BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25861_g1_i1 len=1834 path=[6584:0-312 6896:313-350 13190:351-478
7060:479-503 13340:504-575 7156:576-581 13379:582-599 7180:600-623
1274:624-719 7298:720-742 2352:743-752 7330:753-778 8919:779-854
8995:855-894 9035:895-911 13551:912-970 7548:971-1012 9084:1013-1017
7595:1018-1042 7620:1043-1070 7648:1071-1117 12108:1118-1164
7742:1165-1201 7779:1202-1270 7848:1271-1274 7852:1275-1304
13769:1305-1305 13770:1306-1314 13779:1315-1321 11224:1322-1366
7944:1367-1388 7966:1389-1389 1069:1390-1414 13832:1415-1420
1305:1421-1434 1319:1435-1488 13861:1489-1489 1374:1490-1504
1389:1505-1551 13885:1552-1564 12004:1565-1567 8136:1568-1599
2767:1600-1604 2772:1605-1651 8218:1652-1833]

Length=1834
                                                                      Score     E

ref|XP_004238162.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       402   2e-130   
ref|XP_004236775.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    398   2e-128   
ref|XP_006361401.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    397   3e-128   
emb|CDP05961.1|  unnamed protein product                                387   2e-124   
ref|XP_006354934.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       386   5e-124   
ref|XP_009628388.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    385   1e-123   
ref|XP_004238163.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    379   2e-121   
ref|XP_010319271.1|  PREDICTED: UDP-glycosyltransferase 79B8 isof...    379   1e-120   
ref|XP_004236774.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    378   3e-120   
ref|XP_010062847.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    371   4e-118   
ref|XP_008226432.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       370   3e-117   
ref|XP_008226430.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       367   3e-116   
ref|XP_011082713.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    365   7e-116   
ref|XP_011082711.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    365   1e-115   
ref|XP_010674067.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       363   4e-115   
ref|XP_010062848.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    362   2e-114   
gb|KCW69983.1|  hypothetical protein EUGRSUZ_F03293                     361   2e-114   
ref|XP_007021598.1|  UDP-Glycosyltransferase superfamily protein        361   3e-114   
ref|XP_002316802.1|  glycosyltransferase family protein                 359   2e-113   Populus trichocarpa [western balsam poplar]
ref|XP_002282825.3|  PREDICTED: UDP-glycosyltransferase 79B6-like       356   2e-112   Vitis vinifera
gb|KCW69984.1|  hypothetical protein EUGRSUZ_F03295                     355   3e-112   
ref|XP_010675464.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       356   3e-112   
ref|XP_011008292.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    356   3e-112   
ref|XP_010041982.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    355   6e-112   
ref|XP_002282717.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       354   1e-111   Vitis vinifera
ref|XP_006354953.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    353   1e-111   
ref|XP_010262362.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    352   2e-110   
ref|XP_003634640.2|  PREDICTED: UDP-glycosyltransferase 79B9-like       350   7e-110   
ref|XP_006281777.1|  hypothetical protein CARUB_v10027945mg             350   1e-109   
ref|NP_200217.1|  anthocyanidin 3-O-glucoside 2'''-O-xylosyltrans...    348   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002523261.1|  UDP-glucosyltransferase, putative                  347   5e-109   Ricinus communis
gb|EYU41034.1|  hypothetical protein MIMGU_mgv1a006102mg                347   1e-108   
ref|XP_010520927.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    347   1e-108   
gb|KDO58530.1|  hypothetical protein CISIN_1g012080mg                   347   1e-108   
ref|XP_010098447.1|  UDP-glycosyltransferase                            346   2e-108   
ref|XP_006451768.1|  hypothetical protein CICLE_v10008184mg             346   2e-108   
ref|XP_002866015.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase      345   3e-108   
ref|XP_002285222.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       343   1e-107   Vitis vinifera
ref|XP_006401632.1|  hypothetical protein EUTSA_v10013471mg             343   2e-107   
ref|XP_010260356.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    342   5e-107   
ref|XP_010474328.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    342   5e-107   
ref|XP_010644165.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       342   6e-107   
gb|KFK27016.1|  hypothetical protein AALP_AA8G323600                    341   1e-106   
ref|XP_006401633.1|  hypothetical protein EUTSA_v10013535mg             340   2e-106   
ref|XP_007021621.1|  UDP-Glycosyltransferase superfamily protein        345   2e-106   
emb|CDP05960.1|  unnamed protein product                                340   2e-106   
ref|XP_004304716.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       340   2e-106   
ref|XP_010260530.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    340   3e-106   
ref|XP_010442979.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    338   1e-105   
ref|XP_007025500.1|  UDP-Glycosyltransferase superfamily protein        338   2e-105   
gb|AEM37037.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase 2         338   2e-105   
ref|XP_006289841.1|  hypothetical protein CARUB_v10003451mg             337   2e-105   
ref|XP_004164964.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       337   4e-105   
gb|KDP36254.1|  hypothetical protein JCGZ_09819                         337   5e-105   
ref|NP_194487.1|  UDP-glycosyltransferase 79B3                          337   5e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AEM37036.1|  UDP-glucose:flavonoid 3-O-glucosyltransferase 1         337   6e-105   
ref|XP_002522508.1|  UDP-glucosyltransferase, putative                  336   1e-104   Ricinus communis
ref|XP_010482811.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    336   1e-104   
ref|XP_008355387.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       336   1e-104   
ref|XP_009339314.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       335   2e-104   
ref|XP_010442976.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    334   4e-104   
ref|XP_002867497.1|  glycosyltransferase family protein                 334   5e-104   
ref|XP_010433351.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    334   7e-104   
ref|XP_008371430.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    334   8e-104   
gb|KGN43487.1|  hypothetical protein Csa_7G041320                       334   1e-103   
ref|XP_004144601.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       333   1e-103   
emb|CAN63797.1|  hypothetical protein VITISV_026414                     332   3e-103   Vitis vinifera
ref|NP_200212.1|  UDP-glycosyltransferase 79B6                          332   5e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448113.1|  PREDICTED: UDP-glycosyltransferase 79B3-like...    331   1e-102   
ref|XP_007021619.1|  UDP-Glycosyltransferase superfamily protein        332   1e-102   
ref|XP_008226434.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       330   2e-102   
ref|XP_007213494.1|  hypothetical protein PRUPE_ppa022356mg             330   2e-102   
ref|XP_010438412.1|  PREDICTED: UDP-glycosyltransferase 79B8            329   4e-102   
ref|XP_006449435.1|  hypothetical protein CICLE_v10015186mg             329   4e-102   
ref|XP_009353146.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    329   5e-102   
ref|XP_008371703.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    329   5e-102   
ref|NP_179877.1|  UDP-glycosyltransferase 79B8                          328   5e-102   Arabidopsis thaliana [mouse-ear cress]
gb|EYU44977.1|  hypothetical protein MIMGU_mgv1a006277mg                328   7e-102   
ref|XP_011045872.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    328   9e-102   
ref|XP_010455340.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       328   9e-102   
ref|XP_006467704.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    327   2e-101   
ref|XP_003527222.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       327   3e-101   
ref|NP_194486.1|  UDP-glycosyltransferase 79B2                          327   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496152.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       326   5e-101   
ref|XP_010496151.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       326   6e-101   
ref|XP_006281795.1|  hypothetical protein CARUB_v10027966mg             326   7e-101   
emb|CAN63557.1|  hypothetical protein VITISV_034121                     326   8e-101   Vitis vinifera
gb|KDP21029.1|  hypothetical protein JCGZ_21500                         326   8e-101   
ref|XP_006449434.1|  hypothetical protein CICLE_v10017784mg             326   8e-101   
ref|XP_010421894.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       325   9e-101   
ref|XP_010437944.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       325   1e-100   
ref|XP_006397072.1|  hypothetical protein EUTSA_v10028656mg             325   2e-100   
ref|XP_002866013.1|  glycosyltransferase family protein                 324   2e-100   
gb|EPS67374.1|  hypothetical protein M569_07398                         325   3e-100   
ref|XP_008245371.1|  PREDICTED: LOW QUALITY PROTEIN: anthocyanidi...    324   3e-100   
ref|XP_004307624.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       324   4e-100   
ref|XP_007213460.1|  hypothetical protein PRUPE_ppa024453mg             324   5e-100   
ref|XP_010446338.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    323   5e-100   
ref|XP_006289802.1|  hypothetical protein CARUB_v10003406mg             323   6e-100   
gb|AFJ52978.1|  UDP-glycosyltransferase 1                               324   6e-100   
gb|AAM65481.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamnosylt...    323   7e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132682.1|  hypothetical protein PHAVU_011G115700g             323   8e-100   
ref|XP_007025501.1|  UDP-Glycosyltransferase superfamily protein        323   9e-100   
ref|XP_006286630.1|  hypothetical protein CARUB_v10002468mg             322   1e-99    
ref|XP_009132454.1|  PREDICTED: UDP-glycosyltransferase 79B6            322   1e-99    
ref|XP_002872446.1|  glycosyltransferase family protein                 322   2e-99    
ref|XP_003543299.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    322   3e-99    
ref|XP_004487585.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       321   7e-99    
ref|XP_010537036.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       321   8e-99    
gb|AFK39154.1|  unknown                                                 321   9e-99    
emb|CDY70505.1|  BnaAnng33940D                                          320   9e-99    
ref|XP_002285228.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       320   1e-98    Vitis vinifera
gb|AFJ52975.1|  UDP-glycosyltransferase 1                               320   2e-98    
ref|XP_004487587.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       320   2e-98    
ref|NP_189604.1|  UDP-glycosyltransferase 79B4                          319   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010442973.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       319   3e-98    
ref|XP_009147894.1|  PREDICTED: UDP-glycosyltransferase 79B5-like...    319   3e-98    
dbj|BAE99810.1|  putative flavonol 3-O-glucosyltransferase              319   4e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CAN63555.1|  hypothetical protein VITISV_034119                     319   4e-98    Vitis vinifera
gb|KFK30258.1|  hypothetical protein AALP_AA7G237800                    319   4e-98    
ref|XP_004487586.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       319   5e-98    
ref|XP_009132456.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       318   6e-98    
ref|XP_010421892.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       318   7e-98    
ref|XP_007132838.1|  hypothetical protein PHAVU_011G128700g             318   7e-98    
emb|CBI20246.3|  unnamed protein product                                317   8e-98    
ref|XP_010277785.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    318   8e-98    
gb|KDO77743.1|  hypothetical protein CISIN_1g039043mg                   318   8e-98    
ref|XP_004248461.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    318   1e-97    
ref|XP_010446317.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       317   1e-97    
ref|XP_003596668.1|  Anthocyanidin 3-O-glucosyltransferase              318   1e-97    
ref|XP_003540412.2|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    318   1e-97    
ref|XP_002866011.1|  glycosyltransferase family protein                 317   1e-97    
ref|NP_974524.1|  UDP-glycosyltransferase 79B7                          316   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446327.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       316   4e-97    
ref|XP_004144602.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       317   4e-97    
gb|AAL09791.1|  AT4g27560/T29A15_50                                     317   4e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006393137.1|  hypothetical protein EUTSA_v10012257mg             316   5e-97    
emb|CDO96715.1|  unnamed protein product                                315   5e-97    
gb|KHN13063.1|  UDP-glycosyltransferase 79B3                            317   5e-97    
ref|XP_003607531.1|  Glucosyltransferase                                316   5e-97    
ref|XP_007213912.1|  hypothetical protein PRUPE_ppa005654mg             316   6e-97    
gb|KHN27959.1|  UDP-glycosyltransferase 79B3                            315   1e-96    
ref|XP_003596675.1|  Anthocyanidin 3-O-glucosyltransferase              315   2e-96    
ref|XP_004485850.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       315   2e-96    
ref|XP_010482808.1|  PREDICTED: UDP-glycosyltransferase 79B9            314   2e-96    
ref|XP_003539949.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    315   2e-96    
ref|XP_010245594.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    315   2e-96    
ref|XP_004146274.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       315   2e-96    
ref|XP_006287748.1|  hypothetical protein CARUB_v10000959mg             314   2e-96    
gb|KHN36713.1|  UDP-glycosyltransferase 79B6                            314   3e-96    
emb|CDY65923.1|  BnaCnng49110D                                          313   5e-96    
ref|NP_200210.1|  UDP-glycosyltransferase 79B9                          313   5e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AES89730.2|  UDP-glucosyltransferase family protein                  314   5e-96    
gb|KGN57635.1|  hypothetical protein Csa_3G236030                       315   5e-96    
ref|XP_004499897.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       313   5e-96    
ref|XP_010442978.1|  PREDICTED: UDP-glycosyltransferase 79B6 isof...    312   7e-96    
ref|XP_003596670.1|  Anthocyanidin 3-O-glucosyltransferase              313   7e-96    
gb|EYU28028.1|  hypothetical protein MIMGU_mgv1a006231mg                313   8e-96    
ref|XP_009340538.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       313   8e-96    
ref|XP_009107252.1|  PREDICTED: UDP-glycosyltransferase 79B5-like       313   8e-96    
emb|CDY59372.1|  BnaA08g29640D                                          313   9e-96    
gb|AES66927.2|  UDP-glucosyltransferase family protein                  313   1e-95    
gb|KHN41619.1|  UDP-glycosyltransferase 79B6                            312   1e-95    
ref|XP_008455481.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    313   1e-95    
ref|XP_010455377.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       312   1e-95    
ref|XP_004166346.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    313   2e-95    
ref|XP_008226433.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       311   2e-95    
emb|CDY03578.1|  BnaC03g68370D                                          312   2e-95    
ref|XP_004487588.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       312   2e-95    
ref|XP_008386210.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       312   2e-95    
gb|AFK34819.1|  unknown                                                 311   3e-95    
ref|XP_003526249.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    311   4e-95    
ref|XP_004301656.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       311   5e-95    
ref|XP_004487584.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       310   8e-95    
gb|ADV71366.1|  glycosyltransferase GT10J15                             310   1e-94    
ref|XP_008456016.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    310   1e-94    
ref|XP_009767952.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    310   1e-94    
ref|XP_003593675.1|  Anthocyanidin 3-O-glucosyltransferase              310   2e-94    
ref|XP_008455479.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    310   2e-94    
ref|XP_009127123.1|  PREDICTED: UDP-glycosyltransferase 79B10-like      309   3e-94    
gb|KFK35925.1|  hypothetical protein AALP_AA4G054400                    308   3e-94    
ref|XP_009610402.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    309   3e-94    
emb|CDY28802.1|  BnaA02g09940D                                          308   5e-94    
gb|AES66919.2|  UDP-glucosyltransferase family protein                  307   6e-94    
gb|ACU24192.1|  unknown                                                 308   6e-94    Glycine max [soybeans]
ref|XP_007132923.1|  hypothetical protein PHAVU_011G136400g             308   7e-94    
ref|XP_010035825.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    308   7e-94    
gb|KHN07772.1|  UDP-glycosyltransferase 79B6                            308   7e-94    
ref|XP_006377437.1|  hypothetical protein POPTR_0011s05910g             307   8e-94    
ref|XP_010111152.1|  UDP-glycosyltransferase                            308   8e-94    
ref|XP_010035826.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    307   1e-93    
gb|KHN36711.1|  UDP-glycosyltransferase 79B6                            307   1e-93    
ref|XP_010666234.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    307   1e-93    
dbj|BAE98680.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamnosyl...    306   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007132927.1|  hypothetical protein PHAVU_011G136700g             306   3e-93    
ref|XP_003607533.1|  Glucosyltransferase                                309   4e-93    
ref|XP_010437932.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       305   4e-93    
gb|AES66918.2|  UDP-glucosyltransferase family protein                  306   5e-93    
ref|XP_004487589.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       305   6e-93    
ref|XP_004505528.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       306   6e-93    
gb|EYU19000.1|  hypothetical protein MIMGU_mgv1a021196mg                305   7e-93    
ref|XP_006401636.1|  hypothetical protein EUTSA_v10013536mg             305   1e-92    
ref|XP_003596667.1|  Anthocyanidin 3-O-glucosyltransferase              305   1e-92    
ref|XP_010455375.1|  PREDICTED: UDP-glycosyltransferase 79B8-like       303   2e-92    
ref|XP_006393134.1|  hypothetical protein EUTSA_v10011473mg             303   2e-92    
ref|NP_176671.1|  UDP-glycosyltransferase 79B10                         303   4e-92    Arabidopsis thaliana [mouse-ear cress]
gb|AES66921.2|  UDP-glucosyltransferase family protein                  302   5e-92    
ref|XP_006361070.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    303   5e-92    
ref|NP_175473.1|  UDP-glycosyltransferase 79B5                          303   5e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003530810.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    303   6e-92    
ref|XP_007149722.1|  hypothetical protein PHAVU_005G093600g             303   6e-92    
gb|ABL74480.1|  glucosyltransferase                                     303   6e-92    Ipomoea batatas [batate]
ref|XP_007132948.1|  hypothetical protein PHAVU_011G138500g             302   7e-92    
ref|XP_010479520.1|  PREDICTED: UDP-glycosyltransferase 79B5            302   7e-92    
ref|XP_002891582.1|  glycosyltransferase family protein                 301   9e-92    
ref|XP_010446347.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    301   9e-92    
ref|XP_008465522.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    303   1e-91    
ref|NP_176672.1|  UDP-glycosyltransferase 79B11                         301   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455478.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    302   2e-91    
emb|CBI20245.3|  unnamed protein product                                300   2e-91    
ref|XP_009340549.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       301   3e-91    
ref|XP_008386212.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    301   3e-91    
ref|XP_010686377.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    301   4e-91    
ref|XP_006286772.1|  hypothetical protein CARUB_v10003323mg             300   7e-91    
sp|Q53UH4.1|DUSKY_IPONI  RecName: Full=Anthocyanidin 3-O-glucosid...    300   8e-91    Ipomoea nil [qian niu]
ref|XP_004293911.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       300   9e-91    
gb|AHJ60266.1|  anthocyanidin 3-O-glucoside-2''-O-glucosyltransfe...    299   2e-90    
ref|XP_006393133.1|  hypothetical protein EUTSA_v10012012mg             298   2e-90    
ref|XP_008350006.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    299   2e-90    
sp|Q53UH5.1|DUSKY_IPOPU  RecName: Full=Anthocyanidin 3-O-glucosid...    298   3e-90    Ipomoea purpurea
ref|XP_004144600.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       298   4e-90    
ref|XP_006282036.1|  hypothetical protein CARUB_v10028277mg             296   7e-90    
ref|XP_003596671.1|  Anthocyanidin 3-O-glucosyltransferase              297   1e-89    
ref|XP_002888295.1|  predicted protein                                  296   2e-89    
emb|CAN63798.1|  hypothetical protein VITISV_026415                     295   3e-89    Vitis vinifera
ref|XP_002888294.1|  glycosyltransferase family protein                 295   4e-89    
ref|XP_003540019.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    295   4e-89    
ref|XP_011087015.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    295   4e-89    
ref|NP_192688.2|  UDP-glycosyltransferase 79B7                          294   6e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008383670.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    295   6e-89    
ref|XP_004144610.1|  PREDICTED: UDP-glycosyltransferase 79B1-like       295   1e-88    
ref|XP_010695817.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    294   1e-88    
gb|AAO42032.1|  unknown protein                                         293   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010093489.1|  UDP-glycosyltransferase                            294   2e-88    
ref|XP_003543300.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    294   3e-88    
ref|XP_004169305.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    292   1e-87    
dbj|BAF75891.1|  glucosyltransferase                                    291   1e-87    Dianthus caryophyllus [carnation]
gb|KHN27960.1|  UDP-glycosyltransferase 79B3                            292   5e-87    
ref|XP_011096374.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    290   7e-87    
ref|XP_009352834.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    290   1e-86    
dbj|BAD95884.1|  glucosyltransferase                                    289   1e-86    Ipomoea nil [qian niu]
dbj|BAD95885.1|  glucosyltransferase                                    289   2e-86    Ipomoea nil [qian niu]
gb|AFJ52976.1|  UDP-glycosyltransferase 1                               289   2e-86    
ref|XP_007021622.1|  UDP-Glycosyltransferase superfamily protein,...    287   3e-86    
ref|XP_009352835.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    285   6e-85    
ref|XP_007132949.1|  hypothetical protein PHAVU_011G138600g             284   1e-84    
gb|EYU43362.1|  hypothetical protein MIMGU_mgv1a019428mg                282   3e-84    
ref|XP_003596676.1|  Anthocyanidin 3-O-glucosyltransferase              280   4e-84    
ref|XP_007149716.1|  hypothetical protein PHAVU_005G093300g             282   6e-84    
emb|CBI20248.3|  unnamed protein product                                288   1e-83    
gb|AFJ52977.1|  UDP-glycosyltransferase 1                               281   2e-83    
gb|KCW69986.1|  hypothetical protein EUGRSUZ_F03297                     278   5e-83    
ref|XP_008349217.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    278   1e-82    
ref|XP_010683409.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       276   8e-82    
ref|XP_010093983.1|  UDP-glycosyltransferase                            276   1e-81    
ref|XP_009132457.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       274   2e-81    
emb|CDY43058.1|  BnaA03g12050D                                          272   7e-81    
emb|CDY43844.1|  BnaC03g14770D                                          271   2e-80    
emb|CDY68468.1|  BnaC03g71890D                                          271   3e-80    
ref|XP_010683332.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    272   3e-80    
ref|XP_010683331.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       272   5e-80    
ref|XP_010442975.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       270   1e-79    
ref|XP_010683329.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    269   4e-79    
dbj|BAC10994.1|  rhamnosyl transferase                                  268   2e-78    Nierembergia sp. NB17
ref|XP_002309370.1|  hypothetical protein POPTR_0006s19340g             267   2e-78    Populus trichocarpa [western balsam poplar]
ref|XP_009587143.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    267   5e-78    
ref|XP_009416585.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    266   9e-78    
gb|EPS58858.1|  glucosyltransferase                                     265   1e-77    
ref|XP_010683330.1|  PREDICTED: UDP-glycosyltransferase 79B6-like...    265   2e-77    
ref|XP_002509496.1|  UDP-glucosyltransferase, putative                  264   4e-77    
gb|EPS58859.1|  hypothetical protein M569_15954                         263   5e-77    
emb|CAN71740.1|  hypothetical protein VITISV_005149                     274   1e-76    
ref|XP_006373006.1|  hypothetical protein POPTR_0017s06940g             260   2e-76    
ref|XP_009761380.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    263   2e-76    
ref|XP_006421028.1|  hypothetical protein CICLE_v10004868mg             262   3e-76    
gb|KDO40622.1|  hypothetical protein CISIN_1g037721mg                   261   4e-76    
gb|EYU28029.1|  hypothetical protein MIMGU_mgv1a006905mg                260   5e-76    
ref|NP_001275829.1|  1,6-rhamnosyltransferase                           259   3e-75    
emb|CDY43057.1|  BnaA03g12040D                                          256   7e-75    
gb|KFK27014.1|  hypothetical protein AALP_AA8G323200                    252   8e-74    
ref|XP_004247056.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    254   2e-73    
ref|XP_003591655.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    254   3e-73    
ref|XP_006367560.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    253   5e-73    
ref|XP_011089649.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    253   5e-73    
emb|CAA81057.1|  UDP rhamnose: anthocyanidin-3-glucoside rhamnosy...    253   6e-73    
emb|CAA50376.1|  anthocyanin 3 glucoside: rhamnosyltransferase          253   7e-73    
gb|ABO21820.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    253   7e-73    
gb|ABO21818.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    253   7e-73    
gb|ABO21828.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    253   7e-73    
gb|ABO21805.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    253   7e-73    
sp|Q43716.1|UFOG_PETHY  RecName: Full=Anthocyanidin 3-O-glucosylt...    253   8e-73    
gb|ABO21810.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    252   1e-72    
ref|NP_001275524.1|  anthocyanidin 3-O-glucosyltransferase-like         252   1e-72    
gb|KDO77744.1|  hypothetical protein CISIN_1g017557mg                   249   2e-72    
ref|XP_003556320.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    251   3e-72    
ref|XP_004496085.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    251   3e-72    
ref|XP_007144190.1|  hypothetical protein PHAVU_007G135800g             250   5e-72    
gb|ABO21830.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    250   8e-72    
gb|ABO21809.1|  UDP rhamnose:anthocyanidin-3-glucoside rhamnosylt...    250   1e-71    
gb|AFJ52973.1|  UDP-glycosyltransferase 1                               249   3e-71    
ref|XP_010696239.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    246   2e-70    
gb|KHN00987.1|  Anthocyanidin 3-O-glucosyltransferase                   244   1e-69    
gb|KHN30680.1|  Anthocyanidin 3-O-glucosyltransferase                   242   4e-69    
emb|CDP03925.1|  unnamed protein product                                243   5e-69    
emb|CDY65922.1|  BnaCnng49100D                                          242   7e-69    
ref|XP_006593292.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    239   2e-68    
ref|XP_003606381.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    240   3e-68    
ref|XP_006401634.1|  hypothetical protein EUTSA_v10016070mg             236   1e-67    
ref|XP_010909266.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    239   1e-67    
ref|XP_003596801.1|  Pentatricopeptide repeat-containing protein        246   2e-67    
gb|KCW69985.1|  hypothetical protein EUGRSUZ_F03296                     236   2e-67    
ref|XP_010696238.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    237   5e-67    
dbj|BAJ85176.1|  predicted protein                                      236   2e-66    
ref|XP_010909163.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    235   3e-66    
ref|XP_008778568.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    234   5e-66    
ref|XP_006848503.1|  hypothetical protein AMTR_s00013p00259270          234   6e-66    
ref|XP_006354893.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       226   3e-65    
ref|XP_006354894.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       225   9e-65    
ref|XP_003560486.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    231   1e-64    
ref|XP_010445097.1|  PREDICTED: UDP-glycosyltransferase 79B3-like       225   3e-64    
ref|XP_006360080.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       224   2e-63    
ref|XP_010091273.1|  Anthocyanidin 3-O-glucosyltransferase              228   3e-63    
ref|XP_004979787.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    226   6e-63    
ref|XP_004980748.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    224   4e-62    
gb|KHG23094.1|  hypothetical protein F383_29773                         220   5e-61    
ref|XP_003560487.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    219   2e-60    
ref|XP_004979714.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    219   2e-60    
ref|XP_002442800.1|  hypothetical protein SORBIDRAFT_08g003060          219   5e-60    
gb|ABA93458.1|  Flavonol 3-O-glucosyltransferase, putative, expre...    218   9e-60    
gb|ABR16160.1|  unknown                                                 217   2e-59    
ref|XP_008246180.1|  PREDICTED: UDP-glycosyltransferase 79B6-like       211   2e-59    
ref|XP_010111557.1|  Anthocyanidin 3-O-glucosyltransferase              216   5e-59    
ref|XP_004979244.1|  PREDICTED: anthocyanidin 3-O-glucosyltransfe...    214   2e-58    
gb|ABR18376.1|  unknown                                                 214   2e-58    
ref|XP_010091274.1|  Anthocyanidin 3-O-glucosyltransferase              214   2e-58    
ref|NP_001067852.2|  Os11g0457300                                       214   3e-58    
gb|KFK32776.1|  hypothetical protein AALP_AA6G287200                    207   2e-57    
gb|EAY80827.1|  hypothetical protein OsI_36007                          209   2e-56    
ref|XP_003606382.1|  UDP rhamnose anthocyanidin-3-glucoside rhamn...    204   8e-56    
gb|AAN40684.1|  UDP-glucosyltransferase                                 206   9e-56    
ref|NP_001131009.1|  uncharacterized protein LOC100192114 precursor     206   1e-55    
gb|AAR06923.1|  UDP-glycosyltransferase 79A2                            206   1e-55    
gb|KDP29780.1|  hypothetical protein JCGZ_18715                         205   4e-55    
ref|XP_010064901.1|  PREDICTED: anthocyanidin 3-O-glucoside 2'''-...    198   1e-54    
ref|XP_002448983.1|  hypothetical protein SORBIDRAFT_05g002850          204   1e-54    
emb|CBI20242.3|  unnamed protein product                                198   2e-53    
gb|KDP29789.1|  hypothetical protein JCGZ_18724                         200   3e-53    
ref|XP_002448982.1|  hypothetical protein SORBIDRAFT_05g002840          199   7e-53    
ref|XP_009415710.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    197   3e-52    
ref|XP_011017699.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       196   7e-52    
ref|XP_010938322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    194   3e-51    
ref|XP_010277530.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       194   3e-51    
ref|XP_010934404.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    194   4e-51    
gb|KDP29783.1|  hypothetical protein JCGZ_18718                         194   4e-51    
ref|XP_008779257.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    192   5e-51    
ref|XP_004289519.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    194   6e-51    
ref|XP_011015214.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    194   6e-51    
gb|KDP29779.1|  hypothetical protein JCGZ_18714                         193   8e-51    
ref|XP_010938324.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    193   9e-51    
gb|KDP29785.1|  hypothetical protein JCGZ_18720                         192   2e-50    
ref|XP_004288529.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       192   2e-50    
ref|XP_008807755.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    192   3e-50    
ref|XP_010430891.1|  PREDICTED: UDP-glycosyltransferase 79B4            186   3e-50    
ref|XP_011015202.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    191   4e-50    
ref|XP_010456823.1|  PREDICTED: UDP-glycosyltransferase 79B7-like       182   5e-49    
gb|EEE52059.1|  hypothetical protein OsJ_33813                          188   5e-49    
ref|XP_008788945.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    187   9e-49    
ref|XP_004287868.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    187   1e-48    
ref|XP_007018258.1|  UDP-Glycosyltransferase superfamily protein        187   2e-48    
dbj|BAK03755.1|  predicted protein                                      187   2e-48    
gb|KCW79472.1|  hypothetical protein EUGRSUZ_C00857                     186   2e-48    
emb|CDP03916.1|  unnamed protein product                                184   2e-48    
ref|XP_010501682.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       180   2e-48    
emb|CDP03917.1|  unnamed protein product                                184   3e-48    
ref|XP_009408288.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       186   3e-48    
emb|CDP01582.1|  unnamed protein product                                186   3e-48    
ref|XP_010547586.1|  PREDICTED: UDP-glycosyltransferase 91B1            186   4e-48    
gb|ABR18123.1|  unknown                                                 186   4e-48    
ref|XP_010050451.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       187   5e-48    
ref|XP_008789644.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    185   5e-48    
emb|CDP21084.1|  unnamed protein product                                185   6e-48    
gb|KDP29791.1|  hypothetical protein JCGZ_18726                         184   1e-47    
sp|Q66PF2.1|URT1_FRAAN  RecName: Full=Putative UDP-rhamnose:rhamn...    184   2e-47    
gb|KHN11172.1|  UDP-glycosyltransferase 79B3                            181   2e-47    
emb|CDP01583.1|  unnamed protein product                                183   3e-47    
ref|XP_002315125.2|  hypothetical protein POPTR_0010s18980g             183   3e-47    
ref|XP_004288528.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       182   6e-47    
emb|CDP04856.1|  unnamed protein product                                182   7e-47    
ref|XP_010440988.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       182   1e-46    
gb|KEH20103.1|  UDP-glucosyltransferase family protein                  181   2e-46    
dbj|BAN91400.1|  flavonol 3-O-glucoside (1->6) rhamnosyltransferase     177   2e-46    
ref|XP_004955936.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    181   2e-46    
ref|XP_009800982.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    181   3e-46    
ref|XP_004289539.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       180   3e-46    
ref|XP_010905696.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    179   6e-46    
ref|XP_010934416.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    179   6e-46    
ref|XP_007208586.1|  hypothetical protein PRUPE_ppa023071mg             179   1e-45    
ref|XP_007212397.1|  hypothetical protein PRUPE_ppa016365mg             173   2e-45    
emb|CDP21820.1|  unnamed protein product                                177   2e-45    
ref|XP_010661830.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    177   4e-45    
dbj|BAO45905.1|  UDP-glycosyltransferase                                176   6e-45    
ref|XP_002533518.1|  UDP-glucosyltransferase, putative                  176   8e-45    
ref|XP_009364807.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    176   9e-45    
ref|XP_004288503.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    176   9e-45    
ref|XP_010047532.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       176   1e-44    
ref|XP_002865752.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    176   1e-44    
ref|NP_199780.1|  UDP-glycosyltransferase 91C1                          175   1e-44    
ref|XP_007206476.1|  hypothetical protein PRUPE_ppa019000mg             172   3e-44    
emb|CAN63799.1|  hypothetical protein VITISV_026416                     168   3e-44    
dbj|BAK04512.1|  predicted protein                                      173   7e-44    
gb|KHN19033.1|  UDP-glycosyltransferase 79B6                            169   8e-44    
emb|CDP01584.1|  unnamed protein product                                173   1e-43    
ref|XP_010061561.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       173   1e-43    
ref|XP_008338469.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    172   1e-43    
gb|KDP29778.1|  hypothetical protein JCGZ_18713                         172   2e-43    
ref|XP_009623232.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    172   2e-43    
ref|XP_008236334.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    172   2e-43    
emb|CDY43062.1|  BnaA03g12090D                                          170   2e-43    
ref|XP_007156464.1|  hypothetical protein PHAVU_003G288200g             172   2e-43    
ref|XP_008455548.1|  PREDICTED: anthocyanidin 3-O-glucoside 2''-O...    166   2e-43    
gb|EAZ03144.1|  hypothetical protein OsI_25293                          172   3e-43    
ref|XP_009112190.1|  PREDICTED: UDP-glycosyltransferase 91B1            171   3e-43    
gb|EPS66584.1|  hypothetical protein M569_08191                         171   3e-43    
emb|CDO97382.1|  unnamed protein product                                171   4e-43    
ref|XP_007156463.1|  hypothetical protein PHAVU_003G288100g             171   5e-43    
ref|XP_010277529.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    171   5e-43    
dbj|BAJ89368.1|  predicted protein                                      171   5e-43    
ref|XP_006282295.1|  hypothetical protein CARUB_v10028581mg             170   7e-43    
emb|CDP21083.1|  unnamed protein product                                170   7e-43    
gb|AHL38585.1|  glycosyltransferase                                     175   7e-43    
ref|XP_002275850.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    170   8e-43    
ref|XP_009801322.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    170   8e-43    
ref|XP_011073572.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    170   9e-43    
ref|XP_011000621.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       170   9e-43    
ref|XP_010047531.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       170   9e-43    
ref|XP_004250157.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    170   1e-42    
gb|AAM53963.1|AF515727_1  UDP-glucosyltransferase                       170   1e-42    
ref|XP_010442438.1|  PREDICTED: UDP-glycosyltransferase 91C1            169   1e-42    
gb|AAR06918.1|  UDP-glycosyltransferase 91D1                            170   2e-42    
ref|XP_002297733.1|  glycosyltransferase family protein                 169   2e-42    
ref|XP_011093242.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    169   2e-42    
ref|XP_006301862.1|  hypothetical protein CARUB_v10022332mg             165   2e-42    
gb|KCW59683.1|  hypothetical protein EUGRSUZ_H02441                     169   3e-42    
gb|AFK35814.1|  unknown                                                 169   3e-42    
ref|XP_010023429.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       169   3e-42    
ref|XP_007021620.1|  UDP-Glycosyltransferase superfamily protein        167   3e-42    
ref|XP_010485115.1|  PREDICTED: UDP-glycosyltransferase 79B9-like       162   3e-42    
ref|XP_011093243.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    169   3e-42    
ref|NP_001059134.1|  Os07g0202000                                       169   4e-42    
ref|XP_002533517.1|  UDP-glucosyltransferase, putative                  167   5e-42    
gb|AES79436.2|  UDP-glucosyltransferase family protein                  167   6e-42    
ref|XP_006353159.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    168   6e-42    
ref|XP_006836292.1|  hypothetical protein AMTR_s00092p00015830          168   7e-42    
emb|CDP00929.1|  unnamed protein product                                168   7e-42    
ref|XP_003570831.2|  PREDICTED: UDP-glycosyltransferase 91C1-like       168   8e-42    
ref|XP_006852904.1|  hypothetical protein AMTR_s00033p00224400          167   1e-41    
ref|XP_009788298.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    167   1e-41    
ref|XP_009629528.1|  PREDICTED: crocetin glucoside glucosyltransf...    166   1e-41    
ref|XP_007134314.1|  hypothetical protein PHAVU_010G036800g             166   1e-41    
ref|XP_004982379.1|  PREDICTED: UDP-glycosyltransferase 91C1-like       166   1e-41    
ref|NP_001051624.1|  Os03g0804900                                       167   1e-41    
gb|KFK29804.1|  hypothetical protein AALP_AA7G181400                    166   2e-41    
ref|XP_010646446.1|  PREDICTED: LOW QUALITY PROTEIN: putative UDP...    166   2e-41    
ref|XP_008811282.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    166   2e-41    
ref|XP_003559278.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    166   2e-41    
ref|XP_003623218.1|  Anthocyanidin 3-O-glucosyltransferase              167   3e-41    
gb|AFJ53033.1|  UDP-glycosyltransferase 1                               166   3e-41    
ref|XP_010910495.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    166   3e-41    
ref|XP_011092703.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    166   3e-41    
ref|XP_003593142.1|  Glucosyltransferase                                166   4e-41    
gb|AFJ53031.1|  UDP-glycosyltransferase 1                               166   4e-41    
gb|ABR16053.1|  unknown                                                 166   4e-41    
ref|XP_010535333.1|  PREDICTED: UDP-glycosyltransferase 91C1            165   5e-41    
ref|XP_004240255.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    165   5e-41    
gb|KDO60536.1|  hypothetical protein CISIN_1g011765mg                   165   5e-41    
ref|XP_010680364.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    165   7e-41    
dbj|BAC43110.1|  putative anthocyanidin-3-glucoside rhamnosyltran...    164   7e-41    
ref|XP_009606311.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    165   7e-41    
gb|KHN26940.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            164   8e-41    
ref|NP_201358.1|  UDP-glycosyltransferase 91B1                          164   8e-41    
ref|XP_010482257.1|  PREDICTED: UDP-glycosyltransferase 91C1-like...    164   9e-41    
ref|XP_011099970.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    165   9e-41    
ref|XP_003635105.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       164   9e-41    
gb|KHN26938.1|  Putative UDP-rhamnose:rhamnosyltransferase 1            164   9e-41    
ref|XP_006353156.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       164   1e-40    
ref|XP_002320817.1|  hypothetical protein POPTR_0014s08440g             164   1e-40    
gb|ACE87855.1|  UDP-glucosyltransferase                                 164   1e-40    
ref|XP_004489091.1|  PREDICTED: putative UDP-rhamnose:rhamnosyltr...    164   1e-40    
ref|XP_009623233.1|  PREDICTED: UDP-glycosyltransferase 91A1-like       164   1e-40    
ref|XP_003596666.1|  UDP rhamnose-anthocyanidin-3-glucoside rhamn...    162   1e-40    



>ref|XP_004238162.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Solanum lycopersicum]
Length=457

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 238/458 (52%), Positives = 317/458 (69%), Gaps = 11/458 (2%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             + I MFPWLA+GH IPF+ L+N+LAKRGH+IS LLP  A  +L+ +  YP LI F  LTI
Sbjct  1     MEIVMFPWLAYGHLIPFMNLSNELAKRGHKISFLLPKTAETRLQKLIFYPSLINFHKLTI  60

Query  496   PQVEGLPPGAETTADTMN-LDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAETTAD    L+  L  A D L DE+K   LQ  KP+ VF+DFAYWIP+L 
Sbjct  61    PHVDGLPYGAETTADVPGPLESLLATAFDELYDEIKC-FLQNLKPHFVFFDFAYWIPDLA  119

Query  673   SEMG-CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
              E+G  KT+ + V  P +S++S+I S  K    A TAA++++PPPG+PS + VVLRE EA
Sbjct  120   LEIGGIKTLFYRVVCPAVSSVSVIRSPDKAIFMASTAAELVKPPPGYPS-TTVVLRESEA  178

Query  850   YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpl  1029
               +S   +   N +T ++R+ + + RCDAIA + C E+EG++C YI+T+  KPV   GP+
Sbjct  179   KLLSFVFHEYGNGVTFYERIKKGMTRCDAIAMKTCREIEGNFCTYISTQFEKPVLYTGPV  238

Query  1030  lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAV  1209
             + EP  E   E  +  WLEKFEP SV+FCAFGS+++L K QF +L+LG ELT LPFL+ V
Sbjct  239   ISEPKNEPLEEHGLTNWLEKFEPGSVVFCAFGSQMILEKTQFQELVLGFELTELPFLLVV  298

Query  1210  KPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLA  1389
             K PE ++S+E+ALPEGF+ER + K ++   WVPQ  ILRHK+VG FV H G GSMWESLA
Sbjct  299   KTPEGTNSVEEALPEGFKERVQEKGLILDCWVPQLEILRHKSVGCFVTHCGYGSMWESLA  358

Query  1390  -SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ-  1563
                C++++  P   D+  NARLM ++L+  +EV+ DEND F KENLC A+K VM ++ Q 
Sbjct  359   LCDCQLVLL-PRPIDHIFNARLMEKQLKVGIEVEKDENDMFTKENLCKAVKCVMDKDSQI  417

Query  1564  ----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
                 K NHKKW++LL +PGF  NYID+FI  L EL V+
Sbjct  418   GCVVKENHKKWKELLSSPGFMSNYIDNFIQDLNELLVE  455



>ref|XP_004236775.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
isoform X3 [Solanum lycopersicum]
Length=463

 Score =   398 bits (1022),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 325/461 (70%), Gaps = 11/461 (2%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS L I MFPWLA GH IPFL L+N+LAK+GH+IS LLP NA +KL+++NLYP LITF  
Sbjct  6     DSKLQIVMFPWLALGHIIPFLNLSNELAKKGHKISFLLPKNAQIKLQNLNLYPNLITFHT  65

Query  487   LTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             L IP + GLP GAETTAD   +L+  L  A+D L DE+K+  LQ  KP+ VF+DFA+W+ 
Sbjct  66    LKIPHIHGLPYGAETTADVPRSLETLLATAMDELYDEIKS-FLQNLKPHFVFFDFAHWVT  124

Query  664   ELVSEMG-CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             E+  E+G   T+ + + SP  SA+SLI S  K    A TAA+ + PPPG+PS + VVL E
Sbjct  125   EIALEIGDINTICYKLTSPATSAISLIRSPEKSVFMASTAAEKVRPPPGYPSTT-VVLHE  183

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             HEA  +          +T+++R+ + +  CDAIA + C E+EG + +YIAT+  KPV   
Sbjct  184   HEAKLLEFLFQEYGKGVTIYERLTKGMTLCDAIALKTCREIEGTFGDYIATQFKKPVLYT  243

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+LP+P +    E  ++ WLEKFEP SV+FCAFGS+++L K+QF +L+LGLELTGLPFL
Sbjct  244   GPVLPDPEKGPLAEHGLSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFL  303

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             V +KPPE ++S+E+ALPEGF+ER + K +V   WVPQ  IL HK+VG FV+H G GSMWE
Sbjct  304   VVLKPPEGTNSVEEALPEGFKERVQEKGLVLACWVPQLKILTHKSVGCFVSHCGYGSMWE  363

Query  1381  SLA-SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN  1557
             SLA   C++++  P+ +D  L+AR+M ++L+  VEV+ DEN  F KE+LC A+K VM ++
Sbjct  364   SLALCDCQLVLL-PSANDQTLSARMMEQDLKVGVEVKKDENGWFSKESLCKAVKCVMDKD  422

Query  1558  IQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
              Q     K NH+KW+++L +PGF  NYIDSFI  LYEL V+
Sbjct  423   SQVGCLVKENHRKWKEVLSSPGFMSNYIDSFIQILYELLVK  463



>ref|XP_006361401.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Solanum tuberosum]
Length=463

 Score =   397 bits (1020),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 238/460 (52%), Positives = 324/460 (70%), Gaps = 11/460 (2%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S L I MFPWLAFGH IPFL L+N+LAK+GHRIS LLP NA +KL++ NLYP LITF  L
Sbjct  7     SKLQIVMFPWLAFGHLIPFLSLSNELAKKGHRISFLLPKNAEIKLQNFNLYPNLITFHTL  66

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
              IP + GLP GAETTAD   +L+  L  A+D L DE+K+ L  + KP+ VF+DFA+W+PE
Sbjct  67    KIPHIHGLPYGAETTADVPRSLETLLATAMDELYDEIKSFLRNL-KPHFVFFDFAHWVPE  125

Query  667   LVSEMG-CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             + +E+G  KT+ + +  P  SA SL+ S  K    A TAA+ + PPPG+PS + VVL EH
Sbjct  126   IATEIGGIKTLCYKIVCPATSAYSLVRSPKKSVFIASTAAEKVRPPPGYPSTT-VVLHEH  184

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             EA  +          +T+++R+ + +  CDAIA + C E+EG + +YIAT+  KPV   G
Sbjct  185   EAKLLEFLFQEYGKGVTIYERLSKGVTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTG  244

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LP+  +    E  ++ WLEKFEP SV+FCAFGS+++L K+QF +L+LGLELTGLPFL+
Sbjct  245   PVLPDSEKGPLEEHGLSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLL  304

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
              VKPPE + S+E+ALPEGF+ER + K ++   WVPQ  IL HK+VG FV+H G GSMWES
Sbjct  305   VVKPPEGTKSVEEALPEGFKERVQEKGLILDCWVPQLKILTHKSVGCFVSHCGYGSMWES  364

Query  1384  LA-SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENI  1560
             LA   C++++  P+ +D  L+ARLM ++L+  VEV+ DEN  F KE+LC A+K VM ++ 
Sbjct  365   LALCDCQLVLL-PSANDQTLSARLMEQDLKVGVEVKKDENGWFSKESLCKAVKCVMDKDS  423

Query  1561  Q-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
             Q     K NH+KW+++L +PGF +NYIDSFI  L+EL V+
Sbjct  424   QFGCLVKENHRKWKEVLSSPGFMNNYIDSFIQNLHELLVK  463



>emb|CDP05961.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   387 bits (994),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 235/451 (52%), Positives = 316/451 (70%), Gaps = 13/451 (3%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             MFPW A GH  PFL L+N LA++GHRIS LLP  A  +L+H+NL+P LITF  LT+P VE
Sbjct  1     MFPWFATGHMTPFLHLSNKLAEKGHRISFLLPNKAKHQLEHLNLHPSLITFYTLTVPHVE  60

Query  508   GLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMG  684
             GLPPG ET +D  + L   L  A+D ++D V+  LLQ  KP++VFYD A+WIPEL SE+G
Sbjct  61    GLPPGTETASDVPIFLTSLLATAMDNMRDRVRD-LLQKLKPSIVFYDMAHWIPELASEIG  119

Query  685   CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSR  864
              KTV + V S    A++L+ S+   + R +T A++MEPPPG+PS S V+LR HEA  +S 
Sbjct  120   FKTVNYNVVSAASIAIALVPSRKPVEDRTITGAELMEPPPGYPS-STVLLRRHEAQGLSF  178

Query  865   -FLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpep  1041
              FL   ++ IT +DR+  A+KR  AI+ R C E+EG  C+YIA E  KPV+  GP+LPE 
Sbjct  179   IFLEFGKD-ITFYDRITIAMKRSHAISIRTCRELEGSLCDYIAREYHKPVFLTGPVLPES  237

Query  1042  preepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKPPE  1221
              +E+   +K A WL+ FEP +V+FCAFGS+VVL K+QF +L+LG ELTGLPFL+A+KPP 
Sbjct  238   EKEDLQ-EKWANWLKGFEPGTVVFCAFGSQVVLEKQQFQELVLGFELTGLPFLIALKPPF  296

Query  1222  RSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASHCR  1401
              ++S+E+ALPEGF+ R +G+ IV+GGWV Q  IL H +VG FVNH G GSMWESL S C+
Sbjct  297   GTTSVEEALPEGFEGRIRGRGIVYGGWVQQPAILSHPSVGCFVNHCGFGSMWESLMSDCQ  356

Query  1402  IIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGENIQ-----  1563
             I++  P+ +D  LN RL+AEEL+ AVEV+ D    +F +E+LC AIKS M  + +     
Sbjct  357   IVLV-PHLADQILNTRLLAEELKVAVEVERDNKSTWFSRESLCRAIKSAMDRDSEVGGLI  415

Query  1564  KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + NH KW+++L +P F  + I+ FI  L EL
Sbjct  416   RENHAKWKEVLASPTFMGDCIEKFIQDLQEL  446



>ref|XP_006354934.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Solanum tuberosum]
Length=455

 Score =   386 bits (991),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 236/463 (51%), Positives = 324/463 (70%), Gaps = 18/463 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M +S L I MFPWLA GH IP++ L+N+LAKRGH+IS LLP NA ++L+ +NLYP LI F
Sbjct  1     MGESKLEIVMFPWLALGHLIPYMNLSNELAKRGHKISFLLPRNAEIRLQKLNLYPNLIKF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               LTIP V+GLP GAETTAD   +L+  L  A D L DE+K+  LQ  KP+ VF+DFAYW
Sbjct  61    HKLTIPHVDGLPYGAETTADVHRSLESLLATAFDELYDEIKS-FLQNLKPHFVFFDFAYW  119

Query  658   IPELVSEMG-CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             IP++  E+G  KT+ + + SP  +A+S+  S  K      TAA++++PPPG+PS + VVL
Sbjct  120   IPDIAREIGGIKTLFYLLVSP--AAMSI--SPDKATFMTSTAAELVKPPPGYPS-TTVVL  174

Query  835   REHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
             RE EA  +S   +     +T  +R+ +   +CD IA + C E+EG +C+Y+AT L KPV 
Sbjct  175   RESEAKLLSFLFHEYGKGVTFQERLSKGFTQCDVIAVKTCREIEGIFCDYVATLLEKPVL  234

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              AGP++P+P +E+    +++ WLEKFEP SV+FCAFGS+++L K+QF QL+LGLELT LP
Sbjct  235   YAGPVIPDPKKEQ---HELSNWLEKFEPGSVVFCAFGSQLILEKKQFQQLVLGLELTELP  291

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL+ VKPP+ ++S+E+ALPEGF++R + K ++   WVPQ  ILRHK+VG FV H G GSM
Sbjct  292   FLLVVKPPQGTNSVEEALPEGFKQRVQEKGLILDCWVPQLEILRHKSVGCFVTHCGYGSM  351

Query  1375  WESLA-SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             WESL    C++++  P   D+   ARLM + L+  VEV+ DEND F KENLC A+K VM 
Sbjct  352   WESLVMCDCQLVLL-PRPIDHIFTARLMEQHLKVGVEVEKDENDLFTKENLCKAVKCVMD  410

Query  1552  ENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
             ++ Q     K NH+KW++LL +PGF  NYID+FI  L+ L V+
Sbjct  411   KDSQIGCLVKENHRKWKELLSSPGFMSNYIDNFIQDLHGLLVE  453



>ref|XP_009628388.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Nicotiana tomentosiformis]
Length=458

 Score =   385 bits (989),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 233/453 (51%), Positives = 315/453 (70%), Gaps = 11/453 (2%)
 Frame = +1

Query  313   MLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALT  492
             +LHIAMFPW AFGHF PFL LAN+LAKRGH+IS LLP  A  +L+++NL+P LITF +LT
Sbjct  8     ILHIAMFPWFAFGHFTPFLHLANELAKRGHQISFLLPKKAQFQLQNINLHPNLITFHSLT  67

Query  493   IPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPEL  669
             IPQVEGLP G  T +D  + L   L + LD ++D++K++L ++ KP++VFYDFAYWIP+ 
Sbjct  68    IPQVEGLPLGTXTASDVPIFLTCHLAMXLDQMRDQIKSLLAKL-KPHIVFYDFAYWIPDY  126

Query  670   VSEMGCKTVKFTVFSPTISALSLI-TSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
               E+  KT+ + V      A+ L+   KS   G   T  ++M+PP G+PS S VVLREHE
Sbjct  127   APEISYKTICYNVVCAASIAIMLVPVRKSCPSGAPPTVEEMMKPPKGYPS-SAVVLREHE  185

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             +  +S   +     +T +DRV  ALK+CDAI+ R C E  G  C+Y++++  KPV+  GP
Sbjct  186   SRALSFMFHEYGRGVTFYDRVTTALKKCDAISIRTC-ENXGPLCDYLSSQYNKPVFLTGP  244

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
             +LPEP  +E LE K A WL++F+P S++FCAFGS++VL K QF +L+LG+ELT  PFL+A
Sbjct  245   ILPEPTSKELLEGKWATWLKQFKPGSILFCAFGSQMVLEKSQFQELVLGIELTDFPFLIA  304

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP    +IE+ALPEGF+ERTKG+ IV+G  VP+  IL H ++G FV+H G GSMWESL
Sbjct  305   LKPPLGVKTIEEALPEGFEERTKGRGIVYGDLVPKLXILSHSSIGCFVSHCGFGSMWESL  364

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN---  1557
              S C+I++  P+  D  LN RL+A+EL  AVEV+ DEN  F KENLC  I+SVM E    
Sbjct  365   MSECQIVLI-PHLGDQILNTRLLADELNVAVEVERDENGWFTKENLCKVIRSVMNEGSEL  423

Query  1558  --IQKVNHKKWRDLLLTPGFADNYIDSFIHKLY  1650
               + K NH KW++ L  PGF   YI+ F+H L+
Sbjct  424   GYLVKKNHAKWKETLTRPGFMSGYIEEFMHNLH  456



>ref|XP_004238163.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Solanum lycopersicum]
Length=455

 Score =   379 bits (974),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 235/460 (51%), Positives = 312/460 (68%), Gaps = 18/460 (4%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             +S L I MFPWLAFGH IPF+ L+N+LAKRGH I+ LLP NA  +L+ +NLYP LI F  
Sbjct  6     ESKLEIVMFPWLAFGHLIPFMNLSNELAKRGHNITFLLPQNAETRLQKLNLYPNLIKFHK  65

Query  487   LTIPQVEGLPPGAETTADTMN-LDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LTIP V+GLP GAETTAD    ++  L  A D L DE+K+IL Q  KP+ VF+DFAYWIP
Sbjct  66    LTIPHVDGLPYGAETTADVPGPMETLLATAFDELYDEIKSIL-QNLKPHFVFFDFAYWIP  124

Query  664   ELVSEMG-CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             +L  E+G  KT+ + + SP     +L  S  K      TAA++ +PPPG+PS + VVL E
Sbjct  125   DLAKEIGGIKTLIYLLISPA----ALCKSTDKATFMTSTAAELAKPPPGYPSTT-VVLHE  179

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
              EA  +S         +T  +R+ +AL++CD IA + C E+EG +C Y+A  L KPV   
Sbjct  180   SEAKLLSFVYQEYGKGVTFQERLDKALRQCDVIAAKTCREIEGIFCEYLANLLEKPVIYV  239

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP++PEP +E+    +++ WLEKFEP SV+FCAFGS+++L K QF +L+LG ELT LPFL
Sbjct  240   GPVIPEPKKEQ---HELSNWLEKFEPGSVVFCAFGSQMILEKTQFQELVLGFELTELPFL  296

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             + VKPP+ ++S+E+ALPEGF++R + K ++   WVPQ  ILRHK+VG FV H G GSMWE
Sbjct  297   LVVKPPQGTNSVEEALPEGFKQRIQEKGLILDCWVPQLEILRHKSVGCFVTHCGYGSMWE  356

Query  1381  SLA-SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN  1557
             SL    C++++  P   D+   ARLM + L+  VEV+ DEND F KENLC A+K VM ++
Sbjct  357   SLVLCDCQLVLL-PRPIDHIFTARLMGQHLKVGVEVEKDENDMFTKENLCKAVKCVMDKD  415

Query  1558  IQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSV  1662
              Q     K NHKKW+ LL +PGF  NYID+FI  L+ L V
Sbjct  416   SQIGCVVKENHKKWKKLLSSPGFMSNYIDNFIQDLHGLVV  455



>ref|XP_010319271.1| PREDICTED: UDP-glycosyltransferase 79B8 isoform X2 [Solanum lycopersicum]
Length=507

 Score =   379 bits (973),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 239/505 (47%), Positives = 323/505 (64%), Gaps = 55/505 (11%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS L I MFPWLA GH IPFL L+N+LAK+GH+IS LLP NA +KL+++NLYP LITF  
Sbjct  6     DSKLQIVMFPWLALGHIIPFLNLSNELAKKGHKISFLLPKNAQIKLQNLNLYPNLITFHT  65

Query  487   LTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             L IP + GLP GAETTAD   +L+  L  A+D L DE+K+  LQ  KP+ VF+DFA+W+ 
Sbjct  66    LKIPHIHGLPYGAETTADVPRSLETLLATAMDELYDEIKS-FLQNLKPHFVFFDFAHWVT  124

Query  664   ELVSEMG---------------------------------------------CKTVKFTV  708
             E+  E+G                                              KT+ +  
Sbjct  125   EIALEIGDINTICYKLTSPATSAISLIRSPEKSVFMASTAAEKVRPPPEIGGIKTLCYKT  184

Query  709   FSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSRFLNLPRNR  888
               P  SA SL+ S  K    A TAA+ + PPPG+PS + VVL EHEA  +          
Sbjct  185   VCPATSAYSLVRSPEKSVFMASTAAEKVRPPPGYPSTT-VVLHEHEAKLLEFLFQEYGKG  243

Query  889   ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpeppreepleDK  1068
             +T+++R+ + +  CDAIA + C E+EG + +YIAT+  KPV   GP+LP+P +    E  
Sbjct  244   VTIYERLTKGMTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTGPVLPDPEKGPLAEHG  303

Query  1069  IARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKPPERSSSIEDAL  1248
             ++ WLEKFEP SV+FCAFGS+++L K+QF +L+LGLELTGLPFLV +KPPE ++S+E+AL
Sbjct  304   LSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLVVLKPPEGTNSVEEAL  363

Query  1249  PEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLA-SHCRIIVAPPNR  1425
             PEGF+ER + K +V   WVPQ  IL HK+VG FV+H G GSMWESLA   C++++  P+ 
Sbjct  364   PEGFKERVQEKGLVLACWVPQLKILTHKSVGCFVSHCGYGSMWESLALCDCQLVLL-PSA  422

Query  1426  SDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ-----KVNHKKWRD  1590
             +D  L+AR+M ++L+  VEV+ DEN  F KE+LC A+K VM ++ Q     K NH+KW++
Sbjct  423   NDQTLSARMMEQDLKVGVEVKKDENGWFSKESLCKAVKCVMDKDSQVGCLVKENHRKWKE  482

Query  1591  LLLTPGFADNYIDSFIHKLYELSVQ  1665
             +L +PGF  NYIDSFI  LYEL V+
Sbjct  483   VLSSPGFMSNYIDSFIQILYELLVK  507



>ref|XP_004236774.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X1 [Solanum lycopersicum]
Length=509

 Score =   378 bits (971),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 239/507 (47%), Positives = 323/507 (64%), Gaps = 57/507 (11%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS L I MFPWLA GH IPFL L+N+LAK+GH+IS LLP NA +KL+++NLYP LITF  
Sbjct  6     DSKLQIVMFPWLALGHIIPFLNLSNELAKKGHKISFLLPKNAQIKLQNLNLYPNLITFHT  65

Query  487   LTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             L IP + GLP GAETTAD   +L+  L  A+D L DE+K+  LQ  KP+ VF+DFA+W+ 
Sbjct  66    LKIPHIHGLPYGAETTADVPRSLETLLATAMDELYDEIKS-FLQNLKPHFVFFDFAHWVT  124

Query  664   ELVSEMG-----------------------------------------------CKTVKF  702
             E+  E+G                                                KT+ +
Sbjct  125   EIALEIGDINTICYKLTSPATSAISLIRSPEKSVFMASTAAEKVRPPPATEIGGIKTLCY  184

Query  703   TVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSRFLNLPR  882
                 P  SA SL+ S  K    A TAA+ + PPPG+PS + VVL EHEA  +        
Sbjct  185   KTVCPATSAYSLVRSPEKSVFMASTAAEKVRPPPGYPSTT-VVLHEHEAKLLEFLFQEYG  243

Query  883   NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpeppreeple  1062
               +T+++R+ + +  CDAIA + C E+EG + +YIAT+  KPV   GP+LP+P +    E
Sbjct  244   KGVTIYERLTKGMTLCDAIALKTCREIEGTFGDYIATQFKKPVLYTGPVLPDPEKGPLAE  303

Query  1063  DKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKPPERSSSIED  1242
               ++ WLEKFEP SV+FCAFGS+++L K+QF +L+LGLELTGLPFLV +KPPE ++S+E+
Sbjct  304   HGLSNWLEKFEPGSVVFCAFGSQLILEKKQFQELVLGLELTGLPFLVVLKPPEGTNSVEE  363

Query  1243  ALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLA-SHCRIIVAPP  1419
             ALPEGF+ER + K +V   WVPQ  IL HK+VG FV+H G GSMWESLA   C++++  P
Sbjct  364   ALPEGFKERVQEKGLVLACWVPQLKILTHKSVGCFVSHCGYGSMWESLALCDCQLVLL-P  422

Query  1420  NRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ-----KVNHKKW  1584
             + +D  L+AR+M ++L+  VEV+ DEN  F KE+LC A+K VM ++ Q     K NH+KW
Sbjct  423   SANDQTLSARMMEQDLKVGVEVKKDENGWFSKESLCKAVKCVMDKDSQVGCLVKENHRKW  482

Query  1585  RDLLLTPGFADNYIDSFIHKLYELSVQ  1665
             +++L +PGF  NYIDSFI  LYEL V+
Sbjct  483   KEVLSSPGFMSNYIDSFIQILYELLVK  509



>ref|XP_010062847.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   371 bits (952),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 223/460 (48%), Positives = 311/460 (68%), Gaps = 12/460 (3%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             +S  HIAMFPW A GH  PFL L+N+LAKRGH+IS  LP  AL+ L+++NL+P LITF  
Sbjct  6     NSKFHIAMFPWFAVGHVTPFLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHP  65

Query  487   LTIPQVEGLPPGAETTADTMNLDG-SLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+P V  LPPG ET +D    D  SL VA+D  + +++ + LQ  +P+ +FYD A+WIP
Sbjct  66    LTVPSVATLPPGTETASDIPISDAPSLAVAMDLTRRQLE-VSLQAMRPDFIFYDTAHWIP  124

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             ++   +G +TV + V S    A+ L+ ++    G+ +T  ++ +PP G+PS++ VVLR +
Sbjct  125   QVARPLGIRTVCYNVVSAAAIAIVLVPAREVTPGKPLTEEELGKPPVGYPSNT-VVLRGN  183

Query  844   EAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             EA  +  F++LP  + IT   R   A++ CDAIA R C E+EG  C YI+ + GKPV+  
Sbjct  184   EARSLI-FISLPFGDNITFHGRTTTAMRECDAIAMRTCREIEGDLCAYISNQYGKPVFLT  242

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+LPEP  E    +K A WL +FEP SV+FCAFGS+ VL K QF +LL G E TGLPFL
Sbjct  243   GPVLPEPAMETLD-EKWAEWLSRFEPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFL  301

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             +A++PP  ++S+E+A PEGF+ER +G+ +VHGGWV Q +IL H +VG FVNH G GSMWE
Sbjct  302   IALRPPIGTNSVEEAFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWE  361

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-  1557
             SL   C+I++  P+ +D  LN RL+A EL+  VEV+ +E+  F KE+LC AI+SVM E  
Sbjct  362   SLLGDCQIVMV-PHLADQILNTRLLANELKVGVEVEREESGWFSKESLCRAIESVMYEKS  420

Query  1558  ----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
                 + K NH KWR++L++P F   YI+ FI  L EL ++
Sbjct  421   EVGLLVKKNHAKWREVLVSPNFMTGYINRFIQNLQELQMK  460



