),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 196/472 (42%), Positives = 284/472 (60%), Gaps = 16/472 (3%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             M+P +L +A +LHDF T  L+Q+GGTF  KG  F+  D LL SDP N+ YI ++NF NY 
Sbjct  1     MIPDILWHASKLHDFTTSILEQSGGTFLFKGIWFSGSDFLLLSDPINLHYILSRNFPNYH  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  F+++FE  G+GI N+D++ W + R+  ++ +    F  +++ ++ Q +  GLF VL
Sbjct  61    KGKEFKEIFEPLGNGIFNSDNDSWRIQRRIVHSFLKDKRFELAVKNSMEQKILKGLFLVL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             D+ ++  +  D+Q++ +R +FD    + L  +P SL  E   +  F KA  +    ILY+
Sbjct  121   DNASKLESEVDMQDVIQRFTFDNICHLVLGFDPTSLCAE-SHEVAFEKAFDEIEEIILYR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDSQNFSMLT  772
             H+LP   WKLQ+W   I  EKK  +AW  FD F+   ++ K  QL  Q  +D   F +LT
Sbjct  180   HLLPGCVWKLQRW-LQIGEEKKFTKAWRLFDGFLQQCITRKQKQLAQQKSND---FDLLT  235

Query  771   SHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLFN  613
               +       +    K  +FL D      +S G  T  +AL WLFWL+ K+PLVE K+  
Sbjct  236   FFLMKDDHQDQEEITKSDKFLAD-LALNLLSAGRDTIGAALVWLFWLVGKHPLVEKKILE  294

Query  612   EILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGHK  433
             EI K   Q  +     F  EE   LVYLHA  CE LRL+PP+P  HK S++ D LPSGH 
Sbjct  295   EI-KENLQGESNNWRLFNFEELKKLVYLHATICEVLRLYPPVPFEHKTSIKPDVLPSGHH  353

Query  432   VKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTCI  253
             V    RIL S YSMGRM+ IWGEDC+EF+PERW+S+  G IKH PS KF  F+ GPRTC+
Sbjct  354   VPENMRILYSLYSMGRMKDIWGEDCLEFRPERWISE-KGRIKHFPSYKFIAFNSGPRTCL  412

Query  252   GQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             G+ + F+  K VA+++++ Y   ++E H  + P  +++L +  G+KVK++KR
Sbjct  413   GKDLAFIKLKTVASAVLWNYSLRIVEDHH-ISPKISVILYMDKGLKVKVSKR  463



>ref|XP_007031595.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY02521.1| Cytochrome P450, putative [Theobroma cacao]
Length=494

 Score =   349 bits (895),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 185/469 (39%), Positives = 283/469 (60%), Gaps = 16/469 (3%)
 Frame = -3

Query  1533  SRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPA  1354
             +R+S   TNWP++GMLP LL +A R+  F  + ++Q+GGT E++GP F +   ++T+D  
Sbjct  25    NRKSPPITNWPIVGMLPGLLYSARRIFAFLNDCVRQSGGTCEIRGPWFPSLYFIITADHM  84

Query  1353  NIDYIHNKNFNNYPKGTHFQKMF-EIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLE  1177
             N ++I  KNF+NY KG+ F ++F +  G+GI N++S  W   RK    LM    F    +
Sbjct  85    NANHILCKNFDNYEKGSEFNEIFFDCLGEGIFNSNSHSWKSQRKVMLLLMKDDKFVLHFQ  144

Query  1176  RTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHP  997
             R + + +E  L  VL+H+ + G   DLQ++ +R S+D+   + +  +P SL VE  S+ P
Sbjct  145   RILREKLEKSLIIVLEHFMKLGIEVDLQDVLQRFSYDVVCMLAVGFDPSSLSVEL-SEVP  203

Query  996   FRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL  817
              + A   A   +LY+H++P R WKLQ+W   I  EKK ++A  T D F+Y  ++ K  +L
Sbjct  204   IKTAFTQAEERLLYRHLMPVRLWKLQRWL-QIGEEKKLSKALKTVDTFLYQCIASKREKL  262

Query  816   HDQDEDDSQNFSMLTS-------HMKAYKGKPMQFLRDTFVsltisggggttssalTWLF  658
               +   +   +  +T+        M +  GK  + LRD  V++  +G    ++S   W F
Sbjct  263   RCKFLAEEDKYDFVTAFMVQEEGEMTSVDGKSDKLLRDVAVNIMSAGKDTISASLS-WFF  321

Query  657   WLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMN  478
             WLLA NP VE+K+  E+    P  + ++   F VE     VYL A  CE+LRL+P IP+N
Sbjct  322   WLLAMNPSVESKILQEMRANSPSINDEKNMFFSVEGLKRFVYLDAVLCETLRLYPAIPIN  381

Query  477   HKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVP  298
             HK +++ D LPSGH +   TR+L +FY+MGRME IWGEDC+EFKPERW+S+  G + HVP
Sbjct  382   HKTAIQPDILPSGHHIVRNTRVLINFYAMGRMEEIWGEDCLEFKPERWISE-RGDLVHVP  440

Query  297   SNKFPIFSVGPRTCIGQKMFFMVAKIVAASII----FRYHCELMEPHTL  163
             S+KF  F+ GPRTCIG+K+ F+  K+VA S++    F++   +M P  +
Sbjct  441   SHKFIAFNAGPRTCIGRKISFVQMKLVAISVLWIIKFKWFKAIMLPQAM  489



>emb|CDP04331.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   348 bits (893),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 191/477 (40%), Positives = 279/477 (58%), Gaps = 20/477 (4%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             M+P L  N HR  D+ TE L+++GGTFE KGP FAN DML+TSDPAN+++I +K+F+N+ 
Sbjct  1     MMPDLFLNVHRAQDYITEILQESGGTFEFKGPWFANMDMLVTSDPANVNHILSKSFSNFQ  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  F+KMF+I G GI N + E W+  RKT   L+NH GF+  +  T    +E GL PVL
Sbjct  61    KGPEFEKMFDILGKGIFNAECESWESPRKTIMPLINHQGFQKFVGITSWNKLEKGLIPVL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             +  A+ G   DLQ++F + +FD    + L  +P S  ++ P + P   A  DA  A+ Y+
Sbjct  121   ELAAKSGMEVDLQQLFAKFTFDTTCILVLGHDPASPGIDLP-ESPLGNAFADAEEAVFYR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDE----DDSQNF  784
             H++P   WK+Q+W   I  EKK  +A +   +F+   +S K   L   ++     D    
Sbjct  180   HVVPRTCWKIQRW-LQIGAEKKLTKARENLHQFLATNISSKSENLEGINQTAISQDGGGL  238

Query  783   SMLTSHMKAYKG----------KPMQFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
              +L  +MKA                +  RD  +   I  G     + LTW FWLLA NP+
Sbjct  239   DLLARYMKAVGVLKEENRTSDIVSQKIWRDALL-NLIFAGKDIKGAGLTWFFWLLASNPI  297

Query  633   VEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETD  454
              E+ +  EIL    Q    + +   +EE    VYL  A CESLRLFPP+   HK  +  D
Sbjct  298   EESMVRKEILS-NLQVKEGRWQFSNLEEMKKQVYLRGALCESLRLFPPVATQHKAPVNPD  356

Query  453   TLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFS  274
              LPSGH + P T+ L  F++MGRME IWG+ C EFKP+RW+S+   GI H PS KF  F+
Sbjct  357   ILPSGHSINPNTKTLLPFHAMGRMETIWGKVCWEFKPQRWISE-QVGITHEPSFKFTAFN  415

Query  273   VGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              GPR+C G+++ F+  KIVA +++ R+H  ++E H   VP ++++L ++HG+K+K++
Sbjct  416   AGPRSCKGKEICFIQMKIVAVALLCRFHFHILEGHQ-TVPDNSVILHMRHGLKLKVS  471



>ref|XP_008440140.1| PREDICTED: cytochrome P450 86B1-like isoform X2 [Cucumis melo]
Length=507

 Score =   349 bits (896),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 196/479 (41%), Positives = 289/479 (60%), Gaps = 11/479 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P N P  GM   +L N HR+ D  T  L+ +  TF  KG  FA+ D   TSDP+NI +I 
Sbjct  33    PWNLPFFGMTLTILCNLHRIQDHFTHILRLSSSTFFFKGAWFADLDFFFTSDPSNIHHIL  92

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF  YPKG  F+ +FEI GDGI N+DS++W   RKT ++L++   +   +E+   + V
Sbjct  93    STNFERYPKGPDFKYIFEILGDGIFNSDSDVWKNLRKTAHSLVHDHKYLQFVEKITLKKV  152

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             +SGL PVL    + G+  DLQ++F+R SFD         +  SL +E P + PF KA+ D
Sbjct  153   KSGLVPVLQTACENGSVLDLQDLFQRFSFDSTCMFVTGFDLQSLSLELP-EVPFSKAMDD  211

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKL----NQLHDQ  808
             A   I  +H +P++ WK Q     I    +  +AWDT D+ +  +++ K     NQ+ ++
Sbjct  212   AEEVIFLRHFIPKKIWKFQNK-LQIGPPMRMKQAWDTIDETVGKLIASKRESLQNQMKEE  270

Query  807   DEDDSQNFSMLTSHM-KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLV  631
              ++ ++   ++TS++  +      +FLRDT V   +  G  T SSAL+W F+ L+ NP V
Sbjct  271   GDEQTEGVDLITSYITSSIDNDDDKFLRDT-VLNFMIAGRDTLSSALSWFFFCLSNNPTV  329

Query  630   EAKLFNEILKVKPQNHA-KQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETD  454
               K+  E+    P +    Q   F ++E   LVY H A CE+LRL+PP+P  HK++ + D
Sbjct  330   IEKIREELKLTIPTDEPHDQWRIFSIDELKKLVYFHGALCEALRLYPPVPFQHKVATQHD  389

Query  453   TLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFS  274
              LPSGH +KPKT+I+ S Y++GR   +WG+DC+EFKPERW+S+  G IKHVPS KF  F+
Sbjct  390   KLPSGHHIKPKTKIVFSLYALGRTSEVWGKDCLEFKPERWISE-KGSIKHVPSYKFLAFN  448

Query  273   VGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
              GPRTC+G+++ F   KIVAA+II  Y+      H  VVP+ +++L +KHG KV +TKR
Sbjct  449   AGPRTCLGKEVAFTEMKIVAATIIHNYNIIQQIGHK-VVPNPSIILHMKHGFKVNVTKR  506



>gb|EAY88475.1| hypothetical protein OsI_09946 [Oryza sativa Indica Group]
Length=507

 Score =   349 bits (895),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 190/485 (39%), Positives = 277/485 (57%), Gaps = 10/485 (2%)
 Frame = -3

Query  1542  KKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTS  1363
             K   + +  P  WP+IGMLP LL N HR+HD+ T  L  +   F   GP  +N  + +T 
Sbjct  25    KSKRKNTAIPVCWPLIGMLPDLLANRHRIHDWITSLLTASQLNFRFTGPPSSNMRLFITC  84

Query  1362  DPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPS  1183
             DPAN+ ++   NF+NYPKG  F ++F+IFGDGI N D + W   R     L     FR  
Sbjct  85    DPANVRHVFTSNFSNYPKGPDFTEIFDIFGDGIFNVDGDSWRRQRAKAQLLTCRPRFRAF  144

Query  1182  LERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSD  1003
             + R     VE  L P+L H+A  G   +LQ++F RL+FD    V    + G L +  P +
Sbjct  145   VSRCSRAKVEKALLPLLAHFAATGESCNLQDVFMRLTFDTTTMVVSGADTGCLAISLP-E  203

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLN  823
               F +A+ DA   +L +HI+P  +WKL +   GI  E+  AEA    D F+   + ++  
Sbjct  204   VAFARAMDDATRVLLVRHIVPLSWWKLVRR-LGIGYERTMAEALRACDHFVNETIEKRRA  262

Query  822   QLHDQDEDDSQNFSMLTSHMK---AYKGKPMQFLRDTFVsltisggggttssalTWLFWL  652
             +    + D S +  +L+S++      +     FLRDT     IS G   ++ AL+W F+L
Sbjct  263   EKAKGEADGSAD--LLSSYINDDDEEENASSSFLRDT-TMNLISAGRDASAMALSWFFYL  319

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             L KNP V +K+  E+  V          TF  +E   LVYLHAA  E+LRL+PP+P+ HK
Sbjct  320   LTKNPCVVSKILEELDSVNGITTPDGMVTFDPDELRPLVYLHAALSETLRLYPPVPLEHK  379

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
               L  D LPSGH V+P  +I+ S ++M RMEA+WG DC EF+PERW+S   G +++VPS 
Sbjct  380   GVLAADALPSGHDVRPGDKIVVSLFAMARMEAVWGSDCREFRPERWISK-DGKLRYVPSY  438

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  FS GPRTC+G+ M F+  K VAA+++  +  E M  H +V P+ ++VL +K+G+ V
Sbjct  439   KFMTFSSGPRTCLGKDMAFVQLKAVAAAVVKNFEIEAMPGH-VVEPALSIVLHMKNGLMV  497

Query  111   KLTKR  97
             ++ +R
Sbjct  498   RVKRR  502



>ref|XP_004968446.1| PREDICTED: cytochrome P450 86B1-like [Setaria italica]
Length=506

 Score =   348 bits (893),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 187/485 (39%), Positives = 286/485 (59%), Gaps = 8/485 (2%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             ++ + +RR   PTNWPVIG LPA+  NA R+H++ TEFL   G ++ ++GP  +  D+++
Sbjct  27    LFHRLNRRDGLPTNWPVIGALPAITINAGRVHEWVTEFLCAAGLSYVIEGPWGSPVDVVV  86

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T+DPAN+ ++   NF NYPKG  F  +F++ G GI N D E W   R+  +AL++   FR
Sbjct  87    TADPANVAHVFTTNFANYPKGKEFTALFDVLGGGIFNADGEWWAFQRRKAHALLSDARFR  146

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
              ++  +  + +  GL P+LD  A  G   D+Q++F RL+FD+        +PG L    P
Sbjct  147   AAVAASTARKLREGLVPLLDGLAASGATVDMQDVFVRLTFDLTAMFVFGVDPGCLAPGFP  206

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
                PF  A+      + Y+H+ P  + +LQK +  I   K+  +A    D  I  ++S +
Sbjct  207   F-VPFAAAMDTIEEVLFYRHVTPVPWLRLQK-YLKIGHNKRMGKARRVLDASIAELISLR  264

Query  828   LNQLHDQDEDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLL  649
               +    D D   ++      +     +  +FLRDT     +  G  TTSSALTW FWLL
Sbjct  265   RERAGADDADLLTSYLACQDEVGKSGAEFDRFLRDT-TFNLMVAGRDTTSSALTWFFWLL  323

Query  648   AKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
              K+P VEAK+ +E+    P + A      +++    LVYLHAA  ESLRL+PP+P  HK 
Sbjct  324   TKHPDVEAKILDELRAHPPSSGADHHTAAELKR---LVYLHAALSESLRLYPPVPFEHKA  380

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
             +   DTLPSG  V P  R++ SFY+MGRMEA+WG+DC+EF+PERWL+   G ++H PS K
Sbjct  381   AARPDTLPSGTPVGPSRRVIVSFYAMGRMEAVWGKDCLEFRPERWLT-AAGRLRHEPSYK  439

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+VGPRTC+G+ + +   K V A+++ R+  E ++   +V P  +++L +K G+KV+
Sbjct  440   FVAFNVGPRTCLGRDLAYAQMKAVVAAVLPRFRVE-VDAGAVVRPKLSIILHMKDGLKVR  498

Query  108   LTKRK  94
             + KR+
Sbjct  499   VHKRE  503



>gb|EYU31098.1| hypothetical protein MIMGU_mgv1a004607mg [Erythranthe guttata]
Length=518

 Score =   348 bits (893),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 198/508 (39%), Positives = 303/508 (60%), Gaps = 32/508 (6%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNG-GTFELKGPAFANFDML  1372
             +W+   R +    NWP+IGMLPALL +  R+HD  TE L++   GTF  KGP F+  ++L
Sbjct  17    LWRNKKRIAW---NWPLIGMLPALLHHVGRIHDGCTEILRRTRRGTFHFKGPWFSGMEIL  73

Query  1371  LTSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGF  1192
              T +PAN+ YI + NF+N+PKG  F+++F++ GDGI N+D++ W   R+     ++H  F
Sbjct  74    GTVNPANVHYIMSANFHNFPKGPKFREIFDVLGDGIFNSDADSWRHQRRAARGFLSHRRF  133

Query  1191  RPSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEP  1012
                L +     V  GL PVL+  ++     DLQ+IF+RL+FD    +    +PG L V+ 
Sbjct  134   HRFLVKISRDKVAYGLVPVLEMASKENWVLDLQDIFQRLTFDTTCALVTGFDPGCLSVDL  193

Query  1011  PSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSE  832
             P + PF KA+ D   AI  +H+LPE+ WK+ +W   +  E+K ++     D  I   +S+
Sbjct  194   P-EVPFSKAMDDVEEAIFLRHVLPEKIWKMLRW-LRVGSERKMSDGSKILDDVIGKYISK  251

Query  831   KLNQLHDQDEDD--------SQNFSMLTSHMKAYKG-----KPMQ------FLRDTFVsl  709
             K ++L D ++               +LTS++           P+Q      FLRDT +  
Sbjct  252   KRDELRDGNKKKFIEDENEDGDGDDLLTSYINGGDSISQTLDPIQTADEDKFLRDT-ILN  310

Query  708   tisggggttssalTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTE---TFKVEECCD-  541
              +  G  TTSSALTW  WL++ +  VE K+  E+  V       + E    FKVEE  + 
Sbjct  311   LMIAGRDTTSSALTWFTWLVSTHQEVERKILEELKSVISDQDPSEGEFPRVFKVEEITNK  370

Query  540   LVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGED  361
              VYLH A CE+LRL+PP+P  HK   + D LPSGH V P+ +++   Y+MGRME++WG+D
Sbjct  371   AVYLHGALCEALRLYPPVPFQHKEPNQPDILPSGHYVHPEMKVMFFLYAMGRMESVWGKD  430

Query  360   CMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCEL  181
             C+EFKPERW+++  G IKH PS KF  F+ GPRTC+G+++ F+  K+VAA+II+ Y   +
Sbjct  431   CLEFKPERWITE-RGSIKHEPSYKFLAFNAGPRTCLGKEVAFVQMKMVAATIIYNYRVRV  489

Query  180   MEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             ++ H  V P+ +++L ++ G+KV+++KR
Sbjct  490   VDGHR-VEPNCSVILYMRDGLKVRVSKR  516



>ref|XP_006405350.1| hypothetical protein EUTSA_v10027722mg [Eutrema salsugineum]
 gb|ESQ46803.1| hypothetical protein EUTSA_v10027722mg [Eutrema salsugineum]
Length=519

 Score =   348 bits (893),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 196/482 (41%), Positives = 280/482 (58%), Gaps = 17/482 (4%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P NWPV+GMLP +L   H ++D++ E L+ +  TF+ KGP FA  D L+T D ANI Y+ 
Sbjct  41    PWNWPVLGMLPGVLLRLHHIYDYSVEVLECSNLTFQFKGPWFAGMDTLVTVDSANIHYML  100

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
               NF+NY KG  F ++FE+FGDGI+N+DS+LW   RK + A  NH GF+     T    +
Sbjct  101   TSNFSNYIKGPEFHEIFEVFGDGIVNSDSDLWRNLRKLSQATFNHQGFQNFSTFTTRSKL  160

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
               GL P+L+H+A+     DLQ++F+R  FD  +      +P SL +E P +  F KA  D
Sbjct  161   TDGLVPLLNHFAEEEMVVDLQDVFQRFMFDTTYIFLTGSDPRSLSIEMP-EAEFAKAFDD  219

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
                A++Y+HI P   W LQKW  GI  EK   EA  T D+     +S K  ++  Q    
Sbjct  220   IGEAVVYRHIAPRFLWNLQKW-IGIGTEKNMMEANATLDRVCTKFISSKREEIRSQGITR  278

Query  795   SQN--FSMLTSHMKAYKGK-------PMQFLRDTFVsltisggggttssalTWLFWLLAK  643
             SQ     +LT H+K    K         +FLRD +    ++ G  +T++ LTW FW+L++
Sbjct  279   SQGDCKDLLTYHIKLDTNKYELLNPEDDKFLRD-YAVGIMAAGRDSTAATLTWFFWILSE  337

Query  642   NPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSL  463
             NP V  K+  E+    P+    Q ++  + +   LVYLHAA  ESLRL+PPIP   K  +
Sbjct  338   NPNVLTKILQEMNTNLPKKGNGQDKSSYMNK---LVYLHAALSESLRLYPPIPFERKSPI  394

Query  462   ETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFP  283
             + D LPSGHKVK  T I+   Y++GRM+AIWGED ++FKPERW+S+  G +KH PS KF 
Sbjct  395   KPDVLPSGHKVKSNTNIMIFIYALGRMKAIWGEDAIDFKPERWISET-GELKHEPSFKFL  453

Query  282   IFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLT  103
              F  GPRTC+G+ +   + K V   I+  Y   ++     + P   L+L++KHG+K  + 
Sbjct  454   SFMAGPRTCLGKNLAMNLMKTVIVEILQNYEIRVISGQK-IEPKPGLILQMKHGLKATIA  512

Query  102   KR  97
             K+
Sbjct  513   KK  514



>ref|XP_010680859.1| PREDICTED: cytochrome P450 86B1-like [Beta vulgaris subsp. vulgaris]
Length=499

 Score =   347 bits (891),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 198/478 (41%), Positives = 291/478 (61%), Gaps = 15/478 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PTNWP+IGMLP LL+N +R+++   E ++++  TF  KGP F+N ++L++ DP NI+++ 
Sbjct  26    PTNWPLIGMLPTLLKNVYRINEAIIELMERSELTFHFKGPWFSNVNILVSVDPTNINHVL  85

Query  1335  NKNFNNYPKGTHFQKMF-EIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQT  1159
             +K+F +Y KG    ++  E  GDGIL TDS +W  HR   ++  +H  F   L     + 
Sbjct  86    SKHFEDYVKGPKLYEILGEPLGDGILVTDSTVWLHHRNVAHSFFSHPKFHQYLVDVTWKK  145

Query  1158  VESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAII  979
             V++GL PV DH +++    DLQE+F R  +D    + +D +P SL V+ P D P  KA+ 
Sbjct  146   VKNGLIPVFDHVSEQNIEIDLQELFLRFGYDTMCTIMMDHDPTSLSVDSP-DFPLLKAVA  204

Query  978   DAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED  799
             D  +  + +H +P   WKLQ+W   +  EKK  + W   D FIY  +  K     ++D+D
Sbjct  205   DLEHGAIMRHAVPTWIWKLQRWL-NVGYEKKFRQGWKILDNFIYNCIDRKRETKVNKDQD  263

Query  798   -DSQNFSMLTSHM--KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVE  628
              D  +F +LT  M  +       +FLRDT ++     GG TTS+AL+W F+LL+ NP V 
Sbjct  264   FDEVSFDLLTFFMDNEDKNTNDDKFLRDT-ITNFFLAGGETTSTALSWFFYLLSNNPRVF  322

Query  627   AKL---FNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
              K+    N I+ +      K    FK E    LVYLHAA CE+LRL+P +  N K  +E 
Sbjct  323   HKIKEELNSIMTLNDDIEDKILRNFK-ELSNKLVYLHAALCETLRLYPSVQFNPKTPVEP  381

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
               LPSGH+V P T IL   ++MGRM++IWG+DC EFKPERW+ + GG IKH PS KF +F
Sbjct  382   QILPSGHRVNPNTEILFDMHAMGRMKSIWGDDCNEFKPERWILE-GGMIKHEPSYKFSVF  440

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFR-YHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
             S GPR+CIG++M F   KI+ A++I + YH + +E +   VP+ ++VL +K+G KVK+
Sbjct  441   SAGPRSCIGKQMAFTQMKIIVAAVIIQNYHIKAVEKYH--VPTASMVLRMKNGFKVKI  496



>ref|XP_006283573.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
 gb|EOA16471.1| hypothetical protein CARUB_v10004625mg [Capsella rubella]
Length=505