>ref|XP_008226432.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=489

 Score =   370 bits (949),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 213/467 (46%), Positives = 307/467 (66%), Gaps = 20/467 (4%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  HIAMFPW A GH IPFL L+N+LA RGHRIS LLP  A + L+H+NL+P LI FC++
Sbjct  23    SNFHIAMFPWFAMGHSIPFLHLSNELAARGHRISFLLPKKAQIHLQHLNLHPHLIAFCSV  82

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQM----EKPNLVFYDFAY  654
             T+P +EGLP G ET +D  ++L   L  A+D  + +++  L+       K +++FYDFA+
Sbjct  83    TVPHIEGLPEGTETASDIPISLTPLLAAAMDRTRQQIQGFLVSCGVNDRKVDMIFYDFAH  142

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W+PE+   +G K V + V    I+A++++ +++  K R VT  D+ +PPPG+PS + V+L
Sbjct  143   WVPEITRGLGIKCVNYGVACAAITAMAIVPARNVPKDRPVTEEDLRDPPPGYPSSTVVML  202

Query  835   REHEAYQVSRFLNLPR-NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
               HE  Q   F+ +P  + IT ++R++ A K CDAI  R C E+EG +C+Y+  +  KPV
Sbjct  203   PGHEV-QSLMFITMPYGDGITFYERLMTAKKGCDAICIRTCREVEGVFCDYLEAQYKKPV  261

Query  1012  YCAG-------pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlll  1170
                G              + E LED  A W   FE  SV+FC FGS+ VL K+QF +L+L
Sbjct  262   LLTGPVLGAMDSNNKNKKKSEQLEDIWANWFSGFETESVVFCGFGSQWVLEKDQFQELVL  321

Query  1171  gleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFV  1350
             G ELTGLPF VA+KPP   ++IE+ALP+GF+ER KG+ +V GGWV Q++IL H +VG FV
Sbjct  322   GFELTGLPFFVALKPPVGCATIEEALPQGFEERVKGRGVVFGGWVQQTLILSHPSVGCFV  381

Query  1351  NHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCN  1530
             +H G G++WESL S+ +I++  P+ +D+ LN +++ ++L+ AVEV+ +EN  F KE+L  
Sbjct  382   SHCGFGALWESLVSNNQIVLV-PHGADHILNTKILVKDLKVAVEVEREENGWFSKESLSK  440

Query  1531  AIKSVMGEN-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             AI +VM ++     + K NH KWR+ L TPGF D YID F+ KL EL
Sbjct  441   AITTVMAKDNEVGVMVKKNHAKWRETLSTPGFMDGYIDRFVQKLKEL  487



>ref|XP_008226430.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=489

 Score =   367 bits (943),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 212/467 (45%), Positives = 307/467 (66%), Gaps = 20/467 (4%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  HIAMFPW A GH IPFL L+N+LA RGHRIS LLP  A ++L+H+NL+P LI FC++
Sbjct  23    SNFHIAMFPWFAMGHSIPFLHLSNELASRGHRISFLLPKKAQIQLQHLNLHPHLIAFCSV  82

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQM----EKPNLVFYDFAY  654
             T+P +EGLP G ET +D  ++L   L  A+D  + +++  L+       K +++FYDFA+
Sbjct  83    TVPHIEGLPEGTETASDIPISLTPLLAAAMDRTRQQIQGFLVSCGVNDRKVDMIFYDFAH  142

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W+PE+   +G K V + V    I+A++++ +++  K R VT  D+ +PPPG+PS + V+L
Sbjct  143   WVPEITRGLGIKCVNYGVACAAITAMAIVPARNVPKDRPVTEEDLRDPPPGYPSSTVVML  202

Query  835   REHEAYQVSRFLNLPR-NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
                E  Q   F+ +P  + IT ++R++ A K CDAI  R C E+EG +C+Y+  +  KPV
Sbjct  203   PGREV-QSLMFITMPYGDGITFYERLMTAKKGCDAICIRTCREVEGVFCDYLEAQYKKPV  261

Query  1012  YCAG-------pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlll  1170
                G              + E LED  A W   FE  SV+FC FGS+ VL K+QF +L+L
Sbjct  262   LLTGPVLGAMDSNNKNKKKSEQLEDIWANWFSGFETESVVFCGFGSQWVLEKDQFQELVL  321

Query  1171  gleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFV  1350
             G ELTGLPF VA+KPP   ++IE+ALP+GF+ER KG+ +V GGWV Q++IL H +VG FV
Sbjct  322   GFELTGLPFFVALKPPVGCATIEEALPQGFEERVKGRGVVFGGWVQQTLILSHPSVGCFV  381

Query  1351  NHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCN  1530
             +H G G++WESL S+ +I++  P+ +D+ LN +++ ++L+ AVEV+ +EN  F KE+L  
Sbjct  382   SHCGFGALWESLVSNNQIVLV-PHGADHILNTKILVKDLKVAVEVEREENGWFSKESLSK  440

Query  1531  AIKSVMGEN-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             AI +VM ++     + K NH KWR+ L TPGF D YID F+ KL EL
Sbjct  441   AITTVMAKDNEVGVMVKKNHAKWRETLSTPGFMDGYIDRFVQKLKEL  487



>ref|XP_011082713.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X3 [Sesamum indicum]
Length=458

 Score =   365 bits (937),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 222/458 (48%), Positives = 306/458 (67%), Gaps = 12/458 (3%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E S LHIAMFPW+A GH  PF+ LAN+LAKRGH IS+L+P   LL+L H +LYP LI F 
Sbjct  5     EKSKLHIAMFPWVAIGHITPFIHLANELAKRGHSISILIPNKPLLQLGHHSLYPDLIKFH  64

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
              +TIPQVEGLPPGAET +D  +     L +A D   ++V+ IL  + KP++VFYDFA WI
Sbjct  65    VVTIPQVEGLPPGAETASDIDITAKNPLAIAFDATAEQVETILSGL-KPDIVFYDFADWI  123

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             P++ + +G KTV + V   +  A+ ++ ++   K R +T  ++ +PP G+PS S VVLR 
Sbjct  124   PKMAARVGFKTVCYNVICASCMAIGIVPARHIPKDRRLTEEELGQPPKGYPS-STVVLRG  182

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
              EA  +S F+ +         R+  A++ CDAI  R C E+EG  C+Y++ +  KPV+ +
Sbjct  183   QEALTLS-FIAMDYGATKFDVRITAAMQGCDAIGIRTCRELEGPMCDYLSEQYNKPVFLS  241

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             G  +     +  LE+K  +WL KF+P SV++CAFGS+++L K+QF +++LG E+TGLPF 
Sbjct  242   G-PVLPENPKGALEEKWDKWLSKFKPKSVVYCAFGSQLMLQKKQFQEMVLGFEMTGLPFF  300

Query  1201  VAV-KPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             VAV KPP  + SIE+ALPEGF ER   + +VHGGWV Q+  L H +VG FV+H G GSMW
Sbjct  301   VAVSKPPHGADSIEEALPEGFLERVGDRGVVHGGWVQQTQGLNHPSVGCFVSHCGFGSMW  360

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-  1554
             ESL S  +I++  P  +D  LN RL+AEEL+ AVEV+  E   F KE+L  AIKSVM E 
Sbjct  361   ESLLSESQIVLV-PRLADQILNTRLLAEELKVAVEVERGEMGWFSKEDLSKAIKSVMDEE  419

Query  1555  ----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  + K NH KWR+ L++P F DNY+D+FI +LY+L
Sbjct  420   SEVGKLVKENHGKWRETLMSPEFMDNYVDNFIRQLYQL  457



>ref|XP_011082711.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X1 [Sesamum indicum]
 ref|XP_011082712.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
isoform X2 [Sesamum indicum]
Length=457

 Score =   365 bits (936),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 223/457 (49%), Positives = 307/457 (67%), Gaps = 11/457 (2%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E S LHIAMFPW+A GH  PF+ LAN+LAKRGH IS+L+P   LL+L H +LYP LI F 
Sbjct  5     EKSKLHIAMFPWVAIGHITPFIHLANELAKRGHSISILIPNKPLLQLGHHSLYPDLIKFH  64

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
              +TIPQVEGLPPGAET +D  +     L +A D   ++V+ IL  + KP++VFYDFA WI
Sbjct  65    VVTIPQVEGLPPGAETASDIDITAKNPLAIAFDATAEQVETILSGL-KPDIVFYDFADWI  123

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             P++ + +G KTV + V   +  A+ ++ ++   K R +T  ++ +PP G+PS S VVLR 
Sbjct  124   PKMAARVGFKTVCYNVICASCMAIGIVPARHIPKDRRLTEEELGQPPKGYPS-STVVLRG  182

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
              EA  +S F+ +         R+  A++ CDAI  R C E+EG  C+Y++ +  KPV+ +
Sbjct  183   QEALTLS-FIAMDYGATKFDVRITAAMQGCDAIGIRTCRELEGPMCDYLSEQYNKPVFLS  241

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+LPE P+     +K  +WL KF+P SV++CAFGS+++L K+QF +++LG E+TGLPF 
Sbjct  242   GPVLPENPKGALE-EKWDKWLSKFKPKSVVYCAFGSQLMLQKKQFQEMVLGFEMTGLPFF  300

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAV  P  + SIE+ALPEGF ER   + +VHGGWV Q+  L H +VG FV+H G GSMWE
Sbjct  301   VAVSKPHGADSIEEALPEGFLERVGDRGVVHGGWVQQTQGLNHPSVGCFVSHCGFGSMWE  360

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             SL S  +I++  P  +D  LN RL+AEEL+ AVEV+  E   F KE+L  AIKSVM E  
Sbjct  361   SLLSESQIVLV-PRLADQILNTRLLAEELKVAVEVERGEMGWFSKEDLSKAIKSVMDEES  419

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                 + K NH KWR+ L++P F DNY+D+FI +LY+L
Sbjct  420   EVGKLVKENHGKWRETLMSPEFMDNYVDNFIRQLYQL  456



>ref|XP_010674067.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Beta vulgaris subsp. 
vulgaris]
Length=458

 Score =   363 bits (932),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 217/452 (48%), Positives = 302/452 (67%), Gaps = 11/452 (2%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHI MFPW A GH  PFL L+N LA+ GH+I+ L+P  A  +L+H+ LYP LIT   +TI
Sbjct  5     LHIVMFPWFAIGHMTPFLHLSNKLAEYGHKITFLIPKKAKHQLEHLLLYPSLITLHPITI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQME-KPNLVFYDFAYWIPEL  669
             P V  LPPG ET ++  ++L+  L  ALD  + EV++ ++ ++ KP+++FYD AYW+PE+
Sbjct  65    PHVHPLPPGIETASEIPLHLNNHLATALDLTRPEVESFIITLQPKPHVLFYDMAYWVPEI  124

Query  670   VSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
              S++  K+V + V      A++L+ + + G+ +  T  D+ +PPPG+PS S VV    EA
Sbjct  125   ASKLQIKSVCYNVVCAASLAIALVPALNVGRYQPFTEEDVAKPPPGYPS-SNVVFHGPEA  183

Query  850   YQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
               +  FL L   + +T +DR+  ALK CDAIA R C E+E ++CNYI+++  KPV   GP
Sbjct  184   RSL-LFLGLEFGSGLTFYDRMSTALKSCDAIAIRTCREIEDNFCNYISSQYNKPVLLTGP  242

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
             +LPE     PLE + A WL +FEPNSV+FCAFGS+ +L K+QF +LLLG E+T +PFLVA
Sbjct  243   VLPETNNNNPLEARWAEWLSRFEPNSVVFCAFGSQFILEKDQFQELLLGFEMTMVPFLVA  302

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP+   S+E+ALPEGF+ER   + +VHGGWV Q +IL H +VG FVNH G GSMWESL
Sbjct  303   LKPPQGCGSVEEALPEGFKERVGERGVVHGGWVQQPLILAHPSVGCFVNHCGFGSMWESL  362

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN---  1557
              +  +I++  P   D  LN RLM+ EL   VEV+  EN    KE+LC AIKSVMGE+   
Sbjct  363   MAESQIVMV-PQLGDQILNTRLMSGELVVGVEVERTENGWVSKESLCKAIKSVMGEDSEV  421

Query  1558  --IQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
               + + NH  WR ++++ GF   YIDSF+  L
Sbjct  422   GCLVRNNHANWRQIMVSQGFMRGYIDSFVKDL  453



>ref|XP_010062848.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   362 bits (928),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 209/457 (46%), Positives = 295/457 (65%), Gaps = 8/457 (2%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H+AMFPW A GH  P+L L+N+LAKRGH+IS  LP  AL+ L+++NL+P LITF  L
Sbjct  7     SKFHMAMFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  490   TIPQVEGLPPGAETTADTMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPEL  669
             T+P V  LPPG ET +D    D     A   L      + LQ  +P+ +FYD+A+WIP++
Sbjct  67    TVPSVATLPPGTETASDITFSDSPFLAAAMDLTRPQLEVSLQAMQPDFIFYDYAHWIPQV  126

Query  670   VSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
                +G +TV + V S    A+ L+  +   +G+  T  ++ +PP G+PS + VVLR  EA
Sbjct  127   ARPLGIRTVCYNVISAAAIAMVLVPVREVTQGKPCTEEELEKPPNGYPSKT-VVLRGSEA  185

Query  850   YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpl  1029
               +     L  + IT + R   A++ CDAIA R C E+E  +C YI+++ GKPV+  G  
Sbjct  186   RPLIFISLLSGDNITFYGRGTTAMRECDAIALRTCQEIERDFCAYISSQYGKPVFLTG-P  244

Query  1030  lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAV  1209
             +   P  + L++K A WL +F+P SV+FCAFGS+ VL K QF +LL G E TGLPF +A+
Sbjct  245   VLPKPDMKLLDEKWAEWLGQFKPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFFIAL  304

Query  1210  KPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLA  1389
             +PP  ++S+E+A PEGF+ER +G+ +VHGGWV Q +IL H +VG FVNH G GSMWESL 
Sbjct  305   RPPIGTNSVEEAFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWESLL  364

Query  1390  SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN----  1557
               C+I++  P+ +D  LN RL+A EL+  +EV+ +E+  F KE+LC AI+SVM E     
Sbjct  365   GDCQIVMV-PHLADQILNTRLLANELKVGIEVEREESGWFSKESLCRAIESVMDEKSEVG  423

Query  1558  -IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
              + K NH KWR++L++P F   YID FI  L EL ++
Sbjct  424   LLVKKNHAKWREVLVSPNFMTGYIDRFIQNLQELHMK  460



>gb|KCW69983.1| hypothetical protein EUGRSUZ_F03293, partial [Eucalyptus grandis]
Length=448

 Score =   361 bits (926),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 218/448 (49%), Positives = 304/448 (68%), Gaps = 12/448 (3%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             +S  HIAMFPW A GH  PFL L+N+LAKRGH+IS  LP  AL+ L+++NL+P LITF  
Sbjct  6     NSKFHIAMFPWFAVGHVTPFLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHP  65

Query  487   LTIPQVEGLPPGAETTADTMNLDG-SLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+P V  LPPG ET +D    D  SL VA+D  + +++ + LQ  +P+ +FYD A+WIP
Sbjct  66    LTVPSVATLPPGTETASDIPISDAPSLAVAMDLTRRQLE-VSLQAMRPDFIFYDTAHWIP  124

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             ++   +G +TV + V S    A+ L+ ++    G+ +T  ++ +PP G+PS++ VVLR +
Sbjct  125   QVARPLGIRTVCYNVVSAAAIAIVLVPAREVTPGKPLTEEELGKPPVGYPSNT-VVLRGN  183

Query  844   EAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             EA  +  F++LP  + IT   R   A++ CDAIA R C E+EG  C YI+ + GKPV+  
Sbjct  184   EARSLI-FISLPFGDNITFHGRTTTAMRECDAIAMRTCREIEGDLCAYISNQYGKPVFLT  242

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+LPEP  E    +K A WL +FEP SV+FCAFGS+ VL K QF +LL G E TGLPFL
Sbjct  243   GPVLPEPAMETLD-EKWAEWLSRFEPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFL  301

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             +A++PP  ++S+E+A PEGF+ER +G+ +VHGGWV Q +IL H +VG FVNH G GSMWE
Sbjct  302   IALRPPIGTNSVEEAFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWE  361

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-  1557
             SL   C+I++  P+ +D  LN RL+A EL+  VEV+ +E+  F KE+LC AI+SVM E  
Sbjct  362   SLLGDCQIVMV-PHLADQILNTRLLANELKVGVEVEREESGWFSKESLCRAIESVMYEKS  420

Query  1558  ----IQKVNHKKWRDLLLTPGFADNYID  1629
                 + K NH KWR++L++P F   YI+
Sbjct  421   EVGLLVKKNHAKWREVLVSPNFMTGYIN  448



>ref|XP_007021598.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13123.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=458

 Score =   361 bits (926),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 215/455 (47%), Positives = 303/455 (67%), Gaps = 11/455 (2%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H+ MF W A GH  PFL LAN LA++GHRI+ +LP  A+ +L+H+NLYP  I+F  +
Sbjct  7     SDFHVLMFSWFAIGHMTPFLHLANKLAEKGHRITFVLPRKAVNQLEHLNLYPDFISFHPV  66

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P V GLPPGAET +D  + L   L +A+D  +D+V++++  + KPNLV YD A+WIPE
Sbjct  67    TVPSVTGLPPGAETASDIPIFLSHFLSIAMDRTRDQVESVISSV-KPNLVLYDTAHWIPE  125

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +   +G KT+ + V      A+ L+ +++  + R +T A++  PP G+PS S VVLR HE
Sbjct  126   IAKPLGIKTICYNVVCAAAIAIVLVPARNAARERPITEAELAVPPLGYPSSS-VVLRSHE  184

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
                +    N     +T ++R+  A+K CDAI+ R C+E+EG  C+YI ++  KPV   GP
Sbjct  185   GQSLLFVTNPFGEGLTFYERITTAMKNCDAISIRTCHEIEGKLCDYIGSQYEKPVLLTGP  244

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
             +LPE  +     ++   WL  FEP SV++CAFGS+ +  K QF +LLLG ELTGLPF VA
Sbjct  245   VLPEESKSVLD-ERWGSWLAGFEPGSVVYCAFGSQFIFEKPQFQELLLGFELTGLPFFVA  303

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP  +++IE+ALPEGF+ER KG+ +V GGWV Q ++L H +VG FV+H G GSMWESL
Sbjct  304   LKPPLEAATIEEALPEGFEERVKGRGVVWGGWVQQPLVLAHPSVGCFVSHCGFGSMWESL  363

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN---  1557
              S C+I++  P   D  LN RLMA+EL+ AVEV+ +E+    KENL  AIKSVM ++   
Sbjct  364   MSDCQIVLF-PQLGDQILNTRLMADELKVAVEVKREESGWLSKENLSEAIKSVMHKDSEV  422

Query  1558  --IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               + K NHKKWRD  ++P   ++YID FI  ++EL
Sbjct  423   GKLAKENHKKWRD-TISPELTNDYIDKFIQSMHEL  456



>ref|XP_002316802.1| glycosyltransferase family protein [Populus trichocarpa]
 gb|EEE97414.1| glycosyltransferase family protein [Populus trichocarpa]
Length=463

 Score =   359 bits (921),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 226/456 (50%), Positives = 301/456 (66%), Gaps = 12/456 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S   I MFPW A GH  PFL L+N LA++G  IS LLP  A+  L+H NLYP  ITF  +
Sbjct  9     SSFRILMFPWFAVGHLTPFLHLSNKLAEKGCTISFLLPNKAIKLLQHFNLYPDHITFHPV  68

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
              +P VEGLP G ET +D  ++L   L VA+D  +D+V+ I+ + +KP+ V YD AYWIPE
Sbjct  69    KVPHVEGLPLGTETASDIPIHLTHFLCVAMDRTRDQVEKII-RDQKPDFVMYDMAYWIPE  127

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +   +G KT+K++V S    A+ L+ +++  +G+A+TAA++  PP G+PS S VVLR HE
Sbjct  128   VARPLGIKTIKYSVVSAAAIAIVLVPARNVVEGKAITAAELSVPPTGYPSTS-VVLRGHE  186

Query  847   AYQVSRFLNLPRNRITVF-DRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                +  F++ P    T F +R    +K CDAIA R+C EME   C+YI  + GKPV+  G
Sbjct  187   VRSL-LFVSQPYGEGTTFYERACTGMKGCDAIAIRSCYEMEEKLCDYIGRQYGKPVFLTG  245

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPE  R     D+ A+WL +FE  SV+FC+FGS+++L KEQ  +L+LG E TGLPFLV
Sbjct  246   PVLPESARTPLE-DRWAQWLNRFEAGSVVFCSFGSQLILEKEQLQELVLGFESTGLPFLV  304

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
              +KPP  SS+IE+ALPEGF+ER KG+ +V GGWV Q  IL H ++G FVN  G GSMWES
Sbjct  305   VLKPPVGSSTIEEALPEGFEERVKGRGVVWGGWVQQLEILDHPSIGCFVNTCGFGSMWES  364

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ  1563
             L S C+I++  P+  D  LN RLMAEEL+ AVEV+ DE   F KENL NAIK VM ++ +
Sbjct  365   LMSDCQIVLV-PHLGDQILNTRLMAEELKVAVEVERDEKGWFTKENLSNAIKCVMDKDSE  423

Query  1564  -----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  K NH +WR LL + GF  +Y D F   + EL
Sbjct  424   VGSMIKKNHTEWRKLLRSEGFMSSYFDKFFQNMQEL  459



>ref|XP_002282825.3| PREDICTED: UDP-glycosyltransferase 79B6-like [Vitis vinifera]
Length=463

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 215/460 (47%), Positives = 304/460 (66%), Gaps = 12/460 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M +    H+AMFPW AFGH   FL L+N LA+RGH+I+ +LP  A  +L+ +N +P LI+
Sbjct  5     MPKSPKFHVAMFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQTLNFHPTLIS  64

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  L+IP V+GLPPGAET +D  + L   L  A+D   D+++A L +   P+ +FYD ++
Sbjct  65    FHPLSIPHVDGLPPGAETASDIPIFLTHLLATAMDRATDQLEAAL-RASNPDFLFYDCSH  123

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
               P L S +G K + + V      A++L+ ++   K R VT A++  PP G+PS S  V 
Sbjct  124   LAPVLASRLGIKAICYNVVCAASIAIALVPARGVSKDRPVTEAELAVPPSGYPS-STAVF  182

Query  835   REHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             R HE   + +F++ P  + I+ ++R   A+K  DAI+ R C E+EG+ C+YI T+ GKP+
Sbjct  183   RRHEGRAL-QFISAPFGDGISFYERTTTAMKESDAISIRTCREIEGNLCDYIGTQYGKPI  241

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
             +  GP+LPEP       D+ A+WL  F+P S+IFCAFGS+ +L K+QF +L+LGLELTGL
Sbjct  242   FLTGPVLPEPSPTPLE-DRWAQWLGGFKPGSIIFCAFGSQYILEKDQFQELVLGLELTGL  300

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP  +++IE+ALPEGF+ER  G+A VHGGWV Q  IL H +VG FV+H G GS
Sbjct  301   PFLVALKPPTGAATIEEALPEGFKERVGGRAAVHGGWVQQPSILSHPSVGCFVSHCGFGS  360

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL + C+I++  P+  D  LN R++A EL+ AVEV+ +EN  F KE+LC AIKSVM 
Sbjct  361   MWESLMNDCQIVLV-PHLGDQILNTRVLAGELQVAVEVEREENGWFSKESLCKAIKSVMD  419

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E      + + NH KW++    PGF  NY+D F+ +L  L
Sbjct  420   EESEVGGLVRKNHAKWKETFARPGFMSNYVDKFVGQLQGL  459



>gb|KCW69984.1| hypothetical protein EUGRSUZ_F03295 [Eucalyptus grandis]
Length=449

 Score =   355 bits (912),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 206/451 (46%), Positives = 291/451 (65%), Gaps = 8/451 (2%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             MFPW A GH  P+L L+N+LAKRGH+IS  LP  AL+ L+++NL+P LITF  LT+P V 
Sbjct  1     MFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPLTVPSVA  60

Query  508   GLPPGAETTADTMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMGC  687
              LPPG ET +D    D     A   L      + LQ  +P+ +FYD+A+WIP++   +G 
Sbjct  61    TLPPGTETASDITFSDSPFLAAAMDLTRPQLEVSLQAMQPDFIFYDYAHWIPQVARPLGI  120

Query  688   KTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSRF  867
             +TV + V S    A+ L+  +   +G+  T  ++ +PP G+PS + VVLR  EA  +   
Sbjct  121   RTVCYNVISAAAIAMVLVPVREVTQGKPCTEEELEKPPNGYPSKT-VVLRGSEARPLIFI  179

Query  868   LNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpeppr  1047
               L  + IT + R   A++ CDAIA R C E+E  +C YI+++ GKPV+  G  +   P 
Sbjct  180   SLLSGDNITFYGRGTTAMRECDAIALRTCQEIERDFCAYISSQYGKPVFLTG-PVLPKPD  238

Query  1048  eepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKPPERS  1227
              + L++K A WL +F+P SV+FCAFGS+ VL K QF +LL G E TGLPF +A++PP  +
Sbjct  239   MKLLDEKWAEWLGQFKPGSVVFCAFGSQHVLEKGQFQELLRGFESTGLPFFIALRPPIGT  298

Query  1228  SSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASHCRII  1407
             +S+E+A PEGF+ER +G+ +VHGGWV Q +IL H +VG FVNH G GSMWESL   C+I+
Sbjct  299   NSVEEAFPEGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWESLLGDCQIV  358

Query  1408  VAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-----IQKVN  1572
             +  P+ +D  LN RL+A EL+  +EV+ +E+  F KE+LC AI+SVM E      + K N
Sbjct  359   MV-PHLADQILNTRLLANELKVGIEVEREESGWFSKESLCRAIESVMDEKSEVGLLVKKN  417

Query  1573  HKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
             H KWR++L++P F   YID FI  L EL ++
Sbjct  418   HAKWREVLVSPNFMTGYIDRFIQNLQELHMK  448



>ref|XP_010675464.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Beta vulgaris subsp. 
vulgaris]
Length=458

 Score =   356 bits (913),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 213/452 (47%), Positives = 301/452 (67%), Gaps = 11/452 (2%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHI MFPW A GH  PFL L+N LA+ GH+I+ LLP  A  +L+H+ LYP LIT   +TI
Sbjct  5     LHIVMFPWFAIGHMTPFLHLSNKLAEYGHKITFLLPKKAKHQLQHLLLYPSLITLHPITI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQME-KPNLVFYDFAYWIPEL  669
             P V  LPPG ET ++  ++L+  L  ALD  + EV+  ++ ++ KP+L+FYD A+W+PE+
Sbjct  65    PHVHPLPPGTETASEIPLHLNNHLATALDLTRLEVEYFIITLQPKPHLLFYDIAFWVPEI  124

Query  670   VSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
              S++  K++ + V      A++L+ + + G+ + VT  D+ +PPPG+PS S VV    EA
Sbjct  125   ASKLQIKSICYNVVCAASLAIALVPALNVGRDQPVTEEDVAKPPPGYPS-SNVVFHGPEA  183

Query  850   YQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
               +  F+ L   + +T +DR+V A+K CDAIA R C E+E ++C+YI+ +  KPV   GP
Sbjct  184   RSL-LFIGLEFGSGLTFYDRIVTAMKSCDAIAIRTCREIEDNFCDYISAQYNKPVLLTGP  242

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
             +LPE     PLE +   WL +FEPNSV+FCAFGS+ +L K+QF +LLLG E+T LPFLVA
Sbjct  243   VLPETNNNHPLEAQWVEWLSRFEPNSVVFCAFGSQYILEKDQFQELLLGFEMTMLPFLVA  302

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP+    +E+ALPEGF+ER   + +VHGGWV Q +IL H +VG FVNH G GSMWESL
Sbjct  303   LKPPQGCGFVEEALPEGFKERVGERGVVHGGWVQQPLILAHPSVGCFVNHCGFGSMWESL  362

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN---  1557
              +  +I++  P   D  LN RLM+ EL   VEV+  E+    KE+LC AI+SVMGE+   
Sbjct  363   MAESQIVMV-PQLGDQILNTRLMSGELVVGVEVERAESGWVSKESLCKAIQSVMGEDSEV  421

Query  1558  --IQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
               + + NH KWR ++++ GF   YID+F+  L
Sbjct  422   GCLVRNNHAKWRQIMVSQGFMRGYIDNFVKDL  453



>ref|XP_011008292.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Populus euphratica]
Length=463

 Score =   356 bits (913),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 225/456 (49%), Positives = 299/456 (66%), Gaps = 12/456 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S   I MFPW A GH  PFL L+N LA++G  IS LLP  A+  L+H NLYP  ITF  +
Sbjct  9     SNFRILMFPWFAVGHLTPFLHLSNKLAEKGCTISFLLPNKAIKLLQHFNLYPDHITFHPV  68

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
              +P VEGLP G ET +D  + L   L VA+D  +D+V+ I+ + +KP+ V YD AYWIPE
Sbjct  69    QVPHVEGLPLGTETASDIPIYLTHFLCVAMDRTRDQVEKII-RDQKPDFVMYDMAYWIPE  127

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +   +G KT+K++V S    A+ L+ +++  +G+ +TAA++  PP G+PS S VVLR HE
Sbjct  128   VARPLGIKTIKYSVVSAAAIAIVLVPARNVVEGKPITAAELSVPPTGYPSTS-VVLRGHE  186

Query  847   AYQVSRFLNLPRN-RITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                +  F++ P   RIT ++R    +K CDAIA R C+EME   C+YI  +  KPV+  G
Sbjct  187   VRSL-LFVSQPYGERITFYERACTGMKGCDAIAIRTCHEMEEKLCDYIGRQYEKPVFLTG  245

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPE  R     D+ A+WL  FE  SV+FC+FGS+ +L KEQ  +L+LG E TGLPF+V
Sbjct  246   PVLPESARTPLE-DRWAQWLNGFEAGSVVFCSFGSQFILEKEQLQELVLGFESTGLPFIV  304

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
              +KPP  SS+IE+ALPEGF+ER KG+ +V GGWV Q  IL H ++G FVN  G GSMWES
Sbjct  305   VLKPPVGSSTIEEALPEGFEERVKGRGVVWGGWVQQLEILDHPSIGCFVNTCGFGSMWES  364

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ  1563
             L S C+I++  P+  D  LN RLMAEEL+ AVEV+ DE   F KENL NAIK VM ++ +
Sbjct  365   LMSDCQIVLV-PHLGDQILNTRLMAEELKVAVEVERDEKGWFTKENLSNAIKCVMDKDSK  423

Query  1564  -----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  K NH +WR LL + GF  +YID F   + EL
Sbjct  424   VGSMIKKNHTEWRKLLRSEGFMSSYIDKFFQNMQEL  459



>ref|XP_010041982.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Eucalyptus grandis]
Length=461

 Score =   355 bits (911),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 211/458 (46%), Positives = 298/458 (65%), Gaps = 10/458 (2%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H+AMFPW A GH  P+L L+N+LAKRGH+IS  LP  AL+ L+++NL+P LITF  L
Sbjct  7     SKFHMAMFPWFAVGHITPYLHLSNELAKRGHKISFFLPRKALILLENLNLHPNLITFHPL  66

Query  490   TIPQVEGLPPGAETTADTMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPEL  669
             T+P V  LPPG ET +D    D     A   L      + LQ  +P+ +FYD A+WIP++
Sbjct  67    TVPSVATLPPGTETASDIPFSDSPFLAAAMDLTRPQLEVSLQAMRPDFIFYDLAHWIPQV  126

Query  670   VSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
                +G +TV + V S    A+ L+ ++   +G+  T  ++ +PP G+PS + VVLR  EA
Sbjct  127   ARPLGIRTVCYNVVSAAAIAIVLVPAREVTQGKPCTEEELEKPPRGYPSKT-VVLRGSEA  185

Query  850   YQVSRFLNLPR-NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
               +  F++LP  + IT   R   A++ CDAIA R C E+E  +C YI+++ GK V+  G 
Sbjct  186   RSLI-FISLPSGDNITFHGRGTTAMRECDAIALRTCQEIERDFCAYISSQYGKAVFLTG-  243

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
              +   P  + L++K A WL +F+P SV+FCAFGS+ VL K QF +LLLG E TGLPFLVA
Sbjct  244   PVLPEPDMKMLDEKWAEWLGQFKPGSVVFCAFGSQHVLEKGQFQELLLGFETTGLPFLVA  303

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             ++PP  ++S+E+A P+GF+ER +G+ +VHGGWV Q +IL H +VG FVNH G GSMWESL
Sbjct  304   LRPPIGTNSVEEAFPKGFEERVRGRGVVHGGWVQQPLILSHPSVGCFVNHCGFGSMWESL  363

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN---  1557
                C+I++  P+  D  L+ RL+A+EL+  VEV+ +E+  F KE+ C AI+SVM E    
Sbjct  364   LGDCQIVMV-PHLPDQILHTRLLADELKVGVEVEREESGWFSKESFCRAIESVMDEESEV  422

Query  1558  --IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
               + K NH KWR +L++P F  +YID FI  L EL ++
Sbjct  423   GLLVKKNHAKWRKVLVSPNFMTDYIDRFIQNLQELQMK  460



>ref|XP_002282717.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=459

 Score =   354 bits (909),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 231/462 (50%), Positives = 308/462 (67%), Gaps = 18/462 (4%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M +   LHIAMFPW AFGH IP+L L+N+LA RGH+I+ +LP  A  KL+H+N +P LIT
Sbjct  3     MAKSPKLHIAMFPWFAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQHLNFHPALIT  62

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  L +P V+GLPPG ET +D  ++L   L  ALD  +D+V+A L  +  P+L+FYDFAY
Sbjct  63    FHPLIVPHVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTL-NPDLLFYDFAY  121

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKG-RAVTAADIMEPPPGFPSDSKVV  831
             W P L S++G K++ + V      A + I ++   K  R +T  D+  PPPG+PS S VV
Sbjct  122   WAPALASQLGIKSIYYCVVCAAAVAHTPIPAQQGSKDCRQLT--DV--PPPGYPS-STVV  176

Query  832   LREHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             LR HEA ++  F+  P    IT   R + A   CDAI+ R C E EG  C+YI ++ GKP
Sbjct  177   LRPHEA-RLMDFMFAPYGEGITFQQRHITARTSCDAISIRTCQETEGPICDYIGSQYGKP  235

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V+  G  +   P  EPLED+ A+WL  F+P SVIFCAFGS+ V  K+QF +LLLGLELTG
Sbjct  236   VFLTG-PVLPNPSVEPLEDRWAQWLGGFKPGSVIFCAFGSQNVHEKDQFQELLLGLELTG  294

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGG-WVPQSMILRHKAVGYFVNHGGS  1365
             LPF  A+KPP  +++IE+ALPEGFQER  G+ +VHGG WV Q  +L H +VG FV+H G 
Sbjct  295   LPFFAALKPPTGAATIEEALPEGFQERVGGRGLVHGGWWVQQPSVLSHPSVGCFVSHCGY  354

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSV  1545
             GSMWESL S  +I++  P   D  LN+RL+AEEL+ AVEV+ +EN  F KE+LC+AIK+V
Sbjct  355   GSMWESLTSDPQIVLV-PELPDQILNSRLLAEELKVAVEVEREENGLFSKESLCDAIKTV  413

Query  1546  MGEN-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M EN     + K NH KW++ L +  F  NY+D+F+ +L  L
Sbjct  414   MDENSEVGGLVKKNHAKWKEALTSQSFLSNYVDNFVGQLQGL  455



>ref|XP_006354953.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Solanum tuberosum]
Length=428

 Score =   353 bits (905),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 215/458 (47%), Positives = 294/458 (64%), Gaps = 40/458 (9%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             +E+S L I MFPWLAFGH IP++ L+N+LAKRGH+IS LLP NA ++L+ +NLYP LIT 
Sbjct  5     IEESKLEIVMFPWLAFGHLIPYMNLSNELAKRGHKISFLLPKNAEVRLQKLNLYPNLITL  64

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               LT+P V GLP GAETTAD   +L+  L  A D L DE+K+  LQ  KP+ VF+DFAYW
Sbjct  65    HKLTMPHVHGLPYGAETTADVPGSLESLLATAFDELYDEIKS-FLQNLKPHFVFFDFAYW  123

Query  658   IPELVSEMG-CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             IP+L  E+G  KT+ + V  P IS+++LI S  K    A TAA++++PPP +PS + VVL
Sbjct  124   IPDLALEIGGIKTLCYKVVCPAISSIALIRSPVKTTFMASTAAELVKPPPDYPSTT-VVL  182

Query  835   REHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
             RE EA  +S   +     +T ++R  + +  C+AI  + C E+EG +C+YIAT+  KPV 
Sbjct  183   RESEAKLLSFLFHEYGKGVTFYERSKKGMTGCNAIGVKTCREIEGTFCDYIATQFEKPVL  242

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
               GP+L EP +    E  ++ WLEKFE  SV+FCAF S+++L K+QF QL+LG ELT LP
Sbjct  243   YTGPVLAEPTKGPLEEHGLSDWLEKFEAGSVVFCAFRSQMILEKKQFQQLVLGFELTELP  302

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL+ VKPPE ++S+E+ALPEGF+ER + K ++   WVPQ  IL HK+VG FV H G GSM
Sbjct  303   FLLVVKPPEGTNSVEEALPEGFKERVQEKGLILDCWVPQLEILSHKSVGCFVTHCGYGSM  362

Query  1375  WESLA-SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             WESLA   C++++ P                    ++ +  +  +  KE           
Sbjct  363   WESLALCDCQLVLLP------------------RPIDHRGSQIGRLVKE-----------  393

Query  1552  ENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
                   NHKKW++LL +PGF  NYID+FI  L+ L V+
Sbjct  394   ------NHKKWKELLSSPGFMSNYIDNFIQDLHGLLVE  425



>ref|XP_010262362.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=475

 Score =   352 bits (902),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH  PFL ++N LA+RGHR+S  LPT    KL   NL+P LITF  + +
Sbjct  11    LHIAMYPWYAMGHLTPFLHISNKLAERGHRVSFFLPTKTQSKLNSNNLHPNLITFIPVVV  70

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLPPGAETTAD   +L   +  A+D  Q E++A L Q+ KP++VF+DFAYW+P L 
Sbjct  71    PHVDGLPPGAETTADVPHSLHSLIMTAMDLTQPEIEASLRQL-KPHIVFFDFAYWVPALA  129

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +G K++ + + SP      L  S++      +  + +M PPPGFP+ + + L  +EA 
Sbjct  130   RSLGIKSIHYCIISPVTIGYLLSPSRNNISDVDLYESSLMHPPPGFPA-AAIKLHSNEAR  188

Query  853   QVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpl  1029
             +++   N+   + IT ++R   AL  CDA+AFRAC E+EG YC+Y+ T+  KPV  +G  
Sbjct  189   RLALVANIEYGKGITFYERQNIALSDCDALAFRACREIEGSYCDYLETQFRKPVLVSG-S  247

Query  1030  lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAV  1209
             +      + LE++  +WL  FE NSV++CAFGSE +L  +QF +L++GLELTGLPFL A+
Sbjct  248   VVPVAPRDGLEERWVKWLGGFEANSVVYCAFGSECILSLDQFRELVMGLELTGLPFLAAL  307

Query  1210  KPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLA  1389
             K P  + +IE ALPEGF+ER  G+ +VHG WV Q +IL H +VG FV H GSGS+ ESL 
Sbjct  308   KLPIGTDTIEAALPEGFEERVGGRGVVHGQWVQQQLILEHPSVGCFVTHCGSGSLMESLV  367

Query  1390  SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ--  1563
             + C++++  P+  D  LNAR+M  +L+  VEV+   +  F +E++C A+K VM E+ +  
Sbjct  368   NKCQVVLL-PHIGDQILNARMMGGDLKVGVEVEKGGDGLFTRESVCKAVKMVMDEDSEIG  426

Query  1564  ---KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                K NHKKWRD  LT G   +YI +F+H L +L
Sbjct  427   REVKANHKKWRDFFLTEGIESSYIQNFVHGLQDL  460



>ref|XP_003634640.2| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=457

 Score =   350 bits (897),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 229/462 (50%), Positives = 308/462 (67%), Gaps = 18/462 (4%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M +   LHIAMFPW AFGH IP+L L+N+LA RGH+I+ +LP  A  KL+H+N +P LIT
Sbjct  1     MAKSPKLHIAMFPWFAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQHLNFHPALIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  L +P V+GLPPG ET +D  ++L   L  ALD  +D+V+A L  +  P+L+FYDFAY
Sbjct  61    FHPLIVPHVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTL-NPHLLFYDFAY  119

Query  655   WIPELVSEMGCKTVKFT-VFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             W P L S++G K++ ++ V +  ++ + +   +     R +T  D+  PPPG+PS S VV
Sbjct  120   WAPALASQLGIKSIYYSAVCAAAVAHIPIPAQQGSKDCRQLT--DV--PPPGYPS-STVV  174

Query  832   LREHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             LR HEA ++  F+  P    IT   RV  A  R DAI+ R C E +G  C+YI ++ GKP
Sbjct  175   LRPHEA-RLMDFMFAPYGEGITFQQRVTTARARGDAISIRTCQETDGPICDYIGSQYGKP  233

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V+  G  +   P  EPLED+ A+WL  F+P SVIFCAFGS+ V  K+QF +LLLGLELTG
Sbjct  234   VFLTG-PVLPKPSVEPLEDRWAQWLGGFKPGSVIFCAFGSQNVHEKDQFQELLLGLELTG  292

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGG-WVPQSMILRHKAVGYFVNHGGS  1365
             LPF  AVKP    ++IE+ALPEGFQER  G+ +VHGG WV Q  +L H +VG FV+H G 
Sbjct  293   LPFFAAVKPRTGVATIEEALPEGFQERVGGRGLVHGGWWVQQPSVLSHPSVGCFVSHCGY  352

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSV  1545
             GSMWESL S  +I++  P  +D  LN+RL+AEEL+ AVEV+ +EN  F KE+LC+AIKSV
Sbjct  353   GSMWESLTSDPQIVLV-PELADQILNSRLLAEELKVAVEVEREENGLFSKESLCDAIKSV  411

Query  1546  MGEN-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M EN     + K NH KW++ L +  F  NY+D+F+ +L  L
Sbjct  412   MDENSEVGGLVKKNHAKWKEALTSQSFLSNYVDNFVGQLQGL  453



>ref|XP_006281777.1| hypothetical protein CARUB_v10027945mg [Capsella rubella]
 gb|EOA14675.1| hypothetical protein CARUB_v10027945mg [Capsella rubella]
Length=469

 Score =   350 bits (897),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 227/459 (49%), Positives = 308/459 (67%), Gaps = 13/459 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S + I M+PWLAFGH  PFL L+N LA++GH+I  LLP  AL +L+ +NLYP+LITF  +
Sbjct  10    SSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLYPKLITFHTI  69

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             +IPQV+GLPPGAET +D    L   L VA+D  + EV+ I   + KP+LVFYD A+WIPE
Sbjct  70    SIPQVKGLPPGAETNSDVPFFLTHLLAVAMDQTRPEVETIFRTI-KPDLVFYDSAHWIPE  128

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKG--KGRAVTAADIMEPPPGFPSDSKVVLRE  840
             +   MG KTV F + S    ALSL+ +  +    G+ ++  ++ + P G+PS SKVVLR 
Sbjct  129   IAKPMGAKTVCFHIVSAASIALSLVPAAEREVIDGKEMSGEELAKTPLGYPS-SKVVLRA  187

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             HEA  +S          + FD  V A++ CDAIA R C E EG +C+YI+++  KPV   
Sbjct  188   HEAKLLSFVWRKHEGIASFFDVQVAAMRNCDAIAIRTCRETEGKFCDYISSQYNKPVNLT  247

Query  1021  GpllpeppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllgleltglp  1194
             GP+LP     +P  + + A WL KF+PNSV+FCAFGS+ V+ K +QF +L LGLE TGLP
Sbjct  248   GPVLPGSQPNQPSLEPQWAEWLAKFKPNSVVFCAFGSQPVVDKIDQFQELCLGLESTGLP  307

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FLVA+KPP   S++E+ALPEGF+ER +G+ +V+GGW+ Q ++L H +VG FV+H G GSM
Sbjct  308   FLVAIKPPSGVSTVEEALPEGFKERVQGRGVVYGGWIQQPLVLDHPSVGCFVSHCGFGSM  367

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
             WESL S C+I++  P+  +  LNARLM EE+E AVEV+  EN  F + +L +A+KSVM E
Sbjct  368   WESLMSDCQIVLV-PHHGEQILNARLMTEEMEVAVEVERGENGWFSRRSLEDAVKSVMEE  426

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + NH KWR +L   GFAD YI++F   L EL
Sbjct  427   GSEVGVKVRKNHDKWRCVLSDSGFADGYINTFEQSLTEL  465



>ref|NP_200217.1| anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase [Arabidopsis 
thaliana]
 sp|Q9LVW3.1|AXYLT_ARATH RecName: Full=Anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase; 
Short=A3G2''XylT [Arabidopsis thaliana]
 dbj|BAA97127.1| flavonol 3-O-glucosyltransferase-like [Arabidopsis thaliana]
 gb|ACE82596.1| At5g54060 [Arabidopsis thaliana]
 gb|AED96443.1| UDP-glucose:flavonoid 3-o-glucosyltransferase [Arabidopsis thaliana]
 gb|AHL38579.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=468

 Score =   348 bits (894),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 228/462 (49%), Positives = 304/462 (66%), Gaps = 15/462 (3%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E S + I M+PWLAFGH  PFL L+N LA++GH+I  LLP  AL +L+ +NLYP LITF 
Sbjct  8     ESSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLYPNLITFH  67

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
              ++IPQV+GLPPGAET +D    L   L VA+D  + EV+ I   + KP+LVFYD A+WI
Sbjct  68    TISIPQVKGLPPGAETNSDVPFFLTHLLAVAMDQTRPEVETIFRTI-KPDLVFYDSAHWI  126

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKG--KGRAVTAADIMEPPPGFPSDSKVVL  834
             PE+   +G KTV F + S    ALSL+ S  +    G+ ++  ++ + P G+PS SKVVL
Sbjct  127   PEIAKPIGAKTVCFNIVSAASIALSLVPSAEREVIDGKEMSGEELAKTPLGYPS-SKVVL  185

Query  835   REHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
             R HEA  +S          + FD  V A++ CDAIA R C E EG +C+YI+ +  KPVY
Sbjct  186   RPHEAKSLSFVWRKHEAIGSFFDGKVTAMRNCDAIAIRTCRETEGKFCDYISRQYSKPVY  245

Query  1015  CAGpllpeppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllgleltg  1188
               GP+LP     +P  D + A WL KF   SV+FCAFGS+ V+ K +QF +L LGLE TG
Sbjct  246   LTGPVLPGSQPNQPSLDPQWAEWLAKFNHGSVVFCAFGSQPVVNKIDQFQELCLGLESTG  305

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
              PFLVA+KPP   S++E+ALPEGF+ER +G+ +V GGW+ Q ++L H +VG FV+H G G
Sbjct  306   FPFLVAIKPPSGVSTVEEALPEGFKERVQGRGVVFGGWIQQPLVLNHPSVGCFVSHCGFG  365

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM  1548
             SMWESL S C+I++  P   +  LNARLM EE+E AVEV+ ++   F +++L NA+KSVM
Sbjct  366   SMWESLMSDCQIVLV-PQHGEQILNARLMTEEMEVAVEVEREKKGWFSRQSLENAVKSVM  424

Query  1549  ------GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                   GE ++K NH KWR +L   GF+D YID F   L EL
Sbjct  425   EEGSEIGEKVRK-NHDKWRCVLTDSGFSDGYIDKFEQNLIEL  465



>ref|XP_002523261.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF39100.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=460

 Score =   347 bits (891),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 215/458 (47%), Positives = 306/458 (67%), Gaps = 12/458 (3%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             + S  HI MFPW A GH  PFL LAN +A+RG   + LLP  A L+L+H N +P LITF 
Sbjct  5     KSSNFHIVMFPWFAVGHMTPFLHLANRVAERGCSTTFLLPNKAKLQLEHFNTHPDLITFH  64

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
             ++T+P VEGLP G ET +D  ++L   L +ALD  + +V+ +++   +P LV +D A+WI
Sbjct  65    SITVPHVEGLPLGTETASDIPIHLTHFLAIALDRTRRQVEKVIVDT-RPKLVIFDVAHWI  123

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             P++  ++G K + + V      A++L+ +++  K R VT A++++PP G+PS S VVLR 
Sbjct  124   PKITKDLGIKAINYNVVCAASIAIALVPARNVTKDRPVTEAELLQPPAGYPS-SNVVLRG  182

Query  841   HEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
             HE   +  F++LP    IT ++R+  A+K  DAIA R C+E+EG  C+YIA++  KPV+ 
Sbjct  183   HEVRSL-LFVSLPFGEGITFYERIYTAIKGSDAIAIRTCHEIEGKLCDYIASQYEKPVFL  241

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
              GP+LPEP +     D+  +WL  FE +SVIFCAFGS++ L K QF +L+LGLE TGLPF
Sbjct  242   TGPVLPEPSKAPLE-DQWTKWLGGFEKDSVIFCAFGSQIKLEKNQFQELVLGLESTGLPF  300

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+KPP  +S++E+ALPEGF+ER  G+ ++ GGWV Q +IL H +VG F+NH G GSMW
Sbjct  301   LAALKPPNGASTVEEALPEGFEERVNGRGVIWGGWVQQLLILDHPSVGCFLNHCGFGSMW  360

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN  1557
             ESL S C+I++  P+  D  LN R+MAEEL+  VEV  DE+  F KE+L  AI SVM +N
Sbjct  361   ESLMSDCQIVLV-PHLGDQILNTRIMAEELKVGVEVVRDESGWFSKESLRKAITSVMDKN  419

Query  1558  IQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              +     K NH+KW ++L   GF  +YID F+  + +L
Sbjct  420   SEVGSMVKENHRKWTEILGGEGFMTSYIDKFVQNMQDL  457



>gb|EYU41034.1| hypothetical protein MIMGU_mgv1a006102mg [Erythranthe guttata]
Length=457

 Score =   347 bits (889),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 217/459 (47%), Positives = 298/459 (65%), Gaps = 13/459 (3%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHM-NLYPQLITF  480
             E   LHIAMFPW+A GH  PFL + N+LAKRGH +SLLLP  ALLKL H  +     + F
Sbjct  4     ETKKLHIAMFPWIAMGHVTPFLHVGNELAKRGHTVSLLLPKKALLKLGHAADPGGSPVNF  63

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P V GLP GAET +D  +  +  L +A D +  EV+A+L    KP++VFYDFA+W
Sbjct  64    HTVKVPHVAGLPAGAETCSDIDITENNFLAMAFDAMSPEVEALLRDTIKPDVVFYDFAHW  123

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             IP+L S +G KTV + + S +  A  ++ +++  K R +TA ++  PPPG+PS S VVLR
Sbjct  124   IPDLASRVGFKTVCYQIVSASCMAYGVVPARTIPKDRQLTAEELAAPPPGYPS-STVVLR  182

Query  838   EHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
              HE   +S F+      I   +R+  AL  CDAI  R C EMEG  C+Y++ +  KPV+ 
Sbjct  183   RHEGMIMS-FIGRDYGDIRFDERMAAALSGCDAIGIRTCAEMEGPMCDYLSEQYKKPVFL  241

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +GP+LPE P      +K   WL KF P SV++CAFGS+V+L KEQF +++LG E+TGLPF
Sbjct  242   SGPVLPEVPEGPLE-EKWDTWLNKFPPKSVVYCAFGSQVILKKEQFTEMVLGFEMTGLPF  300

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
              +A   P     +E+ALPEGF ER  G+ +VH GWV Q+ IL H +VG FV+H G GSM 
Sbjct  301   FIAAAKPHGVEKVEEALPEGFMERVAGRGVVHCGWVQQTQILSHDSVGCFVSHCGFGSMC  360

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM---  1548
             ESL S C+I++  P   D  LNARL+  E++ AVEV+  E   F KE+LCNA+K+VM   
Sbjct  361   ESLMSDCQIVLV-PRFGDQVLNARLLTAEMKVAVEVERGEMGWFSKEDLCNAVKTVMDVG  419

Query  1549  ---GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                G+ +++ NH  W++ L+ PGF DNYID+F+ +LY+L
Sbjct  420   SEVGDLVRR-NHATWKETLVKPGFMDNYIDNFVQQLYQL  457



>ref|XP_010520927.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
[Tarenaya hassleriana]
Length=468

 Score =   347 bits (889),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 220/465 (47%), Positives = 310/465 (67%), Gaps = 16/465 (3%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E S + I M+PWLA GH   FL L+N LA++GHRI  LLP  A   L+ +NL+P LITF 
Sbjct  7     EGSSMSIVMYPWLALGHMTAFLHLSNKLAEKGHRIVFLLPKKARAHLEPINLHPNLITFR  66

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
              ++IP V GLP GAET +D  + L   L VA+D  + EV+ ++  + KP+LVFYDFA W+
Sbjct  67    TISIPHVHGLPLGAETNSDVPIFLTHLLAVAMDRTRPEVETVVRTV-KPDLVFYDFADWV  125

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSK--GKGRAVTAADIMEPPPGFPSDSKVVL  834
             P + + +G KTV F   S    AL+L+ + ++    G  ++  ++  PPPG+PS SKVVL
Sbjct  126   PGISAPVGAKTVCFDTASAASIALTLVPAAAREMADGAMLSGDELSRPPPGYPS-SKVVL  184

Query  835   REHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
             R HEA  +          ++ F++ V  L+ CDAIA R C E+EG +C +I+++  +PVY
Sbjct  185   RAHEARTLGFLWKRFEGLVSFFEKKVSTLRNCDAIAIRTCREIEGKFCEFISSQYNRPVY  244

Query  1015  CAGpll--peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllglelt  1185
               GP+L   +P  +  LE + A WL KFEP SV++CAFGS+ VL K EQF ++ LGLELT
Sbjct  245   LTGPVLPDTKPSDQAALEPRWADWLSKFEPGSVVYCAFGSQPVLDKLEQFQEVCLGLELT  304

Query  1186  glpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGS  1365
             GLPFL+A+KPP   S++E+ALPEGF+ER KG+ +V+GGWV Q +IL H +VG FV+H G 
Sbjct  305   GLPFLIALKPPSGFSTVEEALPEGFEERVKGRGVVYGGWVQQPLILDHPSVGCFVSHCGF  364

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSV  1545
             GSMWESL   C+I++  P+  +  LNA+LM+EE+E AVEV+ +EN  F + +L +A+KSV
Sbjct  365   GSMWESLLRDCQIVLV-PHLGEQILNAKLMSEEMEVAVEVKREENGWFSRHSLKDAVKSV  423

Query  1546  M------GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYELSV  1662
             M      GE ++K NHKKW+D+L   GF+++YI  F   L +L +
Sbjct  424   MDKDSEIGEIVRK-NHKKWKDVLGESGFSESYISKFEQSLLQLLI  467



>gb|KDO58530.1| hypothetical protein CISIN_1g012080mg [Citrus sinensis]
Length=471

 Score =   347 bits (889),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 209/452 (46%), Positives = 303/452 (67%), Gaps = 12/452 (3%)
 Frame = +1

Query  322   IAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQ  501
             I M PW A GH  PFL L+N LA++GH+I++LLP  A  +L+H NL+P LIT   LT+P 
Sbjct  17    IVMLPWFAVGHMTPFLHLSNKLAEKGHKITILLPRKAQTQLQHFNLHPDLITLHPLTVPH  76

Query  502   VEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSE  678
             V+GLP GAET +D  M+    L +A+D  + +V+A++ +  KP L+FYD AYW+  +   
Sbjct  77    VDGLPAGAETASDVPMSSINLLVIAMDRCRGQVEAVI-KAAKPRLLFYDIAYWMATISKS  135

Query  679   MGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQV  858
             +  K +K+ V      A +L+ +++  K R VT A++  PP G+PSD+ +VLR HEA ++
Sbjct  136   LSIKCIKYNVVCAASIATALVPARNVPKDRPVTEAELAMPPAGYPSDT-IVLRRHEAREL  194

Query  859   SRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllp  1035
             + F++ P    ++ ++R+  +LK  DAI+ R C+E+EG  C YIA +  KPV+  GP+L 
Sbjct  195   T-FISFPFGEGMSFYERITTSLKESDAISIRTCHEIEGDLCEYIARQYNKPVFLTGPVLH  253

Query  1036  eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKP  1215
             EP +     ++  +WL  FE +SV++CAFGS+++L K+QF +LLLGLELTGL FL+A+KP
Sbjct  254   EPAKTPSE-ERWDKWLGGFERSSVVYCAFGSQIILEKKQFQELLLGLELTGLCFLIALKP  312

Query  1216  PERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASH  1395
             P  +S++E+A P+GF ERTKG+ +V G WV Q  IL H +VG FV+H G GSMWESL S 
Sbjct  313   PTGASTVEEAFPDGFAERTKGRGVVCGEWVEQMPILEHSSVGCFVSHCGFGSMWESLMSD  372

Query  1396  CRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----NI  1560
             C+I++  P+  D  LN RL+AEEL+ AVEV+ +EN  F KE+LC AIK VM +     N+
Sbjct  373   CQIVLV-PHLGDQILNTRLLAEELKVAVEVEREENGWFSKESLCKAIKCVMDKESEVGNV  431

Query  1561  QKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              + NH KW+  L++PGF   YID F+  +  L
Sbjct  432   VRRNHAKWKGTLVSPGFVSGYIDKFVQNMRGL  463



>ref|XP_010098447.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB75038.1| UDP-glycosyltransferase [Morus notabilis]
Length=459

 Score =   346 bits (887),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 211/452 (47%), Positives = 300/452 (66%), Gaps = 12/452 (3%)
 Frame = +1

Query  322   IAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQ  501
             +AMFPW A GH  PF+ +AN+LA RGHRIS+LLP  A + L+H+NL+P LITF  +T+P 
Sbjct  6     VAMFPWFATGHIAPFIHVANELAVRGHRISILLPKKAQILLQHLNLHPNLITFHTITVPH  65

Query  502   VEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSE  678
             V+GLPPG ET +D  ++    L  A+D  + +V    L   KP +VFYDFA+W+P++ + 
Sbjct  66    VDGLPPGVETASDIHLSKTHLLAAAMDLTRPQVHD-FLSAAKPQIVFYDFAHWVPDITAH  124

Query  679   MGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQV  858
             +G  +V ++V S +  A++L+ +++    R VT  DI +PPPG+PS S VVLR  E   +
Sbjct  125   IGAISVCYSVVSASSLAIALVPARNVPCDRTVTVEDIKDPPPGYPS-STVVLRGPEVRSL  183

Query  859   SRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllp  1035
               F++LP  + IT ++R   A++  D ++ R C E+EG  C+YIA++  KP+   GP+L 
Sbjct  184   -LFISLPFGDGITFYERTTTAMRNADVLSIRTCREVEGELCDYIASQYKKPLLLTGPVLS  242

Query  1036  eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKP  1215
             EP    PLE +   WL +F+P SV+FCAFGS+ +L K+QF +LLLG E T  PFL+A+KP
Sbjct  243   EPTDTTPLEVRWTEWLNRFKPGSVVFCAFGSQHILKKDQFQELLLGFESTDFPFLIALKP  302

Query  1216  PERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASH  1395
             P    ++E+A P GF ER KG+ IV+GGWV Q +IL H +VG FVNH G GSMWE+L S 
Sbjct  303   PVGCETVEEAFPVGFAERVKGRGIVYGGWVQQPLILNHPSVGCFVNHCGFGSMWEALLSK  362

Query  1396  CRIIVAPPNRSDYalnarlmaeeleaaVEVQTD-ENDKFFKENLCNAIKSVMGEN-----  1557
              +I++  P+  D  LN +L+A+E++ AVEV+ + E+  F KE+L  AIKSV+ E+     
Sbjct  363   NQIVLV-PHLGDQILNTKLLAKEIKVAVEVEKELESGWFSKESLRKAIKSVVDEDSEVGI  421

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
             + + NH KWRDLL  PGF   YID F+  L E
Sbjct  422   MVRKNHAKWRDLLGKPGFISGYIDEFVKNLEE  453



>ref|XP_006451768.1| hypothetical protein CICLE_v10008184mg [Citrus clementina]
 ref|XP_006464820.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Citrus sinensis]
 gb|ESR65008.1| hypothetical protein CICLE_v10008184mg [Citrus clementina]
Length=471

 Score =   346 bits (887),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 209/452 (46%), Positives = 303/452 (67%), Gaps = 12/452 (3%)
 Frame = +1

Query  322   IAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQ  501
             I M PW A GH  PFL L+N LA++GH+I++LLP  A  +L+H NL+P LIT   LT+P 
Sbjct  17    IVMLPWFAVGHMTPFLHLSNKLAEKGHKITILLPRKAQTQLQHFNLHPDLITLHPLTVPY  76

Query  502   VEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSE  678
             V+GLP GAET +D  M+    L +A+D  + +V+A++ +  KP L+FYD AYW+  +   
Sbjct  77    VDGLPAGAETASDVPMSSINLLVIAMDRCRGQVEAVI-KAAKPRLLFYDIAYWMATISKS  135

Query  679   MGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQV  858
             +  K +K+ V      A +L+ +++  K R VT A++  PP G+PSD+ +VLR HEA ++
Sbjct  136   LSIKCIKYNVVCAASIATALVPARNVPKDRPVTEAELAMPPAGYPSDT-IVLRRHEAREL  194

Query  859   SRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllp  1035
             + F++ P    ++ ++R+  +LK  DAI+ R C+E+EG  C YIA +  KPV+  GP+L 
Sbjct  195   T-FISFPFGEGMSFYERITTSLKESDAISIRTCHEIEGDLCEYIARQYNKPVFLTGPVLH  253

Query  1036  eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKP  1215
             EP +     ++  +WL  FE +SV++CAFGS+++L K+QF +LLLGLELTGL FL+A+KP
Sbjct  254   EPAKTPSE-ERWDKWLGGFERSSVVYCAFGSQIILEKKQFQELLLGLELTGLCFLIALKP  312

Query  1216  PERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASH  1395
             P  +S++E+A P+GF ERTKG+ +V G WV Q  IL H +VG FV+H G GSMWESL S 
Sbjct  313   PTGASTVEEAFPDGFAERTKGRGVVCGEWVEQMPILEHSSVGCFVSHCGFGSMWESLMSD  372

Query  1396  CRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----NI  1560
             C+I++  P+  D  LN RL+AEEL+ AVEV+ +EN  F KE+LC AIK VM +     N+
Sbjct  373   CQIVLV-PHLGDQILNTRLLAEELKVAVEVEREENGWFSKESLCKAIKCVMDKESEVGNV  431

Query  1561  QKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              + NH KW+  L++PGF   YID F+  +  L
Sbjct  432   VRRNHAKWKGTLVSPGFVSGYIDKFVQNMRGL  463



>ref|XP_002866015.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42274.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Arabidopsis lyrata 
subsp. lyrata]
Length=468

 Score =   345 bits (886),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 224/460 (49%), Positives = 305/460 (66%), Gaps = 13/460 (3%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
              S + I M+PWLAFGH  PFL L+N LA++GH+I  LLP  AL +L+ +NLYP LITF  
Sbjct  9     SSSMTIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLYPNLITFRT  68

Query  487   LTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             ++IPQV+GLPPGAET +D    L   L +A+D  + EV+ I   + KP+LVFYD A+WIP
Sbjct  69    ISIPQVKGLPPGAETNSDVPFFLTHLLAIAMDQTRPEVETIFRTI-KPDLVFYDSAHWIP  127