 Score =   347 bits (891),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 192/481 (40%), Positives = 279/481 (58%), Gaps = 19/481 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+GM+P  L   HR+++F  E L+    TF  KGP F   DML T DPANI YI + 
Sbjct  34    NWPVLGMIPGFLLVLHRIYNFGVETLEATDLTFFFKGPWFTGMDMLFTVDPANIHYILSS  93

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+NY KG  F+++F++FG+ I ++DSELW   RK    ++NH GF+          +  
Sbjct  94    NFSNYTKGADFKEVFDVFGEMIFSSDSELWKNQRKAAQFMLNHQGFQKLSMSATRSKLYD  153

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+ D   + G   DLQE+FKR +FD  F +    +P SL +E P+   + KA+ D  
Sbjct  154   GLVPLFDQCCEEGKVVDLQEVFKRFTFDTTFFLVTGCDPKSLTIEMPAVE-YAKALDDLG  212

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED---  799
               I Y+HI P+  WKLQ W  G+ +EK+ A+A  TFD+     ++ K  ++  Q  D   
Sbjct  213   EGIFYRHIKPKFLWKLQNW-MGLGQEKRMAKADATFDRVSAKYITAKREEIRSQGIDHHS  271

Query  798   DSQNFSMLTSHMK-------AYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             D ++  +L+SH+K         K    +FLRDT +      G  T +SAL+W FWLL++N
Sbjct  272   DGESEDLLSSHIKLDTTKYELLKPSDDKFLRDT-ILAFNLAGRDTMASALSWFFWLLSEN  330

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P V  K+  EI+        +  +    E+   LVYLHAA  ES+RL+PP+    K  ++
Sbjct  331   PQVVTKIRKEIIDKNISKTGRNAQ----EKLDKLVYLHAALYESVRLYPPVVFQRKSPIK  386

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
              D LPSGHKV+  + I+   Y +GRM A+WGED  EFKPERW+++  GG++H PS KF  
Sbjct  387   ADMLPSGHKVEANSVIIIYLYGLGRMRAVWGEDAAEFKPERWVTET-GGLRHAPSFKFLS  445

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPRTC G+++   + K V   I+  Y  E+++    + P   L+L +KHG++V +TK
Sbjct  446   FNAGPRTCPGKQLAMTLMKTVVVEILQNYDIEVIKGQK-IEPDPGLMLHMKHGLRVTITK  504

Query  99    R  97
             R
Sbjct  505   R  505



>gb|KFK31020.1| hypothetical protein AALP_AA6G057700 [Arabis alpina]
Length=508

 Score =   348 bits (892),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 196/481 (41%), Positives = 282/481 (59%), Gaps = 21/481 (4%)
 Frame = -3

Query  1506  WPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKN  1327
             WPV+GMLP+LL   HR++++  E ++ +  TF+ KGP F   DML T DPANI +I + N
Sbjct  35    WPVLGMLPSLLMVLHRMYEYGIEIMEFSDLTFQFKGPWFVGMDMLFTVDPANIHHIMSSN  94

Query  1326  FNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESG  1147
             F NY KG  FQ +F++FGDGI+ TDSELW   RK+  A+++H GF+     T+   ++ G
Sbjct  95    FPNYIKGPDFQDVFDVFGDGIITTDSELWKDLRKSYQAMVHHQGFQRFSMSTMTSKLKDG  154

Query  1146  LFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVN  967
             L P+LDH+A+ GT  +LQ++F R +FD    +    +P SL +E   D    +A+ D   
Sbjct  155   LVPLLDHFAEEGTTVNLQDVFGRFTFDTILILITGSDPRSLSIEMHEDE-LARALDDVGE  213

Query  966   AILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL----------  817
              ILY+HI P+  WKLQ W   I +EKK  EA  TFD+     +S K  ++          
Sbjct  214   GILYRHIKPKFLWKLQNW-MRIGQEKKMVEADATFDRVCSKYISAKREEIIRSQGILDIS  272

Query  816   HDQDEDDSQNFSML-TSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             + + ED   +F  L T+  K       +FLRDT +   I  G  TT+SAL+W  WLL++N
Sbjct  273   NGESEDLLSSFIKLDTTKYKLLNPSNDKFLRDT-ILAFILAGRDTTASALSWFLWLLSEN  331

Query  639   PLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLE  460
             P V AK+  EI+           E         LVYLH A  E++RL+PP+    K S+E
Sbjct  332   PQVVAKIRQEIIDTDLSRTGNGQENLD-----KLVYLHGALNEAMRLYPPVSFGRKSSVE  386

Query  459   TDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPI  280
             +D LPSGH+V   + I+ S Y++GRM+A+WGED ++FKPERW+S+  GG+K  PS KF  
Sbjct  387   SDVLPSGHRVDANSMIIISLYALGRMKAVWGEDALKFKPERWISE-NGGLKQEPSFKFLA  445

Query  279   FSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             F+ GPR C+G+ +     K VA  I+  Y  ++ +    + P    +L +KHG+KV +TK
Sbjct  446   FNSGPRICLGKNLAMTQMKTVAVEILHNYDIKVTKGQK-IEPVLGFILSMKHGLKVTITK  504

Query  99    R  97
             R
Sbjct  505   R  505



>ref|XP_009381852.1| PREDICTED: cytochrome P450 86B1-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   348 bits (893),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 192/492 (39%), Positives = 289/492 (59%), Gaps = 22/492 (4%)
 Frame = -3

Query  1530  RRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPAN  1351
             R S  P NWPV GMLPA++ + H LHD+  + L   G T+  +GP F   +M+L+ DPAN
Sbjct  35    RHSRMPINWPVFGMLPAVVVHFHHLHDYLADLLLHVGCTWLFRGPWFLGMNMVLSCDPAN  94

Query  1350  IDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERT  1171
             +++I + NF NY KG  F ++F+I GDG+ N D+E W + RK  +  +    FR  +   
Sbjct  95    VNHILSDNFANYRKGDEFNEVFDILGDGLFNADAESWRIQRKLAHNYIGDRSFRSFVATA  154

Query  1170  VCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFR  991
               +  E GL PVL   ++R    +LQ++F RLSFD+   +    + G L    P+  PF 
Sbjct  155   TREKTEKGLLPVLLLKSEREEVAELQDLFMRLSFDVTSLMVFGVDHGCLSANLPAI-PFA  213

Query  990   KAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK------  829
              AI DA  A+L++H +P+ +WK+ K    +  EKK A+AW+  D FI  ++SE+      
Sbjct  214   VAIDDAWEALLFRHAVPKSWWKILK-RLNVGTEKKLAKAWEVIDHFICQVISERREERRV  272

Query  828   --LNQLHDQDEDDSQNFSMLTSHM----KAYKGK--PMQFLRDTFVsltisggggttssa  673
               +N +  +      N  +LTS++    +  +GK  P +FLRD  V   +  G    +  
Sbjct  273   ASINAVQKETSTPRTN-DLLTSYIDNVVEEIQGKFEPHKFLRDN-VLTFMIAGRDGFAIC  330

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFP  493
             L+W FWLL+KNP  EAK+  E+     ++  K++  F  EE   +VYLH A CE+LRLFP
Sbjct  331   LSWFFWLLSKNPTAEAKILEEL--SLHRSREKESMVFDAEELGRMVYLHGAVCETLRLFP  388

Query  492   PIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGG  313
             P+P   K ++  D LPSG KV+P  +IL S Y+MGRME IWG+DCMEF P RW+++  G 
Sbjct  389   PVPYEEKTAVNPDVLPSGMKVEPGDKILFSVYAMGRMEEIWGKDCMEFNPGRWIAE-DGR  447

Query  312   IKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLE  133
              KHVP+ KF  F+ GPR C G+ +     K VAA++++ +  E+++   +V P + ++L 
Sbjct  448   PKHVPAYKFMAFNSGPRICPGRDIALTQIKTVAAAVVWNFRVEVLD-RQMVAPKNAVLLR  506

Query  132   VKHGVKVKLTKR  97
             ++HG+ VKL +R
Sbjct  507   MQHGMMVKLRRR  518



>ref|XP_006280314.1| hypothetical protein CARUB_v10026237mg [Capsella rubella]
 gb|EOA13212.1| hypothetical protein CARUB_v10026237mg [Capsella rubella]
Length=515

 Score =   348 bits (892),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 200/483 (41%), Positives = 285/483 (59%), Gaps = 17/483 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             +WPV+GM+P L    HR++D   E L+    TF  KGP FA  DML+T+DPANI YI N 
Sbjct  35    SWPVLGMVPDLFLMLHRIYDSIVERLESTELTFLFKGPWFAGMDMLITADPANIHYILNS  94

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+N+ KG+ F ++F+ F   +L  DS  W   RK T  ++NH GF+     T+   V+ 
Sbjct  95    NFSNFVKGSEFIEVFDAFECALLTKDSVAWKTQRKATQVMINHQGFQRLSMSTIRSKVKD  154

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLD-KNPGSLFVEPPSDHPFRKAIIDA  973
             GL PVL+H A+ GT  DLQ++F+R +FD          +P SL +E P      KA  D 
Sbjct  155   GLVPVLNHIAEEGTTVDLQDVFRRFTFDTSLVTITGCDDPRSLSIEMPEVES-AKAFDDI  213

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDS  793
             V  + Y+H+ P   WKLQK   G+  EKK  EA   FD+     +S +  ++      +S
Sbjct  214   VEGVFYRHVKPRLLWKLQK-LIGVGIEKKMTEAGAVFDRVCAKYVSARKEEIKRSQGINS  272

Query  792   --QNFSMLTSHMKAYKGK-----PM--QFLRDTFVsltisggggttssalTWLFWLLAKN  640
               ++  +LTSH+K    K     P+  +FLRD  V   +  G  TT+SALTW FWLL++N
Sbjct  273   SVESEDLLTSHIKLDTTKYQLLDPINDKFLRDN-VLALLLAGRDTTASALTWFFWLLSEN  331

Query  639   PLVEAKLFNEILKVKPQNHAKQTETF--KVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             P V  K+  EI K+ P++ + Q +     +E    LVYLHAA CE++RL+PP+P+     
Sbjct  332   PNVMTKIRQEIDKILPRSSSGQEKPSYDPMEHLNKLVYLHAALCETMRLYPPVPLERVSP  391

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
             LE+D LPSGHKV+  ++IL   Y++G+M  IWGED +EFKPERW S+  G ++HVP+ KF
Sbjct  392   LESDVLPSGHKVEANSKILIFIYAVGKMRTIWGEDALEFKPERWNSET-GELRHVPAFKF  450

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPR C+G+ +  M+ KIVA  I+  Y  ++ +      P+ +L L +KHG KV +
Sbjct  451   LAFNAGPRVCLGKHIAMMLMKIVAVEILQNYDIKVAKGQKF-EPNTSLFLRMKHGFKVTI  509

Query  105   TKR  97
              KR
Sbjct  510   NKR  512



>gb|ABF93891.1| Cytochrome P450 family protein [Oryza sativa Japonica Group]
Length=536

 Score =   348 bits (893),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 190/476 (40%), Positives = 283/476 (59%), Gaps = 10/476 (2%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFA-NFDMLLTSDPANIDYI  1339
             P  WP++GMLP LL N H+LHD+ T FL  +   F   GP  + N     T D AN+ +I
Sbjct  34    PVCWPLVGMLPDLLVNRHQLHDWITSFLTASQLNFRFIGPTMSSNMRFFFTCDSANVRHI  93

Query  1338  HNKNFNNYPKGTHFQKMFE-IFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQ  1162
                NF NYPKG  F ++F+   GDGI N D + W   R  T  LM +  F+  + R    
Sbjct  94    FTSNFANYPKGPDFAEIFDDTLGDGIFNVDGDSWRRQRAKTQLLMYNHRFQSFVSRCSSD  153

Query  1161  TVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDH-PFRKA  985
              VE+ L P+L H+A  G   +LQ++F RL+FD+   +   ++PG L +  P    PF +A
Sbjct  154   KVENALLPLLSHFAGTGERCNLQDVFMRLTFDMSTMLASGEDPGCLAISLPMPKVPFVRA  213