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKG--KGRAVTAADIMEPPPGFPSDSKVVLR  837
             E+   +G KTV F + S    ALSL+ +  +    G+ ++  ++ + P G+PS SKVVLR
Sbjct  128   EIAKPVGAKTVCFNIVSAASIALSLVPAAEREVIDGKEMSGEELAKTPLGYPS-SKVVLR  186

Query  838   EHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
              HEA  ++          + FD  V A++  DAIA R C E EG +C+YI+++  KPVY 
Sbjct  187   AHEAKALTFVWRKHEGIASFFDGKVTAMRNSDAIAIRTCRETEGKFCDYISSQYSKPVYL  246

Query  1018  AGpllpeppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllgleltgl  1191
              GP+LP     +P  + + A WL KF P SV+FCAFGS+ V+ K +QF +L LGLE TG 
Sbjct  247   TGPVLPGSQPNQPSLEPQWAEWLAKFNPGSVVFCAFGSQPVVDKIDQFQELCLGLESTGF  306

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP   S++E+ALPEGF+ER +G+ +V+GGW+ Q ++L H +VG FV+H G GS
Sbjct  307   PFLVAIKPPSGVSTVEEALPEGFKERVQGRGVVYGGWIQQPLVLNHPSVGCFVSHCGFGS  366

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL S+C+I++  P   +  LNARLM EE+E AVEV+ +EN  F + +L NA+KSVM 
Sbjct  367   MWESLMSNCQIVLV-PQHGEQILNARLMTEEMEVAVEVEREENGWFSQRSLENAVKSVME  425

Query  1552  ENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E  +     + NH+KWR +L   GFAD YID F   L EL
Sbjct  426   EGSEVSDKVRKNHEKWRCVLTDSGFADGYIDKFEKNLIEL  465



>ref|XP_002285222.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=457

 Score =   343 bits (881),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 222/460 (48%), Positives = 308/460 (67%), Gaps = 16/460 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   + LHIAM+PW AFGH  P+L L+N+LA+RGH+I+ +LP  A  +L+H+NL+P LIT
Sbjct  3     MARSTKLHIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPKKAQSQLQHLNLHPTLIT  62

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  LTIP V+GLPPGAET +D    +   L  A+D   D+V+A L  + KP+ + +DF Y
Sbjct  63    FHPLTIPHVDGLPPGAETASDVPFFMHHLLVTAMDRTADQVEAALRAL-KPDFLLFDFPY  121

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W P L S++G K++ ++       A   +     GK R +TA     PPPG+PS S VVL
Sbjct  122   WAPTLASKLGIKSIYYSAVCAAALARHPVPGGQVGKDRPITAG----PPPGYPS-STVVL  176

Query  835   REHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             R HEA+ V +FL  P    + ++ R+   +K CDAI+ R C+E+EG +C+Y+A++ GKPV
Sbjct  177   RPHEAWMV-KFLYAPFGEGVNLYQRLTTGMKCCDAISIRTCHEIEGAFCDYLASQYGKPV  235

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                GP+LP+P       D+ A+WL  F+P SVIFCAFGS+    K+QF +LLLGLELTGL
Sbjct  236   LLTGPVLPKPLPTPSE-DRWAQWLSGFKPGSVIFCAFGSQNFPEKDQFQELLLGLELTGL  294

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP  +++IE+ALPEGFQER  G+ +VHGGWVPQ  IL H +VG FV+H G GS
Sbjct  295   PFLVALKPPTGAATIEEALPEGFQERVGGRGVVHGGWVPQPSILSHPSVGCFVSHCGFGS  354

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL S  +I++  P   D  LN R +AE L+ AVE++ +EN  F K++LC A++SVM 
Sbjct  355   MWESLTSDPQIVLV-PELPDQILNTRQLAEVLKVAVEIEKEENGWFSKKSLCRAVRSVMD  413

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E      + + NH KW++ L + GF  NYI++F+ +L +L
Sbjct  414   EESEVGGLVRKNHAKWKETLTSQGFMSNYIENFVQQLQQL  453



>ref|XP_006401632.1| hypothetical protein EUTSA_v10013471mg [Eutrema salsugineum]
 gb|ESQ43085.1| hypothetical protein EUTSA_v10013471mg [Eutrema salsugineum]
Length=463

 Score =   343 bits (881),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 228/465 (49%), Positives = 304/465 (65%), Gaps = 17/465 (4%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M +   + I M+PWLAFGH  PFL L+N LA++GH+I  LLP  AL +L+  NLYP LIT
Sbjct  1     MGDSGSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALSQLEPFNLYPNLIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  ++IPQV+GLP GAET +D    L   L VA++  Q EV  IL  + KPNLVFYD AY
Sbjct  61    FHTISIPQVKGLPLGAETNSDVPFFLTHLLAVAMNQTQPEVDTILRTI-KPNLVFYDSAY  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSK--GKGRAVTAADIMEPPPGFPSDSKV  828
             WIPE+   +G KTV + + S    ALSL+ +  +    G+ ++  ++   P G+PS SKV
Sbjct  120   WIPEIAKPVGAKTVCYNIVSAASIALSLVPAAERELTDGKEISLEELARSPLGYPS-SKV  178

Query  829   VLREHEAYQVSRFLNLPRNRI-TVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGK  1005
             +L  HEA  + RF+      I + FD  V A++ CDAIA R C E EG +C+YIA++  K
Sbjct  179   ILLAHEAKNL-RFVWKRHEEIGSFFDGKVTAMRNCDAIAIRTCRETEGKFCDYIASQYSK  237

Query  1006  PVYCAGpllpeppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllgle  1179
             PVY  GP+LP     +   + + A WL KF P SV+FCAFGS+ V+ K +QF +L LGLE
Sbjct  238   PVYLTGPVLPGSKLNQASLEPRWADWLAKFNPGSVVFCAFGSQPVVDKIDQFQELCLGLE  297

Query  1180  ltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHG  1359
              TGLPFLVA+KPP    ++E+ALPEGF+ER KG+ IV+GGW+ Q ++L H +VG FV+H 
Sbjct  298   STGLPFLVAIKPPSGVQTVEEALPEGFEERVKGRGIVYGGWIQQPLVLNHPSVGCFVSHC  357

Query  1360  GSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIK  1539
             G GSMWESL S C++++  P   +  LNARLM +E+E AVEV+ +EN  F + +L  A+K
Sbjct  358   GFGSMWESLMSDCQVVLV-PQHGEQILNARLMTKEMEVAVEVEREENGWFSRRSLEVAVK  416

Query  1540  SVM------GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             SVM      GE ++K NH+KWR +L   GFAD YID F   L  L
Sbjct  417   SVMEEGSEVGEKVRK-NHEKWRCVLSDSGFADGYIDKFEQNLINL  460



>ref|XP_010260356.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=472

 Score =   342 bits (878),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 207/458 (45%), Positives = 293/458 (64%), Gaps = 15/458 (3%)
 Frame = +1

Query  313   MLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALT  492
             + H+AM+PW A GH  P+L L+N LA++GHR+S  LP     KL+H+N YP LI F  + 
Sbjct  9     IFHVAMYPWFAIGHITPYLHLSNKLAEKGHRVSFFLPLKTKSKLEHLNRYPHLIRFITIP  68

Query  493   IPQVEGLPPGAETTADTMN-LDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPEL  669
             I +V+GLPP AETTAD  + +   L   LD  +D V+A LL + KP+LVFYD AYW+P L
Sbjct  69    IARVDGLPPTAETTADVSSPMVPLLMTTLDLTKDHVEAFLLDL-KPDLVFYDLAYWLPAL  127

Query  670   VSEMGCKTVKFTVFSPTISALSLITSKSKGKG--RAVTAADIMEPPPGFPSDSKVVLREH  843
                +G K++ ++V S   S+     ++       + +T  ++M+PP G+PS S   +R +
Sbjct  128   ARHLGIKSIHYSVVSSAASSYLASPARMPPSAGVKQLTQEELMQPPMGYPSSSPFQIRRY  187

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             E            + +T +D +  +    DAI FR C E+EG YC+Y+AT+ GKPV   G
Sbjct  188   ETRDALLAFQDRGDGLTFYDMLTTSFGDSDAICFRTCREIEGPYCDYMATQYGKPVLLTG  247

Query  1024  pllp----eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
             PL+     + P    L++  ++WL  F+  SV++CAFGSE +L K+QF +L+LG ELTGL
Sbjct  248   PLILPAHHQQPNTRLLDEPWSKWLGNFKEGSVVYCAFGSECILQKDQFQELVLGFELTGL  307

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP  +S+IE+ALP+GF+ER +G+ +VHGGWVPQ+ IL H +VG FV+H G GS
Sbjct  308   PFLVALKPPHGASTIEEALPDGFKERVQGRGVVHGGWVPQTQILSHPSVGCFVSHCGYGS  367

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM  1548
             MWESL S C+I++  PN  D  ++ +L+   L+ AVEV+  E D +F +E++C AI+ VM
Sbjct  368   MWESLVSSCQIVLI-PNYGDQFMHTQLLTRSLKVAVEVERREEDGWFSRESVCKAIRLVM  426

Query  1549  -GENI----QKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
              GEN      K NH KWRD LL      +YID+FIH L
Sbjct  427   DGENQIRKEVKANHVKWRDFLLDENMQSSYIDAFIHDL  464



>ref|XP_010474328.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase 
[Camelina sativa]
Length=454

 Score =   342 bits (877),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 224/454 (49%), Positives = 300/454 (66%), Gaps = 15/454 (3%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             M+PWLAFGH  PFL L+N LA++GH+I  LLP  AL +L+ +NLYP LITF  ++IPQV+
Sbjct  1     MYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALTQLEPLNLYPNLITFHTISIPQVK  60

Query  508   GLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMG  684
             GLPPGAET +D    L   L VA++  + EV+ I   + KP+LVF+D A WIPE+   +G
Sbjct  61    GLPPGAETNSDVPYFLTYLLRVAMNQTRPEVETIFHTI-KPDLVFFDTADWIPEVAKSVG  119

Query  685   CKTVKFTVFSPTISALSLITSKSKG--KGRAVTAADIMEPPPGFPSDSKVVLREHEAYQV  858
              KTV F + S    ALSL+ +  +    G+ ++  ++ + P G+PS SKVVLR HEA  +
Sbjct  120   AKTVCFNIVSAAAIALSLVPAAEREVIDGKELSGEELAKTPLGYPS-SKVVLRAHEAKAL  178

Query  859   SRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpe  1038
             +            FD  V  ++ CDAIA R C E EG +C+YI+++  KPVY  GP+LP 
Sbjct  179   NFMWRKREGTACFFDVKVTTMRNCDAIAIRTCRETEGKFCDYISSQYSKPVYLTGPVLPG  238

Query  1039  ppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllgleltglpflVAVK  1212
                 +P  + + A WL KF+P SV+FCAFGS+ V+ K +QF +L LGLE TGLPFLVA+K
Sbjct  239   SKPNQPSLESRWAEWLAKFKPGSVVFCAFGSQPVVDKVDQFQELCLGLESTGLPFLVAIK  298

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP   S++E+ALPEGF+ER +G+ IV GGW+ Q ++L H +VG FV+H G G MWESL S
Sbjct  299   PPSGVSTVEEALPEGFEERVQGRGIVFGGWIQQPLVLDHPSVGCFVSHCGFGLMWESLMS  358

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM------GE  1554
              C+I++  P   +  LNARLM EE+E AVEV+ +EN  F + +L NA+KSVM      GE
Sbjct  359   DCQIVLV-PQHGEQILNARLMTEEMEMAVEVEREENGWFSRGSLENAVKSVMEEGSEVGE  417

Query  1555  NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              ++K NH KWR +L   GFAD YID F   L EL
Sbjct  418   KVRK-NHDKWRCVLAESGFADGYIDKFEQSLIEL  450



>ref|XP_010644165.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=454

 Score =   342 bits (876),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 225/460 (49%), Positives = 308/460 (67%), Gaps = 16/460 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M+++   HI M+PW AFGH IP+L L+N+LA+RGH I+ +LP     +L+H+NL+P LI+
Sbjct  3     MVKNPRFHIVMYPWSAFGHMIPYLHLSNELAERGHSITFILPKKVQSQLQHLNLHPTLIS  62

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F +LTIP V+GLPPGAET +D  ++L   L  A+D   D+V+A L  + K + +FYD AY
Sbjct  63    FHSLTIPYVDGLPPGAETASDVPISLHHLLATAMDRTTDQVEAALRAL-KSDFLFYDTAY  121

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W P L S++G K++ ++  S +  +  L+  +   K R +       PPPG+PS S VVL
Sbjct  122   WAPPLASKLGMKSIFYSAVSASAFSYCLVLDQQISKSRPIPTG----PPPGYPS-STVVL  176

Query  835   REHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             R HEA ++ +FL  P    IT  +R+  A+K CD ++ R C E+EG +C+YI    GKPV
Sbjct  177   RPHEA-RLLQFLLFPFGEDITFHERLTAAIKLCDVVSIRTCQEIEGPFCDYIERRFGKPV  235

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
             +  GP+L EP    P  D+ A+WL  F+P SVIFCAFGS+   GK+QF +LLLG ELTGL
Sbjct  236   FVTGPVLVEPSPLAPE-DRWAQWLSGFKPGSVIFCAFGSQNFPGKDQFQELLLGFELTGL  294

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL A+KPP  +++IE+ALPEGFQER  G+ +V+GGWVPQ  IL H +VG FV+H G GS
Sbjct  295   PFLAALKPPLGAATIEEALPEGFQERVGGRGVVYGGWVPQPSILSHPSVGCFVSHCGFGS  354

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL S  +I++  P   D   NARL+AEEL+ AVEV+ +EN    KE LC AIKSVM 
Sbjct  355   MWESLMSDPQIVLV-PELFDQTFNARLLAEELKVAVEVEKEENGWVSKEGLCKAIKSVMD  413

Query  1552  EN-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E      + K NH KW++ L++ GF  NYID+F+ +L +L
Sbjct  414   EEGEVGCLVKKNHAKWKETLMSQGFMSNYIDNFVRQLLDL  453



>gb|KFK27016.1| hypothetical protein AALP_AA8G323600 [Arabis alpina]
Length=447

 Score =   341 bits (874),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 210/456 (46%), Positives = 299/456 (66%), Gaps = 19/456 (4%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  MFPW  FGH   FL LAN LA++GH+I+ LLP  AL +L+ +NL+P  I F  L
Sbjct  3     SQFHAFMFPWFGFGHMTAFLHLANKLAEKGHKINFLLPKKALKQLEPLNLFPNSIVFHIL  62

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             TIP V+GLP GAETTAD  ++L   L  A+D  +++VK  ++  +KP+L+F+DFA+WIPE
Sbjct  63    TIPPVDGLPAGAETTADIPISLGSFLASAMDRTRNQVKE-MVSNDKPDLIFFDFAHWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G KTV +   S    A+S +  +S          D+  PPPG+PS SKV+LR  E
Sbjct  122   IAKEYGAKTVNYVTISAACVAISFVPGRSPD--------DLAVPPPGYPS-SKVLLRGQE  172

Query  847   AYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                +S FL+ P  +  T ++R++  L  CD I+ R C EMEG +C++I  +  + V   G
Sbjct  173   TKSLS-FLSYPFGDGTTFYERIITGLTNCDVISIRTCQEMEGKFCDFIERQCQRKVLLTG  231

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+L E    + LE++ ++WL +F+P SVI+CA GS+++L K QF +L LG+ELTGLPFLV
Sbjct  232   PMLSEQDNSKLLEEQWSQWLSRFKPGSVIYCALGSQIILEKNQFQELCLGMELTGLPFLV  291

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+  S+I+ ALPEGF+ER KG+ +V GGWV Q +IL H ++G FV+H G GSMWE+
Sbjct  292   AVKPPKGVSTIQVALPEGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWEA  351

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE---  1554
             L + C+I+   P+ ++   N RLM++ELE +VEV+ +E   F KE L  AI+SVM E   
Sbjct  352   LVNDCQIVFI-PHLAEQVFNTRLMSDELEVSVEVKREEIGWFSKERLSGAIRSVMDEDSE  410

Query  1555  --NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               N+ + NH KW++ L+  G  ++Y++ FI  L EL
Sbjct  411   LGNLVRRNHAKWKESLVKTGLMNDYVNKFIEALQEL  446



>ref|XP_006401633.1| hypothetical protein EUTSA_v10013535mg [Eutrema salsugineum]
 gb|ESQ43086.1| hypothetical protein EUTSA_v10013535mg [Eutrema salsugineum]
Length=447

 Score =   340 bits (873),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 211/456 (46%), Positives = 308/456 (68%), Gaps = 19/456 (4%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  MFPW  FGH   FL LAN LA++GH+I+ LLP  AL +L+ +NL+P  I F  +
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPNRIVFDTI  62

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P VEGLP GAETT+D  ++L   L  A+D  +++VK   + M KP+L+F+DFA+WIPE
Sbjct  63    TVPSVEGLPAGAETTSDIPISLGSFLASAMDRTRNQVKE-RVSMSKPDLIFFDFAHWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G K+V F     TISA  +  S S G+    +  D+  PPPG+PS SKV+LR  E
Sbjct  122   IAREYGAKSVNFV----TISAACVAISFSPGR----SPDDLAVPPPGYPS-SKVLLRGQE  172

Query  847   AYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                +S FL+ P  +  T ++R++  L  CD I+ R C EMEG +C++I ++  + V   G
Sbjct  173   TNSLS-FLSYPFGDGTTFYERIMTGLTHCDVISIRTCQEMEGKFCDFIESQFQRKVLLTG  231

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LP+P   +PL+++ + WL +FEP SV++CA GS+++L K+QF +L LG+ELTGLPFLV
Sbjct  232   PMLPDPDNSKPLDEQRSHWLRQFEPESVVYCALGSQIILEKDQFQELCLGMELTGLPFLV  291

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+ +S+I++ALP+GF+ER KG+ +V GGWV Q +IL H ++G FV+H G GSMWES
Sbjct  292   AVKPPKGASTIQEALPKGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWES  351

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE---  1554
             L + C+I+   P+  +   N RLM+EELE +VEV+ +E   F KE+L  AI+SVM +   
Sbjct  352   LVNDCQIVFI-PHLGEQIFNTRLMSEELEVSVEVKREETGWFSKESLSGAIRSVMDKDSE  410

Query  1555  --NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               N+ + NH KW++ +++ G  + Y+++FI  L +L
Sbjct  411   LGNLVRRNHAKWKESIVSSGLMNGYVNNFIEALEKL  446



>ref|XP_007021621.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13146.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=581

 Score =   345 bits (884),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 221/516 (43%), Positives = 314/516 (61%), Gaps = 23/516 (4%)
 Frame = +1

Query  154   IPLSPTSLLSYIYIPNETLSLLHIC------IQKHNTTQPNQFKKASSSASRKHMMED--  309
             +P S T  L+ I+  N ++    +C      IQ     +    +   S+   K  M +  
Sbjct  72    MPSSRTFFLTGIFKKNISIPSSKVCKIWSNKIQIAKEVEEYNLESDHSNTVCKAKMRNPN  131

Query  310   -SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
              S LH+AMFPW +FGHFIP+L L+N LA++GH +S LLP  A  KL+ +N YP LI F  
Sbjct  132   SSKLHLAMFPWFSFGHFIPYLHLSNKLAEKGHEVSFLLPKGAQPKLEQLNQYPNLIQFFP  191

Query  487   LTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             L +  V+G+ PGA+TT+D  + L     +A D  +D+V+AIL  + KP++VF+D  YWIP
Sbjct  192   LVVSHVDGILPGAQTTSDVPLPLHSLFAIAFDQTRDQVEAILRAI-KPDIVFHDLGYWIP  250

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
              L  ++G K++    + P ++A +     +K   R +T  ++ME PPG+PS SKV LR  
Sbjct  251   ALAHQIGIKSI----YYPPVTAAAHALLPTKKVTREMTVEELMEVPPGYPS-SKVKLRAE  305

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             E   ++  L +    ++  DR++ ++   D IAFRA  E+EG YC+Y+A   GKP    G
Sbjct  306   EVSDLTTALKIFGIGLSFRDRIITSMNDSDVIAFRAHREIEGPYCDYVAQHFGKPAMLTG  365

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
               LPE    +   DK A WL  FEP+SV+FCAFGS++ L KE+F +L+LGLEL+G PFLV
Sbjct  366   TCLPETNATQLE-DKWANWLSNFEPSSVVFCAFGSQITLQKEEFQELVLGLELSGQPFLV  424

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             A+ PP+  + IE+ALPEGFQER +G+ ++HGGW PQ ++L H ++G FVNH G G+MWES
Sbjct  425   ALTPPDGCTRIEEALPEGFQERIQGRGLLHGGWFPQELLLSHPSIGCFVNHCGPGTMWES  484

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN--  1557
             L S C+I+   P   D  LN RLM EEL+ AVE +  EN K  KENL  AIK VM ++  
Sbjct  485   LLSDCQIVFI-PRLGDQILNTRLMVEELKVAVEAEKGENSKISKENLSKAIKLVMDKDNE  543

Query  1558  ---IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                + K NH K + +L      + YI++FI  L +L
Sbjct  544   ISVLLKRNHAKLKKILSNRDLQEEYINNFIKGLQDL  579



>emb|CDP05960.1| unnamed protein product [Coffea canephora]
Length=456

 Score =   340 bits (873),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 219/457 (48%), Positives = 311/457 (68%), Gaps = 11/457 (2%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E   LH+AMFP LA GH  PFL LAN+LAKRGH++S LL   A ++L+  NLYP ++TF 
Sbjct  5     EGKRLHVAMFPGLATGHMTPFLHLANELAKRGHKVSYLLTKKAKIQLECGNLYPDVVTFH  64

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
              L +P VEGLPPG E  ++  + L+    +A D + D+V+A L  +  P++V YD A+ I
Sbjct  65    VLPVPHVEGLPPGTENASEIPIFLNSLFALAFDNMSDQVEAALSDL-NPDVVLYDTAFRI  123

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
              +   ++G KTV + V S    AL+L+ ++   K R +T  ++MEPPPG+PS S VVLR+
Sbjct  124   TDFAPKIGFKTVCYNVVSAASIALALVPARQMPKDRPLTEEELMEPPPGYPSSS-VVLRK  182

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             HEA +V  F++      T +DR++ ALK C AIA R+C E+EG +C+YI  +  KPV+ +
Sbjct  183   HEA-KVLAFMSSEFGARTFYDRIITALKGCHAIAIRSCQELEGQFCDYIGGQYQKPVFLS  241

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+LPE  ++     K A WL KFE  SV+FCAFGS+++L K+QF +L+LG ELTGLPF 
Sbjct  242   GPVLPEQEKQPLD-GKWAEWLGKFEQKSVVFCAFGSQIILEKQQFQELVLGFELTGLPFF  300

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VA+KPP  + SIE++LP+GF+ER  G+ +V+GGWV Q  IL H +VG FVNH G GSMWE
Sbjct  301   VALKPPLGTGSIEESLPDGFEERVGGRGVVYGGWVQQPQILSHPSVGCFVNHCGFGSMWE  360

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENI  1560
             SL S C+I++  P+  D  LN+RL+  +L+ AVEV+ DE+  F KE+L +AI +VMG + 
Sbjct  361   SLMSDCQIVLV-PHLGDQILNSRLLCGDLKVAVEVERDESGWFSKESLSSAINAVMGPDS  419

Query  1561  Q-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             +     + +H K +++L +PG+  NY++SFI  LYEL
Sbjct  420   EVGSSLRKSHLKVKEILSSPGYMSNYVESFIQNLYEL  456



>ref|XP_004304716.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=463

 Score =   340 bits (873),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 210/457 (46%), Positives = 293/457 (64%), Gaps = 15/457 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH  PFL ++N LA+RGHRIS  LP     KL++ NL+P LITF  LTI
Sbjct  9     LHIAMYPWFAMGHLSPFLHISNKLAERGHRISFFLPQKTQAKLQYYNLHPDLITFYPLTI  68

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P VEGLP GAETTAD    L   +  A+D  + +++  L ++ KP+LVFYDF++W+P+L+
Sbjct  69    PHVEGLPQGAETTADVPFPLHTLVVTAMDLTRPQIEKFLREL-KPDLVFYDFSHWLPQLL  127

Query  673   SEM--GCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
              E+    K+V + + SP ++   L++ + K   + + A D++E P  FPS S + LR HE
Sbjct  128   RELDGNIKSVLYCIISP-VTIGYLLSPERKLTEKPLVATDLLEAPTSFPS-SIIKLRTHE  185

Query  847   AYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             A  ++   N    R +T  +R + +L  CDAI F+ C E EG +C+YI  ++ KPV  AG
Sbjct  186   ARGLTYVTNQEYGRGVTFLERQLTSLGECDAIGFKTCREFEGKFCDYIEEQMKKPVILAG  245

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P++P PP      ++ A WL  FEP SVI+CAFGSE VL K+Q  +L+LG ELTGLPF  
Sbjct  246   PVVPAPPSSALE-ERWAEWLGGFEPGSVIYCAFGSECVLKKKQLQELVLGFELTGLPFFA  304

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             A+K P    SIE ALPEGF+ER KG+ +VH GWV Q +IL H +VGYFV H GSGS+ E+
Sbjct  305   ALKTPVGLESIEAALPEGFEERVKGRGVVHSGWVQQPLILNHPSVGYFVTHCGSGSLAEA  364

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGENI  1560
             + +HCR+++  P+  D  +NAR+M  +L   VEV+  DE+  F KE +C A+++VM +  
Sbjct  365   MMNHCRLVLL-PHVGDQIINARMMGGDLRVGVEVEKGDEDGLFSKEGVCKAVEAVMDDES  423

Query  1561  Q-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             +     K NH KWR+     G    YID F  +L++L
Sbjct  424   EVGKEVKANHAKWREFFSNKGLEKTYIDCFEQRLHQL  460



>ref|XP_010260530.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=471

 Score =   340 bits (873),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 206/458 (45%), Positives = 292/458 (64%), Gaps = 15/458 (3%)
 Frame = +1

Query  313   MLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALT  492
             + H+ M+PW A GH  P+L L+N LA++GHR+S  LP     KL+H+N YP LI F  + 
Sbjct  8     IFHVTMYPWFAIGHITPYLHLSNQLAEKGHRVSFFLPPKTKSKLEHLNRYPHLIRFITIP  67

Query  493   IPQVEGLPPGAETTADTMN-LDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPEL  669
             I +V+GLPP AETTAD  + +   L   LD  +D V+A LL + KP+LVFYD AYW+P L
Sbjct  68    IARVDGLPPTAETTADVSSPMVPLLMTTLDLTKDHVEAFLLDL-KPDLVFYDLAYWLPAL  126

Query  670   VSEMGCKTVKFTVFSPTISALSLITSKSKGKG--RAVTAADIMEPPPGFPSDSKVVLREH  843
                +G K++ ++V S   S+     ++       + +T  ++M+PP G+PS S   +R +
Sbjct  127   ARHLGIKSIHYSVVSSAASSYLASPARMPPSAGVKQLTQEELMQPPMGYPSSSPFQIRRY  186

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             E            + +T +D +  +    DAI FR C E+EG YC+Y+AT+ GKPV   G
Sbjct  187   ETRDALLAFQDRGDGLTFYDMLTTSFGDSDAICFRTCREIEGPYCDYMATQYGKPVLLTG  246

Query  1024  pllp----eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
             PL+     + P    L++  ++WL  F+  SV++CAFGSE +L K+QF +L+LG ELTGL
Sbjct  247   PLILPAHHQQPNTRLLDEPWSKWLGNFKEGSVVYCAFGSECILQKDQFQELVLGFELTGL  306

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP  +S+IE+ALP+GF+ER +G+ +VHGGWVPQ+ IL H +VG FV+H G GS
Sbjct  307   PFLVALKPPHGASTIEEALPDGFKERVQGRGVVHGGWVPQTQILSHPSVGCFVSHCGYGS  366

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM  1548
             MWESL S C+I++  PN  D  ++ +L+   L+ AVEV+  E D +F +E++C AI+ VM
Sbjct  367   MWESLVSSCQIVLI-PNYGDQFMHTQLLTRSLKVAVEVERREEDGWFSRESVCKAIRLVM  425

Query  1549  -GENI----QKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
              GEN      K NH KWRD LL      +YID+FIH L
Sbjct  426   DGENQIRKEVKANHVKWRDFLLDENMQSSYIDAFIHDL  463



>ref|XP_010442979.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Camelina sativa]
Length=447

 Score =   338 bits (867),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 223/456 (49%), Positives = 300/456 (66%), Gaps = 21/456 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             + I M+PWLAFGH  PFL L+N LA++GH+I  LLP  AL +L+ +NL+P LITF  + I
Sbjct  1     MSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALTQLEPLNLFPNLITFHTIAI  60

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             PQV+GLPPGAET +D    L   L VA++  + EV+ I  ++ KP+LVF+D A+WIPE+ 
Sbjct  61    PQVKGLPPGAETNSDVPYLLTYLLRVAMNQTRPEVETIFHKI-KPDLVFFDTAHWIPEVA  119

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +G KTV F + S    ALSL+ +  +         ++ + P G+PS SKVVLR HEA 
Sbjct  120   KPVGAKTVCFNIVSAAAIALSLVPAAER--------EELAKTPLGYPS-SKVVLRAHEAK  170

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              ++            FD  V  ++ CDAIA R C E EG +C+YI+++  KPVY  GP+L
Sbjct  171   TLNFMWRKREGTACFFDVKVTTMRNCDAIAIRTCRETEGKFCDYISSQYNKPVYLTGPVL  230

Query  1033  peppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllgleltglpflVA  1206
             P     +P  + + A WL KF P+SV+FCAFGS+ V+ K +QF +L LGLE TGLPFL+A
Sbjct  231   PGSKPNQPSLESRWAEWLTKFNPSSVVFCAFGSQPVVDKIDQFQELCLGLESTGLPFLIA  290

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP   S++E+ALPEGF+ER +G+ IV GGW+ Q ++L H +VG FV+H G GSMWESL
Sbjct  291   IKPPTGVSTVEEALPEGFEERVQGRGIVFGGWIQQPLVLDHPSVGCFVSHCGFGSMWESL  350

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM------  1548
              S C+I++  P   +  LNARLM EE+E AVEV+ +EN  F + +L NA+KSVM      
Sbjct  351   MSDCQIVLV-PQHGEQILNARLMTEEMEVAVEVEREENGWFSRRSLENAVKSVMEEGSEV  409

Query  1549  GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             GE ++K NH KWR +L   GFAD YID F   L EL
Sbjct  410   GEKVRK-NHDKWRCVLAESGFADGYIDKFEQSLIEL  444



>ref|XP_007025500.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY28122.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=456

 Score =   338 bits (867),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 206/460 (45%), Positives = 301/460 (65%), Gaps = 13/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M D   HIA++PW A GH   F+ +AN LA+RGH+IS  LP     K++  NL+P LITF
Sbjct  1     MADKTFHIALYPWFALGHITAFVHIANKLAERGHKISFFLPAKTQRKVEAFNLHPDLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P VEGLP GAETT D    L   +  A+D  + +++A LL++ KP+ VF+DF  W
Sbjct  61    IPITVPHVEGLPHGAETTNDVPFPLHPLIMTAMDLTEPDIEASLLEL-KPHFVFFDFTCW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L   +G K+V + + S + +   L++   K   + +T  D++EPP GFPS S + LR
Sbjct  120   LPALSRRLGIKSVLYCIVS-SATIGYLLSPARKILEKGLTGHDLLEPPKGFPSSS-IKLR  177

Query  838   EHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HEA  ++    +     I+   R + +L  CDAI+F+ C E+EG +C+YI  +  K V 
Sbjct  178   THEARGLAAVTTMDYGSGISFVQRQLRSLSDCDAISFKTCREIEGPFCDYIGHQFEKTVI  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              AGP++PEPP+     ++  + L  F+  +VIFCAFGSE VL K+QF +L+LGLE TGLP
Sbjct  238   FAGPVVPEPPKLALE-ERWEKLLSSFQAKTVIFCAFGSECVLKKDQFQELVLGLEQTGLP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FLVA+KPP  + +IE ALPEGFQER +G+ +VHGGWVPQ +ILRH +VG FV H GSGS+
Sbjct  297   FLVALKPPMGAETIESALPEGFQERVQGRGLVHGGWVPQQLILRHPSVGCFVTHCGSGSL  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKEN-LCNAIKSVMG  1551
              E++ + C++++  PN  D  +NARLMA +L   VEV+  + D  FK++ +C A+K+VM 
Sbjct  357   AEAMVNDCQLVLL-PNVGDQIINARLMAGDLRIGVEVEKGDEDGLFKKDGVCKAVKAVMD  415

Query  1552  ENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             ++ +     +VNH KW++ LL PG  ++Y+D+F+ KL+ L
Sbjct  416   DDSEVGKEARVNHAKWKEFLLGPGLENSYMDAFVEKLHAL  455



>gb|AEM37037.1| UDP-glucose:flavonoid 3-O-glucosyltransferase 2 [Brassica rapa 
subsp. oleifera]
Length=468

 Score =   338 bits (868),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 225/459 (49%), Positives = 301/459 (66%), Gaps = 13/459 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S + I M+PWLAFGH   FL L+N LA++GH I  LLP  AL ++K +NLYP LITF  +
Sbjct  10    SSMSIVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLYPNLITFHTI  69

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             +IP V+GLPPGAET +D    L   L VA++  + EV+ IL +  KP+LVFYD A WIPE
Sbjct  70    SIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETIL-RTNKPDLVFYDSADWIPE  128

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKG--KGRAVTAADIMEPPPGFPSDSKVVLRE  840
             +   +G KTV +   S    AL+L+ +  +    G+ ++A ++ +PP G+PS SKVVL  
Sbjct  129   IARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSAEELAKPPLGYPS-SKVVLLA  187

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
              EA  +S          + FD  V A++ CDAIA R C E EG +C+YI ++  +PVY  
Sbjct  188   REAKTLSFVWRRHEGIGSFFDGKVTAMRNCDAIAIRTCRETEGKFCDYIESQYNRPVYLT  247

Query  1021  GpllpeppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllgleltglp  1194
             GP+LP     +   + + A WL KF+P SV+FCAFGS+ V+ K +QF +L LGLE TGLP
Sbjct  248   GPVLPVDEPNKTSLEPRWADWLAKFKPGSVVFCAFGSQPVVEKIDQFQELCLGLEATGLP  307

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FLVA+KPP   S++E+ALPEGFQER +G+ +V+GGWV Q MIL H +VG FV+H G GSM
Sbjct  308   FLVAIKPPSGVSTVEEALPEGFQERVRGRGVVYGGWVQQPMILDHPSVGCFVSHCGFGSM  367

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
             WESL S C++++  P   +  LNARLMAEE+E AVEV+ +EN  F + +L +A+KSVMGE
Sbjct  368   WESLMSDCQMVLV-PQHGEQILNARLMAEEMEVAVEVEREENGWFSRRSLEDAVKSVMGE  426

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + NH KWR +L   GFAD YI  F   L EL
Sbjct  427   GSEVGEKVRKNHDKWRCVLSDSGFADGYISKFEQNLTEL  465



>ref|XP_006289841.1| hypothetical protein CARUB_v10003451mg [Capsella rubella]
 gb|EOA22739.1| hypothetical protein CARUB_v10003451mg [Capsella rubella]
Length=447

 Score =   337 bits (865),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 212/456 (46%), Positives = 305/456 (67%), Gaps = 23/456 (5%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             +S  H  MFPW AFGH IPFL LAN LA++GHR++LLLP  A  +L+H NL+P  I F  
Sbjct  2     ESKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTLLLPKKAQKQLEHHNLFPDSIVFHP  61

Query  487   LTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LTIP V GLP GAETT+D ++++   L  AL+  +D+V+A +  + +P+++F+DFA+WIP
Sbjct  62    LTIPPVNGLPAGAETTSDISISMGKFLSEALNLTRDQVEAAVRAL-RPDIIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             EL  E   K+V + + S T  A +L+   + G            PPPG+PS SKV+ RE+
Sbjct  121   ELAEEHMIKSVSYMIVSATDIAHTLVPGGALGV-----------PPPGYPS-SKVLFREN  168

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A+ +   L++   R+  + R+    K CD IA R C EMEG +CNYI+ +  K V   G
Sbjct  169   DAHTLVT-LSIFYERL--YHRITTGFKSCDVIALRTCKEMEGKFCNYISRQYNKKVLLTG  225

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLE++ +++L K+ P SV+FCA GS++VL K+QF +L LG+E+TGLPFLV
Sbjct  226   PMLPEPDTSKPLEERWSQFLSKYPPGSVVFCALGSQIVLEKDQFQELCLGMEMTGLPFLV  285

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             A+KPP  SS+I++ LPEGF+ER KG+ +V GGWV Q +IL H +VG FVNH G G++WE 
Sbjct  286   ALKPPRGSSTIQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGAIWEC  345

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN--  1557
             L S+C++++  P  SD  L  RLM EE E AVEV  ++   F KE+L +AIKSVM ++  
Sbjct  346   LMSNCQMVLI-PFLSDQVLFTRLMTEEFEVAVEVSREKTGWFSKESLSDAIKSVMDKDSD  404

Query  1558  ---IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                + + NH K +++L++PG  D Y+D+ +  L +L
Sbjct  405   IGKLVRSNHAKLKEVLVSPGLLDGYVDNLVEALVDL  440



>ref|XP_004164964.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=462

 Score =   337 bits (865),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 206/470 (44%), Positives = 300/470 (64%), Gaps = 23/470 (5%)
 Frame = +1

Query  298   MMEDSM--LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQL  471
             M+E+S+  LHIAM+PW AFGH IPFLQ+AN LA +GHRIS+ +P+  L +L+H N +P L
Sbjct  1     MVEESLSSLHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNL  60

Query  472   ITFCALTIPQVEGLPPGAETTADTMNLDGS--LEVALDGLQDEVKAILLQMEKPNLVFYD  645
             ITF  +T+P V+GLPPGA+TTAD  +      L +++D  + E+ A  LQ  KPN++FYD
Sbjct  61    ITFVLITVPHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEI-ASCLQDIKPNVIFYD  119

Query  646   FAYWIPELVSEMGCKTVKFTVFSPTISALSLITSKSK----GKGRAVTAADIMEPPPGFP  813
             FAYW+ +L  +MG  ++ + V    +SA+++   + K         +T  D M+PPPGFP
Sbjct  120   FAYWVTKLADQMGITSIYYNV----VSAVTIGYVQGKIWELSGHDTLTQDDFMQPPPGFP  175

Query  814   SDSKVVLREHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIA  990
             S S + L  HEA   +   +L   N I +FD+   +   C+A+A ++C E+EG +  YI 
Sbjct  176   SSS-IKLHAHEAQNFASLSHLRFSNGIALFDQFSTSFTNCNALALKSCREIEGPFIGYIE  234

Query  991   TELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlll  1170
              EL KPV  +G +  EP       ++  +WL KF   SVI+CAFGSE +L K QF +LLL
Sbjct  235   NELKKPVLLSGAVDLEPLTTSLE-ERWEKWLAKFHSGSVIYCAFGSECILTKIQFQELLL  293

Query  1171  gleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFV  1350
             GLEL+ LPFL  +KPPE   ++E ALPEGF++R +G+ +V+GGWV Q  IL H ++G FV
Sbjct  294   GLELSNLPFLAVLKPPEGIDTVEAALPEGFEQRIEGRGVVYGGWVQQQQILEHPSIGCFV  353

Query  1351  NHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLC  1527
              H G+GS+ E+L   C++++  P+ SD+   AR ++  L+  VEV+  E D FF KE++C
Sbjct  354   THCGAGSLNEALVRKCQLVLL-PHVSDHFFRARTLSSHLKVGVEVEKREEDGFFSKESVC  412

Query  1528  NAIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSV  1662
              A+K+VM E  +     + N  K R+LL+     ++YI++FIHKL  L V
Sbjct  413   KAVKTVMDEENESGKEVRANIAKLRELLVDKDLEESYINNFIHKLRSLIV  462



>gb|KDP36254.1| hypothetical protein JCGZ_09819 [Jatropha curcas]
Length=442

 Score =   337 bits (863),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 209/438 (48%), Positives = 292/438 (67%), Gaps = 12/438 (3%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             ++S+ HI MFPW A GH  PFL L+N LA++G   + LLP  A+ +LKH NLYP LI F 
Sbjct  6     KNSIFHIVMFPWFAVGHMTPFLHLSNRLAEKGLSTTFLLPNKAIQQLKHFNLYPDLIAFH  65

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
             +L IP V+GLP G ET +D  ++L   L +A+D  +D+V+ ++ + +KP LV YD A+WI
Sbjct  66    SLIIPPVDGLPAGTETASDIPIHLTHFLTIAMDRTRDQVEKVIHE-KKPKLVIYDVAHWI  124

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             PE+   +G K + +TV S    A+ L  ++     + +T A++  PP G+PS S VVLR 
Sbjct  125   PEITKSVGIKAINYTVVSAASLAIVLNPARKVTLEKPITEAELAVPPSGYPS-STVVLRR  183

Query  841   HEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
             HE   +  F++ P    IT ++R+  A+K  DA+A R C+E EG +C+YI ++  KPV+ 
Sbjct  184   HEVRSL-LFVSYPFGEGITFYERITNAMKESDALAIRTCHETEGKFCDYIGSQYKKPVFL  242

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
              GP++PEP +     ++  +WL  FE +SVIFCAFGS++VL KEQF +L+LG EL GLPF
Sbjct  243   TGPVIPEPGKAPLE-ERWNKWLNGFEKDSVIFCAFGSQIVLEKEQFQELVLGFELAGLPF  301

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             LVA+KPP   S++E+ALPEGF++R KG+ I+ G WV Q  IL H +VG FVNH G GSMW
Sbjct  302   LVAIKPPAGISTVEEALPEGFEKRVKGRGIICGEWVQQLKILDHPSVGCFVNHCGFGSMW  361

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN  1557
             E+L S+C++++  P+  D  LN R MAEEL+ AVEV+ DEN  F KENL  AIKSVM + 
Sbjct  362   EALMSNCQVVLV-PHLGDQILNTRFMAEELKVAVEVERDENGWFSKENLSQAIKSVMDKE  420

Query  1558  IQ-----KVNHKKWRDLL  1596
              +     K NH KWR+ +
Sbjct  421   SEVGLMVKKNHNKWRETM  438



>ref|NP_194487.1| UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 sp|Q9T081.1|U79B3_ARATH RecName: Full=UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 emb|CAB38269.1| UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB81407.1| UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 dbj|BAC43080.1| putative UDP rhamnose--anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AAO63434.1| At4g27570 [Arabidopsis thaliana]
 gb|AEE85358.1| UDP-glycosyltransferase 79B3 [Arabidopsis thaliana]
 gb|AHL38673.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=453

 Score =   337 bits (864),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 207/457 (45%), Positives = 296/457 (65%), Gaps = 26/457 (6%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H+ M+PW A GH  PFL LAN LA++GH ++ LLP  +L +L+H NL+P  I F ++T+
Sbjct  6     FHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLLPKKSLKQLEHFNLFPHNIVFRSVTV  65

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP G ET ++  +     L  A+D  +D+V+A++  +E P+L+F+DFA+WIPE+ 
Sbjct  66    PHVDGLPVGTETASEIPVTSTDLLMSAMDLTRDQVEAVVRAVE-PDLIFFDFAHWIPEVA  124

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              + G KTVK+ V S +  A  L           V   ++  PPPG+PS SKV+LR+ +AY
Sbjct  125   RDFGLKTVKYVVVSASTIASML-----------VPGGELGVPPPGYPS-SKVLLRKQDAY  172

Query  853   QVSRFLNLPRNRITV----FDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
              + +    P N I V     +RV  +L   D IA R   E+EG++C+YI     K V   
Sbjct  173   TMKKLE--PTNTIDVGPNLLERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLT  230

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+ PEP +   LE++  +WL  +EP+SV+FCA GS+V+L K+QF +L LG+ELTG PFL
Sbjct  231   GPVFPEPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFL  290

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAVKPP  SS+I++ALPEGF+ER KG+ +V GGWV Q +IL H +VG FV+H G GSMWE
Sbjct  291   VAVKPPRGSSTIQEALPEGFEERVKGRGLVWGGWVQQPLILSHPSVGCFVSHCGFGSMWE  350

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             SL S C+I++  P   D  LN RL+++EL+ +VEV  +E   F KE+LC+A+ SVM    
Sbjct  351   SLLSDCQIVLV-PQLGDQVLNTRLLSDELKVSVEVAREETGWFSKESLCDAVNSVMKRDS  409

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                N+ + NH KWR+ + +PG    Y+D+F+  L +L
Sbjct  410   ELGNLVRKNHTKWRETVASPGLMTGYVDAFVESLQDL  446



>gb|AEM37036.1| UDP-glucose:flavonoid 3-O-glucosyltransferase 1 [Brassica rapa 
subsp. oleifera]
Length=468

 Score =   337 bits (864),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 224/459 (49%), Positives = 300/459 (65%), Gaps = 13/459 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S + I M+PWLAFGH   FL L+N LA++GH I  LLP  AL ++K +NLYP LITF  +
Sbjct  10    SSMSIVMYPWLAFGHMTAFLHLSNKLAEKGHEIVFLLPKKALDQVKPLNLYPNLITFHTI  69

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             +IP V+GLPPGAET +D    L   L VA++  + EV+ IL +  KP+LVFYD A WIPE
Sbjct  70    SIPHVKGLPPGAETNSDVPFFLTHLLAVAMNQTRPEVETIL-RTNKPDLVFYDSADWIPE  128

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKG--KGRAVTAADIMEPPPGFPSDSKVVLRE  840
             +   +G KTV +   S    AL+L+ +  +    G+ ++  ++ +PP G+PS SKVVL  
Sbjct  129   IARPVGAKTVCYNTVSAASIALTLVPAAEREIIDGKEMSGEELAKPPLGYPS-SKVVLLA  187

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
              EA  +S          + FD  V A++ CDAIA R C E EG +C+YI ++  +PVY  
Sbjct  188   REAKTLSFVWRRHEGIGSFFDGKVTAMRNCDAIAIRTCRETEGKFCDYIESQYNRPVYLT  247

Query  1021  GpllpeppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllgleltglp  1194
             GP+LP     +   + + A WL KF+P SV+FCAFGS+ V+ K +QF +L LGLE TGLP
Sbjct  248   GPVLPVDEPNKTSLEPRWADWLAKFKPGSVVFCAFGSQPVVEKIDQFQELCLGLEATGLP  307

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FLVA+KPP   S++E+ALPEGFQER +G+ +V+GGWV Q MIL H +VG FV+H G GSM
Sbjct  308   FLVAIKPPSGVSTVEEALPEGFQERVRGRGVVYGGWVQQPMILDHPSVGCFVSHCGFGSM  367

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
             WESL S C++++  P   +  LNARLMAEE+E AVEV+ +EN  F + +L +A+KSVMGE
Sbjct  368   WESLMSDCQMVLV-PQHGEQILNARLMAEEMEVAVEVEREENGWFSRRSLEDAVKSVMGE  426

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + NH KWR +L   GFAD YI  F   L EL
Sbjct  427   GSEVGEKVRKNHDKWRCVLSDSGFADGYISKFEQNLTEL  465



>ref|XP_002522508.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF39808.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=457

 Score =   336 bits (861),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 203/460 (44%), Positives = 292/460 (63%), Gaps = 13/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M +   HI M+PW A GH   FL L+N LA+RGH+IS LLP+  + K +  NL+P LI F
Sbjct  1     MGEETFHIVMYPWFALGHLTSFLHLSNKLAERGHKISFLLPSKTIKKFQPFNLHPDLIIF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P V+GLPPG+ETT D   +L   L  A+D L + V    L   KPN VF+DF +W
Sbjct  61    IPVTVPHVDGLPPGSETTTDVPFSLHSLLMTAMD-LTESVIEFHLTNLKPNFVFFDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K+V +   SP      LI+ + K   +++TAAD+M+PP  FP  S + LR
Sbjct  120   LPALCRKLGVKSVHYCTISPATVGY-LISPERKLLEKSLTAADLMKPPLNFPPSS-IKLR  177

Query  838   EHEAYQVSRFLNLPR-NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HEA  ++     P  + I+  +R + +   CDAI+F+ C EMEG YC+Y+  + GKPV 
Sbjct  178   AHEAQGLAAVTTKPYGSSISFLERQLHSFNECDAISFKTCMEMEGPYCHYVERQFGKPVI  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              AG  +        L++KI+  L+  E   V+FCAFGSE +L K Q  +L+LGLELTGLP
Sbjct  238   LAG-PVVPKSPSSVLDEKISNMLDNSEAGKVVFCAFGSECILKKNQLQELVLGLELTGLP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL A+KPP  + +IE ALPEGF+ER KGK  V+GGWV Q +IL+H +VG F+ H GSGS+
Sbjct  297   FLAALKPPMGAETIESALPEGFEERVKGKGYVYGGWVQQQLILKHPSVGCFITHCGSGSL  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMG  1551
              E++ + C++++  PN  D  +NARLM  +L+  VEV+  E D  F K+ +  A+K+VM 
Sbjct  357   SEAMVNKCQLVLL-PNVGDQIINARLMDGDLKIGVEVEKGEEDGLFTKDGVRKAVKAVMD  415

Query  1552  ENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             ++ +     + NH KWR+ LL+ G  ++YID+F++KL+ L
Sbjct  416   DDSEVGKEVRTNHMKWREFLLSKGLENSYIDAFVNKLHAL  455



>ref|XP_010482811.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like 
[Camelina sativa]
Length=468

 Score =   336 bits (862),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 222/460 (48%), Positives = 299/460 (65%), Gaps = 15/460 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S + I M+PWLAFGH  PFL L+N LA++GH+I  LLP  AL +L+ +NLYP LITF  +
Sbjct  10    SSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALTQLEPLNLYPNLITFHTI  69

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             +IPQV+GLPPGAET +D    L   L VA++  + EV+ I   + KP+LVF+D A WIPE
Sbjct  70    SIPQVKGLPPGAETNSDVPYFLTYLLRVAMNQTRPEVETIFHTI-KPDLVFFDTADWIPE  128

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKG--KGRAVTAADIMEPPPGFPSDSKVVLRE  840
             +   +G KTV F + S    ALSL+ +  +    G  ++  ++ + P G+PS SKVVLR 
Sbjct  129   VAKPVGAKTVCFNIVSAAAIALSLVPAAERKVIDGNEMSGEELAKTPLGYPS-SKVVLRA  187

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             HEA  ++            FD  V  ++ CDAIA R C E EG +C+YI+++  KPVY  
Sbjct  188   HEAKTLNFMWKKREGTACFFDVKVTTMRNCDAIAIRTCRETEGKFCDYISSQYNKPVYLT  247

Query  1021  GpllpeppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGK-EQFHQlllgleltglp  1194
             GP+LP       L + +   WL KF P SV+FCAFGS+ V+ K +QF +L LGLE TGLP
Sbjct  248   GPVLPGTKPNHHLLESRWVEWLAKFNPGSVVFCAFGSQPVVDKIDQFQELFLGLESTGLP  307

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL+A+KPP   S++E+ALPEGF+ER +G+ IV GGW+ Q ++L H +VG FV+H G G M
Sbjct  308   FLIAIKPPTGVSTVEEALPEGFEERVQGRGIVFGGWIQQPLVLDHPSVGCFVSHCGFGPM  367

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM--  1548
             WESL S C+I++  P   +  LNARLM EE+E AVEV+ +EN  F + +L NA+KSVM  
Sbjct  368   WESLMSDCQIVLV-PQHGEQILNARLMTEEMEVAVEVEREENGWFSRRSLENAVKSVMEE  426

Query  1549  ----GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                 GE ++K NH KW+ +L   GFAD YID F   L +L
Sbjct  427   GSEVGEKVRK-NHDKWKCVLAESGFADGYIDKFEQSLIDL  465



>ref|XP_008355387.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Malus domestica]
Length=460

 Score =   336 bits (861),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 207/461 (45%), Positives = 291/461 (63%), Gaps = 11/461 (2%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M E S  H+AMFPWLA GH  P++ L+N+LA RGHR++LL+P  A+L+L+H+N +P LIT
Sbjct  1     MAEPSSFHLAMFPWLAMGHITPYVHLSNELAARGHRVTLLVPKKAILQLEHLNHHPNLIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  +T+P   GLP G E  ++  ++    L  A+D  +D+++   L   KP+ V YD A+
Sbjct  61    FSPVTVPHFNGLPEGTEIASEIPIHNIHFLAAAMDLTRDQIEH-FLSANKPDFVLYDAAH  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W+PE+  + G K+V + V      A++L+ ++   K R +TA ++  PP G+PS + VVL
Sbjct  120   WVPEIARKNGIKSVCYNVVCAAALAIALVPARQVPKDRPITAKELGVPPAGYPS-TTVVL  178

Query  835   REHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
             + HEA  ++       + I  +DR +  +K CDA++ R C E+EG  C+Y+  +  +PV 
Sbjct  179   QGHEARSLTFITEPFGDGIRFYDRTIICMKECDALSIRTCRELEGDMCDYMEDQYKRPVL  238

Query  1015  CAG--pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
               G    L      E LED+ A+W   FE  SV+FCAFGS+ VL K QF +L+LG ELTG
Sbjct  239   LTGPVLGLGSDNNTEQLEDRWAKWFAGFEAGSVVFCAFGSQWVLEKSQFQELVLGFELTG  298

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPF VA+KPP    +IE+ALPEGF+ER KG+ +V G WV Q++IL H AVG FVNH G G
Sbjct  299   LPFFVALKPPLGCETIEEALPEGFEERVKGRGVVVGSWVQQTLILNHPAVGCFVNHCGFG  358

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM  1548
             SMWESL S  +I++  P+  D  LN +L+ ++LE AVEV  +E+  F KE+L  AI SVM
Sbjct  359   SMWESLMSDKQIVLV-PHLGDQILNTKLLVKKLEVAVEVGREESGWFSKESLSKAIXSVM  417

Query  1549  GENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              +  +     K NH KW + L TPGF   YID F+ KL EL
Sbjct  418   DKESEVGVMVKKNHAKWMETLXTPGFMSGYIDRFVQKLKEL  458



>ref|XP_009339314.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Pyrus x bretschneideri]
Length=464

 Score =   335 bits (860),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 205/457 (45%), Positives = 291/457 (64%), Gaps = 11/457 (2%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H+AMFPWLA GH  P++ L+N+LA RGHR++LL+P  A+L+L+H+N +P LITF  +
Sbjct  9     SSFHLAMFPWLAMGHITPYVHLSNELAARGHRVTLLVPKKAILQLEHLNHHPNLITFSPV  68

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P  +GLP G E  ++  ++    L  A+D  +D+++   L   KP+ V YD A+W+PE
Sbjct  69    TVPHFDGLPEGTEIASEIPIHNIHFLAAAMDLTRDQIEH-FLSANKPDFVLYDAAHWVPE  127

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  + G K+V + V      A++L+ ++   K R +TA ++  PP G+PS + VVL+ HE
Sbjct  128   IARKNGIKSVCYNVVCAAALAIALVPARQVPKARPITAKELGVPPAGYPS-TTVVLQGHE  186

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG-  1023
             A  ++       + I  +DR +  +K CDA++ R C E+EG  C+Y+  +  +PV   G 
Sbjct  187   ARSLTFITEPFGDGIRFYDRTIICMKECDALSIRTCRELEGDMCDYMEDQYKRPVLLTGP  246

Query  1024  -pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
                L      E LED+ A+W   FE  S++FCAFGS+ VL K QF +L+LG ELTGLPF 
Sbjct  247   VLGLGSDNNTEQLEDRWAKWFAGFEAGSMVFCAFGSQWVLEKSQFQELVLGFELTGLPFF  306

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VA+KPP    +IE+ALPEGF+ER KG+ +V G WV Q++IL H AVG FVNH G GSMWE
Sbjct  307   VALKPPLGCETIEEALPEGFEERVKGRGVVVGSWVQQTLILNHPAVGCFVNHCGFGSMWE  366

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENI  1560
             SL S  +I++  P+  D  LN +L+ ++LE AVEV  +E+  F KE+L  A+KSVM E  
Sbjct  367   SLMSDKQIVLV-PHLGDQILNTKLLVKKLEVAVEVGREESGWFSKESLSKAVKSVMDEES  425

Query  1561  Q-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             +     K NH KW + L TPGF   YID F+ KL EL
Sbjct  426   EVGVMVKKNHAKWMEALTTPGFMSGYIDRFVQKLKEL  462



>ref|XP_010442976.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X1 [Camelina 
sativa]
Length=447

 Score =   334 bits (857),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 209/457 (46%), Positives = 303/457 (66%), Gaps = 19/457 (4%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             +S  H  MFPW  FGH   FL LAN LA++GH+I+ LLP  AL +LK +N++P  I F  
Sbjct  2     ESKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLKPLNIFPDCIVFHT  61

Query  487   LTIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LTIP V+GLP GAETT+D     GS L  A+D  +++V+  +  + KP+L+F+DFA+WIP
Sbjct  62    LTIPSVDGLPAGAETTSDIPISSGSFLASAMDQTRNQVEEAV-SIGKPDLIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E G K+V F   S    A+S +  +S          D+  PPPG+PS SKV+LR  
Sbjct  121   EIARECGAKSVNFITISAACVAISFVPGRSPD--------DLAVPPPGYPS-SKVLLRRQ  171

Query  844   EAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             E    S FL+ P  +  T ++R++  LK CD I+ R C EMEG +C++I ++  + V   
Sbjct  172   ETNCFS-FLSHPFGDNTTFYERIMIGLKNCDVISIRTCREMEGKFCDFIQSQFQREVLLT  230

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+LPEP   +PLED+  +WL +FEP SV++CA GS+++L K+QF +L LG+ELTGLPFL
Sbjct  231   GPMLPEPYNSKPLEDQWRQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFL  290

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAVKPP+ SS+I++ALP GF+ER KG+ +V GGWV Q +IL H ++G FV+H G GSMWE
Sbjct  291   VAVKPPKGSSTIQEALPNGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWE  350

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-  1557
             +L + C+ +   P+  +   N RLM+EELE +VEV+ +++  F KE+L  +I+SVM ++ 
Sbjct  351   ALVNDCQTVFI-PHLGEQIFNTRLMSEELEVSVEVKREDSGWFSKESLSGSIRSVMDKDS  409

Query  1558  ----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                 + + NH KW++ L++ G  + Y++ FI  L +L
Sbjct  410   ELGYLVRRNHAKWKESLVSTGLMNGYVNKFIEALQKL  446



>ref|XP_002867497.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43756.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   334 bits (857),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 208/453 (46%), Positives = 292/453 (64%), Gaps = 20/453 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H+ M+PW A GH  PFL LAN LA++GH ++ LLP  AL +L+H+NL+P  I F ++TI
Sbjct  6     FHVLMYPWFATGHMTPFLYLANKLAEKGHMVTFLLPKKALKQLEHLNLFPHNIVFRSVTI  65

Query  496   PQVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP G ET ++       L + A+D  +D+V+ +L  +E P+L+F+DFA+WIP++ 
Sbjct  66    PHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEVVLRAVE-PDLIFFDFAHWIPQVA  124

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              ++G KTVK+ V S +  A  L           V   ++  PPPG+PS SKV+LR+ +AY
Sbjct  125   RDLGIKTVKYVVVSASTIASML-----------VPGGELGVPPPGYPS-SKVLLRKQDAY  172

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +            + +RV  +L   D IA R   E+EG++C+YI     K V   GP+ 
Sbjct  173   TMKNLEPTIDAGPNLLERVTTSLMNSDVIAIRTVREIEGNFCDYIEKHCRKKVLLTGPMF  232

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP +   LE++  +WL  +EP+SV+FCA G++V+L K+QF +L LG+ELTG PFLVAVK
Sbjct  233   PEPDKTRELEERWVKWLSGYEPDSVVFCALGTQVILEKDQFQELCLGMELTGSPFLVAVK  292

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS+IE+ALPEGF+ER KG+ +V GGWV Q +IL H +VG FV+H G GSMWESL S
Sbjct  293   PPRGSSTIEEALPEGFKERVKGRGVVWGGWVQQPLILSHPSVGCFVSHCGFGSMWESLLS  352

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P   D  LN RLM++EL+ +VEV  +E   F KE+L +AI SVM       N
Sbjct  353   DCQIVLV-PQLGDQVLNTRLMSDELKVSVEVVREETGWFSKESLRDAINSVMKRDSEIGN  411

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + K NH KWR+ L +PG    Y+D+FI  L +L
Sbjct  412   LVKKNHTKWRETLASPGLLSGYVDNFIESLQDL  444



>ref|XP_010433351.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B3-like 
[Camelina sativa]
Length=453

 Score =   334 bits (856),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 211/464 (45%), Positives = 297/464 (64%), Gaps = 30/464 (6%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M  S  H  M+PW A GH  PFL  AN LA+RGH ++ LLP  AL +L+H+NL+P  I F
Sbjct  1     MGRSRFHALMYPWFATGHMTPFLYPANKLAERGHMVTFLLPKKALKQLEHLNLFPHNIVF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
              ++T+P V+GLP G ET ++  ++    L  A+D  +D+V+ ++  +E P+L+F+DFA+W
Sbjct  61    RSVTVPHVDGLPLGTETASEIPVSTTDLLMSAMDLTRDQVEVVVRAVE-PDLIFFDFAHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             IPE+  + G KTVK+ V S +  A              V   ++  PPPG+PS +KV+LR
Sbjct  120   IPEVARDFGLKTVKYVVVSASTIA-----------NMVVPGGELGVPPPGYPS-TKVLLR  167

Query  838   EHEAYQVSRFLNLPRNRITV----FDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGK  1005
             + +AY + +    P + I V    F+RV  +L  CD +A R   E+EG++C+YI     K
Sbjct  168   KQDAYTMKK----PDHTIDVGPNFFERVTTSLLNCDVVAIRTAREIEGNFCDYIEKHCRK  223

Query  1006  PVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglelt  1185
              V   G L PEP +   LE++  +WL  FEP SV+FCA GS+V+L K+QF +L LG+ELT
Sbjct  224   KVLLTGTLFPEPDKTIQLEERWVKWLSGFEPESVVFCALGSQVILEKDQFQELCLGMELT  283

Query  1186  glpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGS  1365
             G PFLVAVKPP  SS++++ALPEGF+ER KG+ +V GGWV Q +IL H +VG FV+H G 
Sbjct  284   GSPFLVAVKPPRGSSTVQEALPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVSHCGF  343

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEV--QTDENDKFFKENLCNAIK  1539
             GSMWESL S C+I++  P   D  LN RL+++EL+ +VEV  +  E   F KE+L +AI 
Sbjct  344   GSMWESLLSDCQIVLV-PQLVDQVLNTRLLSDELKVSVEVVRENTETGWFSKESLRDAIN  402

Query  1540  SVMGE-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             SVM +     N+ K NH KWR+ L +PGF  +Y+D FI  L +L
Sbjct  403   SVMNKDSEIGNLVKKNHTKWRETLASPGFMTDYVDKFIESLKDL  446



>ref|XP_008371430.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=459

 Score =   334 bits (856),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 215/463 (46%), Positives = 290/463 (63%), Gaps = 17/463 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M D  LH+AM+PW A GH I FL   N LA+RGHRIS  +P   L KL+  NLYP  I F
Sbjct  1     MGDKKLHVAMYPWFAMGHLIAFLHTCNKLAERGHRISFFVPVQTLQKLQAFNLYPDRIAF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P V+GLPPG ETT D    L   L  A+D  +  V   L ++ KP+ VF+DF +W
Sbjct  61    IPINVPHVDGLPPGTETTTDVPFPLHSLLMTAMDLTRPAVGQALREL-KPDFVFFDFTHW  119