Query  984   IIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD  805
             +      +L +HI+P   WKL +   G+  E+K AEA  T ++FIY  + ++  +  ++ 
Sbjct  214   VDYTTRVLLVRHIIPLSLWKLARRL-GVGFERKMAEALRTINQFIYETIVKRRAKKANEG  272

Query  804   EDDSQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
              +DS++  +L+S++K        FLRDT     I+ G  T  SAL+W F+LL KNP V +
Sbjct  273   IEDSED--LLSSYLKDDDENADTFLRDT-TMTLIAAGRDTIGSALSWFFYLLTKNPHVAS  329

Query  624   KLFNEILKV-KPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTL  448
             K+  E+  V +         TF  +E   LVYLHAA CESLRL+PP+P++HK  +  D +
Sbjct  330   KILEELDSVERATTTPDGMVTFDPDELKSLVYLHAAVCESLRLYPPVPLDHKGVVAADVM  389

Query  447   PSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVG  268
             PSGHKV+P  +I+ S Y+MGR E++WG DCMEF+PERW+SD  G +++VPS KF  F  G
Sbjct  390   PSGHKVRPGDKIVVSIYAMGRTESVWGSDCMEFRPERWISD-DGKLRYVPSYKFTPFITG  448

Query  267   PRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             PRTC+G+ M  +  K+VAA+++  +  E +  H +V P  ++VL +K+G+ V++ +
Sbjct  449   PRTCLGKDMALVQLKVVAATVVKNFEIEAVPGH-IVEPKLSMVLHMKNGLMVRVKR  503



>gb|KHN45347.1| Cytochrome P450 86B1 [Glycine soja]
Length=472

 Score =   346 bits (887),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 191/471 (41%), Positives = 281/471 (60%), Gaps = 12/471 (3%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             MLP +  N   + D+ T  LK+ GGTF  +GP  +N +++ TSDP N+ +I +  F NY 
Sbjct  1     MLPGVFLNMPTIFDYITSVLKREGGTFMFEGPCLSNMNIMFTSDPMNVQHITSTKFQNYG  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  F+++FEI GDGI  +DS+LW+ +R   +++     F+  + +T+   +ES L P L
Sbjct  61    KGNDFREIFEILGDGIFRSDSQLWNYNRTILHSVFRKASFQLFVHQTIMNKIESCLLPFL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             D   + G   DLQ++F+RL+FD    + L  +P  L +E P +    KA  +A +A+LY+
Sbjct  121   DRGWKEGMEVDLQDVFQRLTFDNICSIVLGFDPNCLSMEFP-EVACEKAFTEAEDALLYR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED----DSQNF  784
             H  P+  WKL KW   + +EKK  E+    D+ +Y  +  K     + +      D   F
Sbjct  180   HFRPKCLWKLMKWLH-VGKEKKLEESQKIVDQMLYTEIRSKCKVQGESNNSSTPVDESQF  238

Query  783   SMLTSHM-KAYKGKP-MQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLFNE  610
             S+L   + +  KGK    FLRDT +   ++ G  T SS L+W FWL+A +P VE+K+  E
Sbjct  239   SLLNVLINEVGKGKADDNFLRDTAI-NLLAAGRDTISSGLSWFFWLVATHPSVESKILEE  297

Query  609   ILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGHKV  430
             I K  P       +   VE    L YLHAA  E+LRL+PPIP+ HK +L++D LPSGH +
Sbjct  298   IRKNLPAREGNW-KNLGVESISRLTYLHAAISEALRLYPPIPIEHKCALKSDMLPSGHWI  356

Query  429   KPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTCIG  250
                T IL S Y+MGR E IWGEDC++F PERW+S   GGI H+PS KF  F+ GPR+C+G
Sbjct  357   NSNTMILYSLYTMGRAEEIWGEDCLKFIPERWISK-QGGIIHIPSYKFIAFNAGPRSCLG  415

Query  249   QKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + + +   K+VA SI+  YH  L+E   ++ P  ++VL +KHG+KV++TKR
Sbjct  416   KDISYTEMKMVAVSILSNYHVHLVEGQ-IISPRVSIVLHMKHGLKVRVTKR  465



>emb|CDX72693.1| BnaC07g47150D [Brassica napus]
Length=466

 Score =   346 bits (887),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 192/472 (41%), Positives = 279/472 (59%), Gaps = 18/472 (4%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             MLP +L   HR++D + E L+ +  TF+ KGP F+  D+L+T  PANI YI + NF+NY 
Sbjct  1     MLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFSGMDILVTVVPANIHYILSSNFSNYI  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  FQ++FE +GDGI+N+DSELW   RK++  + +H  F  S  R+    ++ GL P+L
Sbjct  61    KGPEFQEIFEAYGDGIINSDSELWRNLRKSSQVIFSHQNFSKSTTRS---KLKDGLLPLL  117

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
              H+A      DLQ++F+R  FD  F      +P SL +E P +  F KA+ D   AI+Y+
Sbjct  118   SHFADEEMVVDLQDVFQRFMFDTTFIFITGSDPRSLSIEMP-EVEFAKALDDVGEAIVYR  176

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDSQNFSMLT  772
             HI P   WKLQKW  GI  EKK  +A    D+     +S K  ++  Q+  D ++  +LT
Sbjct  177   HITPRFLWKLQKW-IGIGTEKKMMKANAVLDRVCAKYISAKREEIRSQENADEESEDLLT  235

Query  771   SHMKAYKGK-------PMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLFN  613
             SH+K    K         +FLRD F    ++ G  +T+  LTW FW+L++NP V +K+  
Sbjct  236   SHIKLDASKYELLNPEDDKFLRD-FTVGFMAAGRDSTACTLTWFFWILSENPNVLSKILQ  294

Query  612   EILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGHK  433
             EI +  P+  + Q ++  + +   LVYLHAA  ES+RL+PPIP   K  ++ D LPSGHK
Sbjct  295   EINENAPKTRSDQDKSSYLNK---LVYLHAALSESMRLYPPIPFERKSPIKPDVLPSGHK  351

Query  432   VKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTCI  253
             VK    I+   Y+MGRM+ +WGED  EFKPERW+S+  GG++H PS KF  F+ GPRTC+
Sbjct  352   VKSNINIMIFLYAMGRMKDVWGEDAREFKPERWISET-GGLRHEPSYKFLSFNAGPRTCL  410

Query  252   GQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             G+ +   + K V   I+  Y   ++     +     L+L +KHG+KV   K+
Sbjct  411   GKNLAMDLMKTVIVEILQAYEINVVSGQK-IEAKPGLILHMKHGLKVTTAKK  461



>gb|ABF93892.1| Cytochrome P450 family protein [Oryza sativa Japonica Group]
 gb|EAZ25522.1| hypothetical protein OsJ_09346 [Oryza sativa Japonica Group]
Length=507

 Score =   347 bits (890),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 189/485 (39%), Positives = 276/485 (57%), Gaps = 10/485 (2%)
 Frame = -3

Query  1542  KKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTS  1363
             K   + +  P  WP+IGMLP LL N HR+HD+ T  L  +   F   GP  +N  + +T 
Sbjct  25    KSKRKNTAIPVCWPLIGMLPDLLANRHRIHDWITSLLTASQLNFRFTGPPSSNMRLFITC  84

Query  1362  DPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPS  1183
             DPAN+ ++   NF+NYPKG  F ++F+IFGDGI N D + W   R     L     FR  
Sbjct  85    DPANVRHVFTSNFSNYPKGPDFTEIFDIFGDGIFNVDGDSWRRQRAKAQLLTCRPRFRAF  144

Query  1182  LERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSD  1003
             + R     VE  L P+L H+A  G   +LQ++F RL+FD    V    + G L +  P +
Sbjct  145   VSRCSRAKVEKALLPLLAHFAATGESCNLQDVFMRLTFDTTTMVVSGADTGCLAISLP-E  203

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLN  823
               F +A+ DA   +L +HI P  +WKL +   GI  E+  AEA    D F+   + ++  
Sbjct  204   VAFARAMDDATRVLLVRHIFPLSWWKLARR-LGIGYERTMAEALRACDHFVNETIEKRRA  262

Query  822   QLHDQDEDDSQNFSMLTSHMK---AYKGKPMQFLRDTFVsltisggggttssalTWLFWL  652
             +    + D S +  +L+S++      +     FLRDT     IS G   ++ AL+W F+L
Sbjct  263   EKAKGEADGSAD--LLSSYINDDDEEENASSSFLRDT-TMNLISAGRDASAMALSWFFYL  319

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             L KNP V +K+  E+  V          TF  +E   LVYLHAA  E+LRL+PP+P+ HK
Sbjct  320   LTKNPCVVSKILEELDSVNGITTPDGMVTFDPDELRPLVYLHAALSETLRLYPPVPLEHK  379

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
               L  D LPSGH V+P  +I+ S ++M RMEA+WG DC +F+PERW+S   G +++VPS 
Sbjct  380   GVLAADALPSGHDVRPGDKIVVSLFAMARMEAVWGSDCRKFRPERWISK-DGKLRYVPSY  438

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  FS GPRTC+G+ M F+  K VAA+++  +  E M  H +V P+ ++VL +K+G+ V
Sbjct  439   KFMTFSSGPRTCLGKDMAFVQLKAVAAAVVKNFEIEAMPGH-VVEPALSIVLHMKNGLMV  497

Query  111   KLTKR  97
             ++ +R
Sbjct  498   RVKRR  502



>ref|XP_002866852.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43111.1| CYP96A9 [Arabidopsis lyrata subsp. lyrata]
Length=515

 Score =   347 bits (890),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 205/484 (42%), Positives = 294/484 (61%), Gaps = 17/484 (4%)
 Frame = -3

Query  1512  TNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             TNWP++GMLP LL    R++DF TE L+     +  KGP     DML T DPANI +I +
Sbjct  34    TNWPLLGMLPGLLPQLPRVYDFITEVLEDGNLNYLFKGPFLGGIDMLFTVDPANIHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
              NF NYPKGT F+K+F++ GDGI N DSELW   RK++ ++MN   F+     T    +E
Sbjct  94    SNFANYPKGTEFKKLFDVLGDGIFNVDSELWKDLRKSSQSMMNDPDFQRFSLATSLSKLE  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
              GL P+LDH A+     DLQ++F+R +FD  F +    +PG L VE P +  F +A+ DA
Sbjct  154   KGLVPLLDHAAKEKLVVDLQDVFQRFTFDTTFVLATGYDPGCLSVEMP-EIEFARALDDA  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDS  793
               AI Y+H+ PE  WK+Q+   G+  E K   A   F++     ++ K ++++  D   S
Sbjct  213   EEAIFYRHVKPEMVWKIQR-LIGVGDELKLKRAHAVFNRVCSECIASKRDEINRGDGSSS  271

Query  792   QNFSMLTS-HMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKNPLV  631
              N  +++S ++   K K +     +FLRDT +   +  G  TT SALTW FWLL KN   
Sbjct  272   SNDLLMSSLNVDTTKYKLLNPSDDRFLRDT-ILSFMLAGRDTTGSALTWFFWLLCKNQEA  330

Query  630   EAKLFNEI-LKVKPQNH-----AKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKM  469
              AK+  EI   + P+N      +  +++F  +    LVYLH A CE+LRL+PP+P NHK 
Sbjct  331   MAKIRQEINTNLFPRNKNDGSVSYDSDSFNPQGIKKLVYLHGAICEALRLYPPVPFNHKS  390

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
               + D LPSGHKVK  ++IL   YS+GRM+++WGED +EFKPERW+S+ G  + H PS K
Sbjct  391   PTKPDVLPSGHKVKANSKILFCLYSLGRMKSVWGEDALEFKPERWISESGRSV-HEPSYK  449

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPRTC+G+++  M  K VA  II  Y   ++E H  + P+ +++L +KHG+KV 
Sbjct  450   FLSFNAGPRTCLGKEVAMMQMKTVAVKIIQNYEINVVEGHK-IKPAPSVILHMKHGLKVT  508

Query  108   LTKR  97
             ++KR
Sbjct  509   VSKR  512



>ref|XP_010429268.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=473

 Score =   346 bits (887),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 193/473 (41%), Positives = 282/473 (60%), Gaps = 14/473 (3%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             MLP  L    R++D+ TE L+ +  T+  KGP F N DML T DPANI +I + NF NYP
Sbjct  1     MLPGFLMEISRVYDYMTELLEASNLTYLFKGPCFGNLDMLFTVDPANIHHIMSSNFANYP  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG+ F+K+F++ GDGI N DS+LW   R++  ++M++  ++    RT    +E GL P L
Sbjct  61    KGSEFKKLFDVLGDGIFNADSKLWKDLRQSAQSIMSNPEYQRFTLRTSMSKLEKGLVPFL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
             +H A++    DLQ++F+R +FD  F +    +PG L  E P +  F +A+ +A  AI ++
Sbjct  121   NHVAEKKLVVDLQDLFQRFTFDTTFVLTTGIDPGCLSTEMP-EIEFARALDEAEEAIFFR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL-HDQDEDDSQNFSML  775
             H  PE  WK+Q+   G+  E K  +A  TFD+     ++ K +++       DS +  +L
Sbjct  180   HFKPEIVWKMQR-LIGLGHELKMTKAHSTFDRVCSKCIASKRDEISRGVINTDSSSKDLL  238

Query  774   TSHMKAYKGK-------PMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLF  616
              S+M     K         +FLRD  +   +  G  TT SALTW FWLL+KNP V  K+ 
Sbjct  239   MSYMNVDTSKYKLLNPSDEKFLRD-MILSFMLAGRDTTCSALTWFFWLLSKNPQVITKIR  297

Query  615   NEI-LKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSG  439
              EI  K+         ++F  +E   LVYLH A CESLRL+PP+P  HK   + D LPSG
Sbjct  298   QEINTKLSLGTKGCDFDSFNRQELNKLVYLHGALCESLRLYPPVPFQHKSPTKPDVLPSG  357

Query  438   HKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRT  259
             HKV   ++I+   YS+GRM+++WGED  EFKPERW+S+  G + HVPS KF  F+ GPRT
Sbjct  358   HKVDASSKIVFCLYSLGRMKSVWGEDASEFKPERWVSE-SGRLTHVPSFKFLSFNAGPRT  416

Query  258   CIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTK  100
             C+G+++     K VA  II  Y  +++E H  + P  +++L +KHG+KV++TK
Sbjct  417   CLGKEVAMTQMKTVAVKIIQNYDIKVVEGHK-IEPVPSIILHMKHGLKVRVTK  468



>ref|XP_010444065.1| PREDICTED: cytochrome P450 86B1-like [Camelina sativa]
Length=516

 Score =   347 bits (889),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 195/484 (40%), Positives = 285/484 (59%), Gaps = 18/484 (4%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             +WPV+GM+P L+   HR++DFA + L+    TF  KGP F   D+LLT+DPANI YI N 
Sbjct  35    SWPVVGMIPGLVLVLHRVYDFAVDLLESTELTFLFKGPWFTGMDLLLTADPANIHYIVNS  94

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+N+ KG+ F+++F+ F   +L  DS  W   RK T+ ++NH GF+     T+   ++ 
Sbjct  95    NFSNFVKGSDFKEVFDAFEYALLTKDSVAWKNLRKATHVMINHQGFQRLSMSTMRGKLKD  154

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLD-KNPGSLFVEPPSDHPFRKAIIDA  973
             GL P  +H  + GT  DLQE+F+RL+ DI         +P SL +E P      KA+ D 
Sbjct  155   GLVPFFNHIVKEGTTVDLQEVFRRLTLDITLVTVTGCDDPRSLSIEMPEVES-AKALDDI  213

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQD--ED  799
             +  I Y+H+ P   WKLQ W  G+  EKK  EA   FD+     +S +  ++      + 
Sbjct  214   LEGIKYRHVKPRFLWKLQNW-LGVGIEKKMTEAGAIFDRVCAKYISARREEIKRSKGIDH  272

Query  798   DSQNFSMLTSHMKAYKGK-----PM--QFLRDTFVsltisggggttssalTWLFWLLAKN  640
             D ++  +LTSH+K    K     P+  +FLRD  V   +  G  T +SALTW FWLL++N
Sbjct  273   DGESEDLLTSHIKLDTTKYQLLDPINDKFLRDN-VLALLLAGRDTIASALTWFFWLLSEN  331

Query  639   PLVEAKLFNEILKVKPQNHAKQTE--TFKVEECCD-LVYLHAAFCESLRLFPPIPMNHKM  469
                  K+  EI K+ P++ +   E  ++   EC + LVYLHAA CE++RL+PP+P+    
Sbjct  332   HKAMTKIRQEIDKILPRSSSSGQEKPSYDQMECVNKLVYLHAALCETMRLYPPVPLERVS  391

Query  468   SLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNK  289
              LE+D LPSGHKV+  + IL   Y +GRM A+WGED ++FKPERW+S+  G ++HVP+ K
Sbjct  392   PLESDVLPSGHKVEANSNILIFIYGVGRMRAVWGEDALDFKPERWISET-GELRHVPAFK  450

Query  288   FPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVK  109
             F  F+ GPR C+G+++   + KIVA  I+  Y   +        P  +L+L +KHG KV 
Sbjct  451   FLAFNAGPRICLGKQLAMTLMKIVAVEILRNYDINVATGQKF-EPDTSLILRIKHGFKVT  509

Query  108   LTKR  97
             + KR
Sbjct  510   INKR  513



>gb|ACR38435.1| unknown [Zea mays]
 gb|AFW80290.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=511

 Score =   347 bits (889),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 190/491 (39%), Positives = 290/491 (59%), Gaps = 17/491 (3%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             ++++ ++R   PTNWPV+G LPA+  NA R+H++ TEFL+  G ++ +KGP  +  D+++
Sbjct  27    LFRRLNQRDGLPTNWPVVGALPAITVNAGRMHEWVTEFLRAAGLSYVMKGPWGSPVDVIM  86

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             T+DPAN+ ++   NF NYPKG  F  +F++ GDGI N D E W   R+  +AL++   FR
Sbjct  87    TADPANVAHVFTSNFGNYPKGQEFAALFDVLGDGIFNADGESWAFQRRKAHALLSDARFR  146

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
               +  +  + +   L P+LD  A  G   DLQ++F RL+FD+        +PG L  + P
Sbjct  147   AGVAASTARKLRDALVPLLDGIAASGAVVDLQDVFVRLTFDLTAMFVFGIDPGCLAPDFP  206

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
                PF  A+      + Y+H+ P  +  LQK+     R     + W+   + +   ++E 
Sbjct  207   Y-VPFAAAMDTVEEVLFYRHVAPVPWLMLQKYL----RTGHSKKMWNA-RRVLDASIAEF  260

Query  828   LNQLHDQDEDDSQNFSMLTSHMKAY-----KGKPMQ-FLRDTFVsltisggggttssalT  667
             ++   ++  +      +LTS++  +      G  ++ FLRDT     +  G  TTSSALT
Sbjct  261   ISLRRERAAEAEAEADLLTSYLACHDEIGKSGAELERFLRDT-TLNLMVAGRDTTSSALT  319

Query  666   WLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPI  487
             W FWLL K+P VEAK+  E+    P + A    T    E   LVYLHAA  ESLRL+PP+
Sbjct  320   WFFWLLTKHPDVEAKVLEELRAHPPLSGAGGHRT--AAELKQLVYLHAALSESLRLYPPV  377

Query  486   PMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIK  307
             P  HK +  TDTLPSG +V P  R++ SFYSMGRMEA+WG+DC EF+PERWL+   G  +
Sbjct  378   PFEHKAAARTDTLPSGARVGPSRRVIVSFYSMGRMEAVWGKDCSEFRPERWLT-AAGRFR  436

Query  306   HVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVK  127
             H PS KF  F+VGPRTC+G+ + +   K V A+++ R+  E+ +   +V P  +++L +K
Sbjct  437   HEPSYKFVAFNVGPRTCLGRDLAYSQMKAVVAAVLPRFRVEV-DAGAVVRPKLSIILHMK  495

Query  126   HGVKVKLTKRK  94
              G+KV++ KR+
Sbjct  496   DGLKVRVHKRE  506



>ref|XP_006404787.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
 gb|ESQ46240.1| hypothetical protein EUTSA_v10000131mg [Eutrema salsugineum]
Length=515

 Score =   347 bits (889),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 202/483 (42%), Positives = 293/483 (61%), Gaps = 15/483 (3%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             PT WP++GMLP LL    R++D+ TE L+ +  TF  KGP+F   DML+T DPANI +I 
Sbjct  34    PTKWPLLGMLPGLLVEIPRVYDYITEVLEASNLTFPFKGPSFGGLDMLITVDPANIHHIM  93

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
             + NF NYPKG+ F+K+F++ GDGI N DS+LW   RK+  ++M+H  F+    RT    +
Sbjct  94    SSNFANYPKGSEFKKIFDVLGDGIFNADSDLWKDLRKSAQSMMSHQEFQRFTLRTSMSKL  153

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E GL P+LDH A++    DLQ++F+R +FD  F +    +PG L +E P +  F +A+ +
Sbjct  154   EKGLVPLLDHVAEKKLVVDLQDVFQRFTFDTTFVLATGIDPGCLSIEMP-EIEFARALDE  212

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDED-  799
             A  A+ ++H+ PE  WK+Q+   G   E K   A  TFD+     ++ K +++     + 
Sbjct  213   AEEALFFRHVKPEMVWKMQR-LIGFGDELKMKRAHSTFDRVCSKCIASKRDEVSRGLINI  271

Query  798   DSQNFSMLTSHM-------KAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKN  640
             DS +  +L S+M       K       +FLRD  +   +  G  TT SALTW FWLL+KN
Sbjct  272   DSSSKDLLMSYMDVDTTKYKLLNPSDEKFLRD-MILSFMIAGRDTTGSALTWFFWLLSKN  330

Query  639   PLVEAKLFNEI-LKVKPQ-NHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMS  466
             P   AK+  EI  K+ P+ N   + ++F  +E   LVYLH A  E+LRL+PP+P  HK  
Sbjct  331   PQATAKIRQEINTKLSPRTNDGSEIDSFNHQELSKLVYLHGALYEALRLYPPVPFQHKSP  390

Query  465   LETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKF  286
              + D LPSGH+V   ++I+   YS+GRM+ +WGED  EFKPERW+S+ G  I HVPS KF
Sbjct  391   TKPDVLPSGHRVDASSKIVFCLYSLGRMKTVWGEDAAEFKPERWISESGRSI-HVPSFKF  449

Query  285   PIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKL  106
               F+ GPRTC+G+ +     K VA  II  Y  +++E H  + P  +++L +K G+KV +
Sbjct  450   LSFNAGPRTCLGKDVAMTQMKTVAVKIIQNYEIKVVEGHK-IEPVPSVILHMKQGLKVMV  508

Query  105   TKR  97
             TKR
Sbjct  509   TKR  511



>ref|XP_004489210.1| PREDICTED: cytochrome P450 86B1-like [Cicer arietinum]
Length=505

 Score =   346 bits (888),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 203/479 (42%), Positives = 287/479 (60%), Gaps = 15/479 (3%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQ-NGGTFELKGPAFANFDMLLTSDPANIDYIHN  1333
             ++P +GMLP LL N  + HDF T+ LKQ +  T E KGP F+  + L+TSDP N+ +I +
Sbjct  34    DYPFVGMLPQLLWNLWKFHDFITQTLKQQHRSTGEFKGPWFSQMNFLITSDPFNVHHIMS  93

Query  1332  KNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVE  1153
             K F NY KG+ F  +FE FGDGI  TDS+ W  +R   +++     F    E+ + + +E
Sbjct  94    KFFYNYVKGSEFHDIFEAFGDGIFATDSDTWKYNRSLFHSVFKQRDFEIFQEKIIHKKLE  153

Query  1152  SGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDA  973
             + LFP+LDH  ++G   DLQ++F R +FD    V L  +P  L ++ P      KA    
Sbjct  154   TSLFPMLDHVEKQGLVLDLQDVFSRFTFDNICSVILGCDPNCLSIDFPY-VVCEKAFDQI  212

Query  972   VNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDS  793
                I Y+H+LP+  WK QK   GI  E+K  +A   FD+FIY  +  K  +L    +++ 
Sbjct  213   EECIFYRHVLPKSVWKFQK-LLGIGHERKMTKACKEFDQFIYSSIESKREELRKCSKNNI  271