Query  658   IPELVSE--MGCKTVKFTVFSP-TISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKV  828
             +PEL+ E  MG K++ + + SP TI  LS  T +     +  TAAD+M PPP FP+ S +
Sbjct  120   MPELLHELDMGIKSIHYCIISPATIGYLS--TPERNPTEKLPTAADLMLPPPSFPASS-I  176

Query  829   VLREHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGK  1005
              LR HEA  +   L     R +T   R   +   CDAIAF+ C EMEG Y +YI T+  K
Sbjct  177   TLRTHEARGLVAVLLKEFGRGMTFMQRQFLSFSGCDAIAFKTCREMEGPYSDYIETQYKK  236

Query  1006  PVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglelt  1185
             PV  AG ++PE    E   +K A+WLE FE  S+I+CAFGSE +L  +QF +LLLG ELT
Sbjct  237   PVILAGSVVPETSTTELD-EKWAKWLEGFEAKSMIYCAFGSECILKIDQFQELLLGFELT  295

Query  1186  glpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGS  1365
             GLPF  A+KPP  + SIE ALPEGF+ERT+G+ +V+GGWV Q + LRH +VG FV H GS
Sbjct  296   GLPFFAALKPPMGAESIESALPEGFEERTRGRGVVYGGWVQQPLFLRHPSVGCFVTHCGS  355

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKS  1542
             GS+ E+L + C++++  PN  D  +NAR+M  +L+  VEV+  + D  F KE +  A+++
Sbjct  356   GSLSEALVNECQLVLL-PNVGDQIINARMMGCDLKVGVEVEKRDLDGLFTKEGVAKAVEA  414

Query  1543  VM---GENIQKV--NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             VM   GE  ++V  NH KWR+     G  ++Y+DSF  KL++L
Sbjct  415   VMEDGGELAEEVRSNHAKWREFFSGQGLGNSYLDSFEQKLHKL  457



>gb|KGN43487.1| hypothetical protein Csa_7G041320 [Cucumis sativus]
Length=473

 Score =   334 bits (856),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 205/470 (44%), Positives = 299/470 (64%), Gaps = 23/470 (5%)
 Frame = +1

Query  298   MMEDSM--LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQL  471
             M+E+S+  LHIAM+PW AFGH IPFLQ+AN LA +GHRIS+ +P+  L +L+H N +P L
Sbjct  12    MVEESLSSLHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNL  71

Query  472   ITFCALTIPQVEGLPPGAETTADTMNLDGS--LEVALDGLQDEVKAILLQMEKPNLVFYD  645
             ITF  +T+P V+GLPPGA+TTAD  +      L +++D  + E+ A  LQ  KPN++FYD
Sbjct  72    ITFVLITVPHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEI-ASCLQDIKPNVIFYD  130

Query  646   FAYWIPELVSEMGCKTVKFTVFSPTISALSLITSKSK----GKGRAVTAADIMEPPPGFP  813
             FAYW+ +L  +MG  ++ + V    +SA+++   + K         +T  D M+PPPGFP
Sbjct  131   FAYWVTKLADQMGITSIYYNV----VSAVTVGYVQGKIWELSGHDTLTQDDFMQPPPGFP  186

Query  814   SDSKVVLREHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIA  990
             S S + L  HEA   +   +L   N I +FD+   +   C+A+A ++C E+EG +  YI 
Sbjct  187   SSS-IKLHAHEAQNFASLSHLRFSNGIALFDQFSTSFTNCNALALKSCREIEGPFIGYIE  245

Query  991   TELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlll  1170
              EL K V  +G +  EP       ++  +WL KF   SVI+CAFGSE +L K QF +LLL
Sbjct  246   NELKKHVLLSGAVDLEPLTTSLE-ERWEKWLAKFHSGSVIYCAFGSECILTKIQFQELLL  304

Query  1171  gleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFV  1350
             GLEL+ LPFL  +KPPE   ++E ALPEGF++R +G+ +V+GGWV Q  IL H ++G FV
Sbjct  305   GLELSNLPFLAVLKPPEGIDTVEAALPEGFEQRIEGRGVVYGGWVQQQQILEHPSIGCFV  364

Query  1351  NHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLC  1527
              H G+GS+ E+L   C++++  P+ SD+   AR ++  L+  VEV+  E D FF KE++C
Sbjct  365   THCGAGSLNEALVRKCQLVLL-PHVSDHFFRARTLSSHLKVGVEVEKREEDGFFSKESVC  423

Query  1528  NAIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSV  1662
              A+K+VM E  +     + N  K R+LL+     ++YI++FIHKL  L V
Sbjct  424   KAVKTVMDEENESGKEVRANIAKLRELLVDKDLEESYINNFIHKLRSLIV  473



>ref|XP_004144601.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=462

 Score =   333 bits (854),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 205/470 (44%), Positives = 299/470 (64%), Gaps = 23/470 (5%)
 Frame = +1

Query  298   MMEDSM--LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQL  471
             M+E+S+  LHIAM+PW AFGH IPFLQ+AN LA +GHRIS+ +P+  L +L+H N +P L
Sbjct  1     MVEESLSSLHIAMYPWFAFGHMIPFLQIANKLANKGHRISIFIPSKTLPELQHFNHFPNL  60

Query  472   ITFCALTIPQVEGLPPGAETTADTMNLDGS--LEVALDGLQDEVKAILLQMEKPNLVFYD  645
             ITF  +T+P V+GLPPGA+TTAD  +      L +++D  + E+ A  LQ  KPN++FYD
Sbjct  61    ITFVLITVPHVDGLPPGAQTTADISHPSQLPLLMISMDLTEPEI-ASCLQDIKPNVIFYD  119

Query  646   FAYWIPELVSEMGCKTVKFTVFSPTISALSLITSKSK----GKGRAVTAADIMEPPPGFP  813
             FAYW+ +L  +MG  ++ + V    +SA+++   + K         +T  D M+PPPGFP
Sbjct  120   FAYWVTKLADQMGITSIYYNV----VSAVTVGYVQGKIWELSGHDTLTQDDFMQPPPGFP  175

Query  814   SDSKVVLREHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIA  990
             S S + L  HEA   +   +L   N I +FD+   +   C+A+A ++C E+EG +  YI 
Sbjct  176   SSS-IKLHAHEAQNFASLSHLRFSNGIALFDQFSTSFTNCNALALKSCREIEGPFIGYIE  234

Query  991   TELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlll  1170
              EL K V  +G +  EP       ++  +WL KF   SVI+CAFGSE +L K QF +LLL
Sbjct  235   NELKKHVLLSGAVDLEPLTTSLE-ERWEKWLAKFHSGSVIYCAFGSECILTKIQFQELLL  293

Query  1171  gleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFV  1350
             GLEL+ LPFL  +KPPE   ++E ALPEGF++R +G+ +V+GGWV Q  IL H ++G FV
Sbjct  294   GLELSNLPFLAVLKPPEGIDTVEAALPEGFEQRIEGRGVVYGGWVQQQQILEHPSIGCFV  353

Query  1351  NHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLC  1527
              H G+GS+ E+L   C++++  P+ SD+   AR ++  L+  VEV+  E D FF KE++C
Sbjct  354   THCGAGSLNEALVRKCQLVLL-PHVSDHFFRARTLSSHLKVGVEVEKREEDGFFSKESVC  412

Query  1528  NAIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSV  1662
              A+K+VM E  +     + N  K R+LL+     ++YI++FIHKL  L V
Sbjct  413   KAVKTVMDEENESGKEVRANIAKLRELLVDKDLEESYINNFIHKLRSLIV  462



>emb|CAN63797.1| hypothetical protein VITISV_026414 [Vitis vinifera]
Length=443

 Score =   332 bits (851),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 294/439 (67%), Gaps = 18/439 (4%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M +   LHIAMFPW AFGH IP+L L+N+LA RGH+I+ +LP  A  KL+H+N +P LIT
Sbjct  1     MAKSPKLHIAMFPWXAFGHMIPYLNLSNELAGRGHKITFILPRKAQSKLQHLNFHPALIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  L +P V+GLPPG ET +D  ++L   L  ALD  +D+V+A L  +  P+L+FYDFAY
Sbjct  61    FHPLIVPHVDGLPPGTETASDIPVSLTYLLATALDRTRDQVEAALRTL-NPHLLFYDFAY  119

Query  655   WIPELVSEMGCKTVKFT-VFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             W P L S++G K++ ++ V +  ++ + +   +     R +T  D+  PPPG+PS S VV
Sbjct  120   WAPALASQLGIKSIYYSAVCAAAVAHIPIPAQQGSKDCRQLT--DV--PPPGYPS-STVV  174

Query  832   LREHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             LR HEA ++  F+  P    IT   RV  A  R DAI+ R C E +G  C+YI ++ GKP
Sbjct  175   LRPHEA-RLMDFMFAPYGEGITFQQRVTTARARGDAISIRTCQETDGPICDYIGSQYGKP  233

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V+  G  +   P  EPLED+ A+WL  F+P SVIFCAFGS+ V  K+QF +LLLGLELTG
Sbjct  234   VFLTG-PVLPKPSVEPLEDRWAQWLGGFKPGSVIFCAFGSQNVHEKDQFQELLLGLELTG  292

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGG-WVPQSMILRHKAVGYFVNHGGS  1365
             LPF  AVKP    ++IE+ALPEGFQER  G+ +VHGG WV Q  +L H +VG FV+H G 
Sbjct  293   LPFFAAVKPRTGVATIEEALPEGFQERVGGRGLVHGGWWVQQPSVLSHPSVGCFVSHCGY  352

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSV  1545
             GSMWESL S  +I++  P  +D  LN+RL+AEEL+ AVEV+ +EN  F KE+LC+AIKSV
Sbjct  353   GSMWESLTSDPQIVLV-PELADQILNSRLLAEELKVAVEVEREENGLFSKESLCDAIKSV  411

Query  1546  MGEN-----IQKVNHKKWR  1587
             M EN     + K NH KW+
Sbjct  412   MDENSEVGGLVKKNHAKWK  430



>ref|NP_200212.1| UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 sp|Q9FN26.1|U79B6_ARATH RecName: Full=UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 dbj|BAB10731.1| flavonol 3-O-glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAV84494.1| At5g54010 [Arabidopsis thaliana]
 gb|AAW30019.1| At5g54010 [Arabidopsis thaliana]
 gb|AED96438.1| UDP-glycosyltransferase 79B6 [Arabidopsis thaliana]
 gb|AHL38580.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=453

 Score =   332 bits (850),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 211/456 (46%), Positives = 297/456 (65%), Gaps = 19/456 (4%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  MFPW  FGH   FL LAN LA++ H+I+ LLP  A  +L+ +NL+P  I F  L
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKDHKITFLLPKKARKQLESLNLFPDCIVFQTL  62

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             TIP V+GLP GAETT+D  ++L   L  A+D  + +VK  +  + KP+L+F+DFA+WIPE
Sbjct  63    TIPSVDGLPDGAETTSDIPISLGSFLASAMDRTRIQVKEAV-SVGKPDLIFFDFAHWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G K+V F   S    A+S +  +S+         D+   PPG+PS SKV+LR HE
Sbjct  122   IAREYGVKSVNFITISAACVAISFVPGRSQD--------DLGSTPPGYPS-SKVLLRGHE  172

Query  847   AYQVSRFLNLPRNRITVF-DRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                +S FL+ P    T F +R++  LK CD I+ R C EMEG +C++I  +  + V   G
Sbjct  173   TNSLS-FLSYPFGDGTSFYERIMIGLKNCDVISIRTCQEMEGKFCDFIENQFQRKVLLTG  231

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLED+  +WL KF+P SVI+CA GS+++L K+QF +L LG+ELTGLPFLV
Sbjct  232   PMLPEPDNSKPLEDQWRQWLSKFDPGSVIYCALGSQIILEKDQFQELCLGMELTGLPFLV  291

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+ SS+I++ALP+GF+ER K + +V GGWV Q +IL H ++G FV+H G GSMWE+
Sbjct  292   AVKPPKGSSTIQEALPKGFEERVKARGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWEA  351

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE---  1554
             L + C+I+   P+  +  LN RLM+EEL+ +VEV+ +E   F KE+L  A++SVM     
Sbjct  352   LVNDCQIVFI-PHLGEQILNTRLMSEELKVSVEVKREETGWFSKESLSGAVRSVMDRDSE  410

Query  1555  --NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               N  + NH KW++ LL  G    Y++ F+  L +L
Sbjct  411   LGNWARRNHVKWKESLLRHGLMSGYLNKFVEALEKL  446



>ref|XP_010448113.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X1 [Camelina 
sativa]
 ref|XP_010448114.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X1 [Camelina 
sativa]
 ref|XP_010448115.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X2 [Camelina 
sativa]
 ref|XP_010448116.1| PREDICTED: UDP-glycosyltransferase 79B3-like isoform X3 [Camelina 
sativa]
Length=453

 Score =   331 bits (848),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 211/463 (46%), Positives = 295/463 (64%), Gaps = 28/463 (6%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M  S  H  M+PW A GH  PFL LAN LA++GH ++ LLP  AL +L+H+NL+P  I F
Sbjct  1     MGSSRFHALMYPWFAAGHITPFLYLANKLAEKGHMVTFLLPKKALKQLEHLNLFPHNIVF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P V+GLP G ET ++  ++ +  L  A+D  +D+V+A++  +E P+L+F+DFA+W
Sbjct  61    RFVTVPHVDGLPIGTETASEIPVSTNNLLMSAMDLTRDQVEAVVRAVE-PDLIFFDFAHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             IPE+  + G KTVK+ V S +  A  L           V   ++  PPPG+PS SKV+LR
Sbjct  120   IPEVARDFGLKTVKYVVVSASTVASIL-----------VPGGELGVPPPGYPS-SKVLLR  167

Query  838   EHEAYQVSRFLNLPRNRITV----FDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGK  1005
             + + Y +      P   I V    ++RV  +L  CDAIA R   E+EG  C+YI     K
Sbjct  168   KQDGYTMKN----PNPTIDVGPNFYERVTTSLMNCDAIAIRTVREIEGDLCDYIEKHSRK  223

Query  1006  PVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglelt  1185
              V   GP+ PEP +   LE++  +WL  FEP+SV+FCA GS+++L K+QF +L LG+ELT
Sbjct  224   KVLVTGPVFPEPDKTIQLEERWVKWLSGFEPDSVVFCALGSQIILEKDQFQELCLGMELT  283

Query  1186  glpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGS  1365
             G PFLV VKPP  SS++++ALPEGF+ER KG+ +V  GWV Q +IL H +VG FV+H G 
Sbjct  284   GSPFLVVVKPPRGSSTVQEALPEGFEERIKGRGVVWEGWVQQPLILSHPSVGCFVSHCGF  343

Query  1366  GSMWESLASHCRIIVAPPNR-SDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKS  1542
             GSMWESL S C+I++ P  +  D+  NARLM +EL+ +VEV  +E   F KE+L +AI S
Sbjct  344   GSMWESLLSDCQIVLVPQAQLGDHIRNARLMTDELKVSVEVVREETGWFSKESLRDAINS  403

Query  1543  VMGE-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             VM       N+ K NH KWR+ L +PG    Y+D+FI  L +L
Sbjct  404   VMKSDSEIGNLVKKNHTKWREPLASPGLMTGYVDNFIESLKDL  446



>ref|XP_007021619.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY13144.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=505

 Score =   332 bits (852),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 220/502 (44%), Positives = 311/502 (62%), Gaps = 29/502 (6%)
 Frame = +1

Query  169   TSLLSYIYIPNETLSLLHICIQKHNTTQPNQFKKASSSASRKHMMEDSMLHIAMFPWLAF  348
             +S +SYI + N T      C +  NTT   Q K  +S++S         LH+AMFPW AF
Sbjct  25    SSFVSYIMLINIT------CFELSNTTHRLQAKMRNSNSSS--------LHVAMFPWFAF  70

Query  349   GHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVEGLPPGAE  528
             GHFIP+L L+N LA++GH++S LLP  A  KL+ +N YP L+ F  L +  V+G+PPGAE
Sbjct  71    GHFIPYLHLSNKLAEKGHKVSFLLPKGAQPKLEQLNQYPNLLQFFPLVVSHVDGMPPGAE  130

Query  529   TTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMGCKTVKFT  705
             T +D    L   L +A D  +D+V+AIL  + K ++VF+D  +WIP L  ++G K++ + 
Sbjct  131   TASDVPQPLHSLLAIAFDQTRDQVEAILRAI-KADVVFHDMGHWIPALAHQIGIKSIYYA  189

Query  706   VFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSRFLNLPRN  885
                    + +     +K   + +T  +++E PPG+PS SKV  +  EA  V+    +   
Sbjct  190   A-----VSAAANAHLAKEVSKEMTVEELIEVPPGYPS-SKVRFKAEEAAIVTILPEIFGI  243

Query  886   RITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpeppreepleD  1065
              ++  DR++ A+K  D IAFR   E+EG +C+YIA   GKPV   GP LPE    +   D
Sbjct  244   GLSFQDRIITAMKDSDVIAFRTYREIEGPFCDYIAQHFGKPVMLTGPSLPETNATQLE-D  302

Query  1066  KIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKPPERSSSIEDA  1245
             K A WL  FEP+SV+FC+FGS++ L K +F +L+LG EL+G PFLVA+ PP+   +IE+A
Sbjct  303   KWANWLSNFEPSSVVFCSFGSQIALQKGEFQELVLGFELSGQPFLVALTPPDGCITIEEA  362

Query  1246  LPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASHCRIIVAPPNR  1425
             LPEGF ER +G+ +V+GGWVPQ ++L H +VG FVNH G G+MWESL S C+I++  P  
Sbjct  363   LPEGFHERIQGRGLVYGGWVPQELLLSHSSVGCFVNHCGYGTMWESLLSDCQIVLI-PRL  421

Query  1426  SDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-----IQKVNHKKWRD  1590
              D  LN RLM EELE AVEVQ  EN +  KENL  AIK VM ++     + K NH K ++
Sbjct  422   GDQILNTRLMVEELEVAVEVQKGENREISKENLSKAIKMVMDKDNEIAGLLKRNHAKLKN  481

Query  1591  LLLTPGFADNYIDSFIHKLYEL  1656
             +L      + YI++FI  L +L
Sbjct  482   ILSNRDLQEEYINNFIEGLQDL  503



>ref|XP_008226434.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=450

 Score =   330 bits (845),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 202/452 (45%), Positives = 284/452 (63%), Gaps = 13/452 (3%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             MFPW A GH  P+L LAN+LA RGHRI+ L+P  A L+L+H+ L+  LI F  + +P V 
Sbjct  1     MFPWFAMGHINPYLHLANELASRGHRITFLVPNKARLQLQHLVLHSNLIVFSPVAVPHVH  60

Query  508   GLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMG  684
             G P G E  ++  +++   L  A+D  + E++   L + KP+ V YD A W+PE+    G
Sbjct  61    GFPDGTEIASEIPIHMTHLLATAMDRTRGEIEQ-FLTVSKPDFVLYDTAQWVPEIARRNG  119

Query  685   CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSR  864
              KTV +        A++L+ +++  K R +T  ++ EPP G+PS + VVLR  EA  ++ 
Sbjct  120   TKTVCYNFVCAAALAITLVPARNVPKDRPITEEELREPPAGYPSKN-VVLRGAEAKALT-  177

Query  865   FLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG--pllp  1035
             F+ LP    IT ++R   A+K CD ++ R C E+EG  C+YI  +  KPV   G    L 
Sbjct  178   FITLPYGEGITFYERTKTAMKECDVLSIRTCRELEGDLCDYIEAQYKKPVLLTGPVLGLG  237

Query  1036  eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKP  1215
                + E LE++  +W   FE  SV+FCAFGS+ +L K+QF +L+LG ELT LPF VA+KP
Sbjct  238   SDKKSEKLEERWEKWFSGFEAGSVVFCAFGSQWILEKDQFQELVLGFELTRLPFFVALKP  297

Query  1216  PERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASH  1395
             P   ++IE+ALP GF+ER KG+ +V GGWV Q+ IL HK+VG FVNH G GSMWESL +H
Sbjct  298   PLGCATIEEALPNGFEERVKGRGVVFGGWVQQTAILSHKSVGCFVNHCGFGSMWESLMTH  357

Query  1396  CRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ----  1563
              +I++  P   D  LN +L+ +EL+ AVEV+ +EN  F KE+L  AIKSVM ++ +    
Sbjct  358   NQIVLV-PQLGDQILNTKLLVKELKVAVEVEREENGWFSKESLRKAIKSVMDKDSEVGVM  416

Query  1564  -KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              K NH KW + L +PGF   YID F+ KL EL
Sbjct  417   IKENHAKWVETLSSPGFMSGYIDRFVQKLKEL  448



>ref|XP_007213494.1| hypothetical protein PRUPE_ppa022356mg [Prunus persica]
 gb|EMJ14693.1| hypothetical protein PRUPE_ppa022356mg [Prunus persica]
Length=450

 Score =   330 bits (845),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 202/453 (45%), Positives = 288/453 (64%), Gaps = 15/453 (3%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             M+PW   GH   FL ++N LA+RGHRIS   P+    KL+  NL+   I+F  + +P V+
Sbjct  1     MYPWFGMGHLTSFLHISNKLAERGHRISFFSPSKVQQKLEAFNLHSHRISFIPIDVPHVD  60

Query  508   GLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVS--E  678
             GLPPG ETTAD    L   L  A+D  +  ++  L ++ +PN VF+DF +W+PEL+   +
Sbjct  61    GLPPGTETTADVPFPLHSLLVTAMDLTRPAIEQALCEL-RPNFVFFDFTHWLPELLHKLD  119

Query  679   MGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQV  858
             +G K+V +   SP      LI+ + K   +++T AD+MEPPP FP+ S + L+ HEA  +
Sbjct  120   IGIKSVHYCTISPATVGF-LISPERKLFEKSLTEADLMEPPPSFPASS-IKLQTHEARAL  177

Query  859   SRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllp  1035
                  +   R +T  +R + +   CDAIAF+ C EMEG YC+Y+ T+ GKPV  AGP++P
Sbjct  178   VGATLMEYGRGVTFLERQMGSFSNCDAIAFKTCREMEGPYCDYVETQFGKPVILAGPVVP  237

Query  1036  eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKP  1215
             E P  E   +K A+W + FE  +VI+CAFGSE +L K QF +LLLG ELTGLPF  A+KP
Sbjct  238   ESPTTELD-EKWAKWFDGFEAKTVIYCAFGSECILNKAQFQELLLGFELTGLPFFAALKP  296

Query  1216  PERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASH  1395
             P    SIE ALPEGF+ER +G+ IVHGGWV Q +IL+H +VG FV H GSGS+ E+L + 
Sbjct  297   PMGVESIEAALPEGFEERVQGRGIVHGGWVQQPLILKHPSVGCFVTHCGSGSLSEALMNE  356

Query  1396  CRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGENIQ---  1563
             CR+++  PN  D  +NAR+M+ +L+  VEV+  DE+  F  E +C A+K+VM +  +   
Sbjct  357   CRLVLL-PNVGDQIINARMMSRDLKVGVEVEKGDEDGVFTTEGVCKAVKTVMDDESEVAK  415

Query  1564  --KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               + NH KWR+     G  ++ +DSF  KL++L
Sbjct  416   EVRTNHAKWREFFTGKGLENSCLDSFEQKLHQL  448



>ref|XP_010438412.1| PREDICTED: UDP-glycosyltransferase 79B8 [Camelina sativa]
Length=442

 Score =   329 bits (843),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 205/453 (45%), Positives = 300/453 (66%), Gaps = 23/453 (5%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS  H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +++H NL+P  I F  
Sbjct  2     DSKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHP  61

Query  487   LTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+P V GLPPGAETT+D +++ D  L  ALD  + +V+A +  + +P+L+F+DFA+WIP
Sbjct  62    LTVPHVNGLPPGAETTSDISISEDNLLSEALDLTRGQVEAAVRAL-RPDLIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E   K+V + + S T  A + +   S G            PPPG+PS SKV   E+
Sbjct  121   EVAKEFMIKSVSYIIVSATTIAHTHVPGGSLGV-----------PPPGYPS-SKVRFGEN  168

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A+ +++ L++   R+  + ++    KRCD IA R C E+EG +C+YIA +  K V   G
Sbjct  169   DAHALAK-LSIFYKRL--YHQITTGFKRCDIIALRTCKEIEGKFCDYIAHQYQKKVLLTG  225

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLE++ + +L  F P SV+FCA GS++VL K+QF +L LG+ELTGLPFL+
Sbjct  226   PMLPEPDTSKPLEERWSHFLSGFPPRSVVFCALGSQIVLEKDQFQELCLGMELTGLPFLL  285

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP  SS++++ LPEGF+ER KG+ +V GGWV Q +IL H +VG FVNH G G++WE 
Sbjct  286   AVKPPRGSSTVQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGAIWEC  345

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN--  1557
             + S+C++++  P  SD  L  +LM +E E +VEV  ++   F KE+L +AIKSVM ++  
Sbjct  346   MMSNCQMVLL-PFLSDQTLFTKLMTKEFEVSVEVLREKTGWFSKESLRDAIKSVMDKDSD  404

Query  1558  ---IQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                + + NH K +++L++PG    Y+D+F+  L
Sbjct  405   LGKVVRSNHAKLKEVLVSPGLLTVYVDNFVEAL  437



>ref|XP_006449435.1| hypothetical protein CICLE_v10015186mg [Citrus clementina]
 gb|ESR62675.1| hypothetical protein CICLE_v10015186mg [Citrus clementina]
Length=458

 Score =   329 bits (844),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 197/460 (43%), Positives = 293/460 (64%), Gaps = 12/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             MED  LHIAM+PW A GH   +L ++N LA+RGH+IS +LPTN   K +  NL+  LITF
Sbjct  1     MEDKKLHIAMYPWFAMGHLTSYLHISNKLAERGHKISFILPTNTQTKFEPFNLHKHLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P V+GLP G ETT D    L   L  A+D  +  ++AI+  + KPN+VF+DF YW
Sbjct  61    IPITVPCVDGLPSGTETTTDVPFPLHPLLMTAMDLTEPAIEAIVRDI-KPNIVFFDFTYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K++ F   SP      L++ + K   + +T AD+++PP GFP  SK+ LR
Sbjct  120   LPSLARKLGIKSIAFVTISPATVGY-LLSPERKFPDKVLTEADLLQPPQGFPP-SKIKLR  177

Query  838   EHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
              HEA  ++         ++  +R++  L  CDAI F+ C E+EG YC+Y+ ++  K V  
Sbjct  178   AHEARGLAAATVKDFGGLSFMERLLLCLTECDAIGFKTCREIEGAYCDYVESQFEKRVIL  237

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             AGP+LPEP       ++       F+  S+IFCA GSE VL K+QF +L+ G ELTGLPF
Sbjct  238   AGPVLPEPTTSVLE-EEFETLFSSFKAKSLIFCALGSECVLKKDQFQELISGFELTGLPF  296

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
               A+KPP    +IE ALPEGF++R KG+  VHGGWV Q +IL+H +VG FV H GSGS+ 
Sbjct  297   FAALKPPTGHDTIESALPEGFEDRVKGRGFVHGGWVQQQLILKHPSVGCFVTHCGSGSLS  356

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGE  1554
             E++ + C++++  PN  D  +N+RLM E+L+  VEV+  DE+  F ++ +C A+K+VM +
Sbjct  357   EAMVNECQLVLL-PNVGDQIINSRLMGEDLKVGVEVERGDEDGLFTRDGVCKAVKAVMDD  415

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELS  1659
             + +     + NH K R+ L++PG  ++Y+D F+ +L+ L+
Sbjct  416   DSEVGKDARQNHAKLREFLISPGLENSYVDGFVQELHSLA  455



>ref|XP_009353146.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=459

 Score =   329 bits (844),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 211/462 (46%), Positives = 292/462 (63%), Gaps = 15/462 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M D  LH+AM+PW A GH   FL ++N LA+RGHRIS  +P   L KL+  NLYP  I F
Sbjct  1     MGDKKLHVAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPVKTLQKLEAFNLYPDRIAF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P V GLPPG ETTAD    L   L   +D  + E+   L ++ KP+ VF+DF  W
Sbjct  61    IPINVPHVPGLPPGTETTADVPFPLHSLLMTTMDLTRPEIGQALREL-KPDFVFFDFTQW  119

Query  658   IPELVSE--MGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             +PEL+ E  MG K++ +   SP  + L L T +     +  TAAD+M PPP FP+ S + 
Sbjct  120   MPELLHELDMGTKSIHYCTISPA-TVLYLSTLERNLMEKQPTAADLMLPPPSFPASS-IT  177

Query  832   LREHEAYQ-VSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             LR HEA   V+  L      +T   R   +   CDAIAF+ C E+EG YC+YI T+L KP
Sbjct  178   LRTHEARGLVAVMLKEFGRGVTFMQRQFRSFSGCDAIAFKTCREIEGPYCDYIGTQLRKP  237

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V  AGP +PE P +E   +K ++WLE FE  S+I+CAFGSE +L  +QF +LLLG E+TG
Sbjct  238   VLLAGPGVPETPTKELD-EKWSKWLEGFEAKSMIYCAFGSECILKIDQFQELLLGFEITG  296

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPF  A+KPP  + SIE ALPEGF+ERT+ + +V+GGWV Q + LRH +VG FV H GSG
Sbjct  297   LPFFAALKPPMGAESIESALPEGFEERTRERGVVYGGWVQQPLFLRHPSVGCFVTHCGSG  356

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSV  1545
             S+ E+L + C++++  PN  D  +NAR+M+ +L+  VEV+  + D  F KE +  A+++V
Sbjct  357   SLSEALVNECQLVLL-PNVGDQIINARVMSRDLKVGVEVEKGDLDGLFTKEGVSKAVEAV  415

Query  1546  M---GENIQKV--NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M   GE  ++V  NH KWR+ L      ++Y++SF  KL++L
Sbjct  416   MEDGGEVAEEVRSNHAKWREFLCGKELENSYLNSFERKLHQL  457



>ref|XP_008371703.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=459

 Score =   329 bits (844),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 208/457 (46%), Positives = 290/457 (63%), Gaps = 15/457 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LH AM+PW A GH   FL ++N LA+RGHRIS  +P   L KL+  NLYP  I F  + +
Sbjct  6     LHXAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPVKTLQKLEAFNLYPDRIAFIPINV  65

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLPPG ETTAD    L   L  A+D  + E+   L ++ KP+ VF+DF  W+PEL+
Sbjct  66    PHVPGLPPGTETTADVPFPLHSLLMTAMDLTRPEIGQALREL-KPDFVFFDFTQWMPELL  124

Query  673   SE--MGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
              E  MG K++ +   SP  + L L T +     +  T AD+M PPP FP+ S + LR HE
Sbjct  125   HELDMGTKSIHYCTISPA-TVLYLSTPERNLMEKQPTVADLMLPPPSFPASS-ITLRTHE  182

Query  847   AYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             A  +   +     R +T   R   +   CDAIAF+ C E+EG YC+YI T+L KPV+ AG
Sbjct  183   ARGLVDVMLKEFGRGVTFMQRQFRSFSGCDAIAFKTCREIEGPYCDYIGTQLRKPVFLAG  242

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P++PE P +E   +K ++WLE+FE  S+I+CAFGSE +L  +QF +LL G E+TGLPF  
Sbjct  243   PVVPETPTKELD-EKWSKWLERFEAKSMIYCAFGSECILKIDQFQELLXGFEITGLPFFA  301

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             A+KPP  + SIE ALPEGF ERT+ + +V+GGWV Q + LRH +VG FV H GSGS+ E+
Sbjct  302   ALKPPMGAESIESALPEGFAERTRERGVVYGGWVQQPLFLRHPSVGCFVTHCGSGSLSEA  361

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM---G  1551
             L + C++++  PN  D  +NAR+M+ +L+  VEV+  + D  F KE +  A+++VM   G
Sbjct  362   LVNECQLVLL-PNVGDQIINARVMSRDLKVGVEVEKGDLDGLFTKEGVSKAVEAVMEDGG  420

Query  1552  ENIQKV--NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E  ++V  NH KWRD L      ++Y++SF  KL++L
Sbjct  421   EVAEEVRSNHAKWRDFLCRKELENSYLNSFEQKLHQL  457



>ref|NP_179877.1| UDP-glycosyltransferase 79B8 [Arabidopsis thaliana]
 sp|O81010.1|U79B8_ARATH RecName: Full=UDP-glycosyltransferase 79B8 [Arabidopsis thaliana]
 gb|AAC32440.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AAO64763.1| At2g22930 [Arabidopsis thaliana]
 dbj|BAE99613.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AEC07376.1| UDP-glycosyltransferase 79B8 [Arabidopsis thaliana]
 gb|AHL38844.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=442

 Score =   328 bits (842),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 204/452 (45%), Positives = 296/452 (65%), Gaps = 23/452 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH IPFL LAN LA++GH+I+ LLP  A  +L+H NL+P  I F  LTI
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAEKGHQITFLLPKKAQKQLEHHNLFPDSIVFHPLTI  64

Query  496   PQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT+D ++++D  L  ALD  +D+V+A +  + +P+L+F+DFA+WIPE+ 
Sbjct  65    PHVNGLPAGAETTSDISISMDNLLSEALDLTRDQVEAAVRAL-RPDLIFFDFAHWIPEIA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + + S T  A +       G            PPPG+PS SKV+ RE++A+
Sbjct  124   KEHMIKSVSYMIVSATTIAYTFAPGGVLGV-----------PPPGYPS-SKVLYRENDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              ++  L++   R+  + ++    K CD IA R CNE+EG +C+YI+++  K V   GP+L
Sbjct  172   ALAT-LSIFYKRL--YHQITTGFKSCDIIALRTCNEIEGKFCDYISSQYHKKVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PE    +PLE++++ +L +F P SV+FCA GS++VL K+QF +L LG+ELTGLPFL+AVK
Sbjct  229   PEQDTSKPLEEQLSHFLSRFPPRSVVFCALGSQIVLEKDQFQELCLGMELTGLPFLIAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS++E+ LPEGFQER KG+ +V GGWV Q +IL H ++G FVNH G G++WE L +
Sbjct  289   PPRGSSTVEEGLPEGFQERVKGRGVVWGGWVQQPLILDHPSIGCFVNHCGPGTIWECLMT  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-----  1557
              C++++  P   D  L  RLM EE + +VEV  ++   F KE+L +AIKSVM ++     
Sbjct  349   DCQMVLL-PFLGDQVLFTRLMTEEFKVSVEVSREKTGWFSKESLSDAIKSVMDKDSDLGK  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
             + + NH K ++ L + G    Y+D F+ +L E
Sbjct  408   LVRSNHAKLKETLGSHGLLTGYVDKFVEELQE  439



>gb|EYU44977.1| hypothetical protein MIMGU_mgv1a006277mg [Erythranthe guttata]
Length=450

 Score =   328 bits (842),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 300/453 (66%), Gaps = 11/453 (2%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             L IAMFPW+A GH  PF+ LAN+LAKRGH IS+ +P  ++L+L H NLYP LI F  + +
Sbjct  3     LKIAMFPWIAIGHITPFIHLANELAKRGHSISIFIPPKSVLQLAHHNLYPDLIEFTPVGV  62

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  ++    L VA D +  +++  LLQ  KP++VFYDFA WIP L 
Sbjct  63    PHVDGLPTGAETASDIDISAKDPLAVAFDAMSGDIET-LLQNLKPDIVFYDFADWIPALA  121

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
             +++G KTV + V   ++ A+ ++ ++S    R +T  ++MEPP G+PS S VVLR  EA 
Sbjct  122   AKIGFKTVCYNVICASVMAIGIVPARSIPTDRPLTLQELMEPPSGYPS-STVVLRGQEAM  180

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +S F+ +         R+  A++ CDAI  R C E+EG   +Y++++  KPV+ +GP+L
Sbjct  181   TLS-FIGMDYGATKFHVRIAAAMRGCDAIGIRTCRELEGPMVDYLSSQYNKPVFLSGPVL  239

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP +E    +K   WL KF P SV++CAFGS+++L K+QF +++LG E+TGLPF VAV 
Sbjct  240   PEPAKEPLE-EKWLTWLSKFPPKSVVYCAFGSQMILKKDQFQEMVLGFEMTGLPFFVAVS  298

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
              P  + SIE+ALPEGF ER  G+ +VHGGWV Q   L H +VG FV+H G GSMWESL S
Sbjct  299   KPAGADSIEEALPEGFLERVGGRGVVHGGWVQQIQFLNHPSVGCFVSHCGFGSMWESLLS  358

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              CRI++  P  +D  LN RL+AEEL+ AVEV+      F KE+L  AI S M E      
Sbjct  359   DCRIVLV-PRLADQILNTRLLAEELKVAVEVERGVMGWFSKEDLSKAIVSAMDEESELGK  417

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + K NH  W++ L+ PG+ D+Y+D+FI +LY+L
Sbjct  418   MVKRNHAVWKETLVNPGYMDDYVDNFIQQLYQL  450



>ref|XP_011045872.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Populus euphratica]
Length=462

 Score =   328 bits (842),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 201/455 (44%), Positives = 287/455 (63%), Gaps = 15/455 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH   F+  +N LA+RGHR+S  LP     K +  NL+P LITF  +T+
Sbjct  13    LHIAMYPWFALGHLTAFVHFSNKLAERGHRVSFFLPKKTQSKFEPFNLHPDLITFIPITV  72

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP G ETT +    L   L  A+D L + V    L++  P+ VF+DF +W+P L 
Sbjct  73    PHVDGLPTGTETTTNVPFPLHPLLMTAMD-LTEHVIEDHLRILNPHFVFFDFTHWLPVLS  131

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              + G K+V F + SP      L   +   K  ++TAAD+M+PPP FP  S + LR HEA 
Sbjct  132   RKHGIKSVHFCIISPATIGYLLSPER---KLESLTAADLMQPPPSFPP-SLIKLRAHEAR  187

Query  853   QVSRF-LNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpl  1029
              +    +    + I+  +R + AL +CDA+AF+ C EMEG Y +YI  + GKPV  AGP+
Sbjct  188   GMCAVTVQQYGSNISFQERNLYALSQCDAMAFKTCREMEGPYSDYIEDQFGKPVILAGPI  247

Query  1030  lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAV  1209
             +PEPP      +KIA+ L+ F+  +++FCAFGSE +L K+QF +L+LGLELT LPF   +
Sbjct  248   VPEPPNSVLE-EKIAKMLDNFKAETLVFCAFGSECILKKDQFQELVLGLELTSLPFFAVL  306

Query  1210  KPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLA  1389
             KPP  + +IE ALPEGF+ER KG+  V+ GWV Q +ILRH +VG FV H GSGS+ E + 
Sbjct  307   KPPIGAETIESALPEGFEERVKGRGFVYTGWVQQQLILRHPSVGCFVTHCGSGSLSEGMV  366

Query  1390  SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGEN---  1557
             + C++++  PN  D  +NAR++  +L   VEV+  E D  F +  +C A+K+VM ++   
Sbjct  367   NKCQLVLL-PNAGDQIINARVVGGDLNVGVEVKKGEEDGLFTRHGVCEAVKAVMDDDSEV  425

Query  1558  --IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               + + NH KWR+ LL  G  ++Y+D F+HKL+EL
Sbjct  426   GKLVRANHAKWREFLLGKGLENSYVDGFVHKLHEL  460



>ref|XP_010455340.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=442

 Score =   328 bits (841),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 205/455 (45%), Positives = 298/455 (65%), Gaps = 23/455 (5%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS  H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +++H NL+P  I F  
Sbjct  2     DSKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHP  61

Query  487   LTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+P V GLPPGAETT+D +++ D  L  ALD  + +V+A +  + +P+L+F+DFA WIP
Sbjct  62    LTVPHVNGLPPGAETTSDISISEDNLLSEALDLTRGQVEAAVRAL-RPDLIFFDFALWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E+  K+V + + S T  A + +   S G            PPPG+PS SKV   E+
Sbjct  121   EVAKELMIKSVSYIIVSATTIAHTHVPGGSLGV-----------PPPGYPS-SKVRFGEN  168

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A+ +++ L++   R+  + ++    KRCD IA R C E+EG +C+YIA +  K V   G
Sbjct  169   DAHALAK-LSIFYKRL--YHQITTGFKRCDIIALRTCKEIEGKFCDYIAHQYQKKVLLTG  225

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLE+  + +L  F P SV+FCA GS++VL K+QF +L LG+EL GLPFL+
Sbjct  226   PMLPEPDTSKPLEEHWSHFLSGFPPRSVVFCALGSQIVLEKDQFQELCLGMELIGLPFLL  285

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+ SS++++ LPEGF+ER KG  +V GGWV Q +IL H +VG FVNH G G++WE 
Sbjct  286   AVKPPKGSSTVQEGLPEGFEERMKGHGVVWGGWVQQPLILSHPSVGCFVNHCGPGAIWEC  345

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN--  1557
             + S+C++++  P  SD  L  +LM EE + +VEV  ++   F KE+L +AIKSVM ++  
Sbjct  346   IMSNCQMVLL-PFLSDQTLFTKLMTEEFKVSVEVLREKTGWFSKESLRDAIKSVMDKDSD  404

Query  1558  ---IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
                + + NH   +++L++PG    Y+DSF+  L E
Sbjct  405   LGKLVRSNHANLKEILVSPGLLTGYVDSFVEALQE  439



>ref|XP_006467704.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Citrus sinensis]
Length=458

 Score =   327 bits (839),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 197/460 (43%), Positives = 296/460 (64%), Gaps = 12/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             MED  LHIAM+PW A GH   +L ++N LA+RGH+IS +LPTN   K +  NL+  L+TF
Sbjct  1     MEDKKLHIAMYPWFAMGHLTSYLHISNKLAERGHKISFILPTNTHTKFEPFNLHKHLVTF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P V+GLP G ETT D    L   L  A+D  +  ++AI+  + KPN+VF+DF YW
Sbjct  61    IPITVPCVDGLPSGTETTTDVPFPLHPLLMTAMDLTEPAIEAIVRDI-KPNIVFFDFTYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K++ F   SP      L++ + K + + +T AD+++PP GFP  SK+ LR
Sbjct  120   LPSLARKLGIKSIAFVTISPATVGY-LLSPERKLRDKVLTEADLLQPPQGFPP-SKIKLR  177

Query  838   EHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
              HEA  ++         ++  +R++  L  CDAI F+ C E+EG YC+Y+ ++  K V  
Sbjct  178   AHEARGLAAATVKDFGGLSFMERLLLCLTECDAIGFKTCREIEGAYCDYVESQFEKRVIL  237

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             AGP+LPEPP      ++       F+  S+IFCA GSE VL K+QF +L+LG ELTGLPF
Sbjct  238   AGPVLPEPPASVLE-EEFEMLFSSFKAKSLIFCALGSECVLKKDQFQELILGFELTGLPF  296

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
               A+KPP    +IE ALPEGF++R KG+  VHGGWV Q +IL+H +VG FV H GSGS+ 
Sbjct  297   FAALKPPTGHDTIESALPEGFEDRVKGRGFVHGGWVQQQLILKHPSVGCFVTHCGSGSLS  356

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGE  1554
             E++ + C++++  PN  D  +N+RLM E+L+  VEV+  DE+  F ++ +C A+K+VM +
Sbjct  357   EAMVNECQLVLL-PNVGDQIINSRLMGEDLKVGVEVERGDEDGLFTRDGVCKAVKAVMDD  415

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELS  1659
             + +     + NH + R+ L++PG  ++Y+D F+ +L+ L+
Sbjct  416   DSEVGKDARQNHAELREFLISPGLENSYVDGFVQELHSLA  455



>ref|XP_003527222.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Glycine max]
Length=462

 Score =   327 bits (839),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 297/459 (65%), Gaps = 15/459 (3%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             + +LHIAMFPW A GH  PFL L+N+LAKRGH+I+ LLP  A L+L+H+N +P LITF  
Sbjct  6     NHLLHIAMFPWFATGHMTPFLHLSNELAKRGHKITFLLPKKAKLQLQHLNNHPHLITFHT  65

Query  487   LTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LTIP V+GLP G ET ++  ++L+  L +A+D  +D+V+  L     P+ V YD AYW+P
Sbjct  66    LTIPHVKGLPHGTETASEIPISLNHLLVIAMDKTRDQVEHTL-SATNPDFVLYDNAYWVP  124

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             ++  ++G KT+ + V      A+ L+ +++  K R +T  ++ +PP G+PS SKVVL   
Sbjct  125   QIAKKLGIKTICYNVVCAASLAIVLVPARNVPKDRPITVEELSQPPEGYPS-SKVVLTGL  183

Query  844   EAYQVSRFLNLP--RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
             EA  +  F+++P   + IT +DR+  AL+  DAIA R   E+EG++C+YIA++ GK V  
Sbjct  184   EAESL-MFISVPFGEDNITFYDRITSALRESDAIAIRTSREIEGNFCDYIASQFGKKVLL  242

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
              GP+LPE    +   +  A WL+ F   S+++CAFGS++ L K+QF +LLLG EL+GLPF
Sbjct  243   TGPVLPEEAEGKLE-ENWANWLDAFANESIVYCAFGSQINLEKDQFQELLLGFELSGLPF  301

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             LVA+K P    S+E+ALPEGF+ER KG+ +V  GWV Q +IL+H +VG FVNH G GSMW
Sbjct  302   LVALKTPRGCESVEEALPEGFEERVKGRGVVSRGWVQQLLILKHPSVGCFVNHCGFGSMW  361

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM---  1548
             ESL S  +I++  P   D  LN +L+ EEL  AVEV+   N    KE+L  AIK VM   
Sbjct  362   ESLMSDKQIVLV-PQLGDQVLNTKLLVEELGVAVEVERGGNGWVSKESLSKAIKLVMDGD  420

Query  1549  ---GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                G  ++K NH +W+    +P   + Y+D F+  L + 
Sbjct  421   SEVGARVKK-NHMEWKKTGGSPNLMNGYMDRFVQNLQDF  458



>ref|NP_194486.1| UDP-glycosyltransferase 79B2 [Arabidopsis thaliana]
 sp|Q9T080.1|U79B2_ARATH RecName: Full=UDP-glycosyltransferase 79B2 [Arabidopsis thaliana]
 emb|CAB38268.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 emb|CAB81406.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
 gb|AAL49923.1| putative UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AAN13158.1| putative UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase 
[Arabidopsis thaliana]
 gb|AEE85357.1| UDP-glycosyltransferase 79B2 [Arabidopsis thaliana]
 gb|AHL38674.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=455

 Score =   327 bits (838),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 205/457 (45%), Positives = 293/457 (64%), Gaps = 26/457 (6%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H+ M+PW A GH  PFL LAN LA++GH ++ L+P  AL +L+++NL+P  I F ++T+
Sbjct  6     FHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTV  65

Query  496   PQVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP G ET ++       L + A+D  +D+V+ ++  +E P+L+F+DFA+WIPE+ 
Sbjct  66    PHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEGVVRAVE-PDLIFFDFAHWIPEVA  124

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              + G KTVK+ V S +  A  L           V   ++  PPPG+PS SKV+LR+ +AY
Sbjct  125   RDFGLKTVKYVVVSASTIASML-----------VPGGELGVPPPGYPS-SKVLLRKQDAY  172

Query  853   QVSRFLNLPRNRITV----FDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
              +    +   N I V     +RV  +L   D IA R   E+EG++C+YI     K V   
Sbjct  173   TMKNLES--TNTINVGPNLLERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLT  230

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+ PEP +   LE++  +WL  +EP+SV+FCA GS+V+L K+QF +L LG+ELTG PFL
Sbjct  231   GPVFPEPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFL  290

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAVKPP  SS+I++ALPEGF+ER KG+ +V G WV Q ++L H +VG FV+H G GSMWE
Sbjct  291   VAVKPPRGSSTIQEALPEGFEERVKGRGVVWGEWVQQPLLLSHPSVGCFVSHCGFGSMWE  350

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             SL S C+I++  P   D  LN RL+++EL+ +VEV  +E   F KE+L +AI SVM    
Sbjct  351   SLLSDCQIVLV-PQLGDQVLNTRLLSDELKVSVEVAREETGWFSKESLFDAINSVMKRDS  409

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                N+ K NH KWR+ L +PG    Y+D+FI  L +L
Sbjct  410   EIGNLVKKNHTKWRETLTSPGLVTGYVDNFIESLQDL  446



>ref|XP_010496152.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=442

 Score =   326 bits (835),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 207/453 (46%), Positives = 298/453 (66%), Gaps = 23/453 (5%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS  H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +++H NL+P  I F  
Sbjct  2     DSKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHP  61

Query  487   LTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+P V GLPPGAETT+D +++ D  L  ALD  + +V+A +  + +P+L+F+DFA+WIP
Sbjct  62    LTVPHVSGLPPGAETTSDISISEDNLLCEALDLTRGQVEAAVRAL-RPDLIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             EL  E   KTV + + S T  A + +   S G            PPPG+PS SKV   E+
Sbjct  121   ELAKEHMIKTVSYIIVSATTIAHTHVPGGSLGV-----------PPPGYPS-SKVRFGEN  168

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A+ + + L++   R+  + ++    KRCD IA R C E+EG +C+YIA +  K V   G
Sbjct  169   DAHALEK-LSIFYKRL--YHQITTGFKRCDIIALRTCKEIEGKFCDYIAHQYQKKVLLTG  225

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLE++ + +L  F P SV+F A GS++VL K+QF +L LG+ELTGLPFL+
Sbjct  226   PMLPEPDTSKPLEERWSHFLSGFPPRSVVFFALGSQIVLEKDQFQELCLGMELTGLPFLL  285

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP  SS++++ LPEGF+ER KG+ +V GGWV Q +IL H +VG FVNH G G++WE 
Sbjct  286   AVKPPRGSSTVQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGAIWEC  345

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN--  1557
             L S+C++++  P  SD  L  +LM +E E +VEV  ++   F KE+L +AIKSVM ++  
Sbjct  346   LMSNCQMVLL-PFLSDQTLFTKLMTKEFEVSVEVLREKTGWFSKESLRDAIKSVMDKDSD  404

Query  1558  ---IQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                + + NH K +++L++PG    Y+D+F+  L
Sbjct  405   LGKVVRSNHAKLKEVLVSPGLLTAYVDNFVEAL  437



>ref|XP_010496151.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=442

 Score =   326 bits (835),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 204/455 (45%), Positives = 299/455 (66%), Gaps = 23/455 (5%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS  H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +++H NL+P  I F  
Sbjct  2     DSKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHP  61

Query  487   LTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+P V GLP GAETT+D +++ D  L   LD  +D+V+A +  + +P+L+F+DFA+WIP
Sbjct  62    LTVPHVNGLPRGAETTSDISISEDNLLCEVLDLTRDQVEAAVRAL-RPDLIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E+  KTV + + S T  A   +   + G            PPPG+PS SKV L E+
Sbjct  121   EVAKELLIKTVSYIIVSATTIAHDQVPGGACGV-----------PPPGYPS-SKVRLGEN  168

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A+ +++ L++   R+  + ++    KRCD IA R C ++EG +C+YIA +  K V   G
Sbjct  169   DAHAIAK-LSIFYKRL--YHQITTGFKRCDIIALRTCKDIEGKFCDYIAHQYQKKVLLTG  225

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLE + + +L  F P SV+FCA GS++VL K+QF +L LG+ELTGLPFL+
Sbjct  226   PMLPEPDTSKPLEQRWSHFLSGFPPRSVVFCALGSQIVLEKDQFQELCLGMELTGLPFLL  285

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+ SS++++ LPEGF+ER KG+ +V GGWV Q +IL H +VG FVNH G G++WE 
Sbjct  286   AVKPPKGSSTVQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGAIWEC  345

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN--  1557
             L + C++++  P   D  L  RL+ +E E +VEV  ++   F KE+L +A+KSVM ++  
Sbjct  346   LMTDCQMVLL-PFLHDQVLFTRLLTDEFEVSVEVLREKTGWFSKESLRDAVKSVMDKDSD  404

Query  1558  ---IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
                + + NH K +++L++PG    Y+DSF+  L E
Sbjct  405   LGKLVRSNHAKLKEILVSPGLLTGYVDSFVEALQE  439



>ref|XP_006281795.1| hypothetical protein CARUB_v10027966mg [Capsella rubella]
 gb|EOA14693.1| hypothetical protein CARUB_v10027966mg [Capsella rubella]
Length=447

 Score =   326 bits (835),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 212/457 (46%), Positives = 299/457 (65%), Gaps = 21/457 (5%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  MFPW  FGH   FL LAN LA+ GHRI+ LLP  AL +L+ +NL+P  I F  L
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEGGHRITFLLPKKALKQLEPLNLFPDFIIFQTL  62

Query  490   TIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             TIP V+GLP GAETT+D     GS L  A+D  +++V+  +  + KP+L+F+DFA+WIPE
Sbjct  63    TIPSVDGLPAGAETTSDIPISSGSFLASAMDRTRNQVEEAV-SIGKPDLIFFDFAHWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIME-PPPGFPSDSKVVLREH  843
             +  E G K+V +   S    A+S +   S          D M  PPPG+PS SKV+LR  
Sbjct  122   IAREYGAKSVNYITISAACVAISFVPGHS---------PDAMAVPPPGYPS-SKVLLRGQ  171

Query  844   EAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             E      FL+ P  +  T ++R++  LK CD I+ R C EMEG +C++I ++  + V   
Sbjct  172   ET-NCFAFLSYPFGDGTTFYERIMIGLKNCDIISIRTCQEMEGKFCDFIESQFQRKVLLT  230

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+LPEP   +PLED+  +WL ++EP SVI+CA GS+++L K+QF +L LG+ELTGLPFL
Sbjct  231   GPMLPEPDNSKPLEDQWRKWLNQYEPGSVIYCALGSQIILEKDQFQELCLGMELTGLPFL  290

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAVKPP+  S+I++ALP GF+ER KG+ +V GGWV Q +IL H ++G FV+H G GSMWE
Sbjct  291   VAVKPPKGFSTIQEALPNGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWE  350

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             +L + C+I+   P+  +  LN RLM+EELE +VEV+ +E   F KE+L ++IKSVM +  
Sbjct  351   ALVNDCQIVFI-PHLGEQILNTRLMSEELEVSVEVKREETGWFSKESLSDSIKSVMDKDS  409

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                N+ + NH KW++ L++ G  +  ++ FI  L +L
Sbjct  410   ELGNLVRRNHAKWKESLVSTGLMNRDVNKFIEALQKL  446



>emb|CAN63557.1| hypothetical protein VITISV_034121 [Vitis vinifera]
Length=447

 Score =   326 bits (835),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 206/460 (45%), Positives = 293/460 (64%), Gaps = 26/460 (6%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M +    H+AMFPW AFGH   FL L+N LA+RGH+I+ +LP  A  +L+ +N +P LI+
Sbjct  3     MPKSPKFHVAMFPWFAFGHMTAFLHLSNKLAERGHKITFMLPKKAQSQLQTLNFHPTLIS  62

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  L+IP V+GLPPGAET +D  + L   L  A+D   D+++A L +   P+ +FYD ++
Sbjct  63    FHPLSIPHVDGLPPGAETASDIPIFLTHLLATAMDRATDQLEAAL-RASNPDFLFYDCSH  121

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
               P L S +G K + + V      A++L+ ++   K R VT A++  PP G+PS S  V 
Sbjct  122   LAPVLASRLGIKAICYNVVCAASIAIALVPARGVSKDRPVTEAELAVPPSGYPS-STAVF  180

Query  835   REHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             R HE   + +F++ P  + I+ ++R   A+K  DAI+ R C E+EG+ C+YI T+ GKP+
Sbjct  181   RRHEGRAL-QFISAPFGDGISFYERTTTAMKESDAISIRTCREIEGNLCDYIGTQYGKPI  239

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
             +  GP+LPEP       D+ A+WL              S+ +L K+QF +L+LGLELTGL
Sbjct  240   FLTGPVLPEPSPTPLE-DRWAQWL--------------SQYILEKDQFQELVLGLELTGL  284

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP  +++IE+ALPEGF+ER  G+A VHGGWV Q  IL H +VG FV+H G GS
Sbjct  285   PFLVALKPPTGAATIEEALPEGFKERVGGRAAVHGGWVQQPSILSHPSVGCFVSHCGFGS  344

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL + C+I++  P+  D  LN R++A EL+ AVEV+ +EN  F KE+LC AIKSVM 
Sbjct  345   MWESLMNDCQIVLV-PHLGDQILNTRVLAGELQVAVEVEREENGWFSKESLCKAIKSVMD  403

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E      + + NH KW++    PGF  NY+D F+ +L  L
Sbjct  404   EESEVGGLVRKNHAKWKETFARPGFMSNYVDKFVGQLQGL  443



>gb|KDP21029.1| hypothetical protein JCGZ_21500 [Jatropha curcas]
Length=458

 Score =   326 bits (836),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 209/464 (45%), Positives = 278/464 (60%), Gaps = 20/464 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M D+  HIAM+PW A GH   FL L+N LA+RGH+IS LLP       +  NLYP LIT 
Sbjct  1     MADNTFHIAMYPWFALGHLTSFLHLSNKLAERGHKISFLLPPKTKSNFEPFNLYPNLITL  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + IP V+GLPPG+ETTAD    L   +  A+D  Q  ++  L  + KP+ VF+DF +W
Sbjct  61    IPIDIPHVDGLPPGSETTADVPFPLHPLIMTAMDLTQPTIEFHLRNL-KPHFVFFDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++  K+V +   SP      L         +  T  D+M PPP FP  S + LR
Sbjct  120   LPALSRKLNIKSVHYYTISPATVGYLLRPEIKIADNKIRTEVDLMNPPPSFPRSS-IKLR  178

Query  838   EHEAYQVSRFLNLPRNR-----ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELG  1002
              HEA    R L     R     I+   R       CDA++F+ C EMEG YCNYI  +  
Sbjct  179   AHEA----RHLAAGAKREFGSGISFSQRQWICFSECDAVSFKTCTEMEGPYCNYIEKQFC  234

Query  1003  KPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglel  1182
             K V  AGP++PEPP     ++ I R L+ FE  SVIFCAFG+E +L K+QF +LLLGLE 
Sbjct  235   KKVILAGPVVPEPPSLVLDQE-IERILDNFEEGSVIFCAFGTECLLNKDQFQELLLGLES  293

Query  1183  tglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGG  1362
             TGLPF  A+KPP     IE ALPEGFQER KG+  V+G WV Q +IL+H +VG FV H G
Sbjct  294   TGLPFFAALKPPIGVEKIESALPEGFQERVKGRGFVYGDWVQQQLILQHPSVGCFVTHCG  353

Query  1363  SGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKEN-LCNAIK  1539
             SGS+ E++ + C++++  PN  D  +NARLM  +L+  VEV+  E D  F +N +C A+K
Sbjct  354   SGSLSEAMVTKCQLVLL-PNVGDQIINARLMGGDLKVGVEVEKGEEDGLFSKNGVCKAVK  412

Query  1540  SVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             +VM  + +     K NH KWR+ LL+ G  D+YID F+ KL+E+
Sbjct  413   AVMNNDSEVKEEVKQNHTKWREFLLSQGLEDSYIDGFVQKLHEM  456



>ref|XP_006449434.1| hypothetical protein CICLE_v10017784mg [Citrus clementina]
 gb|ESR62674.1| hypothetical protein CICLE_v10017784mg [Citrus clementina]
Length=458

 Score =   326 bits (836),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 207/464 (45%), Positives = 298/464 (64%), Gaps = 20/464 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M     HIAM+PW A GH  PFL +AN LA+RGHRIS LLP  A+ K +  NL+  LITF
Sbjct  1     MGSETFHIAMYPWFAMGHLTPFLHIANKLAERGHRISFLLPAKAITKFEPSNLHRDLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +++P+V+GLPPGAETT D    L   L  A+D  +  ++++L ++ KP+ VF+DF +W
Sbjct  61    IPVSVPRVDGLPPGAETTNDVPFPLHPLLMTAMDLTEPAIESVLRRL-KPDFVFFDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  + G K+V + + SP      L++ + K + R +T  D++ PP GFP+ SK+ LR
Sbjct  120   LPPLARKFGIKSVLYCIISPATIGY-LLSPERKLRERTLTDNDLLRPPQGFPT-SKIRLR  177

Query  838   EHEAYQVSR-FLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HEA  ++   +      ++   R + +L  CDAI F+ C E+EG YC+YI ++ GKPV 
Sbjct  178   AHEARGLAAATVKEFGGGLSFAKRNLLSLSECDAIGFKTCREIEGPYCDYIGSQFGKPVI  237

Query  1015  CAGpllpeppreepleDKIARW---LEKFEPNSVIFCAFGSEVVLGKEQFHQlllglelt  1185
              +GP LPE PR         RW   L  F+  S+IFCAFGSE VL KEQF +L+LG EL+
Sbjct  238   LSGPALPESPRLALE----ERWETLLGSFKSKSLIFCAFGSECVLNKEQFQELVLGFELS  293

Query  1186  glpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGS  1365
             GLPFLVA+KPP    +IE ALPEGF+ER KG+  +HGGWV Q +IL+H +VG FV H GS
Sbjct  294   GLPFLVALKPPVGHDTIESALPEGFEERVKGRGFIHGGWVQQQLILKHPSVGCFVTHCGS  353

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKS  1542
             GS+ E++ + C++++  PN  D  +NARLM EEL+  VEV+  DE+  F ++ +C A+K+
Sbjct  354   GSLSEAMVNECQLVLL-PNVGDQIINARLMGEELKVGVEVEKGDEDGLFTRDGVCKAVKA  412

Query  1543  VMGENIQKV------NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             V+ ++  +V      NH KWR+ L +    ++++D F+ KL+ L
Sbjct  413   VIDDDHSEVGKEIKENHAKWREFLRSERLENSHLDGFVQKLHGL  456



>ref|XP_010421894.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=447

 Score =   325 bits (834),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 212/461 (46%), Positives = 301/461 (65%), Gaps = 26/461 (6%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS  H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +++H NL+P  I F  
Sbjct  2     DSKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIVFHP  61

Query  487   LTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+P V GLPPGAETT+D +++ D  L  ALD  + +V+A +  + +P+L+F+DFA+WIP
Sbjct  62    LTVPHVNGLPPGAETTSDISISEDNLLSEALDLTRGQVEAAVRAL-RPDLIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             EL  E   K+V + + S T+ A      +    G  V       PPPG+PS SKV+ R +
Sbjct  121   ELAKEHMIKSVSYMIVSATVIA------RLHDPGAPVEV-----PPPGYPS-SKVLFRGN  168

Query  844   EAYQ-VSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             +A+  V R +   R    ++ ++    K CD IA R CNE+EG +C++I+ +  K V   
Sbjct  169   DAHALVIRSIFYER----LYHQLATGFKSCDVIALRTCNEIEGKFCDFISRQYQKKVLLT  224

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+LPEP   +PLE+  + +L  F P SV+FCA GS++VL K+QF +L LG+ELTGLPFL
Sbjct  225   GPMLPEPDTSKPLEEHWSHFLSGFPPGSVVFCALGSQIVLEKDQFQELCLGMELTGLPFL  284

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAVKPP  SS+I+++LPEGF+ER KG+ +V GGWV Q +IL H +VG FVNH G G++WE
Sbjct  285   VAVKPPRGSSTIQESLPEGFEERVKGRGVVSGGWVQQPLILSHPSVGCFVNHCGPGAIWE  344