Query  792   QNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKNPLVE  628
             +   +LT  M+  K         +FLRD         G  T +SALTWLF+L+A +PLVE
Sbjct  272   EMVDLLTLFMRKDKESQQVIHDDKFLRDA-AFNLFVAGRDTITSALTWLFYLVATHPLVE  330

Query  627   AKLFNEIL-KVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDT  451
              K+  EI    K  N  K+     V++   LVYLH A CE+LRLFPPIP   K +++ D 
Sbjct  331   TKILEEIKDNFKTINIEKK---LGVDDVKKLVYLHGAICEALRLFPPIPFESKKAIKGDI  387

Query  450   LPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSV  271
             LPSGH V P T IL S YSMGR E IWG+DC+EFKPERW+S+  G I H PS KF  F+ 
Sbjct  388   LPSGHIVDPNTMILFSLYSMGRFEDIWGKDCLEFKPERWISE-RGRIVHEPSYKFFTFNA  446

Query  270   GPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK  94
             GPRTC+G+ + F+  K++A SI+ +Y  ++ E H  ++ S ++VL +K+G++VKLTKR+
Sbjct  447   GPRTCLGKDLSFIQIKMIATSILCKYRVQVGEDHIPIL-SHSIVLLMKNGLRVKLTKRQ  504



>gb|KEH24775.1| cytochrome P450 family protein [Medicago truncatula]
Length=505

 Score =   345 bits (886),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 200/489 (41%), Positives = 295/489 (60%), Gaps = 20/489 (4%)
 Frame = -3

Query  1530  RRSMDP--TNWPVIGMLPALLQNAHRLHDFATEFLK-QNGGTFELKGPAFANFDMLLTSD  1360
             RR   P  T++P+ GM+  LL N  R+HDF T+ LK Q+  T E  GP F + + L+TSD
Sbjct  26    RRCKYPILTDYPIFGMIIPLLWNLPRVHDFITQLLKKQHRNTCEFMGPWFTSMNYLVTSD  85

Query  1359  PANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSL  1180
             P N+ ++ +K+F+NY KG  + ++FE FGDGI NTDSE W  +R   ++++    F    
Sbjct  86    PINLHHMLSKSFDNYVKGHEYHEIFEAFGDGIFNTDSETWKYNRSLFHSILKIRDFEMFQ  145

Query  1179  ERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDH  1000
             ++ +   +E  L P+LDH  Q+G+  DLQ++F R +FD    V L  +P  L ++ P D 
Sbjct  146   KKIIQNKLEKSLIPLLDHVQQQGSVVDLQDVFNRFTFDNICSVVLGCDPNCLSIDFP-DV  204

Query  999   PFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQ  820
                KA       I Y+H +P+  WKLQKW   I  EK   +A  T+D+F+Y  +  K  +
Sbjct  205   ACEKAFNQIEEGIFYRHKVPKSVWKLQKWL-QIGEEKNMTKACKTYDQFVYANIKSKREE  263

Query  819   LHDQDEDDSQNFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFW  655
             L  +   +++   +LT+ MK  KG  +     +FLRD         G  T +SALTWLF+
Sbjct  264   L-SKCRKNNEMVDLLTTLMKEEKGSQVVMHDDKFLRDV-AFNLFVAGRDTITSALTWLFY  321

Query  654   LLAKNPLVEAKLFNEILKVKPQNHAKQT--ETFKVEECCDLVYLHAAFCESLRLFPPIPM  481
             L+A +PLVEAK+  EI     +N       +   ++E   LVYLH A CE+LRLFPPIP 
Sbjct  322   LIATHPLVEAKILEEI----KENFGTINIEKKLGIDELKKLVYLHGAICEALRLFPPIPF  377

Query  480   NHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHV  301
               K +++ D LPSGH V P T IL   YSMGR E IWG+DC+EFKPERW+S+  GGI H 
Sbjct  378   ERKQAIKGDILPSGHIVNPNTIILFFLYSMGRFEEIWGKDCLEFKPERWISE-RGGIVHT  436

Query  300   PSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHG  121
             PS KF  ++ GPRTC+G+ + F+  K+   +I+ +Y  ++++ H  ++ S ++VL +K+G
Sbjct  437   PSYKFISYNAGPRTCLGKDLSFIQIKMTTIAILSKYCVQVVDGHVPIL-SHSIVLLMKNG  495

Query  120   VKVKLTKRK  94
             +KV++TKR+
Sbjct  496   LKVRITKRE  504



>gb|KEH24777.1| cytochrome P450 family protein [Medicago truncatula]
Length=505

 Score =   345 bits (885),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 193/476 (41%), Positives = 284/476 (60%), Gaps = 11/476 (2%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             ++  +GMLP+LL N   +HDF    LKQ+ G+ E  GP F   +  +TSDP N+ +I +K
Sbjct  36    DYTFLGMLPSLLWNLWNIHDFLAALLKQHRGSGEFMGPWFTKMNYFITSDPMNVHHIMSK  95

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
              F+NY KG  F ++FE FGDGI N DS+ W  +R   +++     F    E+ +   +E 
Sbjct  96    RFDNYVKGHEFHEIFEAFGDGIFNADSKTWKYNRSLLHSIFKQRSFELFQEKIIQNKLER  155

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
              L P+LDH  Q+G+  DLQ++F R +FD    V L  +P  L ++ P D    KA     
Sbjct  156   SLIPLLDHVQQQGSVVDLQDVFNRFTFDNICSVVLGCDPNCLSIDFP-DVACEKAFDQIE  214

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDSQ  790
               I Y+H++P   W+LQ+    + +EKK  +A   FD+FIY  +  K  +L    ++  +
Sbjct  215   ECIFYRHVVPRSVWRLQQ-LLQVGQEKKMTKACKEFDQFIYSNIESKRVELRKGTKNIDE  273

Query  789   NFSMLTSHMKAYKGKPM-----QFLRDTFVsltisggggttssalTWLFWLLAKNPLVEA  625
                +LT+ M   KG  +     +FLRD         G  T +SALTWLF+L+A +PLVE 
Sbjct  274   MGDLLTTLMNEEKGSQVVQHDDKFLRDA-AFNLFVAGRDTITSALTWLFYLVATHPLVET  332

Query  624   KLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLP  445
             K+  EI +     +  Q +   V+E   LVYLH A CE++RLFPPIP   K +++ D LP
Sbjct  333   KILEEIKEHFGTINIDQ-KKLGVDEVKKLVYLHGAICEAIRLFPPIPFERKKAIKGDVLP  391

Query  444   SGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGP  265
             SGH + P T IL S YSMGR E IWGEDC+EFKPERW+S+  G I H PS KF  F+ GP
Sbjct  392   SGHIINPNTIILFSLYSMGRFEEIWGEDCLEFKPERWISE-RGSIVHEPSYKFFSFNAGP  450

Query  264   RTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             RTC+G+ + F+  K++A +I+ +Y  ++++ H  ++ S ++VL +K+G+KV++TKR
Sbjct  451   RTCLGKDLSFIQVKMIAIAILSKYCVQVVDGHVPIL-SHSIVLLMKNGLKVRITKR  505



>ref|XP_006651021.1| PREDICTED: cytochrome P450 86B1-like [Oryza brachyantha]
Length=506

 Score =   345 bits (884),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/480 (38%), Positives = 278/480 (58%), Gaps = 7/480 (1%)
 Frame = -3

Query  1515  PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIH  1336
             P  WP++GMLP LL N HR+H + T  L  +   F   GP  ++  + +T DPAN+ ++ 
Sbjct  34    PLCWPLVGMLPELLANRHRIHGWITSLLAVSKLNFRFTGPTSSSMRLFITCDPANVRHVF  93

Query  1335  NKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTV  1156
               NF NYPKG  F ++F+IFG GI N D + W   R     LM    FR  + R     V
Sbjct  94    TSNFCNYPKGPDFAEIFDIFGGGIFNVDGDAWRRQRAKAQLLMCRPQFRAFVSRCSRAKV  153

Query  1155  ESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIID  976
             E+ L P+L H+A  G   +LQ++F RL+FD    +    + G L    P +  F +A+ D
Sbjct  154   ETSLLPLLAHFAATGEACNLQDVFMRLTFDTTTMMVSGADAGCLATSLP-EVAFARAVDD  212

Query  975   AVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDD  796
              +  +L +HI+P  +WKL +   G+  E+  AEA  T D F++  + ++  +    + +D
Sbjct  213   VMRVLLVRHIVPLSWWKLARR-LGVGYERTMAEALRTCDLFVHETIEKRRAEKARGEAED  271

Query  795   SQNFSMLTSHMKAYKGKPMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLF  616
             S +  +L+S++   +     FLRDT     IS G   ++ AL+W F+LL KNP V +K+ 
Sbjct  272   SAD--LLSSYINDDEESADAFLRDT-TMNLISAGRDASAMALSWFFYLLTKNPHVVSKIL  328

Query  615   NEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGH  436
              E+  +     A    TF  +E   LVYLHAA  E+LRL+PP+P+ HK  L  D LPSGH
Sbjct  329   EELRAIDSIATADGMVTFDSDELRPLVYLHAALSETLRLYPPVPLEHKGVLAADVLPSGH  388

Query  435   KVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTC  256
              V+P  +I+ S ++M RM+A+WG DC EF+PERW++   G +++VPS KF  FS GPRTC
Sbjct  389   GVRPGDKIVVSLFAMARMDAVWGNDCREFRPERWVTK-DGKLRYVPSYKFMAFSSGPRTC  447

Query  255   IGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKRK*NHQAM  76
             +G+ M F+  K VAA+++  +  E +  H +V P+ ++VL +K+G  V++ +R  N Q +
Sbjct  448   LGKDMAFVQLKAVAAAVLKNFEVEAVPGH-VVEPALSIVLHMKNGFMVRVKRRTTNAQLL  506



>gb|KDP35253.1| hypothetical protein JCGZ_09412 [Jatropha curcas]
Length=498

 Score =   344 bits (882),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/475 (39%), Positives = 275/475 (58%), Gaps = 11/475 (2%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWP +GMLP+L+ +    HD++   ++++GGTF  KGP F+N D++ T DPAN+ +  + 
Sbjct  31    NWPFLGMLPSLVAHVPDFHDWSKALIERSGGTFLFKGPWFSNMDIVATCDPANVKHTLST  90

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF NYPKG  F++MF++ GDGI N DS+LW   RK  +AL+NH  F   L +T    +  
Sbjct  91    NFYNYPKGDEFKEMFDVLGDGIFNADSDLWKHQRKNASALINHDRFHSFLVKTTYNKLAK  150

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
              L PVL+   +    FD Q++  R +FD+        +P S+  + P D  F  A+  A 
Sbjct  151   ELHPVLELLCKENKVFDFQDLIDRFTFDVAMIFVTGYDPESVSTKLPKDE-FSIALDYAE  209

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL--HDQDEDD  796
              A+ Y+H+ P+ FWKLQ+   GI +E+K  EA +T D+     +S +  QL  H  D   
Sbjct  210   QAVFYRHVFPKLFWKLQR-LLGIGKEQKLKEAKETLDRMAAKYISMRREQLETHKYDIFP  268

Query  795   SQNFSMLTSHMKAYKGKPM-QFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKL  619
                 +   S  K    K   +FLRD  V    +       ++LTWLFWLL+KN   E ++
Sbjct  269   EDLLASYISQGKMIGSKSQDEFLRDVIV----NFLVAGRVNSLTWLFWLLSKNQRAETRI  324

Query  618   FNEILKVKPQNHAK-QTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPS  442
               E+  +          + FK E+   L+YLHAA CE+LRL+PP+   HK  L+ D LPS
Sbjct  325   REELKSIASTGETTGGLQLFKQEKVNKLIYLHAALCETLRLYPPVVYEHKKPLKPDVLPS  384

Query  441   GHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPR  262
             GH V PK +IL   Y MGR++++WGEDCMEFKPERW+S+ G  I+  P  KF  F+ GPR
Sbjct  385   GHHVDPKMKILYLSYVMGRLKSLWGEDCMEFKPERWISEEGRLIQQSPY-KFLTFNAGPR  443

Query  261   TCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             TC+G+++     K VAA I+  Y  +++E H       +++L +K+G+ V++++R
Sbjct  444   TCLGKEIALTEMKAVAAFILHNYQVKVIEGHVPEPTCASIILHIKNGLMVRISRR  498



>gb|KEH41380.1| cytochrome P450 family protein [Medicago truncatula]
Length=508

 Score =   344 bits (883),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 190/490 (39%), Positives = 295/490 (60%), Gaps = 16/490 (3%)
 Frame = -3

Query  1533  SRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANF-DMLLTSDP  1357
             S++++   NWP+IGMLP++L N  ++HD+AT  LK +GGTF+ KGP F N   ++ TSDP
Sbjct  22    SKKNVTLPNWPIIGMLPSVLHNLSKIHDYATLVLKHHGGTFQFKGPWFTNLATVIFTSDP  81

Query  1356  ANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLE  1177
              N+ +I +KNF+NY KG+ F ++FE+ G GI N DS  W   R   ++L+ +       +
Sbjct  82    MNVHHIISKNFSNYGKGSDFHEIFEVLGLGIFNLDSNEWKQERALFHSLLKNKNIEIFYQ  141

Query  1176  RTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSL--FVEPPSD  1003
             + + + +E+ L P LDH ++     DLQ++ +R +FDI        +P SL       SD
Sbjct  142   QNIQKKLENCLLPFLDHASKEVKGLDLQDVIERFTFDITCIFLFGFDPNSLPYKYNELSD  201

Query  1002  HPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS----  835
               + KA+    + +LY+H +P+  WKLQKW   I +EKK   A +   +F+   +S    
Sbjct  202   IAYVKAVSVLEDLLLYRHYMPKCIWKLQKWLH-IGQEKKGTVAKENLHEFLNKCISYYKG  260

Query  834   -EKLNQLHDQDEDDSQNFSMLTSHMKAYKGKPM---QFLRDTFVsltisggggttssalT  667
              E+   L   ++ D  ++ ++   MK   GK      ++RDT     ++ G GT SS L 
Sbjct  261   DEEKRILERNEDADESHYCLVKELMKERLGKGETNEMYIRDT-ALNLLAAGNGTISSGLN  319

Query  666   WLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPI  487
             W FWL++ +P+VEAK+  EI              F V+E   LVYLH A CE+LRL+PP+
Sbjct  320   WFFWLVSTHPIVEAKIIQEIKVNCLTKEDNLITNFSVKELDKLVYLHGAICEALRLYPPV  379

Query  486   PMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIK  307
             P  HK ++ +D LPSG  V   T+++ S Y+MGRME IWG+DC+EF+PERW+SD  G I 
Sbjct  380   PFEHKCAVNSDILPSGDHVSLNTKLIYSLYAMGRMEQIWGDDCLEFRPERWISD-RGQII  438

Query  306   HVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVK  127
             HVPS KF  F+ GPR+C+G+ + F+  K+VAA++++++  +++E H +V P  +++L ++
Sbjct  439   HVPSYKFIAFNAGPRSCLGKDITFLQMKMVAAAVLWKFRIQVVEGH-IVTPKVSVILRIE  497

Query  126   HGVKVKLTKR  97
              G  V L+KR
Sbjct  498   -GFTVNLSKR  506



>ref|XP_007019556.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY16781.1| Cytochrome P450 [Theobroma cacao]
Length=517

 Score =   344 bits (883),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 189/485 (39%), Positives = 288/485 (59%), Gaps = 10/485 (2%)
 Frame = -3

Query  1533  SRRSMD-PTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDP  1357
             SR++ D P NWP+IGMLP +L N HRL D  TE L+ +GGTF LKG  F N D+++TSDP
Sbjct  35    SRKNKDLPWNWPIIGMLPMILTNWHRLADRCTEILESSGGTFTLKGFWFVNMDLIITSDP  94

Query  1356  ANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLE  1177
             AN+ +I + NF+ YPKG  ++K F++FG G++N+D E W   +      ++H  F   L 
Sbjct  95    ANVHHILSSNFSMYPKGVEWKKRFDVFGSGLINSDFEEWKNRKVFFRGYLSHQRFHELLP  154

Query  1176  RTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHP  997
             +    ++++ L P L+H +++    D   + K   F I  +     +  S F     ++ 
Sbjct  155   KIFEDSMKNKLIPSLEHVSKQDIPVDFASLLKGHIFYISCRFATGCDACSSFPVSFHENI  214

Query  996   FRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQL  817
             F  AI +A  AI  +H+ PE  WKLQKW  GI +E K  +A  T D  +   +S K  ++
Sbjct  215   FPNAIANACEAIFARHLFPESIWKLQKW-LGIGKEGKLRDARITIDNVLAEQISLKRKEM  273

Query  816   HDQDEDDSQNFSMLTSHMKAYK-----GKPMQFLRDTFVsltisggggttssalTWLFWL  652
              D+  ++  +F+ L  H+  ++           +RD  +   + G   TTS+AL+W FWL
Sbjct  274   SDRMAEEDIDFNALELHLIGHRLLGPLSVSNSLIRDNML-ALMFGTQDTTSTALSWFFWL  332

Query  651   LAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHK  472
             L+++P VE ++  EI +  P+N   +   +  +E   LVYLHAA CE+LRLFPP+P   +
Sbjct  333   LSRHPAVENRIREEIQEYFPENGETKWLAYGAKELDKLVYLHAALCETLRLFPPVPFQTR  392

Query  471   MSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSN  292
               L+ DTLPSG++V     IL   Y+MGRM ++WGEDC EF PERW++   GGIKH P++
Sbjct  393   TPLQNDTLPSGYRVNQGQNILICTYAMGRMTSVWGEDCREFNPERWITH-DGGIKHEPAH  451

Query  291   KFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKV  112
             KF  F+ GPR C G+ + F + K +A++II  YH +++E H +V P  +++L +KHG+ V
Sbjct  452   KFFAFNAGPRICPGKDLGFTLMKAIASTIIHNYHVQVVENH-VVTPKSSIILHMKHGLMV  510

Query  111   KLTKR  97
              + KR
Sbjct  511   TVKKR  515



>ref|XP_009123569.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
 emb|CDY41980.1| BnaA01g05520D [Brassica napus]
Length=503

 Score =   344 bits (882),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 191/480 (40%), Positives = 281/480 (59%), Gaps = 22/480 (5%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             NWPV+GMLP  L   HR++DF+ E L+Q   TF  KGP F   D+L+T DPANI YI + 
Sbjct  34    NWPVLGMLPGFLIVLHRIYDFSVEVLEQTNLTFPFKGPWFTGMDILVTVDPANIHYILSS  93

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+NY KG  F+++F++FG+ I N+D ++W   R+    ++NH GF+          ++ 
Sbjct  94    NFSNYTKGADFKEVFDVFGEMIFNSDGDMWRNQRRAAQYMLNHQGFQKLSMSATRAKLDD  153

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+ D ++++    DLQ +F+R +FD  F +    +P +L VE P D  + KA+    
Sbjct  154   GLVPLFDRFSKKEMVVDLQNVFQRFTFDTTFVLVTGFDPKTLSVEMPEDE-YAKALDVLG  212

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDSQ  790
             + I ++H++P+  WKLQKW  G  +EK+  EA  TFD+     +S K  ++  QD+  + 
Sbjct  213   DGIFFRHVVPKFLWKLQKW-IGFGQEKRTMEAGATFDRVSAKYISAKRKEMRTQDQQSNG  271

Query  789   NF--SMLTSHMKAYKGK-------PMQFLRDTFVsltisggggttssalTWLFWLLAKNP  637
                  +LTSHMK    K         +FLRDT +      G  TT+SAL+W FWLL++NP
Sbjct  272   ECHEDLLTSHMKLDTTKYEILNPSDDKFLRDT-ILAFNLAGRDTTASALSWFFWLLSENP  330

Query  636   LVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLET  457
              V  K+  EI+      H +            LVYL AA  ES+RL+PP+P   K  ++ 
Sbjct  331   RVVTKIRQEII-TNINLHGQHN-------LDKLVYLQAALYESMRLYPPVPFQRKSPIKP  382

Query  456   DTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIF  277
             D LPSGHKV   + I+   Y++GRM A+WGED MEFKPERW+S   G ++H PS KF  F
Sbjct  383   DLLPSGHKVDSSSTIMIFLYALGRMRAVWGEDAMEFKPERWVSQS-GCLRHEPSFKFLSF  441

Query  276   SVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             + GPRTC G+++   + K VA  I+  Y  ++++    + P   L+L +KHG++V +TKR
Sbjct  442   NAGPRTCPGKQLALTLMKTVAVEILQNYDIKVIKGQK-IEPDPGLILYMKHGLRVTITKR  500



>emb|CDY53178.1| BnaA06g40570D [Brassica napus]
Length=469

 Score =   343 bits (879),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 192/472 (41%), Positives = 277/472 (59%), Gaps = 15/472 (3%)
 Frame = -3

Query  1491  MLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNKNFNNYP  1312
             MLP +L   HR++D + E L+ +  TF+ KGP FA  D+L+T  PANI YI + NF+NY 
Sbjct  1     MLPGVLVRLHRIYDCSVEVLENSNLTFQFKGPWFAGMDILVTVYPANIHYILSSNFSNYI  60

Query  1311  KGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVESGLFPVL  1132
             KG  FQ++FE FGDGI+N+D ELW   RK +  + +H  ++   + T    ++ GL P+L
Sbjct  61    KGPEFQEIFEAFGDGIINSDLELWRNIRKASQVIFSHQKYQNFSKSTTRSKLKDGLLPLL  120

Query  1131  DHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAVNAILYK  952
              H+A      DLQ++F+R  FD  F      +P SL VE P +  F KA+ D   AI+Y+
Sbjct  121   SHFADEEIVVDLQDVFQRFMFDTTFIFITGSDPRSLSVEMP-EVEFAKALDDVGEAIVYR  179

Query  951   HILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQLHDQDEDDSQNFSMLT  772
             HI P   WKLQKW FGI  EKK  +A    D+     +S K  ++  Q+  D ++  +LT
Sbjct  180   HITPRFLWKLQKW-FGIGTEKKMVKANAVLDRVCAKYISAKREEIRSQEIADEESEDLLT  238

Query  771   SHMKAYKGK-------PMQFLRDTFVsltisggggttssalTWLFWLLAKNPLVEAKLFN  613
             SH+K    K         +FLRD F    ++ G  +T+  LTW FW+L++N  V +K+  
Sbjct  239   SHIKLDASKYELLNPEDDKFLRD-FTVGFMAAGRDSTACTLTWFFWILSENSNVLSKILQ  297

Query  612   EILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETDTLPSGHK  433
             EI +  P   + Q ++  + +   LVYLHAA  ES+RL+PPIP   K  ++ D LPSGHK
Sbjct  298   EINENVPITRSDQDKSSYLNK---LVYLHAALSESMRLYPPIPFERKSPIKPDVLPSGHK  354

Query  432   VKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFSVGPRTCI  253
             VK    I+   Y+MGRM+ +WGED  EFKPERW+S+  GG++H PS KF  F+ GPRTC+
Sbjct  355   VKSNINIMIFIYAMGRMKDVWGEDAAEFKPERWISET-GGLRHEPSYKFLSFNAGPRTCL  413

Query  252   GQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
             G+ +   + K V   I+  Y   ++     +     L+L +KHG+KV + K+
Sbjct  414   GKNLAMDLIKTVIVEILQAYEINVVSGQK-IEAKPGLILHMKHGLKVTIAKK  464



>ref|XP_007019638.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY16863.1| Cytochrome P450 [Theobroma cacao]
Length=516

 Score =   344 bits (882),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 188/489 (38%), Positives = 287/489 (59%), Gaps = 9/489 (2%)
 Frame = -3

Query  1548  IWKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLL  1369
             I + S + +  P NWP+IGMLP +L + HRL D  TEFL+ +GGTF +KG  F N D++ 
Sbjct  30    ILRYSGKTNDLPWNWPIIGMLPMILTHFHRLADRCTEFLESSGGTFIVKGLWFTNTDLIF  89