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
              L + C++++  P  SD  L  RL+ EE E +VEV  ++   F KE+L +AIKSVM +  
Sbjct  345   CLMTDCQMVLI-PFLSDQVLFTRLLTEEFEVSVEVFREKTGWFSKESLRDAIKSVMDKES  403

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL-SVQ  1665
                 + + NH K +++L++PG    Y+D+F+  L +L SVQ
Sbjct  404   DLGKLVRSNHAKLKEILVSPGLFAGYVDNFVEGLTDLISVQ  444



>ref|XP_010437944.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=447

 Score =   325 bits (834),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 204/453 (45%), Positives = 297/453 (66%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH IPF+ LAN LA++GHR++ LLP  A  +L+H+N +P  I F  LTI
Sbjct  5     FHAFMFPWFAFGHMIPFIHLANKLAEKGHRVTFLLPKKAQKQLEHLNQFPDSIVFHPLTI  64

Query  496   PQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT+D ++++D  L  A+D  +D+ +A +  + +P+L+F+DFA+WIPE+ 
Sbjct  65    PPVNGLPAGAETTSDISISMDNFLSEAMDLTRDQAEAAVHAL-RPDLIFFDFAHWIPEVA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + + S T  A+S +       G          PPPG+PS SKV+ RE++A+
Sbjct  124   KEHMIKSVSYIIISAT--AISHLREPDTPLGV---------PPPGYPS-SKVLCRENDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
                 F+ +P     ++ +V    KRCD IA R C EMEG +C+Y++ +  K V   GP+L
Sbjct  172   A---FITMPLFYERLYHQVTTGFKRCDVIALRTCREMEGKFCDYVSHQYHKNVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP   +PLE+  + +L  F P SV+FCAFG+++VL K+QF +L LG+ELTGLPFL+AVK
Sbjct  229   PEPDTSKPLEEHWSHFLSGFPPGSVVFCAFGTQIVLEKDQFQELCLGMELTGLPFLLAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS+I++ LPEGF+ER KG+ +V GGWV Q +IL H +VG FVNH G G++WE L S
Sbjct  289   PPRGSSTIQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGTIWECLLS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-----  1557
              C++++  P   D  L  RL+ EE E +VEV  ++   F KE+L +A+KSVM ++     
Sbjct  349   DCQMVLI-PFFGDQVLFTRLLTEEFEVSVEVSREKTGWFSKESLRDAVKSVMDKDSDLGE  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + + NH K +++L++PG    Y+D+F+  L +L
Sbjct  408   LVRSNHAKLKEILISPGLFAGYVDNFVEALTDL  440



>ref|XP_006397072.1| hypothetical protein EUTSA_v10028656mg [Eutrema salsugineum]
 gb|ESQ38525.1| hypothetical protein EUTSA_v10028656mg [Eutrema salsugineum]
Length=443

 Score =   325 bits (832),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 202/463 (44%), Positives = 289/463 (62%), Gaps = 31/463 (7%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS  H  M+PW A GH  PFL LAN LA +GHR++ LLP   L + +H+NL+P  I F +
Sbjct  2     DSKFHALMYPWFATGHMTPFLHLANKLADKGHRVTFLLPKKTLKQYEHLNLFPDKIVFHS  61

Query  487   LTIPQVEGLPPGAETTAD-----TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFA  651
             +T+P V+GLP G ET ++     T  L  ++++    ++D+V A+     KP+L+F+DFA
Sbjct  62    VTVPHVDGLPIGTETASEIPVSSTNLLASAMDLTRAQIEDQVLAV-----KPDLIFFDFA  116

Query  652   YWIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             +WIPE+  + G KTV + V S +  A  L           V   ++  PPPG+PS SKV+
Sbjct  117   HWIPEMAKDFGVKTVMYVVVSASTIASML-----------VQGGELGVPPPGYPS-SKVL  164

Query  832   LREHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             LR+ + Y +    N   +     +R+  +L  CD IA R   E+EG +C+YI     K V
Sbjct  165   LRKQDLYSMKSINN---DGTKFMERITTSLMNCDVIAIRTVREIEGSFCDYIEKHCKKRV  221

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                GP+ PEP   + LE+K + WL  FEP+SV+FCA G++VVL K+QF +L L +ELTGL
Sbjct  222   LLTGPMFPEPDETKQLEEKWSNWLSGFEPDSVVFCALGTQVVLQKDQFQELCLAMELTGL  281

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL+AVKPP   S+I++ALP+GF+ER KG+ +V GGWV Q +IL H +VG FV+H G GS
Sbjct  282   PFLLAVKPPRGISTIQEALPDGFEERVKGRGVVWGGWVQQELILSHPSVGCFVSHCGFGS  341

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL + C+I++  P   D  LN RL++EELE +VEV  +E   F KE+L +AI SVM 
Sbjct  342   MWESLMNDCQIVLI-PQLGDQILNTRLLSEELEVSVEVAREETGWFSKESLRDAITSVME  400

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
                    + ++NH KWR+ L +PG    Y+++ ++ L +L  Q
Sbjct  401   RESETGKLVRMNHNKWRETLFSPGVMIGYVNNSVNSLQDLVYQ  443



>ref|XP_002866013.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42272.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=446

 Score =   324 bits (831),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 202/456 (44%), Positives = 301/456 (66%), Gaps = 20/456 (4%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  MFPW  FGH   FL LAN LA++GH+I+ LLP  AL +L+ +NL+P  I F  L
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPHCIVFHTL  62

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             TIP V+GLP GAETT+D  ++L   L  A+D  +++V+  +  + +P+++F+DFA+WIPE
Sbjct  63    TIPSVDGLPAGAETTSDIPISLGSFLASAMDRTRNQVEEAV-SIRQPDMIFFDFAHWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G K+V F   S    A+S +   S+         D+  PPPG+PS SKV+LR  E
Sbjct  122   IAREYGAKSVNFITISAACVAISFVPGCSQD--------DLGIPPPGYPS-SKVLLRGQE  172

Query  847   AYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                +S FL+ P  +  T ++R++  LK CD I+ R C E+EG +C++I  +  + V   G
Sbjct  173   TNSLS-FLSYPFGDGTTFYERIMIGLKNCDVISIRTCQEIEGKFCDFIERQFQREVLLTG  231

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LP+P  +    D+   WL +FEP SVI+CA GS+++L K+QF +L LG+ELTGLPFLV
Sbjct  232   PMLPDPDSKPLE-DQWRLWLSQFEPESVIYCALGSQIILEKDQFQELCLGMELTGLPFLV  290

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+ + +I++ALP+GF+ER KG+ +V GGWV Q +IL H ++G FV+H G GSMWE+
Sbjct  291   AVKPPKGAKTIQEALPKGFEERVKGRGVVWGGWVKQPLILAHPSIGCFVSHCGFGSMWEA  350

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE---  1554
             + + C+I+   P+  +  LN RLM+EELE +VEV+ ++   F KE+L  A++SVM +   
Sbjct  351   IVNDCQIVFI-PHLGEQILNTRLMSEELEVSVEVKREKAGWFSKESLSGAVRSVMDKDSE  409

Query  1555  --NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               N+ + NH KW++ L++ G  + Y++ FI +L +L
Sbjct  410   LGNLVRRNHAKWKESLVSTGLMNGYVNKFIEELQKL  445



>gb|EPS67374.1| hypothetical protein M569_07398, partial [Genlisea aurea]
Length=459

 Score =   325 bits (832),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 289/459 (63%), Gaps = 13/459 (3%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRG-HRISlllptnallklKHMNLYPQLITF  480
             E   LHIAMFPW+A GH  PF+ LAN+LAKRG H +S+LLP+  L  L+  NLYP L+ F
Sbjct  3     ERRKLHIAMFPWIAMGHITPFIHLANELAKRGGHSVSVLLPSKPLDLLRRHNLYPNLVKF  62

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P  + LP GA+T +D        L  A D +  EV AIL  + +P++VFYDFA W
Sbjct  63    HVVAVPPTDSLPAGAQTASDIDSTAKDPLANAFDAMGPEVAAILRTL-RPDVVFYDFADW  121

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             IP L +E+G KTV + V   ++ A+ ++ ++   + R +T  ++ +PP G+PS S VVLR
Sbjct  122   IPGLAAEIGFKTVCYNVICASVMAIGVVPARRIPEDRPLTVEELAQPPKGYPS-STVVLR  180

Query  838   EHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
               EA  +S F+ +         R+  A+  CDAI  R   E+EG   +Y++ + GKPV+ 
Sbjct  181   GQEALTLS-FIGMDYGSTKFHVRISAAMNNCDAIGIRTIRELEGPMVDYLSQQYGKPVFL  239

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +GPLLP+ P  +   +K  RWL +F P SV++CAFGS++ L K QF +LLLG ELTGLPF
Sbjct  240   SGPLLPKEPEGDLE-EKWDRWLNQFRPKSVVYCAFGSQMTLKKSQFQELLLGFELTGLPF  298

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
              VA+  P    SIE+ALPEGF+ER   + +VHGGWV Q+ IL H +VG FV+H G GSMW
Sbjct  299   FVALSKPHGVDSIEEALPEGFRERVGDRGVVHGGWVQQTQILNHPSVGCFVSHCGFGSMW  358

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN  1557
             ESL S  +I++  P  +D  LN RL+AE+L+ AVEV   +   F +E+LC+AI+S M E+
Sbjct  359   ESLLSDPQIVLV-PKLADQILNTRLLAEDLKVAVEVPRGDMGWFSREDLCSAIRSAMIED  417

Query  1558  IQ------KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                     K+NH +WR+ L   GF D Y D FI  L+ L
Sbjct  418   EAGVAGSLKLNHGRWREKLAGAGFMDGYADGFIDDLHRL  456



>ref|XP_008245371.1| PREDICTED: LOW QUALITY PROTEIN: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Prunus mume]
Length=456

 Score =   324 bits (831),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 203/462 (44%), Positives = 288/462 (62%), Gaps = 18/462 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M D  LHIAM+PW   GH   FL ++N LA+RGHRIS   P+    KL+  NL+   I+F
Sbjct  1     MTDQTLHIAMYPWFGMGHLTSFLHISNKLAERGHRISFFSPSKVQQKLEAFNLHSHRISF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P V+GLPPG ETTAD    L   L  A+D  +  ++  L ++ +PN VF+DF +W
Sbjct  61    IPIDVPHVDGLPPGTETTADVPFPLHSLLVTAMDLTRPAIEQALCEL-RPNFVFFDFTHW  119

Query  658   IPELVS--EMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             +P L+   ++G K+V +   SP      LI+ + K   +++T AD+MEPPP FP+ S + 
Sbjct  120   LPALLHKLDIGIKSVHYCTISPATVGF-LISPERKLLEKSLTEADLMEPPPSFPASS-IK  177

Query  832   LREHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             L+ HEA  +     +   R +T  +R + +   CDAIAF+ C EMEG YC+Y+ T+ GKP
Sbjct  178   LQTHEARALVGATLMEYGRGVTFLERQMGSFSNCDAIAFKTCREMEGPYCDYVETQFGKP  237

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V  AGP++PE P  E   +K A+W + FE  +VI+CAFGSE +L K QF +LLLG ELTG
Sbjct  238   VILAGPVVPESPTTELD-EKWAKWFDGFEAKTVIYCAFGSECILNKAQFQELLLGFELTG  296

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPF  A+KPP    SIE ALPEGF+ER +G+ IVHGGWV         +VG FV H GSG
Sbjct  297   LPFFAALKPPMGVESIEAALPEGFEERGQGRGIVHGGWVXXXXX---PSVGCFVTHCGSG  353

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSV  1545
             S+ E+L + CR+++  PN  D  +NAR+M+ +L+  VEV+  DE+  F  E +C A+K+V
Sbjct  354   SLSEALMNECRLVLL-PNVGDQIINARMMSRDLKVGVEVEKGDEDGVFTTEGVCKAVKTV  412

Query  1546  MGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M +  +     + NH KWR+     G  ++++DSF  KL++L
Sbjct  413   MDDESEVAKEVRTNHAKWREFFTGKGLENSWLDSFEQKLHQL  454



>ref|XP_004307624.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=459

 Score =   324 bits (831),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 202/462 (44%), Positives = 290/462 (63%), Gaps = 15/462 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M D  +HIAM+PW A GH   +L ++N LA+RGH+IS  +P     K+   NL+P LI+F
Sbjct  1     MSDQTMHIAMYPWFAMGHLTSYLHISNKLAERGHKISFFIPIKTQPKMVQFNLHPHLISF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P ++GLP G ETTAD  ++L   L  A+D  + +++  L ++  PN VFYDF+YW
Sbjct  61    IPINVPHIDGLPLGTETTADIPLHLHPHLATAMDLTRPQIEQSLREI-NPNFVFYDFSYW  119

Query  658   IPELVSEMG--CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             +P  + ++G   K+V +   SP      LI+ + K   + +T  +  E P  FPS S + 
Sbjct  120   LPAFLRQLGKTIKSVHYCTISPATVGY-LISPERKLSEKTLTEFEYREAPTSFPSSS-IK  177

Query  832   LREHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             LR HEA  ++   N    R IT   R       CDAIAF+ C E+EG +C+Y+ T+L KP
Sbjct  178   LRPHEARGLAYGANKEYGRGITFLKRQQINFGDCDAIAFKTCRELEGPFCDYLETQLRKP  237

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V  AGP++P+PP      +K A WL  F+  +VIFCAFGSE +L KEQ  +LLLG ELTG
Sbjct  238   VILAGPVVPDPPSSHLE-EKWANWLGGFDSKTVIFCAFGSECILRKEQLQELLLGFELTG  296

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPF  A+KPP    SIE ALP+GF ER +GK IV+GGWV Q +IL+H +VG FV H GSG
Sbjct  297   LPFFAALKPPTGVESIESALPQGFLERVEGKGIVYGGWVQQPLILKHPSVGCFVTHCGSG  356

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSV  1545
             S+ E+L + C++++  PN  D  +NAR+M+ +L+  VEV+  DE+  F KE +C A+K+V
Sbjct  357   SLSEALVNECQLVLL-PNVGDQIINARMMSGDLKVGVEVEKGDEDGLFSKEGVCKAVKAV  415

Query  1546  MGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + E+ +     + NH KWR+   + G   +YI+ F+HKL++L
Sbjct  416   IDEDSEVEKEVRANHAKWREFFSSKGLESSYIEDFVHKLHKL  457



>ref|XP_007213460.1| hypothetical protein PRUPE_ppa024453mg [Prunus persica]
 gb|EMJ14659.1| hypothetical protein PRUPE_ppa024453mg [Prunus persica]
Length=450

 Score =   324 bits (830),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 203/454 (45%), Positives = 289/454 (64%), Gaps = 17/454 (4%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             M+PW A GH   FL ++N LA+RGHRIS   P+    KL+  NL+   I+F  + +P V+
Sbjct  1     MYPWFAMGHLTSFLHISNKLAQRGHRISFFSPSKVQQKLEAFNLHSHRISFIPIDVPHVD  60

Query  508   GLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVS--E  678
             GLPPG ETTAD  +L   L V A+D  +  ++  L ++ +PN VF+DF +W+PEL+   +
Sbjct  61    GLPPGTETTADVPSLLQPLLVTAMDLTRPAIEQALCEL-RPNFVFFDFTHWLPELLHKLD  119

Query  679   MGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQV  858
             +G K+V +   SP      L+  + K    ++T AD+MEPPP FP+ S + L+ HEA  +
Sbjct  120   IGIKSVYYCTISPATVGF-LMCPERKLLEISLTEADLMEPPPSFPASS-IKLQTHEARAL  177

Query  859   --SRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
               +  +   R  +T  +R + +   CDAIAF+ C EMEG YC+Y+ T+ GKPV  AGP++
Sbjct  178   VGASLMEFGRG-VTFLERQMGSFSNCDAIAFKTCREMEGPYCDYVETQFGKPVILAGPVV  236

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PE P  E   +K A+W + F+  +VI+CAFGSE +L K QF +LLLG ELTGLPF  A+K
Sbjct  237   PESPTTELD-EKWAKWFDGFKAKTVIYCAFGSECILNKAQFQELLLGFELTGLPFFAALK  295

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP    SIE ALPEGF+ER +GK IVHGGWV Q +IL+H +VG FV H GSGS+ E+L +
Sbjct  296   PPMGVESIEAALPEGFEERVQGKGIVHGGWVQQPLILKHPSVGCFVTHCGSGSLSEALVN  355

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGENIQK-  1566
              CR+++  PN  D  +NAR+M+ +L+  VEV+  DE+  F  E +C A+K+VM +  +  
Sbjct  356   ECRLVLL-PNMGDQIINARMMSRDLKVGVEVEKEDEDGVFTTEGVCKAVKTVMDDESEVA  414

Query  1567  ----VNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  NH KWR+ L      ++ +DSF  KL++L
Sbjct  415   KEVWTNHAKWREFLSGKELENSCLDSFEQKLHQL  448



>ref|XP_010446338.1| PREDICTED: UDP-glycosyltransferase 79B6-like isoform X1 [Camelina 
sativa]
Length=447

 Score =   323 bits (829),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 209/456 (46%), Positives = 299/456 (66%), Gaps = 19/456 (4%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  MFPW  FGH   FL LAN LA++GH+I+ LLP  AL +L+ +NL+P  I F  L
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPDYIFFHTL  62

Query  490   TIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             TIP V+GLP GAETT+D     GS L  A+D  +++V+  +  + KP+L+F+DFA+WIPE
Sbjct  63    TIPSVDGLPAGAETTSDIQISSGSFLASAMDRTRNQVQEAV-SIGKPDLIFFDFAHWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G ++V F   S    A+S +  +S          D+  PPPG+PS SKV+LR  E
Sbjct  122   IAGEYGARSVNFITISAACVAISFVPGRS--------PDDLAVPPPGYPS-SKVLLRGQE  172

Query  847   AYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                 S FL+ P  +  T ++R++  L  CD I+ R C EMEG +C++I ++  + V   G
Sbjct  173   TNCFS-FLSHPFGDNTTFYERIMIGLTNCDVISIRTCQEMEGKFCDFIESQFQREVLLTG  231

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLED+  +WL +FEP SV++CA GS+++L K+QF +L LG+ELTGLPFLV
Sbjct  232   PMLPEPDNSKPLEDQWMQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFLV  291

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+ SS+I++ALP GF+ER KG+ +V G WV Q +IL H ++G FV+H G GSMWE 
Sbjct  292   AVKPPKGSSTIQEALPNGFEERVKGRGVVWGRWVQQPLILAHPSIGCFVSHCGFGSMWEG  351

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE---  1554
             L + C+I+   P+  +   N RLM+EELE +VEV+ ++   F KE+L  +I+SVM +   
Sbjct  352   LVNDCQIVFI-PHLGEQIFNTRLMSEELEVSVEVEREDTGWFSKESLSGSIRSVMDKDSE  410

Query  1555  --NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               N+ + NH KW+D L++ G  + Y++ FI  L +L
Sbjct  411   LGNLVRRNHAKWKDSLVSTGLMNGYVNKFIEALQKL  446



>ref|XP_006289802.1| hypothetical protein CARUB_v10003406mg [Capsella rubella]
 gb|EOA22700.1| hypothetical protein CARUB_v10003406mg [Capsella rubella]
Length=447

 Score =   323 bits (829),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 206/456 (45%), Positives = 297/456 (65%), Gaps = 23/456 (5%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             +S  H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +++H NL+P  I F  
Sbjct  2     ESKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQMEHHNLFPDSIVFHP  61

Query  487   LTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LTIP V+GLP GAETT+D +++LD  L  A D  QD+V+A++  + KP+++F+DFA+WIP
Sbjct  62    LTIPHVDGLPAGAETTSDISLSLDNLLSEAFDLTQDQVEAVVCYL-KPDIIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             EL  E   K+V + + S T  AL+ I       G              +PS +KV+L E+
Sbjct  121   ELAKEHKIKSVSYMIVSAT--ALAHINDPGVPFGVPPPG---------YPS-TKVLLGEN  168

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A+ ++  +++   R+  + ++      CD IA R CNEMEG +C+YI+ +  K V   G
Sbjct  169   DAHALAT-MSIFYERL--YHQLTTGFNNCDVIALRTCNEMEGKFCDYISRQYNKKVLLTG  225

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLE++ + +L KF P SV+FCA GS++VL K+QF +L LG+E+TGLPFLV
Sbjct  226   PMLPEPDTSKPLEERWSHFLSKFPPGSVVFCALGSQIVLEKDQFQELCLGMEMTGLPFLV  285

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             A+KPP  SS+I++ LPEGF+ER KG+ +V  GWV Q +IL H +VG FVNH G G++WES
Sbjct  286   ALKPPRGSSTIQEVLPEGFEERVKGRGVVWEGWVQQPLILSHPSVGCFVNHCGPGTIWES  345

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE---  1554
             L + C++++  P  SD  L  RLM +E E AVEV  ++   F KE+L + IKSVM +   
Sbjct  346   LMTDCQLVLI-PFLSDQMLFTRLMTKEFEVAVEVSREKTGWFSKESLSDTIKSVMDKESD  404

Query  1555  --NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                +   NH K +++L +PG  D Y+D+F+  L +L
Sbjct  405   LGKLVSSNHTKLKEVLFSPGLLDGYVDNFVEALADL  440



>gb|AFJ52978.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=462

 Score =   324 bits (830),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 199/459 (43%), Positives = 288/459 (63%), Gaps = 12/459 (3%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E    HI MFPWLA GH  PFL L+N LA +G  I+ +LP  A+ +    N +P LI F 
Sbjct  6     ETKKFHIVMFPWLATGHITPFLHLSNTLASKGFTITFILPKKAIQQFSRFNQHPNLIDFH  65

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
              +T+P V+GLP G ET ++  + +   L +A+D  +D+V+ I+ +   P +V YD A+W+
Sbjct  66    PITLPPVDGLPAGVETASEVPIEVTHFLCIAMDRTRDQVEKII-RGTNPKVVVYDMAHWV  124

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
              ++ + +G K+V +TV S    A + +  +   KG+ +T  ++  PPPG+PS S +VLR 
Sbjct  125   SDITASLGIKSVNYTVLSAAAVAFADVPVRGIVKGKELTVDELAVPPPGYPS-STIVLRP  183

Query  841   HEAYQVSRFLNLPRNRITVF-DRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
             HE   +S F+  P    T F +R+   ++ CDA+A R C+E+EG  C Y+  +  K V+ 
Sbjct  184   HEGKLLS-FIFFPYGEATTFWERISTGMRMCDALAIRTCDEIEGKLCEYLGEQYKKRVFL  242

Query  1018  AGpllpe-ppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              GP+L E       LE++   WL KFEP SV+FCAFGS+++L K QF +L+LG EL+G P
Sbjct  243   TGPVLTEPANDVVSLENQWIDWLGKFEPGSVVFCAFGSQIMLEKSQFQELVLGFELSGHP  302

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FLVA+KPP  SS+I++ALPEGF+ER KG+ I+ G WV Q +IL H +VG FVNH G GSM
Sbjct  303   FLVALKPPAGSSTIKEALPEGFEERVKGRGIIWGEWVQQVLILNHPSVGCFVNHCGFGSM  362

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
             WESL S  +I++  P+  D  LN RL+A+EL+  +EV+ DE     KE L +AIK VM +
Sbjct  363   WESLMSDSQIVLV-PHLGDQVLNTRLLADELKVGLEVERDEQGWVSKEKLSDAIKCVMDQ  421

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + NH KWR ++  P F  +YID F+  L++L
Sbjct  422   GNELGCSLRKNHSKWRGVVSDPDFMSSYIDKFVQNLHDL  460



>gb|AAM65481.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase-like 
protein [Arabidopsis thaliana]
Length=446

 Score =   323 bits (828),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 204/453 (45%), Positives = 291/453 (64%), Gaps = 26/453 (6%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             M+PW A GH  PFL LAN LA++GH ++ L+P  AL +L+++NL+P  I F ++T+P V+
Sbjct  1     MYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTVPHVD  60

Query  508   GLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMG  684
             GLP G ET ++       L + A+D  +D+V+ ++  +E P+L+F+DFA+WIPE+  + G
Sbjct  61    GLPVGTETVSEIPVTSADLLMSAMDLTRDQVEGVVRAVE-PDLIFFDFAHWIPEVARDFG  119

Query  685   CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSR  864
              KTVK+ V S +  A  L           V   ++  PPPG+PS SKV+LR+ +AY +  
Sbjct  120   LKTVKYVVVSASTIASML-----------VPGGELGVPPPGYPS-SKVLLRKQDAYTMKN  167

Query  865   FLNLPRNRITV----FDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
               +   N I V     +RV  +L   D IA R   E+EG++C+YI     K V   GP+ 
Sbjct  168   LES--TNTINVGPNLLERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPVF  225

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP +   LE++  +WL  +EP+SV+FCA GS+V+L K+QF +L LG+ELTG PFLVAVK
Sbjct  226   PEPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAVK  285

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS+I++ALPEGF+ER KG+ +V G WV Q ++L H +VG FV+H G GSMWESL S
Sbjct  286   PPRGSSTIQEALPEGFEERVKGRGVVWGEWVQQPLLLSHPSVGCFVSHCGFGSMWESLLS  345

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P   D  LN RL+++EL+ +VEV  +E   F KE+L +AI SVM       N
Sbjct  346   DCQIVLV-PQLGDQVLNTRLLSDELKVSVEVAREETGWFSKESLFDAINSVMKRDSEIGN  404

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + K NH KWR+ L +PG    Y+D+FI  L +L
Sbjct  405   LVKKNHTKWRETLTSPGLVTGYVDNFIESLQDL  437



>ref|XP_007132682.1| hypothetical protein PHAVU_011G115700g [Phaseolus vulgaris]
 gb|ESW04676.1| hypothetical protein PHAVU_011G115700g [Phaseolus vulgaris]
Length=457

 Score =   323 bits (829),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 204/459 (44%), Positives = 288/459 (63%), Gaps = 12/459 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             ME   LHIAM+PWLA GH   FL L N LA RGHRIS + P  A  KL+  NL+P+LITF
Sbjct  1     MEPRPLHIAMYPWLAMGHQTAFLHLCNKLAIRGHRISFITPPKAQAKLEPFNLHPELITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P VEGLPP A+TTAD T  L  ++  A+D  +D+++ +L  + KP+LVFYDF +W
Sbjct  61    VTITVPHVEGLPPDAQTTADVTYPLQPNIMTAMDLTKDDIETLLTDL-KPDLVFYDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K V +   S  +   +L  ++   +G  ++ +D+MEPP G+P DS + L 
Sbjct  120   MPTLTKKLGIKAVHYCTASSVMVGYTLPPARYY-QGIDLSESDLMEPPKGYP-DSSIKLH  177

Query  838   EHEAYQVS-RFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HEA   + +  +   + +  +DR   AL   D +A+R C E+EG Y +YI  E  KPV 
Sbjct  178   AHEARAFAGKRKDTFGSDVLFYDRQFTALNEADVLAYRTCREIEGPYLDYIGNEFNKPVL  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              +GP++ EPP  E   +K + WL  FEP +V++C FGSE  L  EQF +L+LGLELTG+P
Sbjct  238   ASGPVILEPPTSELE-EKFSTWLGGFEPGTVVYCCFGSECTLRPEQFQELVLGLELTGMP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL AVKPP    ++E A+PEGF+ER KG+  V+GGWV Q +IL H +VG F+ H GSGS+
Sbjct  297   FLAAVKPPVGFHTVESAMPEGFEERVKGRGFVYGGWVMQQLILAHPSVGCFITHCGSGSL  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
              E+L + CR+++  PN  D  LNAR+MA  LE  VEV   E+  + K+++C A+  VM E
Sbjct  357   SEALVNKCRLVLL-PNVGDQILNARMMANNLEVGVEVDKGEDGMYTKDSVCKAVSIVMDE  415

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +      VNH + R+ LL       Y+D+F  +L E+
Sbjct  416   ENETSKKVTVNHTRIRETLLDKDLESYYLDNFCTRLREI  454



>ref|XP_007025501.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
 gb|EOY28123.1| UDP-Glycosyltransferase superfamily protein [Theobroma cacao]
Length=456

 Score =   323 bits (828),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 205/464 (44%), Positives = 292/464 (63%), Gaps = 21/464 (5%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M +  LH+AM+PW A GH   FL ++N LA+RGH+IS  LPT    K +  NL+P +ITF
Sbjct  1     MGEKFLHMAMYPWFAVGHITSFLHISNKLAERGHKISFFLPTKTQSKFEPFNLHPDVITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P ++GLP G ETT D   +L   L  A+D  +  ++A L ++ KP+ +F+DF +W
Sbjct  61    IPIKVPHIDGLPLGTETTTDIPFSLQPLLMAAMDLTEPAIEASLREL-KPHFLFFDFTFW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L   +G K++ +   SP      LI+   K   + +T +D+MEPP GFPS S + LR
Sbjct  120   MPALCHRLGIKSMYYCTISPATVGY-LISPTRKILEKGLTGSDLMEPPLGFPSSS-IKLR  177

Query  838   EHEAYQVSRFLNLPRNR-----ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELG  1002
             +HEA    R L     R     I+   R + AL  CDAI F+ C E+EG YC+Y+  +  
Sbjct  178   DHEA----RGLAAATTREYGSGISFVVRQLTALNECDAIGFKTCREIEGPYCDYVEKQFE  233

Query  1003  KPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglel  1182
             KPV  AGP+ PEPP +    ++  + L  F+  +VIFCAFGSE VL K+QF +L+LGLEL
Sbjct  234   KPVILAGPVAPEPPNKTLE-ERWEKLLSSFQAQTVIFCAFGSECVLNKDQFQELVLGLEL  292

Query  1183  tglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGG  1362
             TGLPFLVA+K P  + + E ALPEGFQER KG+  VHG WVPQ +IL H +VG FV H G
Sbjct  293   TGLPFLVALKAPMGAETAESALPEGFQERVKGRGFVHGSWVPQQLILSHPSVGCFVTHCG  352

Query  1363  SGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIK  1539
             SGS+ E++ + C++++  P+  D  +NARLMA +L+  VEV+  E D  F K+++C A+ 
Sbjct  353   SGSLSEAMVNDCQLVLL-PHVGDQIINARLMAGDLKVGVEVEKGEEDGLFRKDDVCKAVM  411

Query  1540  SVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             ++M ++ +     + NH KW+D LL  G   +YIDSF+ KL+ L
Sbjct  412   AMMDDDSEVGKEARANHAKWKDFLLGKGLEISYIDSFVEKLHAL  455



>ref|XP_006286630.1| hypothetical protein CARUB_v10002468mg [Capsella rubella]
 gb|EOA19528.1| hypothetical protein CARUB_v10002468mg [Capsella rubella]
Length=443

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 204/456 (45%), Positives = 299/456 (66%), Gaps = 23/456 (5%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS  H  MFPW +FGH IPFL LAN LA++GHR++ L+P  A  +L+  NL+P+ I F  
Sbjct  2     DSKFHAFMFPWFSFGHMIPFLHLANKLAEKGHRVTFLVPKKAQKQLEPHNLFPESIVFHP  61

Query  487   LTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+P V+GLP GAETT+D ++++D  L  A D  +D+V+A +  + KP+L+F+DFA+WIP
Sbjct  62    LTVPHVDGLPVGAETTSDISISMDNLLSEAFDLTRDQVEAAVRTL-KPDLIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             EL  +   K V + + S T  A +L+   + G            PPPG+PS SKV+ RE+
Sbjct  121   ELAKQHMIKNVSYMIVSATAIAHTLVPGGALGV-----------PPPGYPS-SKVLFREN  168

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A+ +   L++   R+  + ++   LK CD IA R CNE+EG +C+YI+ +  K V   G
Sbjct  169   DAHTLVT-LSIFYERL--YHQLTTGLKSCDVIALRTCNEIEGKFCDYISRQYNKKVLLTG  225

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             PLLPE    +PLE+  +++L KF P SV+FCA GS++VL K+QF +L LG+ELTGLPFL+
Sbjct  226   PLLPELDTSKPLEEHWSQFLRKFPPGSVVFCALGSQIVLEKDQFQELCLGMELTGLPFLI  285

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP  SS++++ALPEGF+ER K + +V GGWV Q +IL H +VG FV+H G G++WE 
Sbjct  286   AVKPPRGSSTVQEALPEGFEERVKERGVVWGGWVQQPLILSHPSVGCFVSHCGPGAIWEC  345

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN--  1557
             L +  ++    P   D  L  RLM EE + +VEV  ++   F KE+  +AIKSVM ++  
Sbjct  346   LMNDVQMAFI-PFLGDQVLFTRLMTEEFQVSVEVLREKTGWFSKESSRDAIKSVMDKDSE  404

Query  1558  ---IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                + + NH K +++L++PG  D Y+D+F+  L +L
Sbjct  405   LGKLVRSNHTKLKEVLVSPGLLDGYVDNFVEALVDL  440



>ref|XP_009132454.1| PREDICTED: UDP-glycosyltransferase 79B6 [Brassica rapa]
Length=447

 Score =   322 bits (826),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 203/456 (45%), Positives = 299/456 (66%), Gaps = 19/456 (4%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  MFPW  FGH   FL LAN LA++GH+I+ LLP   L +L+ +NL+P+ I F  L
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKGLKQLEPLNLFPKSIVFHIL  62

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             TIP V+GLP GAETT+D  + L   L  A+D  + +V+  + ++ KP+L+F+DFA+WIP+
Sbjct  63    TIPSVDGLPDGAETTSDIPITLGSFLASAMDRTRGQVEETV-RLGKPDLIFFDFAHWIPD  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G K+V F   S    A+S +  +S          ++  PPPG+PS SKV+L   E
Sbjct  122   IAREYGAKSVNFVTISAACVAISFVPGRS--------PDELAIPPPGYPS-SKVLLHGQE  172

Query  847   AYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                +S FL+ P  + +T ++R++  L  CD I+ R C EMEG +C++I  E  + V   G
Sbjct  173   TSSLS-FLSYPFGDGVTFYERIMTGLVNCDVISIRTCQEMEGKFCDFIEREFQRKVLLTG  231

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLED+ + WL +F+P SV++C+ GS+++L KEQF +L LG+ELTGLPFLV
Sbjct  232   PMLPEPDNIKPLEDQWSHWLNRFKPGSVVYCSLGSQIILEKEQFQELCLGMELTGLPFLV  291

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+ +S+I++ALP+GF+ER K + +V G WV Q +IL H ++G FV+H G GSMWES
Sbjct  292   AVKPPKGASTIQEALPKGFEERFKERGVVWGEWVHQPLILAHPSIGCFVSHCGFGSMWES  351

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE---  1554
             L + C+I+   P+  +   N RLM+EELE +VEV+ +E   F KE+L  A++SVM +   
Sbjct  352   LLNDCQIVFI-PHLGEQIFNTRLMSEELEVSVEVKREETGWFSKESLSGAVRSVMDKDTE  410

Query  1555  --NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               N+ + NH KW++ LL+ G    Y++ ++  L +L
Sbjct  411   LGNLVRRNHAKWKESLLSSGIISGYVNKYVEALEKL  446



>ref|XP_002872446.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48705.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=442

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 202/452 (45%), Positives = 293/452 (65%), Gaps = 23/452 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +L+H NL+P  I F  LTI
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT+D  +++D  L  ALD  +D+V+A +  + +P+++F+DFA W+PE+ 
Sbjct  65    PPVNGLPAGAETTSDIPISMDNFLSEALDLTRDQVEAAVRAL-RPDMIFFDFAQWVPEMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + +   T  A + +     G            PP  +PS SKV  RE++A+
Sbjct  124   KEHMIKSVSYIIVCATTIAHTHVPGGKLGV-----------PPSSYPS-SKVFFRENDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              ++  L++   R+  + ++   LK CD IA R C E+EG +C+YI+ +  K V   GP+ 
Sbjct  172   ALAT-LSIFYKRL--YHQITTGLKNCDVIAMRTCKEIEGKFCDYISRQYHKKVLLTGPMF  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP   +PLE+  + +L  F P SV+FC+FGS+++L K+QF +L LG+ELTGLPFLVAVK
Sbjct  229   PEPDTTKPLEEHWSHFLSGFTPKSVVFCSFGSQIILEKDQFQELCLGMELTGLPFLVAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS++++ LP+GF+ER KG+ +V GGWV Q +IL H ++G FVNH G G++WESL S
Sbjct  289   PPRGSSTVQEGLPQGFEERVKGRGVVWGGWVQQPLILSHPSIGCFVNHCGPGTIWESLVS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-----  1557
              C++++  P  SD  L  RLM EE E +VEV  ++   F KE+L NAIKSVM ++     
Sbjct  349   DCQMVLI-PFLSDQVLFTRLMTEEFEVSVEVYREKTGWFSKESLSNAIKSVMDKDSDLGK  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
             + + NH K +++L++PG    Y+D+F+  L E
Sbjct  408   LVRSNHTKLKEILVSPGLLTGYVDNFVEALQE  439



>ref|XP_003543299.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=461

 Score =   322 bits (825),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 199/456 (44%), Positives = 292/456 (64%), Gaps = 13/456 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             +HIAM+PW A GHFIPFL L+N LAKRGH+IS ++P     K++H+N +P LIT   +T+
Sbjct  9     MHIAMYPWFAMGHFIPFLHLSNKLAKRGHKISFIVPKRTQTKIQHLNQHPHLITLVPITV  68

Query  496   PQVEGLPPGAETTADTM-NLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP  AETT+D + +    L  A+D ++ +++ +L ++ KP +VF+DF++W+P L 
Sbjct  69    PHVDGLPHDAETTSDVLFSFFPLLATAMDRIEKDIELLLREL-KPQIVFFDFSFWLPNLA  127

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +G K+V++ + +  +S     + +    GR ++  D  +P PGFP DS + L EHEA 
Sbjct  128   RSLGIKSVQYFIVN-AVSVAYFGSPERYHNGRDLSETDFTKPSPGFP-DSSITLHEHEAQ  185

Query  853   QVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpl  1029
              V R   +   + + ++DR     +  DAI F+ C E+EG Y +Y+ T+ GKPV  +GPL
Sbjct  186   FVVRMGKVEFGSGVLMYDRFDIGTRLSDAIGFKGCREIEGPYVDYLETQHGKPVLLSGPL  245

Query  1030  lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAV  1209
             LPEPP       K  +WLE+F P SVIFCA+GSE  L + QF +LLLGLELTG PFL A+
Sbjct  246   LPEPPNTTLE-GKWVKWLEEFNPGSVIFCAYGSETTLQQNQFLELLLGLELTGFPFLAAL  304

Query  1210  KPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLA  1389
             KPP    SIE+ALPEGF+ER +G+ +V+ GWV Q +IL H +VG F+ H G+GS+ E+L 
Sbjct  305   KPPNGFESIEEALPEGFRERVQGRGVVYEGWVQQQLILGHPSVGCFITHCGAGSITEALV  364

Query  1390  SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDEND--KFFKENLCNAIKSVMGENIQ  1563
             S C+++  P   SDY + AR+M+ EL+  VEV+  E D   F KE++C A+K VM +  +
Sbjct  365   SECQLVFLPRLGSDYVITARMMSRELKVGVEVEKSEEDDGSFTKESVCKAVKIVMDDENE  424

Query  1564  -----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  + NH+K R++LL+      ++D    KL  L
Sbjct  425   LGRQVRENHRKVRNILLSNNLESFHVDILCDKLRAL  460



>ref|XP_004487585.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Cicer arietinum]
 gb|AGU14140.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   321 bits (823),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 293/460 (64%), Gaps = 12/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             ME   LH+AMFPW A GHF PFL L+N LA+RGH+IS  +P   L KL+H+NL+P LITF
Sbjct  1     MEAPPLHLAMFPWFAMGHFTPFLHLSNKLAQRGHKISFFIPKKTLNKLQHLNLHPHLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P V+GLP GAETT+D   +L   +  A+D    E++ +LL+  KP +VF+DF YW
Sbjct  61    FTINVPHVDGLPYGAETTSDVPFSLFPLIATAMDQTDKEIE-LLLKELKPQIVFFDFQYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K+V++ + +P  +A  L T   + +GR +T AD+M+PP GFP  S +   
Sbjct  120   LPNLTKKLGIKSVQYMIINPMTTAY-LGTGPRQSQGRELTEADLMKPPSGFPG-SCIKFH  177

Query  838   EHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              +E   ++   N+   + + +  R+       DAI ++ C E++G Y  Y+ T  GKPV 
Sbjct  178   SYELRYLASIGNVVFGSGVLLMYRLDTGTSLADAIGYKGCKEIDGPYVEYLRTIYGKPVL  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              +GPLLPEP       +K   WL+ F+  SV++CA+GSE  L   QF +LLLGLELTG P
Sbjct  238   LSGPLLPEPTLSSLE-EKWVSWLKGFKLGSVVYCAYGSESALEHNQFKELLLGLELTGFP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FLVA+KPP    SIE+ALP+GF ER KG+ I++GGWV Q +IL H +VG F+ H G+ S+
Sbjct  297   FLVALKPPIGFESIEEALPQGFNERVKGRGIIYGGWVQQQLILEHSSVGCFITHCGAASI  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMG  1551
              E L + C++++ P   SD+ +NAR+M+ +L+  VEV+  E D  F KE++C A+ +VM 
Sbjct  357   TEGLVNMCQLVLLPHVGSDHIMNARMMSAKLKVGVEVEKGEEDGLFTKESVCKAVNTVMD  416

Query  1552  ENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E  +     + NH K R++LL+     + +DSF  +LY+L
Sbjct  417   EENEVGREVRANHAKLRNILLSNNLKSSCVDSFCQELYDL  456



>ref|XP_010537036.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Tarenaya hassleriana]
Length=461

 Score =   321 bits (822),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 306/459 (67%), Gaps = 11/459 (2%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M  S +H+ MFPW AFGH  PFL LAN LA++GH+++ LLP  A  +L+++NL+P+ I+F
Sbjct  1     MGGSKIHVLMFPWFAFGHMTPFLHLANKLAEKGHKVTYLLPKKAQEQLENLNLHPESISF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +++P V  LP GAET +D  ++L  SL  A+D  +D+V+A +  + KP+L+FYDFA+W
Sbjct  61    NLVSVPSVNDLPAGAETASDIPISLSSSLASAMDLTRDQVEARVHAL-KPDLIFYDFAHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             IPE+   +G KTV +   S    A+SL+      +    T  +++ PPPG+PS SKVV  
Sbjct  120   IPEIAQRIGVKTVCYVTVSAATVAISLVPGLISSRDGPKTEDELVIPPPGYPS-SKVVFY  178

Query  838   EHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HEA  +  FL+LP  +  T ++RV+ AL +CDAI  R   E+E  +C YI ++  K V 
Sbjct  179   RHEARTL-LFLSLPFGDGTTFYERVIMALTKCDAICLRTYKELERKFCEYIESQYQKKVL  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
               GP+LP+P + +PLED+ + WL  FEP SV+FCA GS+++L K+QF +L LGLELTGLP
Sbjct  238   LTGPMLPDPDKTKPLEDRWSNWLSVFEPGSVVFCALGSQIILEKDQFQELCLGLELTGLP  297

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL  +KPP  +S+I++A P+GF+ER K + +++GGW+ Q +IL H +VG FV+H G GSM
Sbjct  298   FLAVLKPPNGTSAIQEAFPKGFEERVKDRGVIYGGWIQQPLILSHPSVGCFVSHCGFGSM  357

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
             WESL S  +I++  P+  D  LN RLMAEEL+ AVEV  D+   F KE+L +AI SV+ +
Sbjct  358   WESLMSDSQIVLI-PHLGDQILNTRLMAEELKVAVEVHRDKTGWFSKESLSHAIASVVDK  416

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + +     + N +  ++ L++PG    Y+D+F+ +L  L
Sbjct  417   DSETGTFLRKNRQMLKETLVSPGLTSCYVDNFVEELQNL  455



>gb|AFK39154.1| unknown [Lotus japonicus]
Length=457

 Score =   321 bits (822),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 196/460 (43%), Positives = 285/460 (62%), Gaps = 12/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M+ + +HIAMFPW A GH  PFL L+N LA+RGHRIS L+P     KL+H+NL+PQLITF
Sbjct  1     MDSAPMHIAMFPWFAMGHLTPFLHLSNKLARRGHRISFLIPKRTQAKLEHLNLHPQLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P V+GLP  AETT+D   +L  +L  ALD  + +++ +L+ + KP +VF+DF YW
Sbjct  61    VPITVPHVDGLPHDAETTSDVPFSLFSNLATALDLTEKDIEPLLMDL-KPQIVFFDFQYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P +   +G K+V++ + +P  SA     +    +G  +T  D M+PP GFP D  +   
Sbjct  120   LPNMARSLGIKSVQYFIVNPATSAY--FGTPRPSQGSEITEVDCMKPPLGFPDDPPLKFY  177

Query  838   EHEAYQVSRFLNLPRNRITVF-DRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HE   ++ F  +       F DR     +  D +AF+ C E+EG Y +Y+ +   KPV 
Sbjct  178   AHEIRFIASFAKVVFGSGIFFPDRFGMGTRFADLMAFKGCREIEGPYVDYLESVYKKPVL  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              +GPLLPEP       +K   WL KF+  SV+FCA+GSE  L + QF +LLLGLEL+G P
Sbjct  238   LSGPLLPEPSTSTLE-EKWVSWLGKFKAGSVVFCAYGSEGPLQQNQFQELLLGLELSGFP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL A+KPP    SIE+ALPEGF ER  G+ I +GGW+ Q +IL H +VG F+ H G  S+
Sbjct  297   FLAALKPPTGFESIEEALPEGFLERVHGRGIAYGGWIQQQLILEHPSVGCFITHCGGASI  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMG  1551
              E+L + C++++ P   SD+  NAR+M+ +L   VEV+  E D  F KE++C A+K+VM 
Sbjct  357   TEALVNTCQMVLLPRLGSDHVTNARVMSAKLRVGVEVEKGEEDGLFTKESVCKAVKTVMD  416

Query  1552  ENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             +  +     + NH K R+LLL+     + +D+F  +L +L
Sbjct  417   DESELGKEVRANHTKLRNLLLSENLESSCVDTFCQRLQKL  456



>emb|CDY70505.1| BnaAnng33940D [Brassica napus]
Length=445

 Score =   320 bits (821),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 204/455 (45%), Positives = 280/455 (62%), Gaps = 32/455 (7%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+P+ AFGH IP+L LAN LA++GH I+ LLP  A   L+ +NL+P+ I F  +
Sbjct  3     SKFHAFMYPYFAFGHMIPYLHLANKLAEKGHYITFLLPKKAQKHLESLNLFPESIFFHPI  62

Query  490   TIPQVEGLPPGAETTADTM-NLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             T+P VEGLP GAET +D   NL G  +  A+D L+D+++A +  + KP+L+F+D   W+P
Sbjct  63    TLPPVEGLPVGAETASDLPPNLTGKVISDAMDLLRDQIEAKVCAL-KPDLIFFDLTPWVP  121

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E G K+V F + S    A++L      G                FP  S   LR H
Sbjct  122   EMAKEFGVKSVSFQIVSAACVAIALAPGVELG----------------FPQPSG--LRGH  163

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A   S F+N   +   VF R++  +K CD ++ R C E+EG YC++I  E  + V+  G
Sbjct  164   DANLYSIFMN---SHKRVFSRIITGIKNCDVVSIRTCAEIEGKYCSFIERECQRKVFLTG  220

Query  1024  pllpeppreepl--eDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             P+  E         ED+  RWL  FEP SV+FCA GS+ +L K+QF +L LG+ELTGLPF
Sbjct  221   PMFLEAEENSVKPLEDQWNRWLNGFEPGSVVFCALGSQTILEKDQFQELCLGMELTGLPF  280

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             LVAVKPP  +S+I++ALP+GF+ER KG+ IV GGWV Q +IL H++VG FVNH GSGSMW
Sbjct  281   LVAVKPPRGASTIQEALPQGFEERVKGRGIVCGGWVEQPLILSHQSVGCFVNHCGSGSMW  340

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-  1554
             ESL S C+I+   P   D  L  +L++EE E +VEVQ +++  F KE+L +A+KSVM + 
Sbjct  341   ESLVSDCQIVFI-PQSGDQVLTTKLLSEEFEVSVEVQREDSGWFSKESLRDAVKSVMDKD  399

Query  1555  ----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                 NI K NH K R+ L  PG    Y D F+  L
Sbjct  400   SEIGNIVKRNHMKLRETLACPGLLSGYADKFVEAL  434



>ref|XP_002285228.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Vitis vinifera]
Length=458

 Score =   320 bits (821),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 303/460 (66%), Gaps = 15/460 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M  ++   IAM+PW AFGH  P+L L+N+LA+RGH+I+ +LP     +L+H+NL+P LIT
Sbjct  3     MARNTKFQIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPEKTQSQLQHLNLHPTLIT  62

Query  478   FCALTIPQVEGLPPGAETTADTMNLDGSL-EVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  LTIP V+GLPPGAET +D       L   A+D   D+V+A L  + KP+  F+DF Y
Sbjct  63    FHPLTIPHVDGLPPGAETASDVPFFSHHLLATAMDRTSDQVEAALRAL-KPDFFFFDFPY  121

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W P L S++G K++ ++    +  A      +   K   +T  D+  PPPG+PS + VVL
Sbjct  122   WAPALASKLGIKSIYYSAVCASAVAHHPPPGRQVSKDSTLTT-DV--PPPGYPSPT-VVL  177

Query  835   REHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             R HEA+ V +FL  P    + ++ R+   +K CDAI+ R C E+EG +C+Y+A++ GKPV
Sbjct  178   RSHEAWMV-QFLFAPFGEGVNLYQRLTTGMKGCDAISIRTCQEIEGPFCDYLASQYGKPV  236

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                GP+LP+P       D+ A+WL  F+P SVIFCAFGS+   GK+QF +LLLGLELTGL
Sbjct  237   LLTGPVLPKPLPTPLE-DRWAQWLGGFKPGSVIFCAFGSQNFPGKDQFQELLLGLELTGL  295

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP  +++IE+ALPEGFQER  G+ +VHGGWVPQ  IL H +VG FV+H G GS
Sbjct  296   PFLVALKPPTGAATIEEALPEGFQERVGGRGVVHGGWVPQPSILSHPSVGCFVSHCGFGS  355

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL S  +I++  P   D  LN RL+AE L+ AVE+  ++N  F KE+LC AI+SVM 
Sbjct  356   MWESLTSDPQIVLV-PELPDQILNTRLLAEVLKVAVEIDKEQNGWFSKESLCRAIRSVMD  414

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E      + + NH KW+  L   GF  NYID+F+ +L +L
Sbjct  415   EESEVGGLVRKNHAKWKKTLTGQGFMSNYIDNFVQQLQQL  454



>gb|AFJ52975.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=468

 Score =   320 bits (821),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 204/459 (44%), Positives = 286/459 (62%), Gaps = 19/459 (4%)
 Frame = +1

Query  319   HIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIP  498
             H+AMFPW AFGH  P+L LAN LA RGHR+S L+P     K   +N +P LITF  +T+P
Sbjct  13    HVAMFPWFAFGHITPYLHLANHLASRGHRVSFLIPKRTQSKFTKLNRHPHLITFHPITVP  72

Query  499   QVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVS  675
              V+GLPPGAET+ D    L   L  A D  Q +V+ IL ++  P+LV YD A+WIP L  
Sbjct  73    HVDGLPPGAETSYDAPFPLVMFLFTAFDRTQPQVREILTEL-NPSLVLYDLAHWIPSLGL  131

Query  676   EMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQ  855
             E+G K V +   S   SAL ++ S    KG  +T A++M PPPG+PS S VV R  E  Q
Sbjct  132   ELGFKKVAYVTASAVSSALRILPSVKMVKG--MTDAELMRPPPGYPS-SVVVPRLDEVDQ  188

Query  856   VSRFL--NLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpl  1029
              +RFL  +   + +  ++R+  +    DAIAFR C E+EG +C+Y+  + GKP+   GP+
Sbjct  189   -ARFLAEDFGGSAVPFYERLTASNSGGDAIAFRTCRELEGQFCDYLGQQYGKPILLTGPI  247

Query  1030  l--peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             L   +       ++K+  WL  F+  SV++CAFGSE+ LGK+QF +LL G EL GLPFL 
Sbjct  248   LPDEDKTPMTAEDEKLFSWLGNFDGGSVVYCAFGSEIALGKDQFQELLNGFELCGLPFLA  307

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             A+KPP   S++E+A PEGF+++ +G+  V GGWVPQ  IL H +VG FV+H G GSMWE 
Sbjct  308   ALKPPAGCSTVEEAFPEGFEDKVRGRGWVTGGWVPQQRILDHASVGCFVSHCGFGSMWEG  367

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQ-TDENDKFF--KENLCNAIKSVM--  1548
             L S C++++A P   D  +   LM  EL+ AVEV+     D+++  KE L  AI++VM  
Sbjct  368   LLSKCQLVMA-PTLGDQIMGTMLMVNELKVAVEVEKIKSGDRWWIAKEKLSEAIRAVMDG  426

Query  1549  -GENIQKV--NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              GE   +V  NH K+R++L      D Y+D F+ ++++L
Sbjct  427   DGEVGGEVRRNHLKFREVLGEKKVHDKYVDDFVVQIHDL  465



>ref|XP_004487587.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cicer arietinum]
 gb|AGU14138.1| UDP-glycosyltransferase [Cicer arietinum]
Length=455

 Score =   320 bits (820),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 204/460 (44%), Positives = 289/460 (63%), Gaps = 14/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             ME   LHIAMFPW A GHF PFL L+N LA+RGH+IS  +P   L KL+H+NL+P LITF
Sbjct  1     MEAPPLHIAMFPWFAMGHFTPFLHLSNKLAQRGHKISFFIPKKTLNKLQHLNLHPHLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P V+GLP GAETT+D    L   +  A+D  + +++ +L ++ KP +VF+DF +W
Sbjct  61    FTINVPHVDGLPHGAETTSDVPFPLFPLIATAMDQTEKDIELLLKEL-KPQIVFFDFQHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K+V+  + +P  +A          +GR +T  D+++PP GFP DS + L 
Sbjct  120   LPNLTKKLGIKSVQNWIMNPISTAY---LGNRPSQGRELTEVDLLKPPSGFP-DSCINLH  175

Query  838   EHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HE   +  F  L   + +  FDR+    K  DAIAF+ C E++G Y +YI   L KPV+
Sbjct  176   SHELRFLVSFKKLEFGSGVLFFDRLESGSKLSDAIAFKGCKEIDGIYADYIEMVLRKPVF  235

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              +GPLLPEP       +K   WL  F+  SV++CA+G+E  L   QF +LLLGLELTG P
Sbjct  236   LSGPLLPEPTLSSLE-EKWVSWLNGFKHGSVVYCAYGTESALEHNQFQELLLGLELTGFP  294

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FLVA+KPP    SIE+ALP+GF ER K + IV+GGWV Q +IL H +VG F+ H G+ S+
Sbjct  295   FLVALKPPIGFESIEEALPKGFNERVKERGIVYGGWVQQQLILEHSSVGCFITHCGAASI  354

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMG  1551
              E L + C++++ P   +DY LNAR+M+ +L+  VEV+  E D  F KE++C A+  VM 
Sbjct  355   TEGLVNTCQLVLLPHVGADYILNARMMSAKLKVGVEVEKGEEDGLFTKESVCKAVNIVMD  414

Query  1552  ENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E  +     + NH K R+ LL+     + +DSF  KLY+L
Sbjct  415   EGNEIGREVRANHAKMRNFLLSENLESSCVDSFCRKLYDL  454



>ref|NP_189604.1| UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
 sp|Q9LJA6.1|U79B4_ARATH RecName: Full=UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
 dbj|BAB01199.1| UDP-glycose: flavonoid glucosyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AEE77593.1| UDP-glycosyltransferase 79B4 [Arabidopsis thaliana]
Length=448

 Score =   319 bits (818),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 204/455 (45%), Positives = 285/455 (63%), Gaps = 26/455 (6%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  ++PW  FGH IP+L LAN LA++GHR++ L P  A  +L+ +NL+P  I F  +
Sbjct  3     SKFHAFLYPWFGFGHMIPYLHLANKLAEKGHRVTFLAPKKAQKQLEPLNLFPNSIHFENV  62

Query  490   TIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P V+GLP GAETTAD  N     L  A+D L+++++  +  + KP+L+F+DF  WIP+
Sbjct  63    TLPHVDGLPVGAETTADLPNSSKRVLADAMDLLREQIEVKIRSL-KPDLIFFDFVDWIPQ  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E+G K+V + + S    A+                A++  PPPGFPS SKV LR H+
Sbjct  122   MAKELGIKSVSYQIISAAFIAMFF-----------APRAELGSPPPGFPS-SKVALRGHD  169

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             A   S F N    R  +FDRV   LK CD IA R C E+EG+ C++I  +  + V   GP
Sbjct  170   ANIYSLFAN---TRKFLFDRVTTGLKNCDVIAIRTCAEIEGNLCDFIERQCQRKVLLTGP  226

Query  1027  llp--eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             +    +    +PLED+   WL  FEP+SV++CAFG+      +QF +L LG+ELTGLPFL
Sbjct  227   MFLDPQGKSGKPLEDRWNNWLNGFEPSSVVYCAFGTHFFFEIDQFQELCLGMELTGLPFL  286

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAV PP  SS+I++ALPEGF+ER KG+ IV GGWV Q +IL H ++G FVNH G GSMWE
Sbjct  287   VAVMPPRGSSTIQEALPEGFEERIKGRGIVWGGWVEQPLILSHPSIGCFVNHCGFGSMWE  346

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE-  1554
             SL S C+I+   P   D  L  RL+ EELE +V+V+ DE   +F KE+L + +KSVM + 
Sbjct  347   SLVSDCQIVFI-PQLVDQVLTTRLLTEELEVSVKVKRDEITGWFSKESLRDTVKSVMDKN  405

Query  1555  ----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                 N+ + NHKK ++ L++PG   +Y D F+ +L
Sbjct  406   SEIGNLVRRNHKKLKETLVSPGLLSSYADKFVDEL  440



>ref|XP_010442973.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Camelina sativa]
Length=447

 Score =   319 bits (818),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 208/453 (46%), Positives = 284/453 (63%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  P+L LAN LA+ GHR++ LLP  A  +L+H NL+P+ I F  LTI
Sbjct  5     FHAFMFPWFAFGHMTPYLHLANKLAENGHRVTFLLPKKAQKQLEHQNLFPESIVFHPLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAET +D  ++L   L  A+D  +D+V+A +  + +P+L+F+DFAYW+ E  
Sbjct  65    PHVGGLPAGAETASDIPISLGKFLTAAMDLTRDQVEAAVRDL-RPDLIFFDFAYWVAETA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + V S    A  L+     G            PPPG+PS SKV+ REH+A+
Sbjct  124   KEHRVKSVMYFVISANSIAHELVPGGKLGV-----------PPPGYPS-SKVLYREHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F ++   R+  + R+   L  CD I+ R C E+EG +C+YI ++  + V   GP+L
Sbjct  172   ALLTF-SIFYERL--YHRITTGLMNCDFISIRTCKEVEGKFCDYIESQYQRKVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             P+P   + LED+ + WL +FEP SVI+CA GS++ L K QF +L LG+ELT LPFLVAVK
Sbjct  229   PDPDNNKALEDRWSHWLNRFEPGSVIYCALGSQINLEKHQFQELCLGMELTSLPFLVAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ +  I++ALPEGF+ER K + +V G WV Q +IL H +VG FVNH G GSMWESL S
Sbjct  289   PPKGAVKIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSVGCFVNHCGFGSMWESLVS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P   D  LN RLM EELE +VEVQ +E   F KE+L  AI SVM +     N
Sbjct  349   DCQIVLL-PYLCDQVLNTRLMTEELEVSVEVQREETGWFSKESLSVAITSVMDKDSEVGN  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               + NH K +++L++PG    Y D F+  L  L
Sbjct  408   RVRRNHAKMKEILVSPGLLTGYTDEFVETLQNL  440



>ref|XP_009147894.1| PREDICTED: UDP-glycosyltransferase 79B5-like isoform X1 [Brassica 
rapa]
 ref|XP_009147895.1| PREDICTED: UDP-glycosyltransferase 79B5-like isoform X2 [Brassica 
rapa]
Length=445

 Score =   319 bits (817),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 203/455 (45%), Positives = 280/455 (62%), Gaps = 32/455 (7%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+P+ AFGH IP+L LAN LA++GH I+ LLP  A   L+ +NL+P+ I F  +
Sbjct  3     SKFHAFMYPYFAFGHMIPYLHLANKLAEKGHYITFLLPKKAQKHLESLNLFPESIFFHPI  62

Query  490   TIPQVEGLPPGAETTADTM-NLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             T+P VEGLP GAET +D   NL G  +  A+D L+D+++A +  + KP+L+F+D   W+P
Sbjct  63    TLPPVEGLPVGAETASDLPPNLTGKVISDAMDLLRDQIEAKVCAL-KPDLIFFDLTPWVP  121

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E G K+V + + S    A++L      G                FP  S   LR H
Sbjct  122   EMAKEFGVKSVSYQIVSAACVAIALAPGVELG----------------FPQPSG--LRGH  163

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A   S F+N   +   VF R++  +K CD ++ R C E+EG YC++I  E  + V+  G
Sbjct  164   DANLYSIFMN---SHKRVFSRIITGIKNCDVVSIRTCAEIEGKYCSFIERECQRKVFLTG  220

Query  1024  pllpeppreepl--eDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             P+  E         ED+  RWL  FEP SV+FCA GS+ +L K+QF +L LG+ELTGLPF
Sbjct  221   PMFLEAEENSVRPLEDQWNRWLNGFEPGSVVFCALGSQTILEKDQFQELCLGMELTGLPF  280

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             LVAVKPP  +S+I++ALP+GF+ER KG+ IV GGWV Q +IL H++VG FVNH GSGSMW
Sbjct  281   LVAVKPPRGASTIQEALPQGFEERVKGRGIVCGGWVEQPLILSHQSVGCFVNHCGSGSMW  340

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-  1554
             ESL S C+I+   P   D  L  +L++EE E +VEVQ +++  F KE+L +A+KSVM + 
Sbjct  341   ESLVSDCQIVFI-PQSGDQVLTTKLLSEEFEVSVEVQREDSGWFSKESLRDAVKSVMDKD  399

Query  1555  ----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                 NI K NH K R+ L  PG    Y D F+  L
Sbjct  400   SEIGNIVKRNHMKLRETLACPGLLSGYADKFVEAL  434



>dbj|BAE99810.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
Length=448

 Score =   319 bits (817),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 204/455 (45%), Positives = 285/455 (63%), Gaps = 26/455 (6%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  ++PW  FGH IP+L LAN LA++GHR++ L P  A  +L+ +NL+P  I F  +
Sbjct  3     SKFHAFLYPWFGFGHMIPYLHLANKLAEKGHRVTFLAPKKAQKQLEPLNLFPNSIHFENV  62

Query  490   TIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P V+GLP GAETTAD  N     L  A+D L+++++  +  + KP+L+F+DF  WIP+
Sbjct  63    TLPHVDGLPVGAETTADLPNSSKRVLADAMDLLREQIEVKIRSL-KPDLIFFDFVDWIPQ  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E+G K+V + + S    A+                A++  PPPGFPS SKV LR H+
Sbjct  122   MAKELGIKSVSYQIISAAFIAMFF-----------APRAELGSPPPGFPS-SKVALRGHD  169

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             A   S F N    R  +FDRV   LK CD IA R C E+EG+ C++I  +  + V   GP
Sbjct  170   ANIYSLFAN---TRKFLFDRVTTGLKNCDVIAIRTCAEIEGNLCDFIERQCQRKVLLTGP  226