Query  1368  TSDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFR  1189
             TSDP N+ +I + NF+ YPKG  ++K F++FG+ + N+D E W  H+      ++H  F 
Sbjct  90    TSDPVNVHHIFSSNFSMYPKGIGWKKRFDVFGNTLFNSDFEEWKNHKVFFRGYLSHRRFH  149

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPP  1009
               L +    +++  L P L+H +++    D   + K   F I  ++    +  S F    
Sbjct  150   ELLPKIFEDSMKKKLIPSLEHVSKQDIPVDFASLLKGYIFYISCRLATGCDACSSFPVSF  209

Query  1008  SDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEK  829
              ++ F  AI+ A  AI  +HI PE  WKLQKW  GI +E K  +AW T D  +   +S K
Sbjct  210   HENLFSNAIMHACEAIFSRHIFPESIWKLQKW-LGIGKEGKLRDAWITIDNVLAEQISLK  268

Query  828   LNQLHDQDEDDSQNFSMLTSHMKAYK-----GKPMQFLRDTFVsltisggggttssalTW  664
               ++ D+  ++  +F+ L  H+  +K           +RD  +   +     TTS+AL+W
Sbjct  269   RKEVSDRMAEEDIDFNALELHLSRHKLLGPISVSNGLIRDNML-GLMFATQDTTSTALSW  327

Query  663   LFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIP  484
              FWLL+++P VE ++  EI +  P+N   +   +  +E   +VYLHAA CE+LRLFPP+P
Sbjct  328   FFWLLSRHPAVEKRIREEIQEYFPENGETKWLAYGAKELDKMVYLHAALCETLRLFPPVP  387

Query  483   MNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKH  304
                +  L+ DTLPSGH++     IL   Y+MGRM ++WGEDC EFKPERW++   GGIKH
Sbjct  388   FQTRTPLQNDTLPSGHRINRGQNILICTYAMGRMTSVWGEDCREFKPERWITH-DGGIKH  446

Query  303   VPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKH  124
              P++KF  F+ GPR C G+ + F + K +A++II  YH +++E H  V+   ++VL +KH
Sbjct  447   EPAHKFFAFNAGPRICPGKDVGFTLLKGIASAIIHNYHVKVVENHP-VIHQSSIVLHMKH  505

Query  123   GVKVKLTKR  97
             G+ V + KR
Sbjct  506   GLMVAVKKR  514



>gb|KEH40818.1| cytochrome P450 family protein [Medicago truncatula]
Length=507

 Score =   343 bits (881),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 201/491 (41%), Positives = 292/491 (59%), Gaps = 15/491 (3%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W+++ R ++ P NWP++GMLP+ L N    +D+ T  LK +GGTF  +G  F N   +LT
Sbjct  22    WRRN-RNAIVP-NWPILGMLPSTLHNISNYYDYITLVLKHHGGTFRFEGSWFTNSTGILT  79

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRP  1186
             SDP N+ +I +KNF NY KG++F++ FE FG G LN+DS+ W   R   ++      F  
Sbjct  80    SDPMNVHHIVSKNFGNYEKGSNFKETFETFGAGPLNSDSDEWKKERTMLHSFFKRKNFEN  139

Query  1185  SLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSL---FVE  1015
              L++T+ + +E+ L P LDH +    H DL +   R +FDI        +P  L   F  
Sbjct  140   FLKQTIQKKLENFLLPFLDHASIVKAHVDLHDALTRFTFDITCTFLFGFDPNCLQNNFSH  199

Query  1014  PPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS  835
                D  + KA+     AI+Y+   P   WKLQKW   I +EKK   A ++ DKF++  + 
Sbjct  200   DLGDITYHKALSMIEEAIVYRGFFPTFVWKLQKW-LQIGQEKKLKVAQESLDKFLHECIL  258

Query  834   EKL---NQLHDQDEDDSQNFSMLTSHMKAY-KGKPMQ-FLRDTFVsltisggggttssal  670
              KL   N+     E +  +  ++   +K   KGK  + +LRDT V   +  G GT SS L
Sbjct  259   SKLEEQNRFSSTREVEDSDCDLIKEILKGTGKGKTSEKYLRDTAV-NLLLAGNGTVSSGL  317

Query  669   TWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPP  490
             +W FWL++ +P+VEAK+  E +K    +  +   T  VE+   L+YLH A CE+LRL+PP
Sbjct  318   SWFFWLVSCHPVVEAKIIQE-MKDNCLSDDENLITSIVEKLDKLIYLHGAICEALRLYPP  376

Query  489   IPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGI  310
             +P+  K +++ D LPSG  V P TRIL   YSMGRME IWGEDCMEFKPERW+S   G I
Sbjct  377   VPIEQKFAIKADILPSGVHVSPNTRILYYLYSMGRMEKIWGEDCMEFKPERWISK-SGQI  435

Query  309   KHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEV  130
              HVPS KF  F+ GPR+C+G+ + F+  K+ AA+I++++   L++ H  V P  ++ L +
Sbjct  436   IHVPSYKFIAFNAGPRSCLGKDITFVEMKMAAAAILWKFCIHLVDGHP-VTPRLSITLGM  494

Query  129   KHGVKVKLTKR  97
             KHG+KV +TKR
Sbjct  495   KHGLKVIVTKR  505



>gb|KEH40830.1| cytochrome P450 family protein [Medicago truncatula]
Length=509

 Score =   343 bits (881),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 189/494 (38%), Positives = 288/494 (58%), Gaps = 19/494 (4%)
 Frame = -3

Query  1545  WKKSSRRSMDPTNWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLT  1366
             W+++ R    P NWP+IGMLP  L +    HD+AT  LK+NGGT+  +GP F N   +  
Sbjct  22    WRRN-RDEFVPINWPIIGMLPTFLHHLSDFHDYATIVLKRNGGTYRFQGPWFTNTSFVGL  80

Query  1365  SDPANIDYIHNKNFNNYPKGTHFQKMFEIFGDGILNTDS-ELWDLHRKTTNALMNHIGFR  1189
             +DP N+ YI  KNF NY KG+ F  +FE+ G  I N+DS ++W   +   + ++    F+
Sbjct  81    ADPMNVTYITKKNFGNYAKGSKFHDIFEVLGGSIFNSDSNDVWKQEKTMFHLVLGRKSFK  140

Query  1188  PSLERTVCQTVESGLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSL--FVE  1015
                + ++ + V+  L P L+  ++ G   DLQ+ F R +FD    +    +P  L     
Sbjct  141   NMFQHSIQKKVDDYLIPFLNDVSEAGAQVDLQDAFNRFTFDSSCLILFGFDPNCLPNKFN  200

Query  1014  PPSDHPFRKAIIDAVNAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILS  835
                + P++K++      I Y+H +P   WKLQKW   + +EKK   A +  D+F+Y  ++
Sbjct  201   QLREIPYKKSLPVMEEVIFYRHFIPSSLWKLQKWL-NVGQEKKFKVAQEYLDRFLYESIT  259

Query  834   EKLNQLHDQ---DEDDSQNFSMLTSHMKAYKGK---PMQFLRDTFVsltisggggttssa  673
               L +   +   +E D     M+ +  K   GK     ++LRDT     +  G G+ SSA
Sbjct  260   FSLGEEQSKCSNEEMDQCFLGMVKALKKEGYGKGEISEKYLRDT-ALTMVFAGNGSISSA  318

Query  672   lTWLFWLLAKNPLVEAKLFNEILKVKPQNHAKQTETFKVEECC--DLVYLHAAFCESLRL  499
             L+W FWLL+  P+VE K+  EI   K     ++     + +     LVYLH A CE+LRL
Sbjct  319   LSWFFWLLSTYPIVEEKIIQEI---KDNWLTQEDNRIILRDVVLDKLVYLHGAICETLRL  375

Query  498   FPPIPMNHKMSLETDTLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCG  319
             +PPIP  H  ++++D LPSG ++ P T ++ S YSMGRME +WGEDCMEFKPERW+S+  
Sbjct  376   YPPIPFEHICAIKSDILPSGERISPNTSLMYSMYSMGRMEQLWGEDCMEFKPERWISE-R  434

Query  318   GGIKHVPSNKFPIFSVGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLV  139
             G I HVPS KF  F+ GPR CIG+ + F+  K+VAA+++ ++H +++E H LV P  ++ 
Sbjct  435   GDIIHVPSYKFISFNTGPRICIGKDLSFIQMKMVAAALLRKFHIQVVEGH-LVTPRLSVF  493

Query  138   LEVKHGVKVKLTKR  97
             L +KHG+KV+++KR
Sbjct  494   LRMKHGLKVEVSKR  507



>ref|XP_009101865.1| PREDICTED: cytochrome P450 86B1-like [Brassica rapa]
Length=518

 Score =   344 bits (882),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 189/479 (39%), Positives = 279/479 (58%), Gaps = 22/479 (5%)
 Frame = -3

Query  1509  NWPVIGMLPALLQNAHRLHDFATEFLKQNGGTFELKGPAFANFDMLLTSDPANIDYIHNK  1330
             N PV+ MLP LL   HR+HDF  + L+ +G TF  KGP FA  DMLLT+DP NI +I + 
Sbjct  51    NLPVLRMLPGLLMTLHRIHDFTVKILEFSGMTFLFKGPPFAGMDMLLTADPDNIHHIMSS  110

Query  1329  NFNNYPKGTHFQKMFEIFGDGILNTDSELWDLHRKTTNALMNHIGFRPSLERTVCQTVES  1150
             NF+NY KG   Q++F++FGDGI  TDSE+W   RK+  ++++H  F+     T+   ++S
Sbjct  111   NFSNYIKGPGLQEIFDVFGDGIFTTDSEMWKNLRKSIQSMLHHQEFQRFSMSTMTSKLKS  170

Query  1149  GLFPVLDHYAQRGTHFDLQEIFKRLSFDIGFQVFLDKNPGSLFVEPPSDHPFRKAIIDAV  970
             GL P+L+H+A+ GT  DLQ++F RL+FD    +    +P SL +E   D    KA+ D  
Sbjct  171   GLVPLLNHFAEEGTAVDLQDVFGRLTFDTTLILITGSDPRSLSIELHEDE-LAKALDDTG  229

Query  969   NAILYKHILPERFWKLQKWFFGIDREKKHAEAWDTFDKFIYPILSEKLNQ-LHDQDEDDS  793
               IL +H+ P   WK+Q W  G+ +EKK ++A  TFD+     +S K  + L  Q   + 
Sbjct  230   KGILSRHVKPRFLWKMQNW-MGLGQEKKMSQASATFDRVCSKYISAKREEILRSQGVLNG  288

Query  792   QNFSMLTSHMKAYKGKPM-------QFLRDTFVsltisggggttssalTWLFWLLAKNPL  634
             +   +LTS MK    K         + LRDT +   I  G  T +  L+W FWLL+ NP 
Sbjct  289   EGEDLLTSFMKLDTTKYKFLNPSDDKLLRDT-ILAFIIAGRDTVAFTLSWFFWLLSVNPH  347

Query  633   VEAKLFNEILKVKPQNHAKQTETFKVEECCDLVYLHAAFCESLRLFPPIPMNHKMSLETD  454
             V A +  EI+                E    LVYL  A  E++RL+PP+    K  +++D
Sbjct  348   VVANIRQEIIDTTGNGQ---------ENLDKLVYLQGALFEAMRLYPPVSFGRKSPVKSD  398

Query  453   TLPSGHKVKPKTRILTSFYSMGRMEAIWGEDCMEFKPERWLSDCGGGIKHVPSNKFPIFS  274
              LPSGHKV   ++I+   Y++GRM A+WG+D  +FKPERW+++  GG+KH PS+KF  F+
Sbjct  399   VLPSGHKVDANSKIIICLYALGRMRAVWGKDAFKFKPERWITE-NGGLKHEPSSKFLAFN  457

Query  273   VGPRTCIGQKMFFMVAKIVAASIIFRYHCELMEPHTLVVPSDTLVLEVKHGVKVKLTKR  97
              GPRTC+G+ +     K+V   I+ +Y  E+++    + P    +L +KHG++VK+ KR
Sbjct  458   TGPRTCLGKHLAITQMKMVVVEILQKYDVEVIKGQK-IEPVLGFMLSMKHGLRVKVAKR  515



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5121296209290