Query  1027  llp--eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             +    +    +PLED+   WL  FEP+SV++CAFG+      +QF +L LG+ELTGLPFL
Sbjct  227   MFLDPQGKSGKPLEDRWNNWLNGFEPSSVVYCAFGTHFFFEIDQFQELCLGMELTGLPFL  286

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAV PP  SS+I++ALPEGF+ER KG+ IV GGWV Q +IL H ++G FVNH G GSMWE
Sbjct  287   VAVMPPRGSSTIQEALPEGFEERIKGRGIVWGGWVEQPLILSHPSIGCFVNHCGFGSMWE  346

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE-  1554
             SL S C+I+   P   D  L  RL+ EELE +V+V+ DE   +F KE+L + +KSVM + 
Sbjct  347   SLVSDCQIVFI-PQLVDQVLTTRLLTEELEVSVKVKRDEITGWFSKESLRDTVKSVMDKN  405

Query  1555  ----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                 N+ + NHKK ++ L++PG   +Y D F+ +L
Sbjct  406   SEIGNLVRRNHKKLKETLVSPGLLGSYADKFVDEL  440



>emb|CAN63555.1| hypothetical protein VITISV_034119 [Vitis vinifera]
Length=458

 Score =   319 bits (817),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 303/460 (66%), Gaps = 15/460 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M  ++   IAM+PW AFGH  P+L L+N+LA+RGH+I+ +LP     +L+H+NL+P LIT
Sbjct  3     MARNTKFXIAMYPWFAFGHLTPYLHLSNELAERGHKITFILPEKTQSQLQHLNLHPTLIT  62

Query  478   FCALTIPQVEGLPPGAETTADTMNLDGSL-EVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  LTIP V+GLPPGAET +D       L   A+D   D+V+A L  + KP+  F+DF Y
Sbjct  63    FHPLTIPHVDGLPPGAETASDVPFFSHHLLATAMDRTXDQVEAALRAL-KPDFFFFDFPY  121

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W P L S++G K++ ++    +  A      +   K   +T  D+  PPPG+PS + VVL
Sbjct  122   WAPALASKLGIKSIYYSAVCASAVAHHPPPGRQVSKDSTLTT-DV--PPPGYPSPT-VVL  177

Query  835   REHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             R HEA+ V +FL  P    + ++ R+   +K CDAI+ R C E+EG +C+Y+A++ GKPV
Sbjct  178   RSHEAWMV-QFLFAPFGEGVNLYQRLTTGMKGCDAISIRTCQEIEGPFCDYLASQYGKPV  236

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                GP+LP+P       D+ A+WL  F+P SVIFCAFGS+   GK+QF +LLLGLELTGL
Sbjct  237   LLTGPVLPKPLPTPLE-DRWAQWLGGFKPGSVIFCAFGSQNFPGKDQFQELLLGLELTGL  295

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP  +++IE+ALPEGFQER  G+ +VHGGWVPQ  IL H +VG FV+H G GS
Sbjct  296   PFLVALKPPTGAATIEEALPEGFQERVGGRGVVHGGWVPQPSILSHPSVGCFVSHCGFGS  355

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL S  +I++  P   D  LN RL+AE L+ AVE+  ++N  F KE+LC AI+SVM 
Sbjct  356   MWESLTSDPQIVLV-PELPDQILNTRLLAEVLKVAVEIDKEQNGWFSKESLCRAIRSVMD  414

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E      + + NH KW+  L   GF  NYID+F+ +L +L
Sbjct  415   EESEVGGLVRKNHAKWKKTLTGQGFMSNYIDNFVQQLQQL  454



>gb|KFK30258.1| hypothetical protein AALP_AA7G237800 [Arabis alpina]
Length=452

 Score =   319 bits (817),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 194/467 (42%), Positives = 290/467 (62%), Gaps = 27/467 (6%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+PW A GH  PF+ LAN L ++GHR++ LLP  AL + +H+NLYP  I F  +
Sbjct  3     SKFHALMYPWFATGHITPFMHLANKLGEKGHRVTFLLPKKALKQFEHLNLYPHHIVFRTV  62

Query  490   TIPQVEGLPPGAETTAD-----TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             T+P V+GLP G ET+++     T  L  ++++    ++D V+A+     KP+++F+DFA+
Sbjct  63    TVPHVDGLPLGVETSSEIPISSTNLLASAMDLTRSQVEDVVRAL-----KPDVIFFDFAH  117

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             WIPE+  E G K+V + +      A  ++ +            +   PPPG+PS SKV+L
Sbjct  118   WIPEVAREFGAKSVDYLLLCAAAVANLIVHA----------GGEFDVPPPGYPS-SKVLL  166

Query  835   REHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              + +AY +    N   +     +R + +  +CD I  +AC E EG +C Y+ +++ K + 
Sbjct  167   HKKDAYSMKPLANSTEDLDAFKERFIASFTKCDVIMIKACKEFEGKFCTYVESKMDKKIL  226

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
               GP+L       PLE++ + WL +FE  SV+FCAFGSE ++ ++QF +L LG+ELTGLP
Sbjct  227   FTGPMLHHADATIPLEEEWSNWLSRFELGSVVFCAFGSETIMERDQFQELCLGMELTGLP  286

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FLVAVKPP  +++I++ALPEGF+ER KG+ +V GGWV Q +IL H +VG FV+H G GSM
Sbjct  287   FLVAVKPPRGTTTIQEALPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVSHCGLGSM  346

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
             WESL S C+I++  P  ++  +NARLM++ELE +VEV  +E   F KE+L + IKSVM  
Sbjct  347   WESLVSDCQIVLV-PQIAEQIINARLMSQELEVSVEVAREETGWFSKESLRDNIKSVMDR  405

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ*MPIP  1680
             + +     + NH KWR  L +PG  + Y+D  I  L +L V  +  P
Sbjct  406   DSELGNRVRNNHTKWRKTLTSPGLVNGYVDDLIESLKDLIVHALDKP  452



>ref|XP_004487586.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
Length=459

 Score =   319 bits (817),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 196/461 (43%), Positives = 287/461 (62%), Gaps = 12/461 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAMFPW A GH  P+L L+N LAKRGH+IS  +P     KL+  NLYP LIT
Sbjct  1     MDSPSSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNLIT  60

Query  478   FCALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  L +P V+GLP GAETT+D + +L   +  A+D  Q++++ +L Q+  P ++F+DF +
Sbjct  61    FFPLNVPHVDGLPLGAETTSDVSFSLGPLIMTAMDQTQNQIELLLTQL-NPQIIFFDFTF  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W+P++   +G K+  + + +P  ++ +  +     +   +T  D+M+PP G+P  S   L
Sbjct  120   WLPKISQSLGIKSFLYLIVNPATTSYT-TSPLRMCEAEKLTEVDLMKPPKGYPISS-FNL  177

Query  835   REHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             + HEA  ++    L   + +  +DR+   L   DAI F+ C E+EG Y +Y+  + GKPV
Sbjct  178   QFHEAKHLASKRKLEFGSGVLFYDRIFHGLSFADAIGFKGCREIEGSYVDYLQEQFGKPV  237

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
               +GP+LPE P+     +K   WL  F+  S+++CA GSE +L ++QFH+LLLGLELTG 
Sbjct  238   LLSGPVLPEQPKTFLD-EKWGSWLGGFKDGSLVYCALGSEWILKQDQFHELLLGLELTGF  296

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL  VKPP    +IEDALPEGF+ER K K IVH GW+ Q +IL H +VG FV H G+GS
Sbjct  297   PFLAIVKPPIGFETIEDALPEGFKERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGAGS  356

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM  1548
             + E L + C++++ P   SD+ +NA++M   L+  VEV+  E D  F KE++C A+K VM
Sbjct  357   LTEGLMNSCQMVLLPHLDSDHIINAKIMGRHLKVGVEVKKGEEDGLFTKESVCEAVKIVM  416

Query  1549  GENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              +  +     ++NH K R LLL+ G     +D+F  KL EL
Sbjct  417   DDENEVGREVRINHAKVRSLLLSHGLESACVDTFCEKLQEL  457



>ref|XP_009132456.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Brassica rapa]
Length=447

 Score =   318 bits (815),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 205/456 (45%), Positives = 298/456 (65%), Gaps = 19/456 (4%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  MFPW  FGH   FL LAN LA++GH+I+ LLP  AL +L+ +NL+P+ I F  L
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPECIVFHTL  62

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             TIP V+GLP GA+TTAD  + L G L  A+D  + +V+  + ++ KP+L+F+DFA+WIPE
Sbjct  63    TIPSVDGLPDGAQTTADIPITLGGFLASAMDRTRGQVEEAV-RLGKPDLIFFDFAHWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G K V F   S    A+S +  +S          ++  PPPG+PS SKVVLR  E
Sbjct  122   VAKEYGAKCVNFLTISAACVAISFVPGRS--------PDELTVPPPGYPS-SKVVLRGQE  172

Query  847   AYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                +S FL+ P  + +T ++R++  L +CD I+ R C E+EG +C++I  E  + V   G
Sbjct  173   TNFLS-FLSYPFGDGVTFYERIMTGLVKCDVISIRTCQEIEGIFCDFIEREFQRKVLLTG  231

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLED+  +WL +FEP SV++C+ GS+++L KE+F +L LG+ELTGLPFLV
Sbjct  232   PMLPEPDNIKPLEDRWHQWLNRFEPGSVVYCSLGSQIILEKEEFQELCLGMELTGLPFLV  291

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+ +S+I++ALPEGF++R K + +V G  V Q +IL H ++G FV+H G GSMWES
Sbjct  292   AVKPPKGASTIQEALPEGFEDRVKERGVVWGEGVQQPLILAHPSIGCFVSHCGFGSMWES  351

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE---  1554
             L + C+I+   P+  +   N RLM+EELE +VEV+ +E   F KEN+  A++SVM     
Sbjct  352   LLNDCQIVFI-PHLGEQIFNTRLMSEELEVSVEVKREETGWFSKENISGAVRSVMDNDTE  410

Query  1555  --NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               N+ + NH K ++ LL+ G    Y + ++  L +L
Sbjct  411   LGNLVRRNHAKLKESLLSSGIISGYANKYVEALEKL  446



>ref|XP_010421892.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=448

 Score =   318 bits (815),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 201/454 (44%), Positives = 296/454 (65%), Gaps = 24/454 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +L+H NL+P  I F  LT+
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTV  64

Query  496   PQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT+D ++++D  L  A+D  +D+V+A +    +P+L+F+DFA+WIPE+ 
Sbjct  65    PHVNGLPAGAETTSDISISMDNFLSEAMDLTRDQVEAAV-HASRPDLIFFDFAHWIPEVA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + + S T  A++ +       G          PPPG+PS +KV+ RE++A+
Sbjct  124   KEHMIKSVSYIIISAT--AIAHLREPDTPLGV---------PPPGYPS-TKVLCRENDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
                 F+ +P     ++ ++    K+CD IA R C EMEG +C+Y++ +  K V   GP+L
Sbjct  172   A---FITMPFFYERLYHQITTGFKKCDVIALRTCREMEGKFCDYVSHQYHKNVLLTGPML  228

Query  1033  peppreepleDK-IARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAV  1209
             PEP   +PLE++    +L  F P SVIFCA G+++VL K+QF +L LG+ELTGLPFL+AV
Sbjct  229   PEPDTSKPLEEQHWNHFLSGFPPGSVIFCALGTQIVLEKDQFQELCLGMELTGLPFLLAV  288

Query  1210  KPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLA  1389
             KPP  SS++++ LPEGF+ER KG+ +V GGWV Q +IL H +VG FVNH G G++WE L 
Sbjct  289   KPPRGSSTVQEGLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVNHCGPGTIWECLL  348

Query  1390  SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN----  1557
             S C++++  P   D  L  RL+ EE E +VEV  ++   F KE+L +A+KSVM ++    
Sbjct  349   SDCQMVLI-PFFGDQVLFTRLLTEEFEVSVEVSREKTGWFSKESLRDAVKSVMDKDSDLG  407

Query  1558  -IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              + + NH K +++L++PG    Y+D+F+  L +L
Sbjct  408   ELVRSNHAKLKEILISPGLFAGYVDNFVEALTDL  441



>ref|XP_007132838.1| hypothetical protein PHAVU_011G128700g [Phaseolus vulgaris]
 gb|ESW04832.1| hypothetical protein PHAVU_011G128700g [Phaseolus vulgaris]
Length=457

 Score =   318 bits (815),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 199/459 (43%), Positives = 288/459 (63%), Gaps = 12/459 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             ME   LHIAM+PWLA GH IPFL L N LA  GHRIS + P  A  KL+  NL+P+LITF
Sbjct  1     MEARPLHIAMYPWLAMGHQIPFLHLCNKLAIGGHRISFITPPKAQAKLEPFNLHPELITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P VEGLPP A+TTAD T  L  ++  A+D  +D+++ +L  + KP+LVFYDF +W
Sbjct  61    VTITVPHVEGLPPDAQTTADVTYPLQPNIMTAMDLTKDDIQTLLTHL-KPDLVFYDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K V + + S  +   +L  ++   +G  ++ +D+MEPP G+P +S + L 
Sbjct  120   MPTLTKKLGIKAVHYCIVSSVMVGYTLTPARYY-QGVDLSESDLMEPPQGYP-NSSIKLH  177

Query  838   EHEAYQVSRFL-NLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HEA   +R   +   + +  +DR   A+   D +A+R C E+EG Y +YI  +  KPV 
Sbjct  178   AHEACAFARKRKDTFGSDVLFYDRQFTAMNEADVLAYRTCREIEGPYLDYIGNQFNKPVL  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              +GP++ EPP  E   +K + WL  FEP ++++C FGSE  L  EQF +L+LGLELTG+P
Sbjct  238   ASGPVILEPPTTELE-EKFSTWLGGFEPGTMVYCCFGSECTLRPEQFQELVLGLELTGMP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL AVKPP    ++E A+PEGF+ER KG+  V+GGWV Q +IL H +VG F+ H GSGS+
Sbjct  297   FLAAVKPPVGFETVESAMPEGFEERVKGRGFVYGGWVMQQLILAHPSVGCFITHCGSGSL  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
              E+L + C++++  PN  D  LNAR+MA  LE  VEV+  E+  + K+N+C  +  VM E
Sbjct  357   SEALVNKCQLVLL-PNVGDQILNARMMANNLEVGVEVEKGEDGMYTKDNVCKVVSIVMDE  415

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + NH + R+ LL       Y  +F  +L E+
Sbjct  416   ENETSKKVRDNHTRIRETLLDKDLESYYFHNFCTRLREI  454



>emb|CBI20246.3| unnamed protein product [Vitis vinifera]
Length=425

 Score =   317 bits (812),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 214/460 (47%), Positives = 292/460 (63%), Gaps = 45/460 (10%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M+++   HI M+PW AFGH IP+L L+N+LA+RGH I+ +LP     +L+H+NL+P LI+
Sbjct  3     MVKNPRFHIVMYPWSAFGHMIPYLHLSNELAERGHSITFILPKKVQSQLQHLNLHPTLIS  62

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F +LTIP V+GLPPGAET +D  ++L   L  A+D   D+V+A L  + K + +FYD AY
Sbjct  63    FHSLTIPYVDGLPPGAETASDVPISLHHLLATAMDRTTDQVEAALRAL-KSDFLFYDTAY  121

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W P L S++G K + +T       +  L+  +   K R +       PPPG+PS S VVL
Sbjct  122   WAPPLASKLGMKPIFYTF------SYCLVLDQQISKSRPIPTG----PPPGYPS-STVVL  170

Query  835   REHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             R HEA ++ +FL  P    IT  +R+  A+K CD ++ R C E+EG +C+YI        
Sbjct  171   RPHEA-RLLQFLLFPFGEDITFHERLTAAIKLCDVVSIRTCQEIEGPFCDYIER------  223

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                               + A+WL  F+P SVIFCAFGS+   GK+QF +LLLG ELTGL
Sbjct  224   ------------------RWAQWLSGFKPGSVIFCAFGSQNFPGKDQFQELLLGFELTGL  265

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL A+KPP  +++IE+ALPEGFQER  G+ +V+GGWVPQ  IL H +VG FV+H G GS
Sbjct  266   PFLAALKPPLGAATIEEALPEGFQERVGGRGVVYGGWVPQPSILSHPSVGCFVSHCGFGS  325

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL S  +I++  P   D   NARL+AEEL+ AVEV+ +EN    KE LC AIKSVM 
Sbjct  326   MWESLMSDPQIVLV-PELFDQTFNARLLAEELKVAVEVEKEENGWVSKEGLCKAIKSVMD  384

Query  1552  EN-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E      + K NH KW++ L++ GF  NYID+F+ +L +L
Sbjct  385   EEGEVGCLVKKNHAKWKETLMSQGFMSNYIDNFVRQLLDL  424



>ref|XP_010277785.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=462

 Score =   318 bits (816),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 204/466 (44%), Positives = 298/466 (64%), Gaps = 14/466 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M  DS  H+ M+PW AFGH  PFL L+N LA+RGHRIS LLPT A  KL+  NL+P LI 
Sbjct  1     MGTDSTFHVVMYPWFAFGHLTPFLHLSNKLAERGHRISFLLPTKARAKLEAFNLHPDLIR  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  L +P V+GLP GAETT D  ++L   +  A+D  Q +V+A L  + KP+ +F+DF +
Sbjct  61    FVPLVVPHVDGLPAGAETTNDVPLHLQPLIMSAMDRTQPDVEAALKDL-KPDFIFFDFTH  119

Query  655   WIPELVSEMGCKTVKFTVFSP-TISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
              IP L   +G K++++ + S  TI+ L    S    +G  ++  D+M  PPGFP  S + 
Sbjct  120   CIPPLARRLGIKSIQYCITSAATIAYLLAPASIKLEEGAQLSEDDLMHQPPGFPPSSSIK  179

Query  832   LREHEAYQVSRFLNLPR--NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGK  1005
             L  HEA +++ F+      + ++  +R+  AL+  DA+ FR+C+E+EG +C Y+  + GK
Sbjct  180   LHRHEARKMT-FITYREYGSGVSFHERITWALRDSDAVCFRSCSEIEGPFCEYLEKQYGK  238

Query  1006  PVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglelt  1185
              V  +GP+LPEPP      D+ A+WL+ F+  SV++CAFGSE  L K+QF +L+LG ELT
Sbjct  239   IVLLSGPILPEPPTSSLE-DRWAKWLDGFKAGSVVYCAFGSECFLEKDQFQELVLGFELT  297

Query  1186  glpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGS  1365
             GLPF VA+KPP  + ++E+ALPEGF ER +G+ +V GGWV Q +IL H ++G FV+H G 
Sbjct  298   GLPFFVALKPPIGTETMEEALPEGFTERVRGRGVVEGGWVQQQLILGHPSIGCFVSHSGW  357

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKS  1542
              S+ ESL +  ++++ P +  D  ++ARLM+ +L+  VEV+  E D +F +EN+C A+K 
Sbjct  358   ASLIESLVNQPQLVLLPYS-GDQFVHARLMSGDLKVGVEVERREEDGWFTRENVCKAVKM  416

Query  1543  VMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
             VM E+ +     + N  + RD+ L  GF  +YID FI KL  L  Q
Sbjct  417   VMDEDNEVGREVRANRLRLRDVFLKQGFDSSYIDGFIEKLRTLIKQ  462



>gb|KDO77743.1| hypothetical protein CISIN_1g039043mg, partial [Citrus sinensis]
Length=449

 Score =   318 bits (814),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 203/455 (45%), Positives = 293/455 (64%), Gaps = 20/455 (4%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             ++PW A GH  PFL +AN LA+RGHRIS LLP  A+ K +  NL+  LITF  +++P+V+
Sbjct  1     IYPWFAMGHLTPFLHIANKLAERGHRISFLLPAKAITKFEPSNLHRNLITFIPVSVPRVD  60

Query  508   GLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMG  684
             GLPPGAETT D    L   L  A+D  +  ++++L  + KP+ VF+DF +W+P L  + G
Sbjct  61    GLPPGAETTNDVPFPLHPLLMTAMDLTEPAIESVLRHL-KPDFVFFDFTHWLPPLARKFG  119

Query  685   CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSR  864
              K+V + + SP      L++ + K + R +T  D++ PP GFP+ SK+ LR HEA  ++ 
Sbjct  120   IKSVLYCIISPATIGY-LLSPERKLRERTLTDNDLLRPPQGFPT-SKIRLRAHEARGLAA  177

Query  865   -FLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpep  1041
               +      ++   R + +L  CDAI F+ C E+EG YC+YI ++ GKPV  +GP LPE 
Sbjct  178   ATVKEFGGGLSFAKRNLLSLSECDAIGFKTCREIEGPYCDYIGSQFGKPVILSGPALPES  237

Query  1042  preepleDKIARW---LEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PR         RW   L  F+  S+IFCAFGSE VL KEQF +L+LG EL+GLPFLVA+K
Sbjct  238   PRFALE----ERWETLLGSFKSKSLIFCAFGSECVLNKEQFQELVLGFELSGLPFLVALK  293

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP    +IE ALPEGF+ER KG+  +HGGWV Q +IL+H +VG FV H GSGS+ E++ +
Sbjct  294   PPVGHDTIESALPEGFEERVKGRGFIHGGWVQQQLILKHPSVGCFVTHCGSGSLSEAMVN  353

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGENIQKV  1569
              C++++  PN  D  +NARLM EEL+  VEV+  DE+  F ++ +C A+K+V+ ++  +V
Sbjct  354   ECQLVLL-PNVGDQIINARLMGEELKVGVEVEKGDEDGLFTRDGVCKAVKAVIDDDHSEV  412

Query  1570  ------NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                   NH KWR+ L +    ++Y+D F+ KL+ L
Sbjct  413   GKEIKENHAKWREFLRSERLENSYLDGFVQKLHGL  447



>ref|XP_004248461.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Solanum lycopersicum]
Length=456

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 197/460 (43%), Positives = 291/460 (63%), Gaps = 19/460 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             MED  L   M+PW A GH   FL L+N LA RGH++  + PTN L KL+  N YP+LI F
Sbjct  1     MEDKKLTFIMYPWYAMGHLTSFLHLSNKLAHRGHKVFFVHPTNTLSKLEKFNRYPELINF  60

Query  481   CALTIPQVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
              ++T+P V+GLP GAETT+D    + +L   ALD    ++++ L+Q  KP+ +FYDFAYW
Sbjct  61    KSVTVPHVDGLPLGAETTSDVPIFNQNLLCQALDLTLPKIES-LIQEIKPHFIFYDFAYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P +  + G K+V +   +P+ S   L+  ++       + A++M+PPPGFP DS ++L 
Sbjct  120   VPSVARKYGVKSVHYCSITPS-SVGYLMRGEN-----PTSEAEMMQPPPGFPVDSSIMLH  173

Query  838   EHEAYQVSRFLNLPRNR----ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGK  1005
             +HEA  +    ++ +N     ++   R++ A +  DAIAF+   E+EG YC ++  +  K
Sbjct  174   KHEARLIIALHSMGKNSGSGSVSFTQRMLLAFQDGDAIAFKTTREIEGRYCEFVEHKFKK  233

Query  1006  PVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglelt  1185
             PV  AGP+LPEP      E+  ++WLEKF+  +VI CAFGSE  L ++QF +L+LGLELT
Sbjct  234   PVVLAGPVLPEPMETSNTEENWSKWLEKFQEKTVILCAFGSECKLKRDQFQELVLGLELT  293

Query  1186  glpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGS  1365
             G PF  A+KPP  + +IE+ALPEGF+ERT+GK IVH GW  Q ++L H +VG FV H G 
Sbjct  294   GYPFFAALKPPIEADTIEEALPEGFKERTQGKGIVHSGWAEQQLMLSHPSVGCFVTHCGG  353

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQ-TDENDKFFKENLCNAIKS  1542
              S+ E+L + C++++  PN  D  +N+RL   +L+A VEV+  +EN  F K+ +C AIK 
Sbjct  354   NSLSEALINECQLVLV-PNFGDQFINSRLFGGDLKAGVEVERNEENGSFTKDGVCKAIKM  412

Query  1543  VMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
             VM +  +     + N  KW++ LL+ G  D+YID  + KL
Sbjct  413   VMNDESEEGRKIRANRAKWKEFLLSKGLEDSYIDGLVQKL  452



>ref|XP_010446317.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Camelina sativa]
Length=447

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 289/454 (64%), Gaps = 23/454 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  P+L LAN LA+ GHR++ LLP  A  +L+H N++P  I F  LTI
Sbjct  5     FHAVMFPWFAFGHMTPYLHLANKLAENGHRVTFLLPKKAQKQLEHQNMFPDSIVFHPLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  ++L   L  A+D  +D+V+A +  + +P+L+F+D+AYW+ E+ 
Sbjct  65    PHVDGLPAGAETASDIPISLGKFLTAAMDLTRDQVEAAVRDL-RPDLIFFDYAYWVAEMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + V    ISA S+      G    V       PPPG+PS SKV+ REH+A+
Sbjct  124   KEHRVKSVMYFV----ISANSIAHEHVPGGKLGV-------PPPGYPS-SKVLYREHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  + ++   R+  + R+   L  CD I+ R C E+EG +C+YI ++  + V+  GP+L
Sbjct  172   ALLSY-SIYYERM--YHRITTGLMNCDFISIRTCKEVEGKFCDYIESQYQRKVFLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             P+P   + LED+ + WL +FE  SVI+CA GS++ L K QF +L LG+ELTGLPFLVAVK
Sbjct  229   PDPDNSKELEDRWSHWLSRFETGSVIYCALGSQIYLEKNQFQELCLGMELTGLPFLVAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+   +I++ALPEGF+ER K + +V G WV Q +IL H +VG FVNH G GSMWESL S
Sbjct  289   PPKGVETIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSVGCFVNHCGFGSMWESLVS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P   D  LN RLM EELE +VEVQ +E   F KE+L  AI SVM +     N
Sbjct  349   DCQIVLL-PYLCDQVLNTRLMTEELEVSVEVQREETGWFAKESLSVAITSVMDKDSEVGN  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYELS  1659
               + NH K +++L++PG    Y D F+  L  L+
Sbjct  408   RVRRNHAKKKEILVSPGLLTGYTDKFVETLQNLA  441



>ref|XP_003596668.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=461

 Score =   318 bits (814),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 203/462 (44%), Positives = 291/462 (63%), Gaps = 20/462 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             +HI+MFPW A GHF P+L  +N LA RGH+IS  +P N L KL+H+NL+P LITF  +T+
Sbjct  7     MHISMFPWFAMGHFTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITV  66

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP  AETT+D   +L   +  A+D    +++ +LL+  KP +VF+DF YW+P L 
Sbjct  67    PHVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIE-LLLKELKPQIVFFDFQYWLPNLT  125

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              ++G K++++ ++SP IS   L +   K +G  +T  D+ +PP GFP DS +    HE  
Sbjct  126   QKLGIKSLQYLIWSP-ISPAYLGSIPRKSQGTYLTEDDLKKPPTGFP-DSSIKFHSHEL-  182

Query  853   QVSRFLNLPRNR-----ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                RFL   R +     + ++DRV    K  DA++F+ C E++G Y +Y+ T  GKPV  
Sbjct  183   ---RFLASTRKQEFGSGVLLYDRVDTGTKFSDAVSFKGCREIDGLYADYLETVFGKPVLL  239

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +GPLLPE P+     +K   WLE F+  SV+FCA+GSE  L   QF +LLLGLELTG PF
Sbjct  240   SGPLLPEAPKSTLE-EKWLTWLEGFKHGSVVFCAYGSEGPLQHNQFQELLLGLELTGFPF  298

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+KPP    SIE+ALPEGF ER  GK IV+G W+ Q +IL H +VG F+ H G+ S+ 
Sbjct  299   LAALKPPIGFDSIEEALPEGFNERVNGKGIVYGNWIQQQLILEHPSVGCFITHCGAASIT  358

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE  1554
             E L + C++++ P   +D+ +NAR+M+ +L+  VEV+  E D  F KE++C A+K VM +
Sbjct  359   EGLVNTCQLVLLPRAGTDHIMNARMMSSKLKVGVEVEKGEEDGLFTKESVCKAVKIVMDD  418

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
               +     + NH K R+ LL+     + +DSF  KLY+L  Q
Sbjct  419   ENEVGKAVRANHAKMRNFLLSSNLESSCVDSFCQKLYDLLYQ  460



>ref|XP_003540412.2| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=478

 Score =   318 bits (816),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 207/494 (42%), Positives = 303/494 (61%), Gaps = 30/494 (6%)
 Frame = +1

Query  214   LLHICIQKHNTTQPNQFKKASSSASRKHMMEDSMLHIAMFPWLAFGHFIPFLQLANDLAK  393
             +L   +Q+  TT+      ++S+A          LH+A+FPW A GH  P L L+N LA+
Sbjct  1     MLLFFVQRQTTTKTEAAMDSTSAAP---------LHVAIFPWFAMGHLTPILHLSNKLAQ  51

Query  394   RGHRISlllptnallklKHMNLYPQLITFCALTIPQVEGLPPGAETTADT-MNLDGSLEV  570
             RGHRIS ++P     KL+H+NL+P LITF  +T+P+V+GLP  AETT+D   +L   L  
Sbjct  52    RGHRISFIVPKRTQTKLQHLNLHPHLITFVPITVPRVDGLPQDAETTSDIPFSLFPLLAT  111

Query  571   ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMGCKTVKFTVFSPTISALSLITSK  750
             ALD  + +++ +L ++ KP  VF+DF +W+P L   +G K+V + + +P +S   L    
Sbjct  112   ALDRTEKDIELLLREL-KPQFVFFDFQHWLPNLTRSLGIKSVAYFIVNP-LSIAYLGNGP  169

Query  751   SKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSRFLNLPR-----NRITVFDRVVE  915
              + +GR +T  D MEPP GFP D+ +  + HE     RFL   R     + + ++DR+  
Sbjct  170   RQSQGRELTEVDFMEPPQGFPDDACIKFQPHEL----RFLVSTRKLEFGSGVFLYDRLHT  225

Query  916   ALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpeppreepleDKIARWLEKFE  1095
             +    DAI F+ C E+EG Y  Y+ T  GKPV  +GPLLPEPP     E  +A WL +F+
Sbjct  226   STCLADAIGFKGCREIEGPYAEYLETVYGKPVLLSGPLLPEPPNTTLEEKWVA-WLGRFK  284

Query  1096  PNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKPPERSSSIEDALPEGFQERTK  1275
             P SVIFCA+GSE  L + QF +LLLGLELTG PFL A+KPP    SIE+ALPEGF ER K
Sbjct  285   PGSVIFCAYGSESPLPQNQFQELLLGLELTGFPFLAALKPPNGFVSIEEALPEGFSERVK  344

Query  1276  GKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASHCRIIVAPPNRSDYalnarlm  1455
             G+ +  GGWV Q +IL H +VG F+ H G+ S+ E+L + C+++  P   +D+ +NAR+ 
Sbjct  345   GRGVACGGWVQQQLILEHPSVGCFITHCGAASVTEALVNKCQLLFLPRLGADHVINARMF  404

Query  1456  aeeleaaVEVQT-DENDKFFKENLCNAIKSVM------GENIQKVNHKKWRDLLLTPGFA  1614
             +++L+  VEV+  DE+  F KE++C A+K+VM      G  +++ NH K R+ LL+    
Sbjct  405   SKKLKVGVEVEKGDEDGLFTKESVCKAVKTVMEDGNEVGRKVRE-NHAKLRNFLLSDSLE  463

Query  1615  DNYIDSFIHKLYEL  1656
                +D F  +L +L
Sbjct  464   STCVDGFCQQLQDL  477



>ref|XP_002866011.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42270.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=447

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 209/453 (46%), Positives = 286/453 (63%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW A+GH  P+L LAN LA++GHR++ LLP  A  +L+H NL+P  I F  LTI
Sbjct  5     FHAFMFPWFAYGHMTPYLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFYPLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  ++L   L  A+D  +D+V+A +  + KP+L+F+DFAYW+PE+ 
Sbjct  65    PHVDGLPDGAETASDIPISLGKFLTAAMDLTRDQVEAAVRAL-KPDLIFFDFAYWVPEMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + V S    A  L+     G            PPPG+PS +KV+ R H+A+
Sbjct  124   REHNVKSVLYFVVSANSIAHELVPGGELGV-----------PPPGYPS-TKVLYRGHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F  +   R+    R+   LK CD I+ R C E+EG +C+YI  +  + V   GP+L
Sbjct  172   ALLTF-AIFYERLHY--RITTGLKNCDFISIRTCKEVEGKFCDYIEKQYQRKVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP    PLED+   WL  FEP SVI+CA GS++ L K+QF +L LG+ELTGLPFLVAVK
Sbjct  229   PEPDNSRPLEDRWDHWLNHFEPGSVIYCALGSQITLEKDQFQELCLGMELTGLPFLVAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I++ALPEGF ER K   +V G WV Q +IL H +VG FVNH G GSMWESL S
Sbjct  289   PPKGAKTIQEALPEGFAERVKNHGVVWGEWVQQPLILAHPSVGCFVNHCGFGSMWESLVS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P   D  LN RLM+EELE +VEV+ +E   F KE+LC AI  VM +     N
Sbjct  349   DCQIVLL-PYLCDQVLNTRLMSEELEVSVEVKREETGWFSKESLCVAITLVMDKDSELGN  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + + NH K +++L++ G   +Y D F+  L +L
Sbjct  408   LVRTNHAKLKEVLVSHGLLTDYTDKFVETLQDL  440



>ref|NP_974524.1| UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
 sp|Q9M0P3.1|U79B7_ARATH RecName: Full=UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
 emb|CAB78073.1| putative protein [Arabidopsis thaliana]
 gb|AAW52558.1| At4g09500 [Arabidopsis thaliana]
 gb|AEE82758.1| UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
 gb|AHL38704.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=442

 Score =   316 bits (810),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 202/452 (45%), Positives = 292/452 (65%), Gaps = 23/452 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +L+H NL+P  I F  LT+
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTV  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT+D  ++LD  L  ALD  +D+V+A +  + +P+L+F+DFA WIP++ 
Sbjct  65    PPVNGLPAGAETTSDIPISLDNLLSKALDLTRDQVEAAVRAL-RPDLIFFDFAQWIPDMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + + S T  A + +     G             PPG+PS SKV+ RE++ +
Sbjct  124   KEHMIKSVSYIIVSATTIAHTHVPGGKLGVR-----------PPGYPS-SKVMFRENDVH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              ++  L++   R+  + ++   LK CD IA R C E+EG +C++I+ +  K V   GP+ 
Sbjct  172   ALAT-LSIFYKRL--YHQITTGLKSCDVIALRTCKEVEGMFCDFISRQYHKKVLLTGPMF  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP   +PLE++   +L  F P SV+FC+ GS+V+L K+QF +L LG+ELTGLPFL+AVK
Sbjct  229   PEPDTSKPLEERWNHFLSGFAPKSVVFCSPGSQVILEKDQFQELCLGMELTGLPFLLAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS++++ LPEGF+ER K + +V GGWV Q +IL H ++G FVNH G G++WESL S
Sbjct  289   PPRGSSTVQEGLPEGFEERVKDRGVVWGGWVQQPLILAHPSIGCFVNHCGPGTIWESLVS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-----  1557
              C++++  P  SD  L  RLM EE E +VEV  ++   F KE+L NAIKSVM ++     
Sbjct  349   DCQMVLI-PFLSDQVLFTRLMTEEFEVSVEVPREKTGWFSKESLSNAIKSVMDKDSDIGK  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
             + + NH K +++L++PG    Y+D F+  L E
Sbjct  408   LVRSNHTKLKEILVSPGLLTGYVDHFVEGLQE  439



>ref|XP_010446327.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Camelina sativa]
Length=447

 Score =   316 bits (810),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 201/453 (44%), Positives = 291/453 (64%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH IPFL LAN LA+ GH+++ LLP  A  +L+H NL+P  I F  LTI
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAQNGHKVTFLLPKKAQKQLEHHNLFPDSIVFHTLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  ++L+  L  A++  +D+ +A +  + +P+L+F+DF++W+PE+ 
Sbjct  65    PHVDGLPAGAETASDVPLSLEKFLTAAINLTRDQAEAAVRAL-RPDLIFFDFSHWVPEMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E G K+V + V      A SL+     G            PPPG+PS SKV+ RE +A+
Sbjct  124   KEHGVKSVMYFVAGAVSMAHSLVPGGEFGV-----------PPPGYPS-SKVLFREQDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +   L+      +++ R+   L  CD I+ R C E+EG +C+YI ++  + V   GP+ 
Sbjct  172   AL---LSFSIYYESLYHRLTTGLMNCDFISLRTCKEVEGKFCDYIESQYQRKVLLTGPMH  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP   + LE + + WL +FEP SVI+CA GS++ L K+QF +L LG+ELTGLPFLVAV+
Sbjct  229   PEPDNSKTLEARWSHWLSRFEPGSVIYCALGSQISLEKDQFQELCLGMELTGLPFLVAVR  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I++ALPEGF+ER K + +V G WV Q +IL H ++G FV+H G GSMWE+L S
Sbjct  289   PPKGAKTIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSIGCFVSHCGLGSMWEALVS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ---  1563
              C+I++  P  SD  LN RLM+EELE +VEVQ ++   F KE+L  AI SVM ++ +   
Sbjct  349   DCQIVLL-PYLSDQVLNTRLMSEELEVSVEVQREKTGWFSKESLSVAITSVMDKDSEVGN  407

Query  1564  --KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               + NH + +++L++PG    YID FI  L  L
Sbjct  408   RVRRNHARIKEILVSPGLLIGYIDEFIETLQNL  440



>ref|XP_004144602.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 ref|XP_004164963.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 gb|KGN43484.1| hypothetical protein Csa_7G041300 [Cucumis sativus]
Length=460

 Score =   317 bits (811),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 194/462 (42%), Positives = 285/462 (62%), Gaps = 13/462 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAMFPW AFGH  P+LQ+AN LAK+GH+IS L+P+   +KL+  N +P LIT
Sbjct  1     MAATSSLHIAMFPWFAFGHLAPYLQIANKLAKKGHKISFLIPSKTQVKLQPFNHFPNLIT  60

Query  478   FCALTIPQVEGLPPGAETTADTMNLD--GSLEVALDGLQDEVKAILLQMEKPNLVFYDFA  651
             F  + +P V+GLP GAE TAD  NL     +  A+D  Q ++K  LLQ+ KP+++F+DF 
Sbjct  61    FVPIIVPHVDGLPEGAEITADVSNLHEFNLIMTAMDLTQPQIKT-LLQLIKPHVIFFDFT  119

Query  652   YWIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             +WIP+L S++G K++ ++V S T  +  + T   +  G   T  + M+PP G  + S + 
Sbjct  120   FWIPKLASQLGIKSIYYSVISATTFSY-VFTPTRQLCGPDFTVDEFMQPPLGL-AISAIK  177

Query  832   LREHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             L  HEA  V+   N+   + +  F R    L   DAIAF+AC E+EG + +++ +E  KP
Sbjct  178   LHSHEAKNVTFMSNMIFGSDVRFFHRHFTGLCEADAIAFKACGEIEGPFVDFLISEFKKP  237

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V  +GP       +  LE +   WL KF+  SVI+CAFGSE  L K+QF +L+LG ELT 
Sbjct  238   VLLSGPDGDIQEPKTTLEHRWQEWLSKFKSGSVIYCAFGSECTLTKDQFQELVLGFELTN  297

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPFL  +KPP    ++  ALP+GF+ER +G+ +V+GGWV Q  IL H ++G FV H G+G
Sbjct  298   LPFLAVLKPPVGVDTVTAALPDGFEERVEGRGVVYGGWVQQQHILEHPSIGCFVTHCGAG  357

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSV  1545
             S+ E+L   C++++  P+  D+   AR ++  L+  VEV+  E+D FF KE++C A+K++
Sbjct  358   SLSEALVKKCQLVLL-PHVGDHFFRARTLSSCLKVGVEVEKREDDGFFTKESVCEAVKTL  416

Query  1546  MGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M E  +     +    K R+LLL     ++YI +FIH L  L
Sbjct  417   MDEGNERGKEIRATRAKLRELLLDKDLEESYIINFIHNLQSL  458



>gb|AAL09791.1| AT4g27560/T29A15_50 [Arabidopsis thaliana]
Length=461

 Score =   317 bits (811),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 200/449 (45%), Positives = 287/449 (64%), Gaps = 26/449 (6%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H+ M+PW A GH  PFL LAN LA++GH ++ L+P  AL +L+++NL+P  I F ++T+
Sbjct  6     FHVLMYPWFATGHMTPFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIAFRSVTV  65

Query  496   PQVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP G ET ++       L + A+D  +D+V+ ++  +E P+L+F+DFA+WIPE+ 
Sbjct  66    PHVDGLPVGTETVSEIPVTSADLLMSAMDLTRDQVEGVVRAVE-PDLIFFDFAHWIPEVA  124

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              + G KTVK+ V S +  A  L           V   ++  PPPG+PS SKV+LR+ +AY
Sbjct  125   RDFGLKTVKYVVVSASTIASML-----------VPGGELGVPPPGYPS-SKVLLRKQDAY  172

Query  853   QVSRFLNLPRNRITV----FDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
              +    +   N I V     +RV  +L   D IA R   E+EG++C+YI     K V   
Sbjct  173   TMKNLES--TNTINVGPNLLERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLT  230

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+ PEP +   LE++  +WL  +EP+SV+FCA GS+V+L K+QF +L LG+ELTG PFL
Sbjct  231   GPVFPEPDKTRELEERWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFL  290

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAVKPP  SS+I++ALPEGF+ER KG+ +V G WV Q ++L H +VG FV+H G GSMWE
Sbjct  291   VAVKPPRGSSTIQEALPEGFEERVKGRGVVWGEWVQQPLLLSHPSVGCFVSHCGFGSMWE  350

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             SL S C+I++  P   D  LN RL+++EL+ +VEV  +E   F KE+L +AI SVM    
Sbjct  351   SLLSDCQIVLV-PQLGDQVLNTRLLSDELKVSVEVAREETGWFSKESLFDAINSVMKRDS  409

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDS  1632
                N+ K NH KWR+ L +PG    Y++ 
Sbjct  410   EIGNLVKKNHTKWRETLTSPGLVTGYVEG  438



>ref|XP_006393137.1| hypothetical protein EUTSA_v10012257mg [Eutrema salsugineum]
 gb|ESQ30423.1| hypothetical protein EUTSA_v10012257mg [Eutrema salsugineum]
Length=450

 Score =   316 bits (810),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 202/454 (44%), Positives = 286/454 (63%), Gaps = 24/454 (5%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+P  AFGHFIP+L LAN LA++GHRI+ LLP  A  +L+ +NL+P  I    L
Sbjct  3     SKFHAFMYPCFAFGHFIPYLHLANKLAEKGHRITFLLPKKAKKQLESLNLFPYSIVLDPL  62

Query  490   TIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P V+GLP GAETTAD  NL+G  +  A++ L+D+++A +  + KP+L+F+DF +W+PE
Sbjct  63    TLPPVDGLPVGAETTADLSNLNGKVITDAMNLLRDQIEAKVRAL-KPDLIFFDFVHWVPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E+G K+V + + S    A++L      G             PPG+PS  K VLR H+
Sbjct  122   MAKEIGVKSVSYQIVSAACVAMALAPGAELG----------FPQPPGYPS-FKTVLRGHD  170

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             A   S F N   + + +F R    LK CD IA R   E+EG YC++I  +  + V   GP
Sbjct  171   ANLYSLFTN---SCLRLFGRTTTGLKNCDLIAIRTSKEIEGQYCSFIERQCERKVLLTGP  227

Query  1027  l--lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             +    +    +PLED+   WL  F+P S++FCA GS+  + K+QF +L LG+EL GLPFL
Sbjct  228   MFPESQEKSVKPLEDRWNHWLNGFKPGSLVFCALGSQNYIEKDQFQELCLGIELAGLPFL  287

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             +AVKP   SS+I++ALPEGF++R K + IV GGWV Q +IL H++VG FVNH GSGSMWE
Sbjct  288   IAVKPLGGSSTIQEALPEGFEDRVKERGIVWGGWVEQPLILSHQSVGCFVNHCGSGSMWE  347

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG---  1551
             SL S C+I+   P   D  L  RL++EEL+ +V+VQ +++  F KE+L +A+KSVM    
Sbjct  348   SLVSDCQIVFI-PQLGDQVLTTRLLSEELKVSVKVQREDSGWFSKESLRDAVKSVMDVDS  406

Query  1552  --ENIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                N+ K NH+K ++ L+ PG    Y D F+  L
Sbjct  407   EIGNLVKRNHEKLKETLVRPGLLSGYADKFVEAL  440



>emb|CDO96715.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   315 bits (808),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 209/449 (47%), Positives = 278/449 (62%), Gaps = 28/449 (6%)
 Frame = +1

Query  349   GHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVEGLPPGAE  528
             GH   FL ++N LA  GH+I  LLP     +LK  NLYP LI F  L +PQVEGLPPGAE
Sbjct  2     GHLTAFLHMSNKLADGGHKIFFLLPRKTQAQLKQFNLYPDLIDFIPLCVPQVEGLPPGAE  61

Query  529   TTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMGCKTVKFT  705
             TTAD   +L  +L +A+D  Q ++++IL ++ KP +VF+DF +W+P+L   +G K++ F 
Sbjct  62    TTADIPFHLQPNLRLAMDSTQPQIESILQEI-KPQVVFFDFTHWLPKLARRLGIKSIFFI  120

Query  706   VFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSRFLNLPR-  882
               S   S  +        +G   T AD+M+ PPGFPS S + L  HEA    R LN    
Sbjct  121   TMSSATSGYTF-------RGEQTTDADLMKAPPGFPS-SCIKLLSHEA----RGLNFAGK  168

Query  883   -----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpeppr  1047
                  + ++  +R++ + + CDAI F+ C EMEG YC +I  +  KPV  AGP+LPE P 
Sbjct  169   VKEIGSGLSFLERLLISAEDCDAIGFKTCREMEGPYCEFIERKFKKPVILAGPVLPEQPT  228

Query  1048  eepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKPPERS  1227
                  +K  +WL  F+  SVIFCAFGSE  L K+QF +LL GLELTGLPFL A+KPP  S
Sbjct  229   TTLE-EKWEKWLSGFKAKSVIFCAFGSECRLQKDQFQELLKGLELTGLPFLAALKPPIGS  287

Query  1228  SSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASHCRII  1407
              +IE ALPEGF ER +G+++V+GGWV Q +IL H +VG FV H GSGS+ E L + C+++
Sbjct  288   ETIEMALPEGFNERIQGRSVVYGGWVQQQLILAHSSVGCFVTHCGSGSLSEGLVNECQMV  347

Query  1408  VAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVM--GENIQK---V  1569
             +  P   D  +NARLM  +L   VEV+  DE+  F KE +C AI+ VM  G  I K    
Sbjct  348   LL-PQFGDQFINARLMGGDLRVGVEVEKGDEDGLFTKEGVCKAIRMVMDDGSEIGKEVRA  406

Query  1570  NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             NH KWRD LL  G   +YID FI+K+  L
Sbjct  407   NHAKWRDFLLREGTESSYIDEFINKMKRL  435



>gb|KHN13063.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=480

 Score =   317 bits (812),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 202/476 (42%), Positives = 290/476 (61%), Gaps = 31/476 (7%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             + +LHIAMFPW A GH  PFL L+N+LAKRGH+I+ LLP  A L+L+H+N +P LITF  
Sbjct  6     NHLLHIAMFPWFATGHMTPFLHLSNELAKRGHKITFLLPKKAKLQLQHLNNHPHLITFHT  65

Query  487   LTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LTIP V+GLP G ET ++  ++L+  L +A+D  +D+V+  L     P+ V YD AYW+P
Sbjct  66    LTIPHVKGLPHGTETASEIPISLNHLLVIAMDKTRDQVEHTL-SATNPDFVLYDNAYWVP  124

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             ++  ++G KT+ + V      A+ L+ +++  K R +T  ++ +PP G+PS SKVVL   
Sbjct  125   QIAKKLGIKTICYNVVCAASLAIVLVPARNVPKDRPITVEELSQPPEGYPS-SKVVLTGL  183

Query  844   EAYQVSRFLNLP--RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
             EA  +  F+++P   + IT +DR+  AL+  DAIA R   E+EG++C+YIA++ GK V  
Sbjct  184   EAESL-MFISVPFGEDNITFYDRITSALRESDAIAIRTSREIEGNFCDYIASQFGKKVLL  242

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
              GP+LPE    +   +  A WL+ F   S+++CAFGS++ L K+QF +LLLG EL+GLPF
Sbjct  243   TGPVLPEEAEGKLE-ENWANWLDAFANESIVYCAFGSQINLEKDQFQELLLGFELSGLPF  301

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             LVA+K P    S+E+ALPEGF+ER KG+ +V  GWV Q +IL+H +VG FVNH G GSMW
Sbjct  302   LVALKTPRGCESVEEALPEGFEERVKGRGVVSRGWVQQLLILKHPSVGCFVNHCGFGSMW  361

Query  1378  ESLASHCRIIVAPP-----------------NRSDYalnarlmaeeleaaVEVQTDENDK  1506
             ESL S  +I++ P                              A  L  AVEV+   N  
Sbjct  362   ESLMSDKQIVLVPQLGDQVLNTKLLVEELGVAGGGGGGGGGGGAASLGVAVEVERGGNGW  421

Query  1507  FFKENLCNAIKSVM------GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               KE+L  AIK VM      G  ++K NH +W+    +P   + Y+D F+  L + 
Sbjct  422   VSKESLSKAIKLVMDGDSEVGARVKK-NHMEWKKTGGSPNLMNGYMDRFVQNLQDF  476



>ref|XP_003607531.1| Glucosyltransferase [Medicago truncatula]
 gb|AES89728.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=462

 Score =   316 bits (810),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 197/461 (43%), Positives = 279/461 (61%), Gaps = 12/461 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAM+PW A GH  PFL LAN LAK+GH+I+   P +A  KL+  NLYPQLIT
Sbjct  1     MASSSPLHIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  + +P VEGLP  AETTAD    L   +  A+D  Q +++  L  + KP +VFYDF +
Sbjct  61    FITIKVPHVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNL-KPQIVFYDFTH  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             WIP L   +G K   + + S  +   SL T     +G  +T  D+M+PP G+P DS + L
Sbjct  120   WIPSLTKRLGIKAFHYCIISSIMVGYSL-TPARYSQGNNLTEFDLMQPPYGYP-DSSIRL  177

Query  835   REHEAYQVSRFL-NLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
               HEA  ++    N   + +  +DR   AL   DA+ +R C E+EG Y +Y+  +  K V
Sbjct  178   HSHEAKALAAMRKNTFGSNVLFYDRQAIALNEADALGYRTCREIEGPYLDYVQKQFNKSV  237

Query  1012  YCAGpllpeppreepleD-KIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
               +GP+L        + D K A WL  F+ +SV++C FGSE  L   QF +L+LGLEL+G
Sbjct  238   LTSGPVLQILENPNYVLDEKWATWLGGFKADSVVYCCFGSECTLIPNQFQELILGLELSG  297

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             +PF  A+KPP   ++IE+ALPEG  ER KG+ +V+GGWV Q +IL H +VG F+ H GSG
Sbjct  298   MPFFAALKPPFGFATIEEALPEGLAERIKGRGVVYGGWVQQQLILEHPSVGCFITHCGSG  357

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM  1548
             S+ E+L + C++++  PN  D  LNAR+MA  L+  VEV+ DE+  + K+++C A+  VM
Sbjct  358   SLSEALVNKCQLVLL-PNFGDRILNARIMANNLKVGVEVEKDEDGLYTKDSVCKAVSIVM  416

Query  1549  GENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              +  +     + NH K R++LL      +YID+F  KL E+
Sbjct  417   DDENETSKTVRANHAKIREMLLNKDLESSYIDNFCKKLQEI  457



>ref|XP_007213912.1| hypothetical protein PRUPE_ppa005654mg [Prunus persica]
 gb|EMJ15111.1| hypothetical protein PRUPE_ppa005654mg [Prunus persica]
Length=449

 Score =   316 bits (809),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 197/453 (43%), Positives = 285/453 (63%), Gaps = 13/453 (3%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             MFPW A GH  P++ LAN+LA RGHRI+LL+P  A L+L+H+ L+  LI F  + +P V 
Sbjct  1     MFPWFAIGHITPYIHLANELASRGHRITLLVPNKARLQLQHLVLHADLIVFSPVAVPHVH  60

Query  508   GLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMG  684
             GLP G E  ++  +++   L  A+D  + E++   L + K + V YD A W+P +    G
Sbjct  61    GLPEGTEIASEIPIHMTHLLATAMDRTRGEIEQ-FLTVSKLDFVLYDTAQWVPGIARRNG  119

Query  685   CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSR  864
              KTV + V      A++L+ +++  K R +T  ++ E P G+PS + VVL   EA  ++ 
Sbjct  120   IKTVCYNVVCAAALAIALVPARNVPKDRPITEEELREAPAGYPSKN-VVLCGAEAKALT-  177

Query  865   FLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG--pllp  1035
             F++LP    IT ++R   A+K CD ++ R C E+EG  C+Y+  +  KPV   G    L 
Sbjct  178   FISLPYGEGITFYERTTTAMKECDVLSIRTCRELEGDLCDYMEAQYKKPVILTGPVLGLG  237

Query  1036  eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKP  1215
                + E LE++  +W   FE  SV+FCAFG++ +L KEQF +L+LG ELTGLPF VA+KP
Sbjct  238   SDKKSEKLEERWEKWFSGFEAGSVVFCAFGTQWILEKEQFQELVLGFELTGLPFFVALKP  297

Query  1216  PERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASH  1395
             P   ++IE+ALP GF+ER KG+ +V GGWV Q+ IL HK+VG FVNH G GSMWESL + 
Sbjct  298   PSGCATIEEALPNGFEERVKGRGVVFGGWVQQTAILSHKSVGCFVNHCGFGSMWESLMTD  357

Query  1396  CRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ----  1563
              +I++  P+  D  LN +L+ +EL+ AVEV+ +EN    K++L  AIKSVM ++ +    
Sbjct  358   NQIVLV-PHLGDQILNTKLLVKELKVAVEVEREENGWLSKDSLRKAIKSVMDKDSEVGVM  416

Query  1564  -KVNHKKWRDLLLTPGFADNYIDSFIHKLYELS  1659
              K NH KW + L +PGF   YID F+ KL E+S
Sbjct  417   VKKNHAKWVETLSSPGFMSGYIDRFVQKLKEIS  449



>gb|KHN27959.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=461

 Score =   315 bits (807),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 290/460 (63%), Gaps = 21/460 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LH+A+FPW A GH  P L L+N LA+RGHRIS ++P     KL+H+NL+P LITF  +T+
Sbjct  9     LHVAIFPWFAMGHLTPILHLSNKLAQRGHRISFIVPKRTQTKLQHLNLHPHLITFVPITV  68

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P+V+GLP  AETT+D   +L   L  ALD  + +++ +L ++ KP  VF+DF +W+P L 
Sbjct  69    PRVDGLPQDAETTSDIPFSLFPLLATALDRTEKDIELLLREL-KPQFVFFDFQHWLPNLT  127

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +G K+V + + +P +S   L     + +GR +T  D MEPP GFP D+ +  + HE  
Sbjct  128   RSLGIKSVAYFIVNP-LSIAYLGNGPRQSQGRELTEVDFMEPPQGFPDDACIKFQPHEL-  185

Query  853   QVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                RFL   R     + + ++DR+  +    DAI F+ C E+EG Y  Y+ T  GKPV  
Sbjct  186   ---RFLVSTRKLEFGSGVFLYDRLHTSTCLADAIGFKGCREIEGPYAEYLETVYGKPVLL  242

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +GPLLPEPP     E  +A WL +F+P SVIFCA+GSE  L + QF +LLLGLELTG PF
Sbjct  243   SGPLLPEPPNTTLEEKWVA-WLGRFKPGSVIFCAYGSESPLPQNQFQELLLGLELTGFPF  301

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+KPP    SIE+ALPEGF ER KG+ +  GGWV Q +IL H +VG F+ H G+ S+ 
Sbjct  302   LAALKPPNGFVSIEEALPEGFSERVKGRGVACGGWVQQQLILEHPSVGCFITHCGAASVT  361

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVM--  1548
             E+L + C+++  P   +D+ +NAR+ +++L+  VEV+  DE+  F KE++C A+K+VM  
Sbjct  362   EALVNKCQLVFLPRLGADHVINARMFSKKLKVGVEVEKGDEDGLFTKESVCKAVKTVMED  421

Query  1549  ----GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                 G  +++ NH K R+ LL+       +D F  +L +L
Sbjct  422   GNEVGRKVRE-NHAKLRNFLLSDSLESTCVDGFCQQLQDL  460



>ref|XP_003596675.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES66926.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 205/459 (45%), Positives = 288/459 (63%), Gaps = 20/459 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAMFPW A GH  P+L L+N LA RGH+IS  +P N L KL+++NLYP LITF  +T+
Sbjct  7     LHIAMFPWFAMGHLTPYLHLSNKLALRGHKISFFIPKNTLNKLQYLNLYPNLITFFPITV  66

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP  AETT+D   +L   +  A+D  + +++ ILL+  KP +VF+DF YW+P+L 
Sbjct  67    PHVNGLPLDAETTSDVPFSLVPLIATAMDQTEKDIE-ILLKEIKPQIVFFDFQYWLPKLT  125

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +  K++++ + +P +S   L   +    G+ +T  DIM+PP GFP DS +   +HE  
Sbjct  126   KNLDIKSLQYIILTP-VSTAYLGCLQKLSLGKDLTDVDIMKPPSGFP-DSCIKFYKHEL-  182

Query  853   QVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                RFL   R     + + +FDR+       DA+ F+ CNE++G Y +YI T  GKPV  
Sbjct  183   ---RFLASTRKIAFGSGVFLFDRLHIGTTSADAVGFKGCNEVDGPYADYIETVFGKPVLL  239

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +GP+LPEP       +K   WL+ FE  SV+FCA+GSE  L K QF +LLLGLELTG PF
Sbjct  240   SGPVLPEPTNTTLE-EKWISWLKGFENGSVVFCAYGSEGPLEKNQFLELLLGLELTGFPF  298

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+KPP    SIE+ALPEGF ER KGK IV+G W+ Q +IL H +VG F+ H G+ S+ 
Sbjct  299   LAALKPPIGFESIEEALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASIT  358

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGE  1554
             E L + C++++ P   SD+ +NAR+M+ + +  VEV+  DE+  F KE++C A K VM +
Sbjct  359   EGLVNTCQLVLLPRLGSDHIMNARVMSSKFKVGVEVEKGDEDGLFTKESVCKAAKIVMDD  418

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + NH K R+ LL+     + +DSF  KLY L
Sbjct  419   ENEIGREVRANHAKMRNFLLSNNLESSCVDSFCQKLYHL  457



>ref|XP_004485850.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Cicer arietinum]
 gb|AGU14087.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 190/460 (41%), Positives = 289/460 (63%), Gaps = 13/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M  ++ H+AM+PW A GH   +L ++N LA+RGH+IS L+P N + KL+H NL+P LI+F
Sbjct  1     MVANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFLMPKNTISKLEHFNLHPNLISF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +TIP V GLP G+ETTAD   +L   L  A+D  +  ++  L ++ +P++VF+DF YW
Sbjct  61    IPITIPHVHGLPLGSETTADLPFSLHSLLMTAMDLTEPIIEDSLREL-RPHMVFFDFTYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K + +   SP      LI+ + K   +++T AD++ PPP FP  S + L+
Sbjct  120   LPALACQLGIKALHYCTISPATVGY-LISPERKLHEKSLTEADLINPPPSFPP-SAIKLQ  177

Query  838   EHEAYQV-SRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HEA  + +  +N     I+  +R + A   CDAI F+ C EMEG YC+Y+  ++ K V+
Sbjct  178   PHEARGLATSTVNGYGKDISFMERQLIAFTSCDAIVFKTCREMEGLYCDYLERQMRKQVF  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              AG  +   P    L++K   WL +F+P +VIFCAFGSE +L   QF +LLLG ELT +P
Sbjct  238   LAG-PVFPNPPTSTLKEKWVTWLGRFKPKTVIFCAFGSECILKSNQFKELLLGFELTKIP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             F+ A+K P  + +I+ A PEGF ERTKG+ +V G WV Q +IL H +VG FV H GSGS+
Sbjct  297   FIAALKLPIGAETIKSAFPEGFSERTKGRGVVEGDWVQQQLILSHPSVGCFVTHCGSGSL  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQ-TDENDKFFKENLCNAIKSVMG  1551
              E++ + C++++  P+  D  +NAR+M+ +L+  VEV+   EN  F +E +C A+  VM 
Sbjct  357   TEAMVNECQLVLL-PHAGDQFINARIMSGDLKVGVEVEKCKENGLFTREAVCKAVMDVMD  415

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                   ++ + NH KWR+ LL+ G  ++Y+D+ + KL  L
Sbjct  416   NESELGHMVRTNHAKWREFLLSKGLENSYVDNLVQKLDSL  455



>ref|XP_010482808.1| PREDICTED: UDP-glycosyltransferase 79B9 [Camelina sativa]
Length=447

 Score =   314 bits (805),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 204/453 (45%), Positives = 287/453 (63%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  P+L LAN LA+ GHR++ LLP  A  +L+H NL+P+ I F  LTI
Sbjct  5     FHAFMFPWFAFGHMTPYLHLANKLAENGHRVTFLLPKKAQKQLEHHNLFPESIVFHPLTI  64

Query  496   PQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D +++L   L  A+D  +D+V+A +  + +P+L+F+DFAYW+ E  
Sbjct  65    PHVDGLPAGAETASDISISLGKFLTAAMDLTRDQVEAAVRDL-RPDLIFFDFAYWVAETA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + V S    A  L+     G            PPPG+PS SKV+  EH+A+
Sbjct  124   KEHRVKSVMYFVISANSIAHELVPGGKLGV-----------PPPGYPS-SKVLYCEHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F ++   R+  + R+   L  CD I+ R C E+EG +C+YI ++  + V   GP+L
Sbjct  172   ALLTF-SIFYERL--YHRITTGLMNCDFISIRTCKEVEGKFCDYIESQYQRKVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             P+P   + LED+   WL ++EP SVI+CA GS++ L K+QF +L LG+ELTGLPF+VAVK
Sbjct  229   PDPDNSKALEDRWCHWLNRYEPGSVIYCALGSQINLEKDQFQELCLGMELTGLPFIVAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I++ALPEGF+ER K + +V G WV Q +IL H +VG FVNH G GSMWESL S
Sbjct  289   PPKGAVTIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSVGCFVNHCGFGSMWESLVS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ---  1563
              C+I++  P   D  LN RLM EELE +VEVQ +E   F KE+L  AI  VM ++ +   
Sbjct  349   DCQIVLL-PYLCDQVLNTRLMTEELEVSVEVQREETGWFSKESLSVAITLVMDKDSEVGN  407

Query  1564  --KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               + NH K +++L++PG    Y D F+  L  L
Sbjct  408   RVRRNHAKMKEILVSPGLLTGYTDEFVETLQNL  440



>ref|XP_003539949.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=461

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 203/461 (44%), Positives = 284/461 (62%), Gaps = 15/461 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             ME   LHIAM+PWLA GH   FL L N LA RGH+IS + P  A  KL+  NL+P  ITF
Sbjct  1     MESRPLHIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEAFNLHPNSITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P VEGLPP A+TTAD T  L   +  A+D  +D+++ +L  + KP+LVFYDF +W
Sbjct  61    VTITVPHVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLSGL-KPDLVFYDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L   +G K V +   S  +   +L  ++   +G  +  +D+MEPP G+P DS + L 
Sbjct  120   MPALAKSLGIKAVHYCTASSVMVGYTLPPARYH-QGTNLIESDLMEPPEGYP-DSSIKLH  177

Query  838   EHEA--YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
              HEA  +   R      N +  +DR   AL   D +A+R C E+EG Y +YI  +  KPV
Sbjct  178   AHEARAFAAKRKDTFGSN-VLFYDRQFIALNEADVLAYRTCREIEGPYLDYIEKQFNKPV  236

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                GP++ +PP  +   +K + WL  FEP SV++C FGSE  LG  QF +L+LGLELTG+
Sbjct  237   LATGPVILDPPTSDLE-EKFSTWLGGFEPGSVVYCCFGSECTLGPNQFQELVLGLELTGM  295

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL AVK P    ++E A+PEGF+ER KG+  V+GGWV Q +IL H +VG F+ H GSGS
Sbjct  296   PFLAAVKAPLGFETVESAMPEGFEERVKGRGFVYGGWVLQQLILAHPSVGCFITHCGSGS  355

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVM  1548
             + E+L + C++++  PN  D  LNAR+M   LE  VEV+  DE+  + +E++C A+  VM
Sbjct  356   LSEALVNKCQLVLL-PNVGDQILNARMMGNNLEVGVEVEKGDEDGMYTRESVCKAVSIVM  414

Query  1549  -GENIQ----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              GEN      + NH + R+LLL      +Y+DSF  +L E+
Sbjct  415   DGENETSKRVRGNHARIRELLLNKDLESSYVDSFCMRLQEI  455



>ref|XP_010245594.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nelumbo nucifera]
Length=461

 Score =   315 bits (806),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 203/461 (44%), Positives = 292/461 (63%), Gaps = 20/461 (4%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             M+PW A GH +PFL L+N LA+ GHR+S LLP     KL+H+N YP LI F  + IP V+
Sbjct  1     MYPWFAIGHIVPFLHLSNKLAENGHRVSFLLPPKTQSKLQHLNRYPDLIRFIPIAIPPVD  60

Query  508   GLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMG  684
             GLPP AETTAD       L V A++  +D+V+A L  + KP+ VF+DF+YW+P L  ++G
Sbjct  61    GLPPTAETTADVSRPIMPLLVDAMNLTKDQVEAALRNI-KPDFVFFDFSYWLPPLARQLG  119

Query  685   CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVS-  861
              K++ + V SP  ++  L+ ++       +T  ++M+PPPG+P DS + L  HE+  +  
Sbjct  120   IKSILYCVISPASTSYLLVPARKPDGIEQLTEEELMQPPPGYPPDSPIRLCRHESRSLLF  179

Query  862   RFLNLPRNR--ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllp  1035
              F    R    +T +DR   +++ CDA+ FR   EMEG YC+Y+ ++ GKPV   GP+LP
Sbjct  180   AFQKFSRTATGLTFYDRQTTSMRECDALCFRTYREMEGPYCDYMGSQYGKPVLLTGPILP  239

Query  1036  eppreepleDKIARW--------LEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
             E  +   + D    W        L  F+  SV++CAFGSE V  KE+  +L+LGLELTGL
Sbjct  240   EKEKSTTVLDDDEHWCTWSSKWRLGNFKAGSVVYCAFGSECVFTKEKVQELVLGLELTGL  299

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP  + ++E+ALP+GF+ER +G+ +V+GGWVPQ  IL H +VG FV+H G GS
Sbjct  300   PFLVALKPPHGAWTVEEALPDGFRERVEGRGVVYGGWVPQQQILSHLSVGCFVSHCGYGS  359

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM  1548
             MWESL S+C++++  PN  D   NA+L+A  ++ AVEV+  E+D +F +E++C A+K VM
Sbjct  360   MWESLVSNCQMVLL-PNYGDQIKNAKLLARGMKVAVEVERREDDGWFTRESVCRAVKLVM  418

Query  1549  GENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              ++       K NH KWR  LL      +Y D+FI  L  L
Sbjct  419   DDDSHIGRQVKANHAKWRSFLLEESLQRSYTDAFIRDLKAL  459



>ref|XP_004146274.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
Length=471

 Score =   315 bits (807),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 195/465 (42%), Positives = 286/465 (62%), Gaps = 18/465 (4%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E   LHI MFPW A GH  PFL ++N LA + HRI+ LLP N       +NLYP LI+F 
Sbjct  6     ETQNLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSSLFSSLNLYPDLISFH  65

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
              L++P V GLPP A + +D  ++L   L  ALD  + +V  I+  + +P+ VF+DFA+WI
Sbjct  66    FLSLPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSL-RPDFVFFDFAHWI  124

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             P++ + +  +++ FTV S    A+++   +       +T  D  EPP G+PS S VV   
Sbjct  125   PDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPS-STVVFHG  183

Query  841   HEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                 +   FL++P  + IT  +R + + K+ DAIA R C E+EG +C++++ +  K +  
Sbjct  184   SRESRSLLFLSMPFGQGITFHERFMTSYKKSDAIAMRTCQEIEGDFCDFLSNQFQKKILL  243

Query  1018  AG--pllpeppreepleDK-IARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
              G     P    +    DK   +WL +F+  +VIFCAFGS+V+L K+Q  +L+LG+E TG
Sbjct  244   TGPLMAAPSSKIKATTLDKEWEKWLGQFQQKTVIFCAFGSQVILEKQQLEELVLGIEQTG  303

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPFLVA+KPP    S+E+ALP+GF+ER K + IV+GGWV Q +IL H ++G FV+H G G
Sbjct  304   LPFLVALKPPMGYDSMEEALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGFG  363

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM  1548
             SMWESL S  +I++  P   D  LN RL+A+EL+  VEV+ +E+  F ++++  AI+ VM
Sbjct  364   SMWESLMSDAQIVLI-PTLGDQILNTRLLAQELKVGVEVKREEDGSFTRQSVRQAIELVM  422

Query  1549  GEN----------IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
              ++          I K NH KW+DLL  PGF + YID+F+ KL E
Sbjct  423   VDDKNNNRSGVGEIVKKNHAKWKDLLTKPGFLETYIDNFVKKLQE  467



>ref|XP_006287748.1| hypothetical protein CARUB_v10000959mg [Capsella rubella]
 gb|EOA20646.1| hypothetical protein CARUB_v10000959mg [Capsella rubella]
Length=445

 Score =   314 bits (804),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 204/456 (45%), Positives = 294/456 (64%), Gaps = 23/456 (5%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             +S  H  MFPW AFGH IPFL LAN LA++GHR++ L+P  A  +L+  NL+P+ I F  
Sbjct  2     ESKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLVPKKAQKQLEPHNLFPESIVFHP  61

Query  487   LTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+P V GLP GAETT+D  +++D  L  A D   D+V+A +  + KP+L+F+DFA+WI 
Sbjct  62    LTVPHVNGLPVGAETTSDVPISMDNFLSEAFDLTHDQVEAAVRAL-KPDLIFFDFAHWIA  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             +L  E   K+V + +    +SA ++      G    V        PPG+PS SKVV RE+
Sbjct  121   KLAKEHMFKSVSYMI----VSATAVSQLHPPGSSLGVL-------PPGYPS-SKVVFREN  168

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A+ V   L        ++ ++  +LK CDAIA + C EMEG +C+YI+ +  K V   G
Sbjct  169   DAHAV---LTDSIYYERLYHQLTTSLKSCDAIALKTCKEMEGKFCDYISRQYNKKVLLTG  225

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LPEP   +PLE++ + +L KF P SV+FCA GS++VL K+QF +L LG+E+TGLPFL+
Sbjct  226   PMLPEPDTSKPLEERWSHFLSKFPPGSVVFCALGSQIVLEKDQFQELCLGMEMTGLPFLL  285

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVK P   S++++ALPEGF+ER K + +V G WV Q +IL H +VG FVNH G G++WE 
Sbjct  286   AVKSPRGLSTVQEALPEGFEERVKDRGVVWGEWVQQPLILSHPSVGCFVNHCGPGTLWEG  345

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN--  1557
             L S C+I++  P  SD  L  RLM EE + +VEV  ++   F KE+L +AIKSVM ++  
Sbjct  346   LMSDCQIVLL-PFLSDQVLFTRLMTEEFQVSVEVSREKTGWFSKESLRDAIKSVMDKDND  404

Query  1558  ---IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                + + NH K +++L +PG  D Y+D+F+  L +L
Sbjct  405   LGKLVRSNHTKLKEVLGSPGLFDGYVDNFVEVLADL  440



>gb|KHN36713.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=461

 Score =   314 bits (805),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 197/456 (43%), Positives = 289/456 (63%), Gaps = 13/456 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             +HIAM+PW A GHFIPFL L+N LAKRGH+IS ++P     K++H+N +P LIT   +T+
Sbjct  9     MHIAMYPWFAMGHFIPFLHLSNKLAKRGHKISFIVPKRTQTKIQHLNQHPHLITLVPITV  68

Query  496   PQVEGLPPGAETTADTM-NLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP  AETT D + +    L  A+D ++ +++ +L ++ KP +VF+DF++W+P L 
Sbjct  69    PHVDGLPHDAETTLDVLFSFFPLLATAMDRIEKDIELLLREL-KPQIVFFDFSFWLPNLA  127

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +G K+V++ + +  +S     + +    GR ++  D  +P PGFP DS + L EHEA 
Sbjct  128   RSLGIKSVQYFIVN-AVSVAYFGSPERYHNGRDLSETDFTKPSPGFP-DSSITLHEHEAQ  185

Query  853   QVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpl  1029
              V R   +   + + ++DR     +  DAI F+ C E+EG Y +Y+ T+ GKPV  +GPL
Sbjct  186   FVVRMGKVEFGSGVLMYDRFDIGTRLSDAIGFKGCREIEGPYVDYLETQHGKPVLLSGPL  245

Query  1030  lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAV  1209
             LPEPP       K  +WLE+F   SVIFCA+GSE  L + QF +LLLGLELTG PFL A+
Sbjct  246   LPEPPNTTLE-GKWVKWLEEFNSGSVIFCAYGSETTLQQNQFLELLLGLELTGFPFLAAL  304

Query  1210  KPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLA  1389
             KPP    SIE+ALPEGF+ER +G+ +V+ GWV Q +IL H +VG F+   G+GS+ E+L 
Sbjct  305   KPPNGFESIEEALPEGFRERVQGRGVVYEGWVQQQLILGHPSVGCFITLCGAGSITEALV  364

Query  1390  SHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDEND--KFFKENLCNAIKSVMGENIQ  1563
             S C+++  P   SDY + AR+M+ EL+  VEV+  E D   F KE++C A+K VM +  +
Sbjct  365   SECQLVFLPRLGSDYVITARMMSRELKVGVEVEKSEEDDGSFTKESVCKAVKIVMDDENE  424

Query  1564  -----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  + NH+K R++LL+      ++D    KL  L
Sbjct  425   LGRQVRENHRKVRNILLSNNLESFHVDILCDKLRAL  460



>emb|CDY65923.1| BnaCnng49110D [Brassica napus]
Length=448

 Score =   313 bits (803),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 204/453 (45%), Positives = 291/453 (64%), Gaps = 22/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH IP+L LAN LA++GHR++ LLP  A  +L++ +L+P  I F  LTI
Sbjct  5     FHAFMFPWFAFGHMIPYLHLANKLAEKGHRVTFLLPKKAQKQLEYHSLFPDNILFHPLTI  64

Query  496   PQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D +++    L  A+D  +D+V A +  + +P+L+ +DFAYW+PE+ 
Sbjct  65    PPVDGLPAGAETASDISISWGNFLFAAMDLTRDQVTATVHAL-RPDLILFDFAYWVPEMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + V S T  A              V  +++  PPPG+PS +KVV R H+A+
Sbjct  124   KEHRVKSVVYNVVSATTIA-----------HNQVPGSELGVPPPGYPS-AKVVYRAHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +S  L++   R+  + RV   L  CD I+ R C E+EG +C+YI  +  K V   GP+L
Sbjct  172   ALSS-LSIYYERLFYY-RVTTGLTNCDFISIRTCEEIEGKFCDYIGRQYQKKVLLTGPML  229

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP + +PLEDK   WL +FEP SV++CA GS++ L K+QF +L LGLELTGLPF VAV 
Sbjct  230   PEPDKSKPLEDKWNNWLSRFEPGSVVYCALGSQITLEKDQFQELCLGLELTGLPFFVAVT  289

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I++ALPEGF+E  KG+ +V G WV Q +IL H +VG FV+H G GSMWESL S
Sbjct  290   PPKGAKTIQEALPEGFEEGVKGRGVVWGEWVQQPLILAHPSVGCFVSHCGFGSMWESLMS  349

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P  +D  LN RL+ +ELE +VEV  ++   F KENL  A+ SVM +     N
Sbjct  350   DCQIVLL-PYLADQVLNTRLLTDELEVSVEVPREKTGWFSKENLSAAVTSVMDKDSEIGN  408

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + + NH K ++++++PG    Y D+F+  L  L
Sbjct  409   LVRRNHSKLKEVVVSPGLLTGYTDNFVVTLENL  441



>ref|NP_200210.1| UDP-glycosyltransferase 79B9 [Arabidopsis thaliana]
 sp|Q9FN28.1|U79B9_ARATH RecName: Full=UDP-glycosyltransferase 79B9 [Arabidopsis thaliana]
 dbj|BAB10729.1| flavonol 3-O-glucosyltransferase-like protein [Arabidopsis thaliana]
 gb|AAL38880.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AAM20183.1| putative flavonol 3-O-glucosyltransferase [Arabidopsis thaliana]
 gb|AED96436.1| UDP-glycosyltransferase 79B9 [Arabidopsis thaliana]
 gb|AHL38581.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=447

 Score =   313 bits (802),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 207/450 (46%), Positives = 286/450 (64%), Gaps = 23/450 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  P+L LAN LA +GHR++ LLP  A  +L+H NL+P  I F +LTI
Sbjct  5     FHAFMFPWFAFGHMTPYLHLANKLAAKGHRVTFLLPKKAQKQLEHHNLFPDRIIFHSLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  ++L   L  A+D  +D+V+A +  + +P+L+F+D AYW+PE+ 
Sbjct  65    PHVDGLPAGAETASDIPISLGKFLTAAMDLTRDQVEAAVRAL-RPDLIFFDTAYWVPEMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + V S    A  L           V   ++  PPPG+PS SKV+ R H+A+
Sbjct  124   KEHRVKSVIYFVISANSIAHEL-----------VPGGELGVPPPGYPS-SKVLYRGHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F ++   R+    R+   LK CD I+ R C E+EG +C+YI  +  + V   GP+L
Sbjct  172   ALLTF-SIFYERLHY--RITTGLKNCDFISIRTCKEIEGKFCDYIERQYQRKVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP    PLED+   WL +F+P SVI+CA GS++ L K+QF +L LG+ELTGLPFLVAVK
Sbjct  229   PEPDNSRPLEDRWNHWLNQFKPGSVIYCALGSQITLEKDQFQELCLGMELTGLPFLVAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I++ALPEGF+ER K   +V G WV Q +IL H +VG FV H G GSMWESL S
Sbjct  289   PPKGAKTIQEALPEGFEERVKNHGVVWGEWVQQPLILAHPSVGCFVTHCGFGSMWESLVS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P   D  LN RLM+EELE +VEV+ +E   F KE+L  AI SVM +     N
Sbjct  349   DCQIVLL-PYLCDQILNTRLMSEELEVSVEVKREETGWFSKESLSVAITSVMDKDSELGN  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
             + + NH K +++L++PG    Y D F+  L
Sbjct  408   LVRRNHAKLKEVLVSPGLLTGYTDEFVETL  437



>gb|AES89730.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=462

 Score =   314 bits (804),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 196/461 (43%), Positives = 279/461 (61%), Gaps = 12/461 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAM+PW A GH  PFL LAN LAK+GH+I+   P +A  KL+  NLYPQLIT
Sbjct  1     MDSSSPLHIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  + +P VEGLP  AETTAD    L   +  A+D  Q +++  L  + KP +VFYDF +
Sbjct  61    FITIKVPHVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNL-KPQIVFYDFTH  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             WIP L   +  K   + + S  +   +L  S+   KG+ +T  D+M+PP G+P  S + L
Sbjct  120   WIPSLTKRLDIKAFHYCIISSIMIGYTLAPSRYS-KGKDLTEFDLMQPPSGYPGSS-IKL  177

Query  835   REHEAYQVSRFL-NLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
               HEA   +    N   + +  +DR   AL   DA+ ++ C E+EG Y +YI  +  KPV
Sbjct  178   HSHEAKAFAAMRKNTYGSNVLFYDRQAIALNEADALGYKTCREIEGPYLDYIQKQFNKPV  237

Query  1012  YCAGpllpeppreepleDK-IARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
               +GP+LP       + D+  A WL +F+ +SV++C FGSE VL    F +L+LGLELTG
Sbjct  238   LTSGPVLPILENSNYVLDENWATWLGRFKTDSVVYCCFGSECVLKPNTFQELMLGLELTG  297

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             +PF  A+KPP    +IE+ALPEGF ER +G+ +V+GGWV Q +IL H +VG F+ H GSG
Sbjct  298   MPFFAALKPPFGFETIEEALPEGFSERVEGRGVVYGGWVQQQLILEHPSVGCFITHCGSG  357

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM  1548
             S+ E+L + C++++  PN  D  LNAR+M   L+  VEV+  E+  + K+N+C A+  VM
Sbjct  358   SLSEALVNKCQLVLL-PNVGDQILNARMMGNNLKVGVEVEKGEDGFYTKDNVCKAVSIVM  416

Query  1549  GENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              +  +     + NH K R++LL      +YID+F  KL E+
Sbjct  417   NDEDEISKTVRSNHTKIREMLLNKDLESSYIDNFCMKLQEI  457



>gb|KGN57635.1| hypothetical protein Csa_3G236030 [Cucumis sativus]
Length=521

 Score =   315 bits (808),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 198/487 (41%), Positives = 292/487 (60%), Gaps = 25/487 (5%)
 Frame = +1

Query  238   HNTTQPNQFKKASSSASRKHMMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISll  417
             H+ T P   K      ++        LHI MFPW A GH  PFL ++N LA + HRI+ L
Sbjct  41    HHYTHPQNLKMVKGKETQN-------LHILMFPWFATGHITPFLHISNHLASKNHRITFL  93

Query  418   lptnallklKHMNLYPQLITFCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDE  594
             LP N       +NLYP LI+F  L++P V GLPP A + +D  ++L   L  ALD  + +
Sbjct  94    LPNNPSSLFSSLNLYPDLISFHFLSLPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQ  153

Query  595   VKAILLQMEKPNLVFYDFAYWIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAV  774
             V  I+  + +P+ VF+DFA+WIP++ + +  +++ FTV S    A+++   +       +
Sbjct  154   VDRIIHSL-RPDFVFFDFAHWIPDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPL  212

Query  775   TAADIMEPPPGFPSDSKVVLREHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRA  951
             T  D  EPP G+PS S VV       +   FL++P  + IT  +R + + K+ DAIA R 
Sbjct  213   TDEDFREPPVGYPS-STVVFHGSRESRSLLFLSMPFGQGITFHERFMTSYKKSDAIAMRT  271

Query  952   CNEMEGHYCNYIATELGKPVYCAG--pllpeppreepleDK-IARWLEKFEPNSVIFCAF  1122
             C E+EG +C++++ +  K +   G     P    +    DK   +WL +F+  +VIFCAF
Sbjct  272   CQEIEGDFCDFLSNQFQKKILLTGPLMAAPSSKIKATTLDKEWEKWLGQFQQKTVIFCAF  331

Query  1123  GSEVVLGKEQFHQlllgleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGW  1302
             GS+V+L K+Q  +L+LG+E TGLPFLVA+KPP    S+E+ALP+GF+ER K + IV+GGW
Sbjct  332   GSQVILEKQQLEELVLGIEQTGLPFLVALKPPMGYDSMEEALPKGFEERVKERGIVYGGW  391

Query  1303  VPQSMILRHKAVGYFVNHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVE  1482
             V Q +IL H ++G FV+H G GSMWESL S  +I++  P   D  LN RL+A+EL+  VE
Sbjct  392   VQQPLILNHSSIGCFVSHCGFGSMWESLMSDAQIVLI-PTLGDQILNTRLLAQELKVGVE  450

Query  1483  VQTDENDKFFKENLCNAIKSVMGEN----------IQKVNHKKWRDLLLTPGFADNYIDS  1632
             V+ +E+  F ++++  AI+ VM ++          I K NH KW+DLL  PGF + YID+
Sbjct  451   VKREEDGSFTRQSVRQAIELVMVDDKNNNRSGVGEIVKKNHAKWKDLLTKPGFLETYIDN  510

Query  1633  FIHKLYE  1653
             F+ KL E
Sbjct  511   FVKKLQE  517



>ref|XP_004499897.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Cicer arietinum]
 gb|AGU14119.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   313 bits (803),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 191/460 (42%), Positives = 287/460 (62%), Gaps = 13/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M  ++ H+AM+PW A GH   +L ++N LA+RGH+IS  +P N + KL+H NL+P LI+F
Sbjct  1     MVANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFFIPKNTISKLEHFNLHPNLISF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +TIP V+GLP G+ETTAD   +L   L  A+D  +  ++  L ++ +P++VF+DF YW
Sbjct  61    IPITIPHVDGLPLGSETTADLPFSLHSLLMTAMDLTEPIIEDSLREL-RPHMVFFDFTYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K + +   SP      LI+ + K   +++T AD++ PPP FP  S + L+
Sbjct  120   LPALACQLGIKALHYCTISPATVGY-LISPERKLHEKSLTEADLINPPPSFPP-SAIKLQ  177

Query  838   EHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HEA  ++        + I+   R + A   CDAI F+ C EMEG YC+Y+  ++ K V+
Sbjct  178   PHEARGLATSTVKGYGKDISFMQRQLIAFTSCDAIVFKTCREMEGLYCDYLERQMRKQVF  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              AG  +   P    LE+K   WL  F+P +VIFCAFGSE +L   QF +LLLG ELT +P
Sbjct  238   LAG-PVFPKPPTFTLEEKWVTWLGGFKPKTVIFCAFGSECILKSNQFKELLLGFELTKIP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL A+KPP  + +I+ ALPEGF ERTKG+ +V G WV Q +IL H +VG FV H GSGS+
Sbjct  297   FLAALKPPIGAETIKSALPEGFSERTKGRGVVEGDWVQQQLILSHPSVGCFVTHCGSGSL  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQ-TDENDKFFKENLCNAIKSVMG  1551
              E++ + C++++  P+  D  +NAR+M+ +L+  VEV+   EN  F ++ +C A+  VM 
Sbjct  357   TEAMINECQLVLL-PHAGDQFINARIMSGDLKVGVEVEKCKENGLFTRKAVCKAVMDVMD  415

Query  1552  -----ENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                   ++ + NH KWR+ LL+ G  ++Y+D  + KL  L
Sbjct  416   NESELSHMVRTNHAKWREFLLSKGLENSYVDDLVQKLDSL  455



>ref|XP_010442978.1| PREDICTED: UDP-glycosyltransferase 79B6 isoform X2 [Camelina 
sativa]
Length=422

 Score =   312 bits (799),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 199/457 (44%), Positives = 287/457 (63%), Gaps = 44/457 (10%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             +S  H  MFPW  FGH   FL LAN LA++GH+I+ LLP  AL +LK +N++P  I F  
Sbjct  2     ESKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLKPLNIFPDCIVFHT  61

Query  487   LTIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LTIP V+GLP GAETT+D     GS L  A+D  +++V+  +  + KP+L+F+DFA+WIP
Sbjct  62    LTIPSVDGLPAGAETTSDIPISSGSFLASAMDQTRNQVEEAV-SIGKPDLIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E G K+V F   S    A+S +  +S          D+  PPPG+PS SKV+LR  
Sbjct  121   EIARECGAKSVNFITISAACVAISFVPGRSPD--------DLAVPPPGYPS-SKVLLRRQ  171

Query  844   EAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             E    S FL+ P  +  T ++R++  LK CD I+ R C EME +          KP+   
Sbjct  172   ETNCFS-FLSHPFGDNTTFYERIMIGLKNCDVISIRTCREMEDN---------SKPL---  218

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
                          ED+  +WL +FEP SV++CA GS+++L K+QF +L LG+ELTGLPFL
Sbjct  219   -------------EDQWRQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFL  265

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAVKPP+ SS+I++ALP GF+ER KG+ +V GGWV Q +IL H ++G FV+H G GSMWE
Sbjct  266   VAVKPPKGSSTIQEALPNGFEERVKGRGVVWGGWVQQPLILAHPSIGCFVSHCGFGSMWE  325

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-  1557
             +L + C+ +   P+  +   N RLM+EELE +VEV+ +++  F KE+L  +I+SVM ++ 
Sbjct  326   ALVNDCQTVFI-PHLGEQIFNTRLMSEELEVSVEVKREDSGWFSKESLSGSIRSVMDKDS  384

Query  1558  ----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                 + + NH KW++ L++ G  + Y++ FI  L +L
Sbjct  385   ELGYLVRRNHAKWKESLVSTGLMNGYVNKFIEALQKL  421



>ref|XP_003596670.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=458

 Score =   313 bits (802),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 203/465 (44%), Positives = 294/465 (63%), Gaps = 20/465 (4%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAMFPW A GH  P+L  +N LA RGH+IS  +P N L KL+H+NL+P LIT
Sbjct  1     MDAPSPLHIAMFPWFAMGHLTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  +T+P V GLP  AETT+D   +L   +  A+D    +++ +LL+  KP +VF+DF Y
Sbjct  61    FFPITVPHVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIE-LLLKELKPQIVFFDFQY  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W+P L  ++G K++++ +++P IS+  L     K +G+ +T  D+ +PP GFP DS +  
Sbjct  120   WLPNLTQKLGIKSLQYLIWNP-ISSAYLGNIPRKSQGKYLTKDDLKKPPAGFP-DSSIKF  177

Query  835   REHEAYQVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATEL  999
               HE     RFL   R     + + ++DRV    K  DA++F+ C E++G Y +Y+ T  
Sbjct  178   HSHEL----RFLASTRKIEFGSGVLLYDRVDTGTKSSDAVSFKGCREIDGLYADYLETVF  233

Query  1000  GKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgle  1179
             GKPV  +GPLLPEPP+     +K   WL++F+  SVIFCA+GSE  L   QF +LLLGLE
Sbjct  234   GKPVLLSGPLLPEPPKATLE-EKWLTWLKEFKHGSVIFCAYGSEGPLETNQFQELLLGLE  292

Query  1180  ltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHG  1359
             LTG PFL A+KPP    SIE+ALPEGF ER KGK IV+G W+ Q +IL H +VG F+ H 
Sbjct  293   LTGFPFLAALKPPIGFESIEEALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHC  352

Query  1360  GSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAI  1536
             G+ S+ E L + C++++ P   +D+ +NAR+M+  L+  +EV+  E D  F KE++ NA+
Sbjct  353   GAASITEGLVNTCQLVLLPRAGADHIMNARMMSSTLKVGIEVERGEEDGLFTKESVGNAV  412

Query  1537  KSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + VM +  +     + NH K R+ LL+     + ++SF  KLY+L
Sbjct  413   RIVMDDENEVGKEVRANHAKMRNFLLSSNLESSCVNSFCQKLYDL  457



>gb|EYU28028.1| hypothetical protein MIMGU_mgv1a006231mg [Erythranthe guttata]
Length=451

 Score =   313 bits (801),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 206/462 (45%), Positives = 280/462 (61%), Gaps = 22/462 (5%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M +    I M+PWLA GH   FL ++N LA+RGHRI L+LP N   KL+  NL+P LITF
Sbjct  1     MSEKTFRIVMYPWLAIGHLTSFLHISNKLAERGHRIFLILPLNTQSKLQQFNLHPNLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+PQVE LP G ETT+D    L  +L  A+D  +  +  +L ++E P+ V +DFA+W
Sbjct  61    NPITVPQVENLPNGTETTSDVPFPLYKNLRHAMDLTKPAITHLLQELE-PDFVLFDFAHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P +   +G K++ +   SP      L+  +S       +A   +EPPPGFPS     L 
Sbjct  120   LPAVARSLGIKSIYYCTISPAAVGY-LVREES-------SADAFVEPPPGFPSRGIFKLY  171

Query  838   EHEAYQVSRFLNLPR--NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
              HEA  + R  N     N I    R++ A   CDAI F++C EMEG YC ++  +  KP+
Sbjct  172   RHEARAIERINNEMEFENSINFVQRMLIAAGECDAIGFKSCREMEGTYCEFLEKKFKKPI  231

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
               AGP+L + P      +K A WL +FE  SVI+CAFGSE  L K QF +LLLGLELTGL
Sbjct  232   ILAGPVLHKAPISTLD-EKWASWLSRFEARSVIYCAFGSEARLEKGQFQELLLGLELTGL  290

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PF  A+KPP    ++E+ALP GF +RT G+ +VHGGWV Q ++L H +VG FV H GSGS
Sbjct  291   PFFAALKPPRGVETVEEALPRGFADRTLGRGVVHGGWVQQQLMLSHPSVGCFVTHCGSGS  350

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVM  1548
             + E++ + CR+++  P+  D  +NARLMA +L+  VEV+  DE+  F KE +  A+K VM
Sbjct  351   LSEAMVNECRLVLI-PHAGDQIINARLMAGDLKVGVEVERGDEDGLFSKEGVMKAVKLVM  409

Query  1549  ------GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                   G+ I + NH KWRD LL  G  D+YID FI  L  L
Sbjct  410   EGDCEVGKEIGE-NHAKWRDFLLGEGLEDSYIDGFIDNLLGL  450



>ref|XP_009340538.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Pyrus x bretschneideri]
Length=467

 Score =   313 bits (802),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 197/466 (42%), Positives = 286/466 (61%), Gaps = 25/466 (5%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  HIAMFPW A GH  PFL L+N+LA RGH+I+ LLP  A ++L+ +NL+P LITF  +
Sbjct  3     SSFHIAMFPWFAMGHMTPFLHLSNELAARGHKITFLLPKKAQIQLQRLNLHPHLITFHPV  62

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAIL---LQMEKPNLVFYDFAYW  657
             T+P +EGLP   E  ++  ++L   L +A+D  +D+++  L   +   K +++F+D A+W
Sbjct  63    TVPHIEGLPDKTEFVSEIPLSLSHFLTLAIDRTRDQIQDFLKTSVADCKVDMIFFDSAHW  122

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLI-----TSKSKGKGRAVTAADIMEPPPGFPSDS  822
             IPE+   +G K++ + V S    ALSL+      +K       +   + + PPPG+PS +
Sbjct  123   IPEIARGLGIKSIFYGVISAAAYALSLVPICNYVTKDACMAPMIMTEEQLNPPPGYPSST  182

Query  823   KVVLREHEAYQVSRFLNLPRN---RITVFDRVV---EALKRCDAIAFRACNEMEGHYCNY  984
              ++ R HE     R L   R+    I V  R++    A+K CDA   R C E EG +C+Y
Sbjct  183   VILTRSHEV----RSLMTSRSCGVGIRVNQRLITGFRAIKECDAFCLRTCREFEGDFCDY  238

Query  985   IATELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQl  1164
             +  +  KPV   GP+L      + LE++ A W    E  S++FCAFGS+   GK+QF +L
Sbjct  239   LEAQFQKPVLLTGPVLSLEKGPKLLEERWADWFAGLEAGSMVFCAFGSQWAFGKDQFQEL  298

Query  1165  llgleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGY  1344
             +LG ELTG PFLVAVKPP    +IE+ALPEGF+ER +G+ +V GGWV Q +IL H AVG 
Sbjct  299   VLGFELTGSPFLVAVKPPLGCVTIEEALPEGFEERVRGRGVVFGGWVQQPLILSHPAVGC  358

Query  1345  FVNHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENL  1524
             FV+H G G+MWESL S  +I++  P   D  L A+L+A+EL+ AVEV+ +E+  F KE+L
Sbjct  359   FVHHCGYGTMWESLMSENQIVLV-PQLVDQILGAKLLAKELKVAVEVEREEDGWFSKESL  417

Query  1525  CNAIKSVMGEN-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
               A+K VM +      + K NH K+R+++  PGF   Y+D F+  L
Sbjct  418   SKAVKGVMDKESDVGVMVKKNHAKFREIISEPGFMSGYVDRFVDNL  463



>ref|XP_009107252.1| PREDICTED: UDP-glycosyltransferase 79B5-like [Brassica rapa]
Length=451

 Score =   313 bits (801),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 206/455 (45%), Positives = 287/455 (63%), Gaps = 25/455 (5%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+P  AFGH IP+L LAN LA++GH I+ LLP  A  +L+ +NL+P+ I F  L
Sbjct  3     SKFHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQKQLESLNLHPESICFHPL  62

Query  490   TIPQVEGLPPGAETTADTM-NLDGSL-EVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             T+P VEGLP GAETTAD   N  G L   A+D L+D+++A + ++ KP+L+F+D   W+P
Sbjct  63    TLPPVEGLPVGAETTADLPPNTTGKLISDAMDLLRDQIEAKV-RVLKPDLIFFDLVPWVP  121

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E G K+V + + S    A++L      G  +           PG+PS SKV  R H
Sbjct  122   EMAKEFGVKSVSYQIVSAACVAVALAPGVELGFPQQ----------PGYPS-SKVAFRGH  170

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A   S F N   +    F R++  LK  D  + R C E+EG YC++I  E  + V   G
Sbjct  171   DANLYSIFTN---SHKRFFSRIITGLKNSDVASIRTCAEIEGKYCSFIERECQRKVLLTG  227

Query  1024  pl--lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             P+   P+    +PLED+  +WL +FEP SV+FCA GS+ +L K+QF +L LG+ELTGLPF
Sbjct  228   PMFPEPQEKSVKPLEDQWNQWLNRFEPGSVVFCALGSQTILEKDQFQELCLGMELTGLPF  287

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             LVAVK P  SS++++ALPEGF+ER KG+ IV GGWV Q +IL H++VG FVNH GSGSMW
Sbjct  288   LVAVKLPRGSSTVQEALPEGFEERVKGRGIVWGGWVEQPLILSHQSVGCFVNHCGSGSMW  347

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-  1554
             ESL S C+I+   P   D  L  +L++EELE +V+V  +++  F KE+L +A+KSVM + 
Sbjct  348   ESLVSDCQIVFI-PQLGDQVLTTKLLSEELEVSVKVHREDSGWFSKESLRDAVKSVMDKD  406

Query  1555  ----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                 N+ K NH K ++ L++PG    Y D F+  L
Sbjct  407   SEIGNLVKRNHMKLKETLVSPGLLSGYADKFVEAL  441



>emb|CDY59372.1| BnaA08g29640D [Brassica napus]
Length=451

 Score =   313 bits (801),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 206/455 (45%), Positives = 287/455 (63%), Gaps = 25/455 (5%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+P  AFGH IP+L LAN LA++GH I+ LLP  A  +L+ +NL+P+ I F  L
Sbjct  3     SKFHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQKQLESLNLHPESICFHPL  62

Query  490   TIPQVEGLPPGAETTADTM-NLDGSL-EVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             T+P VEGLP GAETTAD   N  G L   A+D L+D+++A + ++ KP+L+F+D   W+P
Sbjct  63    TLPPVEGLPVGAETTADLPPNTTGKLISDAMDLLRDQIEAKV-RVLKPDLIFFDLVPWVP  121

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E G K+V + + S    A++L      G  +           PG+PS SKV  R H
Sbjct  122   EMAKEFGVKSVSYQIVSAACVAVALAPGVELGFPQQ----------PGYPS-SKVAFRGH  170

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A   S F N   +    F R++  LK  D  + R C E+EG YC++I  E  + V   G
Sbjct  171   DANLYSIFAN---SHKRFFSRIITGLKNSDVASIRTCAEIEGKYCSFIERECQRKVLLTG  227

Query  1024  pl--lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             P+   P+    +PLED+  +WL +FEP SV+FCA GS+ +L K+QF +L LG+ELTGLPF
Sbjct  228   PMFPEPQEKSVKPLEDQWNQWLNRFEPGSVVFCALGSQTILEKDQFQELCLGMELTGLPF  287

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             LVAVK P  SS++++ALPEGF+ER KG+ IV GGWV Q +IL H++VG FVNH GSGSMW
Sbjct  288   LVAVKLPRGSSTVQEALPEGFEERVKGRGIVWGGWVEQPLILSHQSVGCFVNHCGSGSMW  347

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-  1554
             ESL S C+I+   P   D  L  +L++EELE +V+V  +++  F KE+L +A+KSVM + 
Sbjct  348   ESLVSDCQIVFI-PQLGDQVLTTKLLSEELEVSVKVHREDSGWFSKESLRDAVKSVMDKD  406

Query  1555  ----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                 N+ K NH K ++ L++PG    Y D F+  L
Sbjct  407   SEIGNLVKRNHMKLKETLVSPGLLSGYADKFVEAL  441



>gb|AES66927.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=459

 Score =   313 bits (801),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 201/465 (43%), Positives = 287/465 (62%), Gaps = 20/465 (4%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAMFPW A GH  P+L L+N LAKRGH+IS  +PT    KL+  NLYP LIT
Sbjct  1     MESPSSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPTKTQTKLEQFNLYPNLIT  60

Query  478   FCALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  L +P + GLP GAETT+D + +L   +  A+D  Q +V+ +L Q+  P +VF+DFA+
Sbjct  61    FYPLNVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLAQL-NPKMVFFDFAF  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             WIP++   +G K+ ++ + SP   + +L  S+   +   +T  D+M+PP G+P +S   L
Sbjct  120   WIPKIAQSLGIKSFQYWIVSPATISYTLSPSR-MCESINLTEFDLMKPPKGYP-NSSFTL  177

Query  835   REHEAYQVSRFLNLPRN-----RITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATEL  999
               HEA    ++L L RN      +  +DR+   L   DAI F+ C ++EG Y +Y+  E 
Sbjct  178   YSHEA----KYLALKRNFEFGSGVLFYDRLFNGLSLSDAIGFKGCRQIEGPYVDYLEQEF  233

Query  1000  GKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgle  1179
             GKPV  +GP+LPEPP+     +K   WL  F+  S+++CA GSE  L  EQF +LLLGLE
Sbjct  234   GKPVLLSGPVLPEPPKTVLD-EKWGSWLGGFKDGSLVYCALGSECKLTLEQFQELLLGLE  292

Query  1180  ltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHG  1359
             LTG PFL  +KPP    ++EDA PE F+ER K K IVH GW+ Q +IL H +VG FV H 
Sbjct  293   LTGYPFLAILKPPVGFETVEDAFPEEFEERVKEKGIVHSGWIQQQLILEHSSVGCFVTHC  352

Query  1360  GSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAI  1536
             G+GS+ E L ++C++++ P   +D+ +NA++M  +L+  VEV+  E D  F KE++C A+
Sbjct  353   GAGSLTEGLTNNCQMVLIPHLDADHIINAKIMGMKLKVGVEVKKGEEDGLFTKESVCEAV  412

Query  1537  KSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             K VM +  +     + NH K R+LLL      + +D F  KL EL
Sbjct  413   KIVMDDENEIGREVRNNHDKLRNLLLNQDLESSCVDGFCEKLQEL  457



>gb|KHN41619.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=460

 Score =   312 bits (800),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 203/461 (44%), Positives = 283/461 (61%), Gaps = 16/461 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             ME   LHIAM+PWLA GH   FL L N LA RGH+IS + P  A  KL+  NL+P  ITF
Sbjct  1     MESRPLHIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEAFNLHPNSITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P VEGLPP A+TTAD T  L   +  A+D  +D+++   L+  KP+LVFYDF +W
Sbjct  61    VTITVPHVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIET--LRGLKPDLVFYDFTHW  118

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L   +G K V +   S  +   +L  ++   +G  +  +D+MEPP G+P DS + L 
Sbjct  119   MPALAKSLGIKAVHYCTASSVMVGYTLPPARYH-QGTNLIESDLMEPPEGYP-DSSIKLH  176

Query  838   EHEA--YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
              HEA  +   R      N +  +DR   AL   D +A+R C E+EG Y +YI  +  KPV
Sbjct  177   AHEARAFAAKRKDTFGSN-VLFYDRQFIALNEADVLAYRTCREIEGPYLDYIEKQFNKPV  235

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                GP++ +PP  +   +K + WL  FEP SV++C FGSE  LG  QF +L+LGLELTG+
Sbjct  236   LATGPVILDPPTSDLE-EKFSTWLGGFEPGSVVYCCFGSECTLGPNQFQELVLGLELTGM  294

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL AVK P    ++E A+PEGF+ER KG+  V+GGWV Q +IL H +VG F+ H GSGS
Sbjct  295   PFLAAVKAPLGFETVESAMPEGFEERVKGRGFVYGGWVLQQLILAHPSVGCFITHCGSGS  354

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVM  1548
             + E+L + C++++  PN  D  LNAR+M   LE  VEV+  DE+  + +E++C A+  VM
Sbjct  355   LSEALVNKCQLVLL-PNVGDQILNARMMGNNLEVGVEVEKGDEDGMYTRESVCKAVSIVM  413

Query  1549  -GENIQ----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              GEN      + NH + R+LLL      +Y+DSF  +L E+
Sbjct  414   DGENETSKRVRGNHARIRELLLNKDLESSYVDSFCMRLQEI  454



>ref|XP_008455481.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
 ref|XP_008455483.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=463

 Score =   313 bits (801),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 190/462 (41%), Positives = 281/462 (61%), Gaps = 13/462 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAMFPW AFGH  P+LQ+AN LAK+GH+IS L+P+    KL+  N +P LIT
Sbjct  4     MAATSSLHIAMFPWFAFGHLSPYLQIANKLAKKGHKISFLIPSKIRAKLQPFNHFPNLIT  63

Query  478   FCALTIPQVEGLPPGAETTADTMNLD--GSLEVALDGLQDEVKAILLQMEKPNLVFYDFA  651
             F  + +P V+GLP GAETTAD  NL     +  A+D  Q ++K+ LLQ  KP+++F+DF 
Sbjct  64    FVPIIVPHVDGLPEGAETTADVSNLHQFNLIMTAMDLTQPQIKS-LLQHIKPHVIFFDFT  122

Query  652   YWIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             +WIP+L S++G K++ ++V S T  +  + T   +  G   T  + ++PP G  + S + 
Sbjct  123   FWIPKLASQLGIKSIYYSVISATTFSY-VFTPTRQLCGPDFTVDEFIKPPLGLAT-SAIK  180

Query  832   LREHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             L  HEA  V+   N+   + +  F R    L   DAIAF+AC E+EG + +++ +E  KP
Sbjct  181   LHSHEAKNVTFMSNMIFGSDVRFFHRHFTGLCESDAIAFKACREIEGPFVDHLISEFKKP  240

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             +  +GP       +  LE +   WL +F+  SVI+CAFGSE  L K+Q  +L+LG ELT 
Sbjct  241   ILLSGPDGDIQEPKTTLEHRWQEWLSRFKYGSVIYCAFGSECTLTKDQLQELVLGFELTN  300

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
              PF    KPP    ++  ALP+GF+ER +G+ +V+GGWV Q  IL H ++G FV H G+G
Sbjct  301   QPFFAVFKPPVGVDTVTAALPDGFEERVEGRGVVYGGWVQQQHILEHPSIGCFVTHCGAG  360

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSV  1545
             S+ E+L   C++++  P+  D+   AR ++  L+  VEV+  E+D FF KE++C A+K+V
Sbjct  361   SLSEALVKKCQLVLL-PHVGDHIFRARTLSSYLKVGVEVEKREDDGFFTKESVCEAVKTV  419

Query  1546  MGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M E  +     +    K R+LLL     ++YI +FIH L  L
Sbjct  420   MDEGNERGKEIRATRAKLRELLLDKDLEESYISNFIHNLQSL  461



>ref|XP_010455377.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=446

 Score =   312 bits (799),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 207/461 (45%), Positives = 299/461 (65%), Gaps = 27/461 (6%)
 Frame = +1

Query  307   DSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCA  486
             DS  H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +++H NL+P  I F  
Sbjct  2     DSKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQVEHHNLFPDSIFFHP  61

Query  487   LTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             LT+  V GLP GAETT+D +++ D  L  ALD  + +V+A +  + +P+ +F+DFA+WIP
Sbjct  62    LTVTHVNGLPLGAETTSDISISEDNLLSEALDLTRSQVEAAVRAL-RPDFIFFDFAHWIP  120

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             EL  E   K+V + + S T+ A            R          PPG+PS +KV+ RE+
Sbjct  121   ELAKEHKIKSVSYMIVSATVIA------------RLHDPGAPGVHPPGYPS-TKVLFREN  167

Query  844   EAYQ-VSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             +A+  V+R +   R    +++++    K CD IA R C E+EG +C++I+ +  K V   
Sbjct  168   DAHALVTRSIFYER----LYNQLTTGFKSCDVIALRTCKEIEGKFCDFISRQYQKKVLLT  223

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             GP+LPEP   +PLE+  + +L  F P SV+FCA GS++VL K+QF  L LG+ELTGLPFL
Sbjct  224   GPMLPEPATSKPLEEHWSHFLSGFPPGSVVFCALGSQIVLEKDQFQDLCLGMELTGLPFL  283

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             VAVKPP  SS+I+++LPEGF+ER KG+ +V GGWV Q +IL H +VG FV+H G G++WE
Sbjct  284   VAVKPPRGSSTIQESLPEGFEERVKGRGVVWGGWVQQPLILSHPSVGCFVHHCGPGTIWE  343

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
              L + C++++  P  SD  L  RL+ EE E +VEV  ++   F KE+L NAIKSVM +  
Sbjct  344   CLMTDCQMVLI-PFLSDQVLFTRLLTEEFEVSVEVSREKIGWFSKESLRNAIKSVMDKES  402

Query  1555  NIQKV---NHKKWRDLLLTPGFADNYIDSFIHKLYEL-SVQ  1665
             ++ K+   NH K +++L++PG   +Y+D+F+  L +L SVQ
Sbjct  403   DLGKLVGSNHAKLKEILVSPGLFSSYVDNFVEALADLISVQ  443



>ref|XP_004166346.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B6-like 
[Cucumis sativus]
Length=471

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 194/465 (42%), Positives = 285/465 (61%), Gaps = 18/465 (4%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E   LHI MFPW A GH  PFL ++N LA + HRI+ LLP N       +NLYP LI+F 
Sbjct  6     ETQNLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSSLFSSLNLYPDLISFH  65

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
              L++P V GLPP A + +D  ++L   L  ALD  + +V  I+  + +P+ VF+DFA+WI
Sbjct  66    FLSLPSVPGLPPSAHSASDIPLSLTPLLASALDLTRPQVDRIIHSL-RPDFVFFDFAHWI  124

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             P++ + +  +++ FTV S    A+++   +       +T  D  EPP G+PS S VV   
Sbjct  125   PDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPS-STVVFHG  183

Query  841   HEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                 +   FL++P  + IT  +R + + K+ DAIA R C E+EG +C++++ +  K +  
Sbjct  184   SRESRSLLFLSMPFGQGITFHERFMTSYKKSDAIAMRTCQEIEGDFCDFLSNQFQKKILL  243

Query  1018  AG--pllpeppreepleDK-IARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
              G     P    +    DK   +WL +F+  +VIFCAFGS+V+L K+Q  +L+LG+E TG
Sbjct  244   TGPLMAAPSSKIKATTLDKEWEKWLGQFQQKTVIFCAFGSQVILEKQQLEELVLGIEQTG  303

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPFLVA+KPP    S+E+ALP+GF+ER K + IV+GGWV Q +IL H ++G FV+H G G
Sbjct  304   LPFLVALKPPMGYDSMEEALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGFG  363

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM  1548
             SMWESL S  +I++  P   D  LN RL+A+EL+  VEV+ +E+  F ++++  AI+ VM
Sbjct  364   SMWESLMSDAQIVLI-PTLGDQILNTRLLAQELKVGVEVKREEDGSFTRQSVRQAIELVM  422

Query  1549  GEN----------IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
              ++          I   NH KW+DLL  PGF + YID+F+ KL E
Sbjct  423   VDDKNNNRSGVGEIVXENHAKWKDLLTKPGFLETYIDNFVKKLQE  467



>ref|XP_008226433.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Prunus mume]
Length=439

 Score =   311 bits (798),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 199/452 (44%), Positives = 280/452 (62%), Gaps = 24/452 (5%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             MFPW A GH  P+L LAN+LA RGHR +LL+P  A L+L+H+ L+  LI F  + IP V 
Sbjct  1     MFPWFAIGHITPYLHLANELASRGHRTTLLVPNKARLQLQHLVLHADLIVFSPVAIPHVH  60

Query  508   GLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMG  684
             GLP G E  ++  +++   L  A+D  + E++   L + KP+ V YD A W+P +    G
Sbjct  61    GLPEGTEIASEIPIHMTHLLATAMDRTRGEIEQ-FLTISKPDFVLYDTAQWVPGIARRNG  119

Query  685   CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSR  864
              KTV + V      A++L           V A ++ EPP G+PS + VVL   EA  ++ 
Sbjct  120   IKTVCYNVVCAAALAIAL-----------VPARNLREPPAGYPSKN-VVLCGAEAKALT-  166

Query  865   FLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG--pllp  1035
             F++LP    IT ++R   A+K CD ++ R C E+EG  C+Y+  +  KPV   G    L 
Sbjct  167   FISLPYGEGITFYERTTTAMKECDVLSIRTCRELEGDLCDYMEAQYKKPVILTGPVLGLG  226

Query  1036  eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKP  1215
                + E L+++  +W   FE  SV+FCAFG++ +L K+QF +L+LG ELTGLPF VA+KP
Sbjct  227   SDKKSEKLDERWEKWFSGFEAGSVVFCAFGTQWILEKDQFQELVLGFELTGLPFFVALKP  286

Query  1216  PERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASH  1395
             P   ++IE+ALP GF+ER KG+ +V GGWV Q+ IL HK+VG FVNH G GSMWESL + 
Sbjct  287   PSGCATIEEALPNGFEERVKGRGVVFGGWVQQTAILSHKSVGCFVNHCGFGSMWESLMTD  346

Query  1396  CRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ----  1563
              +I++  P+  D  LN +L+ +EL+ AVEV+ +EN  F KE+L  AIKSVM ++ +    
Sbjct  347   NQIVLV-PHLGDQILNTKLLVKELKVAVEVEREENGWFSKESLRKAIKSVMDKDSEVGVM  405

Query  1564  -KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              K NH KW + L +PGF   YID F+ KL EL
Sbjct  406   VKKNHAKWVETLSSPGFMSGYIDRFVQKLKEL  437



>emb|CDY03578.1| BnaC03g68370D [Brassica napus]
Length=451

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 206/455 (45%), Positives = 285/455 (63%), Gaps = 25/455 (5%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+P  AFGH IP+L LAN LA++GH I+ LLP  A  +L+ +NL+P+ I F  L
Sbjct  3     SKFHAFMYPCFAFGHMIPYLHLANKLAEKGHSITFLLPKKAQKQLESLNLHPESICFHPL  62

Query  490   TIPQVEGLPPGAETTADTM-NLDGSL-EVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             T+P VEGLP G ETTAD   N  G L   A+D L+DE++A + ++ KP+L+F+D   W+P
Sbjct  63    TLPPVEGLPVGVETTADLPPNTTGKLISDAMDLLRDEIEAKV-RVLKPDLIFFDLVPWVP  121

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
             E+  E G K+V + + S    A++L      G             P G+PS SKV LR H
Sbjct  122   EMAKEFGVKSVSYQIVSAACVAVALAPGVELG----------FSQPSGYPS-SKVALRGH  170

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             +A   S F N   +    F R++  LK  D ++ R C E+EG YC++I  E  + V    
Sbjct  171   DANLYSVFTN---SHKRFFSRIITGLKNSDVVSIRTCAEIEGKYCSFIERECQRKVLLTA  227

Query  1024  pl--lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             P+   P+    +PLED+   WL  FEP SV+FCA GS+ +L K+QF +L LG+ELTGLPF
Sbjct  228   PMFPEPQEKSVKPLEDQWNNWLNVFEPGSVVFCALGSQTILEKDQFQELCLGMELTGLPF  287

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             LVAVK P  SS++++ALPEGF+ER KG+ IV GGWV Q +IL H++VG FVNH GSGSMW
Sbjct  288   LVAVKLPRGSSTVQEALPEGFKERVKGRGIVWGGWVEQPLILSHQSVGCFVNHCGSGSMW  347

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-  1554
             ESL S C+I+   P   D  L  +L++EELE +V+V  +++  F KE+L +A+KS+M + 
Sbjct  348   ESLVSDCQIVFI-PQLGDQVLTTKLLSEELEVSVKVHREDSGWFSKESLRDAVKSMMDKD  406

Query  1555  ----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                 N+ K NH K R+ L++PG    Y D+F+  L
Sbjct  407   SEIGNLVKRNHMKLRETLVSPGLLSGYADNFVEAL  441



>ref|XP_004487588.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
 gb|AGU14137.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 198/464 (43%), Positives = 288/464 (62%), Gaps = 20/464 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M+   LHIAMFPW A GH  PFL L+N LA+RGH+IS  +P     KL+H+NL+P LITF
Sbjct  1     MDTPPLHIAMFPWFAMGHLTPFLHLSNKLAQRGHKISFFIPKKTQTKLQHLNLHPHLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P V+GLP GAETT+D   +L   +  A+D    +++ +LL+  KP +VF+DF +W
Sbjct  61    FTINVPHVDGLPYGAETTSDVPFSLFPLIATAMDQTDKDIE-LLLKELKPQIVFFDFQHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  + G K++++ +++P IS   L T   + +GR +   D+M+PP GFP D+ + L 
Sbjct  120   LPNLTKKHGIKSLQYLIWNP-ISTAYLGTGPRQSQGRELNEVDLMKPPSGFP-DTCINLH  177

Query  838   EHEAYQVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELG  1002
              HE     RFL   R     + I ++DRV    +  D IAF+ C E++G Y  Y+ +  G
Sbjct  178   SHEL----RFLVSSRKLEFGSGILLYDRVDLGARLADVIAFKGCKEIDGPYVEYLGSVFG  233

Query  1003  KPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglel  1182
             K V  +GP+LPEPP      +K   WL  F+  SV++CA+GSE  L   QF +LLLGLEL
Sbjct  234   KSVLLSGPILPEPPMSTLE-EKWVSWLNGFKQGSVVYCAYGSESALEHNQFKELLLGLEL  292

Query  1183  tglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGG  1362
             TG PFL A+KPP    SIE+ALP+GF ER KG+ I +GGWV Q +IL H ++G F+ H G
Sbjct  293   TGFPFLAALKPPVGFESIEEALPQGFNERVKGRGIAYGGWVQQQLILGHTSIGCFITHCG  352

Query  1363  SGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIK  1539
             + S+ E L + C++++ P   SD+ +NAR+M+ +L+  VE++  E D  F KE++C A+ 
Sbjct  353   AASITEGLVNTCQLVLLPRLGSDHIMNARMMSAKLKVGVEIEKGEEDGLFTKESVCKAVN  412

Query  1540  SVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              VM E  +     + NH K R+ LL      + +DSF  +LY+L
Sbjct  413   IVMDEENELGREVRANHAKLRNFLLCNNLESSSVDSFCQELYDL  456



>ref|XP_008386210.1| PREDICTED: UDP-glycosyltransferase 79B9-like [Malus domestica]
Length=468

 Score =   312 bits (799),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 200/469 (43%), Positives = 286/469 (61%), Gaps = 26/469 (6%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  HIAMFPW A GH  PFL L+N+LA RGH+I+ LLP  A + L+H+NL+P L+TF  +
Sbjct  3     SSFHIAMFPWFALGHMTPFLHLSNELAARGHKITFLLPKKAQILLQHLNLHPHLVTFHPV  62

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAIL---LQMEKPNLVFYDFAYW  657
             T+P +EGLP   E  ++  ++L   L +A+D  +D+++  L   +   K +++F+D A+W
Sbjct  63    TVPHIEGLPDKTEFVSEIPLSLSHFLTLAIDRTRDQIQDFLKTSVANCKVDMIFFDSAHW  122

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLI------TSKSKGKGRAVTAADIMEPPPGFPSD  819
             IPE+   +G K++ + V      ALSL+      T  +      +T     +PPPG+PS 
Sbjct  123   IPEIARGLGIKSIFYGVICAAAYALSLVPICNYVTKDACMAPMTMTEEQQHKPPPGYPSS  182

Query  820   SKVVLREHEAYQVSRFLNLPRN---RITVFDRVV---EALKRCDAIAFRACNEMEGHYCN  981
             + V+ R HE     R L   R+    I V  R++    A+K CDA   R C E EG +C+
Sbjct  183   TVVLTRSHEV----RSLMTSRSCGVGIRVNQRLITGFRAIKECDAFCLRTCREFEGDFCD  238

Query  982   YIATELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQ  1161
             Y+  +  KPV   GP+L        LE++ A W   FE  +V+FCAFGS+    K+QF +
Sbjct  239   YLEAQFQKPVLLTGPVLSLEKGPTLLENRWADWFAGFEAGTVVFCAFGSQWAFEKDQFQE  298

Query  1162  lllgleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVG  1341
             L+LG ELTGLPFLVAVKPP    +IE+ALPEGF+ER +G+ +V GGWV Q +IL H AVG
Sbjct  299   LVLGFELTGLPFLVAVKPPLGCVTIEEALPEGFEERVRGRGVVFGGWVQQPLILSHPAVG  358

Query  1342  YFVNHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKEN  1521
              FV+H G G+MWESL S  +I++  P   D  L A+L+A+EL+ AVEV+ +E+  F +E+
Sbjct  359   CFVHHCGYGTMWESLMSENQIVLV-PQLVDQILGAKLLAKELKVAVEVEREEDGWFSRES  417

Query  1522  LCNAIKSVMGEN-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
             L  A+KSVM +      + K NH K R+++  PGF   Y+D F+  L E
Sbjct  418   LSKAVKSVMDKGSDVGVMVKKNHAKCREIISEPGFMSGYVDKFVDNLKE  466



>gb|AFK34819.1| unknown [Medicago truncatula]
Length=458

 Score =   311 bits (798),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 204/459 (44%), Positives = 287/459 (63%), Gaps = 20/459 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAMFPW A GH  P+L L+N LA RGH+IS  +P N L KL+++NLYP LITF  +T+
Sbjct  7     LHIAMFPWFAMGHLTPYLHLSNKLALRGHKISFFIPKNTLNKLQYLNLYPNLITFFPITV  66

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP  AETT+D   +L   +  A+D  + +++ ILL+  KP +VF+DF YW+P+L 
Sbjct  67    PHVNGLPLDAETTSDVPFSLVPLIATAMDQTEKDIE-ILLKEIKPQIVFFDFQYWLPKLT  125

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +  K++++ + +P +S   L   +    G+ +T  DIM+PP GFP DS +   +HE  
Sbjct  126   KNLDIKSLQYIILTP-VSTAYLGCLQKLSLGKDLTDVDIMKPPSGFP-DSCIKFYKHEL-  182

Query  853   QVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                RFL         + + +FDR+       DA+ F+ CNE++G Y +YI T  GKPV  
Sbjct  183   ---RFLASTGKIAFGSGVFLFDRLHIGTTSADAVGFKGCNEVDGPYADYIETVFGKPVLL  239

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +GP+LPEP       +K   WL+ FE  SV+FCA+GSE  L K QF +LLLGLELTG PF
Sbjct  240   SGPVLPEPTNTTLE-EKWISWLKGFENGSVVFCAYGSEGPLEKNQFLELLLGLELTGFPF  298

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+KPP    SIE+ALPEGF ER KGK IV+G W+ Q +IL H +VG F+ H G+ S+ 
Sbjct  299   LAALKPPIGFESIEEALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASIT  358

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGE  1554
             E L + C++++ P   SD+ +NAR+M+ + +  VEV+  DE+  F KE++C A K VM +
Sbjct  359   EGLVNTCQLVLLPRLGSDHIMNARVMSSKFKVGVEVEKGDEDGLFTKESVCKAAKIVMDD  418

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + NH K R+ LL+     + +DSF  KLY L
Sbjct  419   ENEIGREVRANHAKMRNFLLSNNLESSCVDSFCQKLYHL  457



>ref|XP_003526249.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=459

 Score =   311 bits (797),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 202/461 (44%), Positives = 283/461 (61%), Gaps = 15/461 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M+   LHIAM+PWLA GH   FL L N LA RGH+IS + P  A  KL+  NL+P  ITF
Sbjct  1     MKSRPLHIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEPFNLHPNSITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P VEGLPP A+TTAD T  L   +  A+D  +D+++ +L  + KP+LVFYDF +W
Sbjct  61    VTINVPHVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLTGL-KPDLVFYDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L   +G K V +   S  +   +L  S+   +G  +  +D+MEPP G+P DS + L+
Sbjct  120   MPALAKRLGIKAVHYCTASSVMVGYTLTPSRFH-QGTDLMESDLMEPPEGYP-DSSIKLQ  177

Query  838   EHEA--YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
              HEA  +   R      N +  +DR   AL   D +A+R C E+EG Y +YI  +  KPV
Sbjct  178   THEARTFAAKRKDTFGSN-VLFYDRQFIALNEADLLAYRTCREIEGPYMDYIGKQFNKPV  236

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                GP++ +PP  +   +K + WL  FEP SV++C FGSE  L   QF +L+LGLELTG+
Sbjct  237   VATGPVILDPPTLDLE-EKFSTWLGGFEPGSVVYCCFGSECTLRPNQFLELVLGLELTGM  295

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL AVK P    ++E A+PEGFQER KG+  V+GGWV Q +IL H +VG F+ H GSGS
Sbjct  296   PFLAAVKAPLGFETVESAMPEGFQERVKGRGFVYGGWVQQQLILAHPSVGCFITHCGSGS  355

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVM  1548
             + E+L + C++++  PN  D  LNAR+M   LE  VEV+  DE+  + KE++C A+  VM
Sbjct  356   LSEALVNKCQLVLL-PNVGDQILNARMMGTNLEVGVEVEKGDEDGMYTKESVCKAVSIVM  414

Query  1549  ---GENIQKV--NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                 E  ++V  NH + R+LLL      +Y+DSF  +L E+
Sbjct  415   DCENETSKRVRANHARIRELLLNKDLESSYVDSFCMRLQEI  455



>ref|XP_004301656.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Fragaria vesca 
subsp. vesca]
Length=471

 Score =   311 bits (797),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 202/470 (43%), Positives = 281/470 (60%), Gaps = 14/470 (3%)
 Frame = +1

Query  280   SASRKHM-MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMN  456
             S   KH+ + D  +H+AM+PW A GH   FL ++N LA+RGH+IS  LP     KL+H N
Sbjct  3     SVVDKHLSLSDQTMHVAMYPWFAMGHLTAFLHISNKLAERGHKISFFLPIKTQSKLQHYN  62

Query  457   LYPQLITFCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNL  633
             L+P LITF  L +P V+GLPPG ETTAD  ++L   +  A+D  + +++  LL++ +P+ 
Sbjct  63    LHPHLITFIPLNVPHVDGLPPGTETTADVPLSLGSLVATAMDLTRPQIEQHLLKL-RPDY  121

Query  634   VFYDFAYWIPELVSEMGC--KTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPG  807
             VF+DF++W+P L+ ++G   K+V + V +P      L    S+ K       D   P   
Sbjct  122   VFFDFSHWLPALLRQLGSNIKSVCYWVINPASVWYLLSLGLSRKKALDDVVDDPAHPSLC  181

Query  808   FPSDSKVVLREHEAYQVSRFLNLPRNRITVF-DRVVEALKRCDAIAFRACNEMEGHYCNY  984
             F S   + L+ HEA       N+       F  R + +L  CDAI F+ C E  G + NY
Sbjct  182   FSSSFSIKLKAHEARAYEAMANMEYGSGLPFVKRCLTSLSDCDAICFKTCREFAGPFRNY  241

Query  985   IATELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQl  1164
                ++ KPV  AG + P+PP      +K  +WL  FEP +VIFCA GSE VL K+Q  QL
Sbjct  242   FEMQMNKPVILAGLVTPDPPSSRLE-EKWEKWLGGFEPRTVIFCALGSEYVLTKQQLQQL  300

Query  1165  llgleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGY  1344
             LLG E TGLPF  A+K P    SIE ALPEGF+ER KGK +V G WV Q +IL+H AVG 
Sbjct  301   LLGFERTGLPFFAALKSPTGVESIESALPEGFEERVKGKGVVSGSWVQQPIILKHPAVGC  360

Query  1345  FVNHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKEN  1521
             FV H GSGS+ E+L + C+++   PN  D+ +NARLM+  L+  VE++  DE+  F KE 
Sbjct  361   FVTHCGSGSINEALLNECQLVFL-PNIGDHIINARLMSGYLKVGVEIEKGDEDGLFTKEG  419

Query  1522  LCNAIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             +C A+K+VM E+ Q     + NH KWR+     GF  +YID F+ KL+E+
Sbjct  420   VCKAVKAVMDEDSQVGKEVRTNHAKWREFFSNKGFESSYIDGFVQKLHEM  469



>ref|XP_004487584.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
Length=458

 Score =   310 bits (795),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 283/462 (61%), Gaps = 15/462 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAMFPW A GH IP+L L+N LAKRGH+IS   P     KL+  NLYP LIT
Sbjct  1     MDSPSSLHIAMFPWFAMGHLIPYLHLSNKLAKRGHKISFFTPKKTQTKLEQFNLYPNLIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  L +P V+GLP GAETT+D  ++L   L  A+D  Q++++ +L Q+ KP ++F+DF +
Sbjct  61    FYPLNVPHVDGLPFGAETTSDVAISLGPILMTAMDQTQNQIELLLTQL-KPQIIFFDFVF  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKG-KGRAVTAADIMEPPPGFPSDSKVV  831
             W+P++   +G K+  + + +P  + +S  TS  +  +   +T  D+M+PP G+P+     
Sbjct  120   WLPKITQRLGIKSFLYFIINP--ATISYTTSPPRMFEAENLTEVDLMKPPKGYPTSFN--  175

Query  832   LREHEAYQVSRFLNLPRNRITVFD-RVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             L+ HEA  ++    +       F  R    L   DAI F+ C E+EG Y +Y+  + GKP
Sbjct  176   LQSHEAKHLASTRKIEFGSGIPFSVRSYNCLSLTDAIGFKGCREIEGPYVDYLQEQFGKP  235

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V  +GP+LPE  +     +K   WL  F+  S+++CA GSE+ L ++QFH+LLLGLELTG
Sbjct  236   VLLSGPVLPEQSKTALD-EKWGSWLGGFKDGSLVYCALGSELKLKQDQFHELLLGLELTG  294

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
              PFL  +KPP    +IEDALPEGF+ER K K IVH GW+ Q +IL H +VG FV H G+G
Sbjct  295   FPFLAILKPPVGFETIEDALPEGFKERVKEKGIVHSGWIQQQLILEHPSVGCFVTHCGAG  354

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSV  1545
             S+ E L ++C++++ P    DY +NAR+M   L+  VEV+  E D  F KE++  A+K V
Sbjct  355   SITEGLVNNCQMVLLPQLNGDYIINARIMGRHLKVGVEVKKGEEDGLFTKESVYEAVKIV  414

Query  1546  MGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M +  +     + NH K R+LLL      + +D+F  KL EL
Sbjct  415   MDDENEIGREVRSNHTKVRNLLLRHDLESSCLDTFCEKLQEL  456



>gb|ADV71366.1| glycosyltransferase GT10J15 [Pueraria montana var. lobata]
Length=460

 Score =   310 bits (794),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 203/459 (44%), Positives = 285/459 (62%), Gaps = 20/459 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIA+FPW A GH  P L L+N LA+RGH+IS ++P     KL+H+NL+P LITF  + +
Sbjct  9     LHIAIFPWFAMGHLTPTLHLSNKLAQRGHKISFIIPKTTQTKLQHLNLHPHLITFVPIKV  68

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP  AETT+D   +L   L  ALD  + +++ +LL+  KP +VF+DF +W+P L 
Sbjct  69    PHVDGLPHDAETTSDLPFSLFPLLATALDRTEKDIE-LLLRKLKPQIVFFDFQHWLPNLT  127

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +G K+V + +  P +SA  L     K +GR +T  D+MEPP GFP DS      HE  
Sbjct  128   RSLGIKSVMYFITHP-LSAAYLGNGPRKSQGRELTELDLMEPPQGFP-DSCFKFHAHEL-  184

Query  853   QVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                RFL   R     + + ++DR+  +    DAI F+ C E++G Y  Y+ T  GKPV  
Sbjct  185   ---RFLVAARKLEFGSGVFLYDRLHTSTILADAIGFKGCKEIDGPYAEYLETVYGKPVLL  241

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +GPLLPEPP      +K   W  +F P SVIFCA+GSE  L + QF +LLLGLELTG PF
Sbjct  242   SGPLLPEPPNSTLE-EKWVAWFGRFNPGSVIFCAYGSESPLPQNQFQELLLGLELTGFPF  300

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+KPP    SIEDALPEGF ER + + I HGGWV Q +IL H ++G F+ H G+ S+ 
Sbjct  301   LAALKPPNGFESIEDALPEGFGERVQERGIAHGGWVQQQLILGHPSIGCFITHCGAASVT  360

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE  1554
             E+L + C++++ P   SD+ +NAR+M+ +L+  VEV+  E D  F KE++C A+K VM +
Sbjct  361   EALVNKCQLVLLPRLGSDHIMNARMMSVKLKVGVEVEKGEEDGLFTKESVCKAVKIVMDD  420

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + NH K R+ LL+     + +DSF  +L +L
Sbjct  421   GNEVGREVRENHAKLRNFLLSDNLESSCVDSFCQQLQDL  459



>ref|XP_008456016.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B6-like 
[Cucumis melo]
Length=472

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 193/466 (41%), Positives = 287/466 (62%), Gaps = 20/466 (4%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E   LHI MFPW A GH  PFL ++N LA + HRI+ LLP N       +NLYP LI+F 
Sbjct  7     ETQSLHILMFPWFATGHITPFLHISNHLASKNHRITFLLPNNPSPXFHSLNLYPNLISFH  66

Query  484   ALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
              L++P V GLPP A + +D  ++L   L  A D  + +V  I+  + +P+ VF+DFA+WI
Sbjct  67    FLSLPSVPGLPPAAHSASDIPLSLTPLLASAFDLTRPQVHRIIHSL-RPDFVFFDFAHWI  125

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             P++ + +  +++ FTV S    A+++   +       +T  D  EPP G+PS S VV  +
Sbjct  126   PDITAPLQIRSICFTVVSAASVAVTVFPGRRVSLDHPLTDEDFREPPVGYPS-STVVFHD  184

Query  841   HEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                 +   FL++P  + IT  +R++ + K+ DAIA R C E+EG +C++++ +L K +  
Sbjct  185   SRESRSLLFLSMPFGQGITFHERLMTSYKKSDAIAMRTCQEIEGDFCDFLSNQLQKKILL  244

Query  1018  AG--pllpeppreepleDK-IARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
              G     P    +    DK   +WL +F+P +VIFCAFGS+V+L K+Q  +L+LG+E TG
Sbjct  245   TGPLMAAPSSRIKATTLDKEWEKWLGQFQPKTVIFCAFGSQVILEKQQLEELVLGIEQTG  304

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPFLVA+KPP    S+++ALP+GF+ER K + IV+GGWV Q +IL H ++G FV+H G G
Sbjct  305   LPFLVALKPPMGYDSMKEALPKGFEERVKERGIVYGGWVQQPLILNHSSIGCFVSHCGFG  364

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM  1548
             SMWESL S  +I++  P   D  LN RL+A+EL+  VEV+ +E+  F ++++  AI+ VM
Sbjct  365   SMWESLMSDAQIVLI-PTLGDQILNTRLLAQELKVGVEVKREEDGSFTRQSVRQAIELVM  423

Query  1549  -----------GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
                        GE ++K NH KW+ LL  P F + YID+F+  L E
Sbjct  424   VDDNNNNGSGIGEMVKK-NHAKWKHLLTKPSFLETYIDNFVMNLQE  468



>ref|XP_009767952.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nicotiana sylvestris]
Length=469

 Score =   310 bits (795),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 203/477 (43%), Positives = 286/477 (60%), Gaps = 34/477 (7%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             MED  L   M+PW A GH   FL L+N LA RGH I  + PTN L KL+  NLYPQLI F
Sbjct  1     MEDKKLTFVMYPWYAMGHLTSFLHLSNKLADRGHTIFFIHPTNTLSKLEKFNLYPQLINF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
              ++T+P VEGLP GAETT+D  +     L  ALD  Q ++++ L+Q  KP+ + YDFAYW
Sbjct  61    ISITVPHVEGLPIGAETTSDIPIFKQNLLWQALDLTQQKIES-LIQELKPHFILYDFAYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAAD-IMEPPPGFPSDSKVVL  834
             +P +  + G K++ +   +P+     +       +G   T  D +MEPP GFP +S + L
Sbjct  120   VPLVARKYGVKSIHYCSITPSSVGYLM-------RGEKPTPEDEMMEPPLGFPPNSSIKL  172

Query  835   REHEAYQVSRFLNLPRNRITVFD-----------------RVVEALKRCDAIAFRACNEM  963
              ++EA  ++   ++ +                        R++ A +  D IAF+   E+
Sbjct  173   HKYEARLIAALHSIGKESSGSGSGLGSGSGSGSGSVSFTRRLLLAFQDGDVIAFKTTKEI  232

Query  964   EGHYCNYIATELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLG  1143
             EG YC ++  +  KPV  AGP+LPEP     LE+ +++WLEKF+  +VIFCAFGSE  L 
Sbjct  233   EGPYCEFVENKFKKPVILAGPILPEPIDTSNLEENLSKWLEKFQEKTVIFCAFGSECKLK  292

Query  1144  KEQFHQlllgleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMIL  1323
             KEQF +L+LGLELTGLPF  A+KPP  + +IEDALPEGF+ER +GK IVH GW  Q +IL
Sbjct  293   KEQFQELVLGLELTGLPFFAALKPPFEAETIEDALPEGFKERIEGKGIVHSGWAEQQLIL  352

Query  1324  RHKAVGYFVNHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDEND  1503
              H +VG FV H G  S+ E++ +  ++++  PN  D  +NARL   +L   VEV+ DE +
Sbjct  353   SHPSVGCFVTHCGGNSLSEAMITEGQLVLV-PNFGDQFVNARLFGGDLRVGVEVERDEEN  411

Query  1504  KFF-KENLCNAIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               F +E++C AIK VM +  +     + N  KWR+ LL+ G  D+YID+F+ KL  L
Sbjct  412   GLFTRESVCKAIKMVMNDESEEGREIRANRAKWREFLLSKGLEDSYIDAFVQKLQTL  468



>ref|XP_003593675.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES63926.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=458

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 195/460 (42%), Positives = 290/460 (63%), Gaps = 13/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M  ++ H+AM+PW A GH   +L ++N LA+RGH+IS L+P N + KL+H NL+P LI+F
Sbjct  1     MVANIFHVAMYPWFALGHLTSYLHISNKLAERGHKISFLMPRNTISKLEHFNLHPDLISF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +TIP V+GLP G+ETTAD   +L   L  A+D  +  ++  L ++ +P++VF+DF YW
Sbjct  61    VPITIPHVDGLPLGSETTADIPFSLHSLLMTAMDLTEPIIEDTLREL-RPHMVFFDFTYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L   +G K + +   SP      LI+ + K   +++T  D+++PPP FP  S + L+
Sbjct  120   LPALACRLGIKALHYCTISPATVGY-LISPERKLHEKSLTEEDLIDPPPSFPP-SAIKLQ  177

Query  838   EHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              HEA  ++        + I+   R + +   CDAI F+ C EMEG YC+Y+   + K V 
Sbjct  178   PHEARGLATATVKGYGKDISFTKRQLISFTSCDAIVFKTCREMEGPYCDYLEKTMRKQVI  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              AG  +   P    LE+K   WL  F+  +VIFCAFGSE +L   QF +LLLG ELTG+P
Sbjct  238   LAG-PVLPDPPTTTLEEKWVTWLGGFKSKTVIFCAFGSECILKSNQFKELLLGFELTGMP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL A+KPP  + +++ ALPEGF ERTKG+AIV G WV Q +IL H++VG FV H GSGS+
Sbjct  297   FLAALKPPIGAKTMKLALPEGFIERTKGRAIVVGDWVQQQLILSHQSVGCFVTHCGSGSL  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM-  1548
              E++ + C++++  P+  D  +NAR+M+ +L+  VEV+  E+D  F KE +C A+K+VM 
Sbjct  357   TEAMVTDCQLVLL-PHAGDQFINARIMSGDLKVGVEVEKSEDDGLFTKEAVCKAVKTVMD  415

Query  1549  --GE--NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               GE  ++ + NH KW   LL+ G  ++Y+D  + KL  L
Sbjct  416   SEGELGHMVRTNHAKWGKFLLSQGLENSYVDDLVQKLDSL  455



>ref|XP_008455479.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=469

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 197/464 (42%), Positives = 279/464 (60%), Gaps = 13/464 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAM+PW AFGH IP+LQ+AN LAK+GHRIS L+P+N   KL+  N +P LIT
Sbjct  1     MAATSSLHIAMYPWFAFGHLIPYLQIANKLAKKGHRISFLIPSNTQPKLQPFNHFPNLIT  60

Query  478   FCALTIPQVEGLPPGAETTADTMNLD--GSLEVALDGLQDEVKAILLQMEKPNLVFYDFA  651
             F  + +P V GLP GAETTAD  NL     +  A+D  Q ++++  LQ  KP+  F+DF 
Sbjct  61    FLPIIVPHVNGLPQGAETTADVSNLQQFSLIMTAMDLTQPQIES-FLQHVKPHFFFFDFT  119

Query  652   YWIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             YW+P+L S+ G K++  +V S T  A     S+    G   T  D M+PP GFPS S + 
Sbjct  120   YWMPKLASQFGIKSIYHSVISATTFAYVYPPSRQLC-GHDFTVDDFMKPPLGFPS-SVIK  177

Query  832   LREHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             L  HEA   +   ++   + +  F R    L   DAIAF++  E+EG + +Y+ TE  KP
Sbjct  178   LHSHEAKFYASMSHMKFGSDVLFFHRHFTGLCESDAIAFKSSREIEGPFIDYLETEFKKP  237

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V  +GP          LE + A  L +F+  SVI+CAFGSE  L K+Q  +L+LG ELT 
Sbjct  238   VLLSGPDGNIQEPTTTLEQRWAECLSEFKAGSVIYCAFGSECTLTKDQLQELVLGFELTN  297

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPF   +KPP    +I  ALPEGF++R +G+ +V+GGWV Q  IL H ++G FV H G+G
Sbjct  298   LPFFAVLKPPHGMDTINAALPEGFEQRIQGRGVVYGGWVQQQHILEHPSIGCFVTHCGAG  357

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSV  1545
             S+ E+L   C+++   P+  D+   AR ++  L+  VEV+  + D  F KE++C A+K+V
Sbjct  358   SLSEALVKKCQLVFL-PHIGDHFFRARTLSSCLKVGVEVERRQEDGVFNKESVCKAVKTV  416

Query  1546  MGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSV  1662
             M E  +     + N  K R+LL+     ++YI++FIHKL+ L V
Sbjct  417   MDEENESGKEIRANLAKLRELLVDKDLEESYINNFIHKLHCLIV  460



>ref|XP_009127123.1| PREDICTED: UDP-glycosyltransferase 79B10-like [Brassica rapa]
Length=451

 Score =   309 bits (791),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 200/453 (44%), Positives = 285/453 (63%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  P++ LAN LA++GHR++ LLP  A  +L+H+NL+P  I F  +TI
Sbjct  9     FHAFMFPWFAFGHMTPYVHLANKLAEKGHRVTFLLPKKAKKQLEHLNLFPDSIVFHPITI  68

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  + L   L  A+D  +D+V+A +  + +P+++ +D AYWI E+ 
Sbjct  69    PHVDGLPAGAETPSDIPVTLWRFLSTAMDLTRDQVEAAVRAL-RPDIILFDLAYWITEVA  127

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E G K++ + V S T  A  L           V   ++  PPPG+PS S ++ R H+A+
Sbjct  128   KEHGIKSMLYNVISATSIAHDL-----------VPGGELGVPPPGYPS-STLLFRRHDAH  175

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F    +     + RV   L  CD I+ R C E+EG +C+YI  +  K V   GP+L
Sbjct  176   ALLSFAVYYKR---FYYRVTTGLTDCDFISIRTCEEIEGKFCDYIGRQYQKKVLLTGPML  232

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP + +PLEDK   WL  FEP SV++CA GS++ L K+QF +L LGLELTGLPF VAV 
Sbjct  233   PEPDKSKPLEDKWNNWLSGFEPGSVVYCALGSQITLEKDQFQELCLGLELTGLPFFVAVT  292

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I++ALPEGF+ER KG+ +V G WV Q +IL H +VG FV+H G GSMWESL S
Sbjct  293   PPKGAKTIQEALPEGFEERVKGRGVVWGEWVQQPLILAHPSVGCFVSHCGFGSMWESLMS  352

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P  +D  LN RL+ +ELE +VEV  ++   F KENL  A+ SVM +     N
Sbjct  353   DCQIVLL-PYLADQVLNTRLLTDELEVSVEVPREKTGWFSKENLSVAVTSVMDKDSEIGN  411

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + + NH K ++++++PG    Y D+F+  L  L
Sbjct  412   LVRRNHSKLKEVVVSPGLLTGYTDNFVVTLENL  444



>gb|KFK35925.1| hypothetical protein AALP_AA4G054400 [Arabis alpina]
Length=449

 Score =   308 bits (790),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 202/456 (44%), Positives = 285/456 (63%), Gaps = 29/456 (6%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+P   FGH IP+L LAN LA++GH+++ L+PT A  +L+ +N +P  I F  L
Sbjct  3     SKFHAFMYPIFGFGHMIPYLHLANKLAEKGHKVTFLVPTKAQKQLQPLNRFPSSILFETL  62

Query  490   TIPQVEGLPPGAETTADTMNLDGSLEV---ALDGLQDEVKAILLQMEKPNLVFYDFAYWI  660
             T+P V+GLP GAETT+D    D S E+   A+D L+D+++A +  + KP+L+F+DF   I
Sbjct  63    TLPHVDGLPDGAETTSDLP--DSSKELLSNAMDLLRDQIEAKVRAL-KPDLIFFDFVDSI  119

Query  661   PELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             PE+  ++G K V + + S    A+ L              A++  PPPG+PS SKV LR 
Sbjct  120   PEMAKKLGVKCVSYQIVSAACIAMFL-----------APGAELGFPPPGYPS-SKVALRG  167

Query  841   HEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             H+A   S F +    R  +FDRV +AL  CD +A R C E+EG  C++I  +  + V   
Sbjct  168   HDANLYSHFTS---TRQILFDRVTKALMNCDIVAIRTCAEIEGKLCDFIERQCQRKVLLT  224

Query  1021  Gpl--lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
             GP+    +    + LED+   WL  FEP SV+FCAFG+   L K+QF +L LG+ELTGLP
Sbjct  225   GPMLPELQDRSSKQLEDRWNHWLNGFEPGSVVFCAFGTHCFLEKDQFQELCLGMELTGLP  284

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL+AV PP  SS+I++ALPEGF+ER KG+ +V   WV Q +IL H +VG FVNH G GSM
Sbjct  285   FLLAVMPPRGSSTIQEALPEGFEERVKGRGVVSREWVEQPLILSHPSVGCFVNHCGFGSM  344

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
             WESL S CRI+   P  +D  L  RL+ EELE +V++Q +++  F KE+L +A+KSVM +
Sbjct  345   WESLLSDCRIVFV-PLLADQVLTTRLLTEELEVSVKIQREDSGWFSKESLRDAVKSVMDK  403

Query  1555  N-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
             +     + K NHKK ++ L++PG    Y D F+  L
Sbjct  404   DSEIGKLVKRNHKKLKETLVSPGLLCGYADKFVEAL  439



>ref|XP_009610402.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Nicotiana tomentosiformis]
Length=461

 Score =   309 bits (791),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 202/469 (43%), Positives = 284/469 (61%), Gaps = 26/469 (6%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             MED  L   M+PW A GH   FL L+N LA RGH I  + PTN L KL+  NLYPQLI F
Sbjct  1     MEDKKLTFIMYPWYAMGHLTSFLHLSNKLADRGHTIFFIHPTNTLSKLEKFNLYPQLINF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
              ++ +P VEGLP GAETT+D ++     L  ALD  Q ++++ L+Q  KP+ + YDFAYW
Sbjct  61    ISIKVPHVEGLPLGAETTSDISIFKQNLLWQALDLTQQKIES-LIQELKPHFILYDFAYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAAD-IMEPPPGFPSDSKVVL  834
             +P +  + G K++ +   +P+     +       +G   T  D +MEPP GFP +S + L
Sbjct  120   VPLVARKYGVKSIHYCSITPSSVGYLM-------RGEKPTPEDEVMEPPLGFPPNSSIKL  172

Query  835   REHEAYQVSRF---------LNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYI  987
              ++EA  ++                  ++   R++ A +  D IAF+   E+EG YC ++
Sbjct  173   HKYEARLIAALHSIGKESSGSGSGSGSVSFTRRLLLAFQDGDIIAFKTTKEIEGPYCEFV  232

Query  988   ATELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQll  1167
               +  KPV  AGP+LPEP     LE+ +++WLEKF+  +VIFCAFGSE  L KEQF +L+
Sbjct  233   ENKFKKPVVLAGPILPEPIDTSNLEENLSKWLEKFQEKTVIFCAFGSECKLKKEQFQELV  292

Query  1168  lgleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYF  1347
             LGLELTGLPF  A+KPP  + +IEDALPE F+ER +GK IVH GW  Q +IL H +VG F
Sbjct  293   LGLELTGLPFFAALKPPFEAETIEDALPERFKERIEGKGIVHSGWAEQQLILSHPSVGCF  352

Query  1348  VNHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENL  1524
             V H G  S+ E++ + C++++  PN  D  +NARL   +L   VEV+ DE +  F +E +
Sbjct  353   VTHCGGNSLSEAMITECQLVLV-PNFGDQFINARLFGGDLRVGVEVERDEENGLFTREGV  411

Query  1525  CNAIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             C AIK VM  + +     + N  KWR+ LL+ G  D+YID+F+ KL  L
Sbjct  412   CKAIKMVMNGDSEEGREIRANRAKWREFLLSKGLEDSYIDAFVQKLQTL  460



>emb|CDY28802.1| BnaA02g09940D [Brassica napus]
Length=451

 Score =   308 bits (789),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 200/453 (44%), Positives = 284/453 (63%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  P++ LAN LA++GHR++ LLP  A  +L+H+NL+P  I F  +TI
Sbjct  9     FHAFMFPWFAFGHMTPYVHLANKLAEKGHRVTFLLPKKANKQLEHLNLFPDSIVFHPITI  68

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  + L   L  A+D  +D+V+A +  + +P+++ +D AYWI E+ 
Sbjct  69    PHVDGLPAGAETPSDIPVTLWRFLSTAMDLTRDQVEAAVRAL-RPDIILFDLAYWITEVA  127

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E G K++ + V S T  A  L           V   ++  PPPG+PS S ++ R H+A+
Sbjct  128   KEHGIKSMLYNVISATSIAHDL-----------VPGGELGVPPPGYPS-STLLFRRHDAH  175

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F    +     + RV   L  CD I+ R C E+EG +C+YI  +  K V   GP+L
Sbjct  176   ALLSFAVYYKR---FYYRVTTGLTDCDFISIRTCEEIEGKFCDYIGRQYQKKVLLTGPML  232

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP + +PLEDK   WL  FEP SV++CA GS++ L K QF +L LGLELTGLPF VAV 
Sbjct  233   PEPDKSKPLEDKWNNWLSGFEPGSVVYCALGSQITLEKNQFQELCLGLELTGLPFFVAVT  292

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I++ALPEGF+ER KG+ +V G WV Q +IL H +VG FV+H G GSMWESL S
Sbjct  293   PPKGAKTIQEALPEGFEERVKGRGVVWGEWVQQPLILAHPSVGCFVSHCGFGSMWESLMS  352

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P  +D  LN RL+ +ELE +VEV  ++   F KENL  A+ SVM +     N
Sbjct  353   DCQIVLL-PYLADQVLNTRLLTDELEVSVEVPREKTGWFSKENLSVAVTSVMDKDSEIGN  411

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + + NH K ++++++PG    Y D+F+  L  L
Sbjct  412   LVRRNHSKLKEVVVSPGLLTGYTDNFVVTLENL  444



>gb|AES66919.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=437

 Score =   307 bits (787),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 185/462 (40%), Positives = 272/462 (59%), Gaps = 44/462 (10%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             +HI+MFPW A GHF P+L  +N LA RGH+IS  +P N L KL+H+NL+P LITF  +T+
Sbjct  7     MHISMFPWFAMGHFTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLITFFPITV  66

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP  AETT+D   +L   +  A+D    +++ +LL+  KP +VF+DF YW+P L 
Sbjct  67    PHVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIE-LLLKELKPQIVFFDFQYWLPNLT  125

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              ++G K++++ ++SP IS   L +   K +G  +T  D+ +PP GFP DS +    HE  
Sbjct  126   QKLGIKSLQYLIWSP-ISPAYLGSIPRKSQGTYLTEDDLKKPPTGFP-DSSIKFHSHEL-  182

Query  853   QVSRFLNLPRNR-----ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                RFL   R +     + ++DRV    K  DA++F+ C E++G Y +Y+ T  GKPV  
Sbjct  183   ---RFLASTRKQEFGSGVLLYDRVDTGTKFSDAVSFKGCREIDGLYADYLETVFGKPVLL  239

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +G  L     +  LE+K   WLE F+  SV+FCA+GSE                      
Sbjct  240   SG-PLLPEAPKSTLEEKWLTWLEGFKHGSVVFCAYGSE----------------------  276

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
               A+KPP    SIE+ALPEGF ER  GK IV+G W+ Q +IL H +VG F+ H G+ S+ 
Sbjct  277   --ALKPPIGFDSIEEALPEGFNERVNGKGIVYGNWIQQQLILEHPSVGCFITHCGAASIT  334

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE  1554
             E L + C++++ P   +D+ +NAR+M+ +L+  VEV+  E D  F KE++C A+K VM +
Sbjct  335   EGLVNTCQLVLLPRAGTDHIMNARMMSSKLKVGVEVEKGEEDGLFTKESVCKAVKIVMDD  394

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
               +     + NH K R+ LL+     + +DSF  KLY+L  Q
Sbjct  395   ENEVGKAVRANHAKMRNFLLSSNLESSCVDSFCQKLYDLLYQ  436



>gb|ACU24192.1| unknown [Glycine max]
Length=458

 Score =   308 bits (789),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 194/464 (42%), Positives = 282/464 (61%), Gaps = 20/464 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M+ S +HIAMFPW A GH  P+L L+N LAKRGHRIS  +P     KL+  NL+P LITF
Sbjct  1     MDASSMHIAMFPWFAMGHLTPYLHLSNKLAKRGHRISFFIPKRTQHKLEQFNLFPHLITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P VEGLP GAETT+D + +L   +  A+D  + +++ +L+++ KP +VF+DF YW
Sbjct  61    YPINVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLIEL-KPQIVFFDFTYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L   +G K+ ++ + SP   A +    + +     +T  D+M+PP G+P  S + L 
Sbjct  120   LPNLTRRLGIKSFQYMIVSPATVAYNASPPRMQ-NSVNLTEVDLMQPPLGYPVSS-IKLH  177

Query  838   EHEAYQVSRFLNLPRN-----RITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELG  1002
              HEA    +FL   RN      +  +DR+   L   DAI F+ C E+EG Y +Y+  + G
Sbjct  178   AHEA----KFLASKRNWEFGSGVLFYDRLYGGLSPSDAIGFKGCREIEGPYVDYLEEQFG  233

Query  1003  KPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglel  1182
             K V  +G  +   P    LE K   WLE+F+P+SVIFCA GSE  L  +QF + LLGLEL
Sbjct  234   KSVLLSG-PIIPEPPNTVLEGKWGSWLERFKPDSVIFCALGSEWKLPHDQFQEFLLGLEL  292

Query  1183  tglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGG  1362
             TGLPFL  +K P    ++E ALPEGF+ER + + IVHGGW+ Q +IL H +VG F+ H G
Sbjct  293   TGLPFLAVLKTPIGFETLEAALPEGFKERVEERGIVHGGWIQQQLILEHPSVGCFITHCG  352

Query  1363  SGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIK  1539
             +GS+ E+L + C+I++ P    D+ +NAR+M E L+  VEV+  E D +F KE++  A+K
Sbjct  353   AGSLTEALVNKCQIVLLPQVDGDHIVNARMMGENLKIGVEVEKGEEDGWFTKESVSKAVK  412

Query  1540  SVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              VM +  +     + NH K R+ L++       +D F  KL +L
Sbjct  413   IVMDDENEVGREVRTNHAKLRNFLVSHNLESACVDGFCQKLRDL  456



>ref|XP_007132923.1| hypothetical protein PHAVU_011G136400g [Phaseolus vulgaris]
 gb|ESW04917.1| hypothetical protein PHAVU_011G136400g [Phaseolus vulgaris]
Length=461

 Score =   308 bits (789),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 191/457 (42%), Positives = 288/457 (63%), Gaps = 15/457 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH   +L LAN LAKRGH+IS ++P     K++H NLYPQL+TF  +T+
Sbjct  8     LHIAMYPWFAIGHISAYLHLANKLAKRGHKISFIVPKLTKSKVEHFNLYPQLVTFIPITM  67

Query  496   PQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLPP AETT D T++L   +   +D  + +++ +LL++ KPN+VF+D+  W+P L 
Sbjct  68    PLVDGLPPHAETTFDATISLGKLIMTGMDRTEKDIELLLLEL-KPNIVFFDYTCWMPNLA  126

Query  673   SEMGCKTVKFTVFSPTI-SALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
               +G K+V +   S    S +  +  +   K  A    +++ PP GFP D  + L+ HE 
Sbjct  127   RSLGIKSVHYITLSMIFESYMECMEKQFSEKNIAEHELNLLNPPAGFP-DPSIKLQAHEV  185

Query  850   YQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
              Q++  +N    + +  +DR+  + +  DA+AFR C E+EG Y +++    GKP+  +GP
Sbjct  186   RQLTSVVNSEFGSGVRYYDRISTSTRLSDAVAFRGCREIEGLYADFLEISYGKPLLLSGP  245

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
             ++PEP       ++ A WL  F+  SV++CAFGSE  L ++Q  +LL+GLELTG PFL A
Sbjct  246   VIPEPHTSPLE-EEWAEWLSGFKEESVVYCAFGSECRLHQDQLKELLVGLELTGFPFLAA  304

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +K P    S+E A+P+GF ER +G+ IVHG WV Q++IL H ++G F+ H G  S+ E+L
Sbjct  305   LKAPIGFESVEAAMPKGFSERVRGRGIVHGSWVQQTLILDHPSIGCFITHCGVASLLEAL  364

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM-----  1548
              S+C+I+V  PN  D  LNAR+++  ++A V+V+  E D  F KE++C A+K+VM     
Sbjct  365   VSNCQIVVL-PNFIDQLLNARMISSSIKAGVQVEKGEEDGLFTKESVCAAVKTVMDLESE  423

Query  1549  -GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              G  +++ NH K R+LLLT    + Y+D F  KL EL
Sbjct  424   VGREVRE-NHLKLRNLLLTKDLENTYLDGFCQKLQEL  459



>ref|XP_010035825.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Eucalyptus grandis]
 gb|KCW47287.1| hypothetical protein EUGRSUZ_K01079 [Eucalyptus grandis]
Length=457

 Score =   308 bits (789),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 281/460 (61%), Gaps = 13/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M +S LHIAM+PWLA GH  PFL LAN LAK+GH+IS L+P     KL+H N +P LITF
Sbjct  1     MGESRLHIAMYPWLAMGHLTPFLHLANKLAKKGHKISFLIPPRTRAKLEHFNRHPDLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + IP VEGLPP AETT+D    L   +  A+D  +  V+  LLQ  KP+ VF+DF +W
Sbjct  61    VPIAIPHVEGLPPDAETTSDVPYPLHPLIMTAMDHTEPTVRQ-LLQTLKPHCVFHDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDS-KVVL  834
             +P +  ++G K+V + + SP   + +L  ++     + +T AD M PP G+P+ S K+ L
Sbjct  120   LPAIAHDLGIKSVHYCIISPVTVSYTLSPARHLSAHK-LTEADYMVPPAGYPNSSIKLHL  178

Query  835   REHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              E  A    R+     N I   DR+       D ++FR+C E+E  Y  Y+ ++ GKPV 
Sbjct  179   HEARALIAIRYKTYGSN-IGFSDRMFAGYVESDILSFRSCREIEQPYIEYLKSQFGKPVL  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              +GP++PEP       +K   WL  F+  SVI+CAFGSE  + K+QF +LLLGLELTGLP
Sbjct  238   LSGPVIPEPSTSGLD-EKWVEWLGDFKDGSVIYCAFGSECTMQKDQFQELLLGLELTGLP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL A+KPP  +SSIE+ALP GF+ER +G+  VHGGWV Q +IL+H A+G F+ H G+ S 
Sbjct  297   FLAALKPPFGTSSIEEALPVGFEERVQGRGTVHGGWVQQQLILQHPAIGCFITHCGTSST  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDEND-KFFKENLCNAIKSVMG  1551
              E+L + C++++  P   D   NAR+M   L+  VEV+  E D +  KE++C A+ +VM 
Sbjct  357   IEALVNKCQLVLL-PQVGDQIFNARMMGNNLKVGVEVEKGEEDGRLTKESVCKAVNTVMD  415

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E     N  + NH K R++LL       YID F  +L  L
Sbjct  416   EGDAYGNEVRENHAKIREILLDKKLESTYIDCFDQELQNL  455



>gb|KHN07772.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=459

 Score =   308 bits (789),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 201/461 (44%), Positives = 282/461 (61%), Gaps = 15/461 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M+   LHIAM+PWLA GH   FL L N LA RGH+IS + P  A  KL+  NL+P  ITF
Sbjct  1     MKSRPLHIAMYPWLAMGHQTAFLHLCNKLAIRGHKISFITPPKAQAKLEPFNLHPNSITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P VEGLPP A+TTAD T  L   +  A+D  +D+++ +L  + KP+LVFYDF +W
Sbjct  61    VTINVPHVEGLPPDAQTTADVTYPLQPQIMTAMDLTKDDIETLLTGL-KPDLVFYDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L   +G K V +   S  +   +L   +   +G  +  +D+MEPP G+P DS + L+
Sbjct  120   MPALAKRLGIKAVHYCTASSVMVGYTLSPVRFH-QGTDLMESDLMEPPEGYP-DSSIKLQ  177

Query  838   EHEA--YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
              HEA  +   R      N +  +DR   AL   D +A+R C E+EG Y +YI  +  KPV
Sbjct  178   THEARAFAAKRKDTFGSN-VLFYDRQFIALNEADLLAYRTCREIEGPYMDYIGKQFNKPV  236

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                GP++ +PP  +   +K + WL  FEP SV++C FGSE  L   QF +L+LGLELTG+
Sbjct  237   VATGPVILDPPTLDLE-EKFSTWLGGFEPGSVVYCCFGSECTLRPNQFLELVLGLELTGM  295

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL AVK P    ++E A+PEGFQER KG+  V+GGWV Q +IL H +VG F+ H GSGS
Sbjct  296   PFLAAVKAPLGFETVESAMPEGFQERVKGRGFVYGGWVQQQLILAHPSVGCFITHCGSGS  355

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVM  1548
             + E+L + C++++  PN  D  LNAR+M   LE  VEV+  DE+  + KE++C A+  VM
Sbjct  356   LSEALVNKCQLVLL-PNVGDQILNARMMGTNLEVGVEVEKGDEDGMYTKESVCKAVSIVM  414

Query  1549  ---GENIQKV--NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                 E  ++V  NH + R+LLL      +Y+DSF  +L E+
Sbjct  415   DCENETSKRVRANHARIRELLLNKDLESSYVDSFCMRLQEI  455



>ref|XP_006377437.1| hypothetical protein POPTR_0011s05910g [Populus trichocarpa]
 gb|ERP55234.1| hypothetical protein POPTR_0011s05910g [Populus trichocarpa]
Length=446

 Score =   307 bits (787),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 197/451 (44%), Positives = 285/451 (63%), Gaps = 15/451 (3%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             M+PW A GH   F+  +N LA+RGHR+S  LP     K +  NL+P LITF  +T+P V+
Sbjct  1     MYPWFALGHLTAFVHFSNKLAERGHRVSFFLPKKTQSKFEPFNLHPDLITFIPITVPHVD  60

Query  508   GLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMG  684
             GLP G ETT D    L   L  A+D L + V    L++  P+ +F+DF +W+PEL  + G
Sbjct  61    GLPTGTETTTDVPFPLHPLLMTAMD-LTEHVIKDHLRILNPHFIFFDFTHWLPELSRKHG  119

Query  685   CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSR  864
              K+V F + SP      L   +   K  ++TAAD+M+PPP F   S + LR HEA  +  
Sbjct  120   IKSVHFCIISPATIGYMLSPER---KLESLTAADLMQPPPSF-PPSSIKLRAHEARGICA  175

Query  865   F-LNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpep  1041
               +    + I+  +R + +L +CDAIAF+AC EMEG Y +YI  + GKPV  AGP++PEP
Sbjct  176   VTVKQFGSNISFQERNIYSLSQCDAIAFKACREMEGPYSDYIEDQFGKPVILAGPIVPEP  235

Query  1042  preepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKPPE  1221
             P      +KIA+ L+ F+  +++FCAFGSE +L K+QF +L+LGLELT LPF   +KPP 
Sbjct  236   PNSVLE-EKIAKMLDSFKAETLVFCAFGSECILKKDQFQELVLGLELTSLPFFAVLKPPI  294

Query  1222  RSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASHCR  1401
              + +IE ALPEGF+ER KG+ +V+ GWV Q +ILRH +VG FV H GSGS+ E + + C+
Sbjct  295   GAETIESALPEGFEERVKGRGLVYTGWVQQQLILRHPSVGCFVTHCGSGSLSEGMVNKCQ  354

Query  1402  IIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGEN-----IQ  1563
             +++  PN  D  +NAR++  +L+  VEV+  E D  F +  +C A+K+VM ++     + 
Sbjct  355   LVLL-PNVGDQIINARVVGGDLKVGVEVKKGEEDGLFTRHGVCEAVKAVMDDDSEVGKLV  413

Query  1564  KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + NH KWR+ LL     ++Y+D F+HKL+EL
Sbjct  414   RANHAKWREFLLGKELENSYVDGFVHKLHEL  444



>ref|XP_010111152.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXC30543.1| UDP-glycosyltransferase [Morus notabilis]
Length=460

 Score =   308 bits (788),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 203/456 (45%), Positives = 282/456 (62%), Gaps = 13/456 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH   FL ++N LA+RGHRIS  +PT    KL   NL+P LI+F  + +
Sbjct  5     LHIAMYPWFAMGHLTSFLHISNKLAERGHRISFFIPTETQPKLSSFNLHPHLISFLPIDV  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLPP AETT D    L   L  A+D  +  ++A L+Q+ KP+ VF+DF +W+P+  
Sbjct  65    PHVPGLPPTAETTNDIPYALFSLLMTAMDLTRPAIEASLVQL-KPHFVFFDFTHWLPQSA  123

Query  673   SEMG-CKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
               +G  KT+ +   SP      LI+ + +   +++  +D++ PP  FPS S + L  HEA
Sbjct  124   RRIGNIKTLLYCTISPAAVGY-LISPERELNEKSLKESDLLVPPKSFPSLSCIRLSAHEA  182

Query  850   YQ-VSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
                V   +      I+  +R + AL   DAI F+   EMEG YC+YI  + GK V  AGP
Sbjct  183   RGLVKETVKELGAGISFLERQLIALNDSDAIGFKTSREMEGVYCDYIERQFGKKVILAGP  242

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
             ++PEPP      +K A +L  F    VIFCAFGSE VL  +QF +L++GLELTGLPFLVA
Sbjct  243   VVPEPPNSALE-EKWANFLGNFGCKKVIFCAFGSECVLENDQFQELIIGLELTGLPFLVA  301

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP+    IE ALPEGF+ER K + IVHGGWV Q +ILRH +VG FV H GSGS+ E L
Sbjct  302   LKPPKGYEKIECALPEGFEERVKERGIVHGGWVQQQLILRHSSVGCFVTHCGSGSLLEGL  361

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGENIQ  1563
              + C++++  PN  D  +NAR+M+ +L   VEV+  +E+  F +E +C A+K VM +  +
Sbjct  362   MNECQLVLV-PNVGDQIINARMMSGDLRVGVEVKRGNESGAFTREGVCKAVKDVMDDESE  420

Query  1564  -----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  + NH KWR+ LL+ G  D+YID F+ +L  +
Sbjct  421   VGKEVRTNHDKWREFLLSKGLEDSYIDCFVEELLAM  456



>ref|XP_010035826.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Eucalyptus grandis]
 gb|KCW47284.1| hypothetical protein EUGRSUZ_K01076 [Eucalyptus grandis]
Length=457

 Score =   307 bits (787),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 280/460 (61%), Gaps = 13/460 (3%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M +S LHIAM+PWLA GH  PFL LAN LAK+GH+IS L+P     KL+H N +P LITF
Sbjct  1     MGESRLHIAMYPWLAMGHLTPFLHLANKLAKKGHKISFLVPPRTQAKLEHFNRHPDLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + IP VEGLPP AETT+D    L   +  A+D  +  V   LLQ  KP+ V +DF +W
Sbjct  61    VPIAIPHVEGLPPDAETTSDVPYPLHPLIMTAMDHTEPTVHQ-LLQTLKPHCVLHDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDS-KVVL  834
             +P +  ++G K+V + + SP   + +L   +     + +T AD M PP G+P+ S K+ L
Sbjct  120   LPAIARDLGIKSVHYCIISPVTVSYTLSPVRHLSAHK-LTEADYMVPPAGYPNSSIKLHL  178

Query  835   REHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              E  A    R+     N I   DR+       D ++FR+C E+E  Y  Y+ ++ GKPV 
Sbjct  179   HEARALIAIRYKTYGSN-IGFSDRMFAGYVESDILSFRSCREIEQPYIEYLKSQFGKPVL  237

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              +GP++PEP       +K   WL  F+  SVI+CAFGSE  + K+QF +LLLGLELTGLP
Sbjct  238   LSGPVIPEPSTSGLD-EKWVEWLGDFKDGSVIYCAFGSECTMQKDQFQELLLGLELTGLP  296

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL A+KPP  +SSIE+ALPEGF+ER +G+ IVHGGWV Q +IL+H A+G F+ H G+ S 
Sbjct  297   FLAALKPPFGTSSIEEALPEGFEERVQGRGIVHGGWVQQQLILQHPAIGCFITHCGTSST  356

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDEND-KFFKENLCNAIKSVMG  1551
              E+L + C++++  P   D   NAR+M   L+  VEV+  E D +  KE++C A+ +VM 
Sbjct  357   IEALVNKCQLVLL-PQVGDQIFNARMMGNNLKVGVEVEKGEEDGRLTKESVCKAVNTVMD  415

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E     N  + NH K R++LL       Y+D F  +L  L
Sbjct  416   EGDAYGNEVRENHAKIREILLDKKLESTYMDCFDQELQNL  455



>gb|KHN36711.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=458

 Score =   307 bits (787),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 193/464 (42%), Positives = 282/464 (61%), Gaps = 20/464 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M+ S +HIAMFPW A GH  P+L L+N LAKRGHRIS  +P     KL+  NL+P LITF
Sbjct  1     MDASSMHIAMFPWFAMGHLTPYLHLSNKLAKRGHRISFFIPKRTQHKLEQFNLFPHLITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P VEGLP GAETT+D + +L   +  A+D  + +++ +L+++ KP +VF+DF YW
Sbjct  61    YPINVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLIEL-KPQIVFFDFTYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L   +G K+ ++ + SP   A +    + +     +T  D+M+PP G+P  S + L 
Sbjct  120   LPNLTRRLGIKSFQYMIVSPATVAYNASPPRMQ-NSVNLTEVDLMQPPLGYPVSS-IKLH  177

Query  838   EHEAYQVSRFLNLPRN-----RITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELG  1002
              HEA    +FL   RN      +  +DR+   L   DAI F+ C E+EG Y +Y+  + G
Sbjct  178   AHEA----KFLASKRNWEFGSGVLFYDRLYGGLSLSDAIGFKGCREIEGPYVDYLEEQFG  233

Query  1003  KPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglel  1182
             K V  +G  +   P    LE +   WLE+F+P+SVIFCA GSE  L  +QF + LLGLEL
Sbjct  234   KSVLLSG-PIIPEPPNTVLEGRWGSWLERFKPDSVIFCALGSEWKLPHDQFQEFLLGLEL  292

Query  1183  tglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGG  1362
             TGLPFL  +K P    ++E ALPEGF+ER + + IVHGGW+ Q +IL H +VG F+ H G
Sbjct  293   TGLPFLAVLKTPIGFETLEAALPEGFKERVEERGIVHGGWIQQQLILEHPSVGCFITHCG  352

Query  1363  SGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIK  1539
             +GS+ E+L + C+I++ P    D+ +NAR+M E L+  VEV+  E D +F KE++  A+K
Sbjct  353   AGSLTEALVNKCQIVLLPQVDGDHIVNARMMGENLKIGVEVEKGEEDGWFTKESVSKAVK  412

Query  1540  SVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              VM +  +     + NH K R+ L++       +D F  KL +L
Sbjct  413   IVMDDENEVGREVRTNHAKLRNFLVSHNLESACVDGFCQKLRDL  456



>ref|XP_010666234.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=459

 Score =   307 bits (787),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 203/458 (44%), Positives = 281/458 (61%), Gaps = 20/458 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+ W AFGH   FLQLAN LA+RGH+IS  LPT    KL   N +P LITF  + +
Sbjct  9     LHIAMYSWFAFGHLTSFLQLANKLAQRGHKISFFLPTKTQQKLTPHNHHPHLITFIPIAV  68

Query  496   PQVEGLPPGAETTADTMNLDGSL-EVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P VEGLP GAETTAD      SL   A+D  QD ++++L Q+ KP+LVF+DF  W+P + 
Sbjct  69    PAVEGLPSGAETTADVPYEARSLIMAAMDLTQDTIESLLSQL-KPDLVFFDFTEWLPNVA  127

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFP-SDSKVVLREHEA  849
              + G K+V +        A  L  ++++  GR     D+  PPPGFP S S + LR+HEA
Sbjct  128   RKHGVKSVYYATLLAVSGAYFLPRARAQLGGR-----DLTRPPPGFPPSKSMITLRDHEA  182

Query  850   ----YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                 Y V++ +        +  R   AL+ CDA A ++C EMEG YC+++     KP+  
Sbjct  183   RAVGYAVTQ-MEFGGPGKMMLQRHAVALEACDAFAAKSCREMEGDYCDFVYNVYRKPLLL  241

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             AGP++PEPP      DK+  WL  F  +SVI+CA GSE  L K++F +LLLGLELTG+PF
Sbjct  242   AGPVVPEPPAARLD-DKLNAWLSSFAKDSVIYCALGSECFLSKDRFQELLLGLELTGMPF  300

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+K P    ++E ALPEGF+ERTKG+ IVHG WV Q +IL+H +VG FV H G+GS+ 
Sbjct  301   LAALKLPIGYETMEHALPEGFEERTKGRGIVHGDWVQQQLILQHPSVGCFVTHCGAGSLS  360

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN  1557
             E++ S+C++++  P  +D  +NAR ++ +L+  VEV+  E+    K+ +C  IK +M   
Sbjct  361   EAMVSNCQLVLF-PQVTDQFINARFLSLDLKVGVEVEIGEDGILTKDGICKTIKVIMDPK  419

Query  1558  IQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              +     ++N  KWRD LL  G   +YI  FI  L  L
Sbjct  420   SEVGREARINRVKWRDFLLAKGLEASYISGFIQNLRGL  457



>dbj|BAE98680.1| UDP rhamnose-anthocyanidin-3-glucoside rhamnosyltransferase - 
like protein [Arabidopsis thaliana]
Length=435

 Score =   306 bits (785),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 198/442 (45%), Positives = 284/442 (64%), Gaps = 26/442 (6%)
 Frame = +1

Query  361   PFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVEGLPPGAETTAD  540
             PFL LAN LA++GH ++ L+P  AL +L+++NL+P  I F ++T+P V+GLP G ET ++
Sbjct  1     PFLFLANKLAEKGHTVTFLIPKKALKQLENLNLFPHNIVFRSVTVPHVDGLPVGTETVSE  60

Query  541   TMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVSEMGCKTVKFTVFSP  717
                    L + A+D  +D+V+ ++  +E P+L+F+DFA+WIPE+  + G KTVK+ V S 
Sbjct  61    IPVTSADLLMSAMDLTRDQVEGVVRAVE-PDLIFFDFAHWIPEVARDFGLKTVKYVVVSA  119

Query  718   TISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQVSRFLNLPRNRITV  897
             +  A  L           V   ++  PPPG+PS SKV+LR+ +AY +    +   N I V
Sbjct  120   STIASML-----------VPGGELGVPPPGYPS-SKVLLRKQDAYTMKNLES--TNTINV  165

Query  898   ----FDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpllpeppreepleD  1065
                  +RV  +L   D IA R   E+EG++C+YI     K V   GP+ PEP +   LE+
Sbjct  166   GPNLLERVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPVFPEPDKTRELEE  225

Query  1066  KIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVKPPERSSSIEDA  1245
             +  +WL  +EP+SV+FCA GS+V+L K+QF +L LG+ELTG PFLVAVKPP  SS+I++A
Sbjct  226   RWVKWLSGYEPDSVVFCALGSQVILEKDQFQELCLGMELTGSPFLVAVKPPRGSSTIQEA  285

Query  1246  LPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLASHCRIIVAPPNR  1425
             LPEGF+ER KG+ +V G WV Q ++L H +VG FV+H G GSMWESL S C+I++  P  
Sbjct  286   LPEGFEERVKGRGVVWGEWVQQPLLLSHPSVGCFVSHCGFGSMWESLLSDCQIVLV-PQL  344

Query  1426  SDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----NIQKVNHKKWRD  1590
              D  LN RL+++EL+ +VEV  +E   F KE+L +AI SVM       N+ K NH KWR+
Sbjct  345   GDQVLNTRLLSDELKVSVEVAREETGWFSKESLFDAINSVMKRDSEIGNLVKKNHTKWRE  404

Query  1591  LLLTPGFADNYIDSFIHKLYEL  1656
              L +PG    Y+D+FI  L +L
Sbjct  405   TLTSPGLVTGYVDNFIESLQDL  426



>ref|XP_007132927.1| hypothetical protein PHAVU_011G136700g [Phaseolus vulgaris]
 gb|ESW04921.1| hypothetical protein PHAVU_011G136700g [Phaseolus vulgaris]
Length=452

 Score =   306 bits (784),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 196/462 (42%), Positives = 289/462 (63%), Gaps = 21/462 (5%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M  + LHIAM+PW A GH  PFL LAN LAKRGH+IS  +P     KL+++NL P LITF
Sbjct  1     MNAASLHIAMYPWFAMGHLTPFLHLANKLAKRGHKISFFIPKRTQAKLENLNLRPSLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFA-Y  654
               +++P V+GLP GAETT+D   +L   +  A+D  + +++ +LL++ KP++V +DFA Y
Sbjct  61    VPISVPHVDGLPCGAETTSDVPSSLFPLIASAMDLTEKDIELLLLEL-KPHIVLFDFATY  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W+P L   +G K++++ + SP  + +  + S ++ +       D+ +PP GFP D  V L
Sbjct  120   WLPNLARRIGIKSLQYWIISP--ATIGYMASPARKR-----EDDMRKPPSGFP-DCSVKL  171

Query  835   REHEA--YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
              EHE   +  SR L    N I ++DR+       D I F+ C E+EG Y +Y+ T+ GKP
Sbjct  172   HEHEVRFFAASRKLEF-GNGILLYDRISIGADLSDHIGFKGCREIEGPYVDYLETQFGKP  230

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V  +GPL+PE         K   WL +F+  SVI+CA GSE  L + Q  +L+LGLELTG
Sbjct  231   VLLSGPLVPESSNSTLEA-KWGEWLGRFKAGSVIYCALGSENSLQQNQLKELVLGLELTG  289

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             +PFL A+KPP    S+EDALP+GF+ER + + +V+GGWV Q +IL H +VG F+ H G+ 
Sbjct  290   MPFLAALKPPNEFESLEDALPKGFKERVQERGVVYGGWVQQQLILAHPSVGCFITHCGAA  349

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSV  1545
             S+ E+L + C++++ P   SD+ +NAR M E+L  AVEV+  E D  F KE++  A+K V
Sbjct  350   SLTEALVNQCQLVLLPRLGSDFIINARTMGEKLRVAVEVEKGEEDGLFTKESVGKAVKIV  409

Query  1546  MGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M +  +     + NH K R+LLL+  F    +D+F HKL ++
Sbjct  410   MDDENELGREVRANHNKVRNLLLSDSFESTCVDAFCHKLRDI  451



>ref|XP_003607533.1| Glucosyltransferase [Medicago truncatula]
Length=552

 Score =   309 bits (791),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 195/464 (42%), Positives = 278/464 (60%), Gaps = 12/464 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAM+PW A GH  PFL LAN LAK+GH+I+   P +A  KL+  NLYPQLIT
Sbjct  1     MDSSSPLHIAMYPWFAMGHQTPFLHLANKLAKKGHKITFFTPKSAQSKLEPFNLYPQLIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  + +P VEGLP  AETTAD    L   +  A+D  Q +++  L  + KP +VFYDF +
Sbjct  61    FITIKVPHVEGLPLNAETTADVPYPLHPHIMTAMDLTQPDIETHLTNL-KPQIVFYDFTH  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             WIP L   +  K   + + S  +   +L  S+   KG+ +T  D+M+PP G+P  S + L
Sbjct  120   WIPSLTKRLDIKAFHYCIISSIMIGYTLAPSRY-SKGKDLTEFDLMQPPSGYPGSS-IKL  177

Query  835   REHEAYQVSRFL-NLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
               HEA   +    N   + +  +DR   AL   DA+ ++ C E+EG Y +YI  +  KPV
Sbjct  178   HSHEAKAFAAMRKNTYGSNVLFYDRQAIALNEADALGYKTCREIEGPYLDYIQKQFNKPV  237

Query  1012  YCAGpllpeppreepleDK-IARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
               +GP+LP       + D+  A WL +F+ +SV++C FGSE VL    F +L+LGLELTG
Sbjct  238   LTSGPVLPILENSNYVLDENWATWLGRFKTDSVVYCCFGSECVLKPNTFQELMLGLELTG  297

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             +PF  A+KPP    +IE+ALPEGF ER +G+ +V+GGWV Q +IL H +VG F+ H GSG
Sbjct  298   MPFFAALKPPFGFETIEEALPEGFSERVEGRGVVYGGWVQQQLILEHPSVGCFITHCGSG  357

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM  1548
             S+ E+L + C++++  PN  D  LNAR+M   L+  VEV+  E+  + K+N+C A+  VM
Sbjct  358   SLSEALVNKCQLVLL-PNVGDQILNARMMGNNLKVGVEVEKGEDGFYTKDNVCKAVSIVM  416

Query  1549  GENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYELSVQ  1665
              +  +     + NH K R++LL      +YID+F +    L  Q
Sbjct  417   NDEDEISKTVRSNHTKIREMLLNKDLESSYIDNFCYNYLILVEQ  460



>ref|XP_010437932.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=444

 Score =   305 bits (782),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 200/453 (44%), Positives = 288/453 (64%), Gaps = 26/453 (6%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AF H IPFL LAN LA++GHR++ LLP  A  +L+H NL+P  I F  LT+
Sbjct  5     FHAFMFPWFAFVHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFYPLTV  64

Query  496   PQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT+D  ++ D  L  ALD  +D+V+A    + +P+L+F+DFA+WIPEL 
Sbjct  65    PHVNGLPAGAETTSDIAISKDNFLYEALDLTRDQVEAAFRAL-RPDLIFFDFAHWIPELA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + +     SA ++  S + G    V       PPPG+PS SKV  R ++A+
Sbjct  124   KEHMIKSVSYMI----ASATAVAHSHAPGGLLGV-------PPPGYPS-SKVFFRGNDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +S F     +++T         K CD IA R C E+EG +C+YI+++  K V   GP+L
Sbjct  172   TISTFFERVCHQLTT------GFKNCDVIALRTCKEIEGKFCDYISSQYQKKVLLTGPML  225

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PE    +PL++  +++L  F P SV+FCA G++ VL K+QF +L LGLELTGLPFL+AV 
Sbjct  226   PELDTSKPLDEHWSQFLSGFPPGSVVFCALGNQTVLEKDQFQELCLGLELTGLPFLLAVN  285

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS++++ LPEGF+ER KG+A V GG V Q +IL H +VG FVNH G G++WE L +
Sbjct  286   PPRGSSTVQEGLPEGFEERVKGRAEVWGGRVQQPLILSHPSVGCFVNHCGPGTIWECLMT  345

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C++++  P   D  L  RL+ EE E +VEV  ++   F+KE+L +AIKSVM +      
Sbjct  346   DCQMVLI-PYIGDQVLFTRLLTEEFEVSVEVPREKTGWFWKESLRDAIKSVMDKESDVGK  404

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + + NH K +++L++PG    Y+++F+  L +L
Sbjct  405   LVRSNHAKLKEILVSPGLFAGYVNNFVEALADL  437



>gb|AES66918.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=476

 Score =   306 bits (784),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 199/473 (42%), Positives = 287/473 (61%), Gaps = 12/473 (3%)
 Frame = +1

Query  262   FKKASSSASRKHMMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallk  441
             F+K    ++   M   S LHIAMFPW A GH  P+L L+N LAKRGH+IS  +P     K
Sbjct  6     FEKVIEHSTLSAMESPSSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTK  65

Query  442   lKHMNLYPQLITFCALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQM  618
             L+  NLYP LITF  L +P + GLP GAETT+D + +L   +  A+D  Q +V+ +L Q+
Sbjct  66    LEQFNLYPNLITFYPLNVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLTQL  125

Query  619   EKPNLVFYDFAYWIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEP  798
               P +VF+DF +W+P++   +G K+++  + SP   + +   S+   +G  +T  D+M+P
Sbjct  126   -NPEIVFFDFTFWLPKIAHNLGIKSLQCWIVSPATVSYNASPSR-MCEGTNLTEFDLMKP  183

Query  799   PPGFPSDSKVVLREHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHY  975
             P G+P  S   L  HEA  ++    L   + I  +DR+   L   DAI F+   E+EG Y
Sbjct  184   PKGYPISS-FNLYYHEAKHLALKRKLEFGSGIFFYDRIYYGLSLSDAIGFKGIREIEGPY  242

Query  976   CNYIATELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQF  1155
              +Y+  E GKPV  +GP+LPEPP+     +K   WL  F+  S+++CA GSE  L ++QF
Sbjct  243   VDYLEQEFGKPVLLSGPVLPEPPKTVLD-EKWGSWLNGFKDGSLVYCALGSESKLSQKQF  301

Query  1156  HQlllgleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKA  1335
             H+LLLGLELTG PFL  +KPP    ++EDA PEGF+ER K K IVH GW+ Q +IL H +
Sbjct  302   HELLLGLELTGYPFLAILKPPIGFETVEDAFPEGFEERVKEKGIVHSGWIQQQLILEHSS  361

Query  1336  VGYFVNHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEV-QTDENDKFF  1512
             VG FV H G+GS+ E L ++C+I++ P    D+  N ++M  EL+  VEV + DE+  F 
Sbjct  362   VGCFVTHCGAGSLTEGLINNCQIVLMPHLDGDHITNTKIMGRELKVGVEVNKGDEDGLFT  421

Query  1513  KENLCNAIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             KE++C A+K VM +  +     + NH K R+LLL      + +D F  KL +L
Sbjct  422   KESVCEAVKIVMDDENEIGREVRNNHDKLRNLLLNQDLESSCVDGFCEKLQKL  474



>ref|XP_004487589.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cicer arietinum]
 gb|AGU14103.1| UDP-glycosyltransferase [Cicer arietinum]
Length=457

 Score =   305 bits (782),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 200/464 (43%), Positives = 288/464 (62%), Gaps = 20/464 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             ME   LH+AMFPWLA GHF P+L L+N LAKRGH+IS  +P N L KL+H+NL P LITF
Sbjct  1     MEAPPLHLAMFPWLAMGHFTPYLHLSNKLAKRGHKISFFIPKNTLNKLQHLNLNPHLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+P V+GLP  AET +D   +L   +  A+D  + E++ +LL+  KP +VF+DF YW
Sbjct  61    VPITVPHVDGLPHDAETASDVPFSLLPLIATAMDETKKEIE-LLLKELKPQIVFFDFQYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P L  ++G K+V++ + SP  S         +  G+ +T  D+ +PP G+P DS + L 
Sbjct  120   VPNLTKKLGIKSVQYWIASP-YSISYFFHGPRQSLGKELTVDDLKKPPSGYP-DSSIKLH  177

Query  838   EHEAYQVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELG  1002
              HE     +FL   R     + + ++DR+       DAI F+ C E++G Y  Y+ T  G
Sbjct  178   SHEL----QFLASSRKLVFGSGVLLYDRLHFGTSLADAIGFKGCKEIDGPYAQYLGTVYG  233

Query  1003  KPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglel  1182
             KP   +GPLLPE P      +K   WL+ F+  SV++CA+GSE  L + QF +LLLGLEL
Sbjct  234   KPSLLSGPLLPESPLTTLD-EKWVSWLKGFKHGSVVYCAYGSEGPLQENQFKELLLGLEL  292

Query  1183  tglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGG  1362
             TG PF+ A+KPP    SIE+ALP+GF ER KG+ IV+GGWV Q +IL H +VG F+ H G
Sbjct  293   TGFPFVAALKPPVGFESIEEALPQGFNERVKGRGIVYGGWVQQQLILEHPSVGCFITHCG  352

Query  1363  SGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIK  1539
             + S+ E+L + C++++ P    D+ +NAR+M+ +L+  VEV+  DE+  F KE++CNA+ 
Sbjct  353   AASITEALVNTCQLVLLPRVGVDHIMNARMMSTKLKVGVEVEKGDEDGLFTKESVCNAVN  412

Query  1540  SVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              VM E  +     K NH + R  LL+     + +D+F  KL  L
Sbjct  413   IVMDEGNEIGREVKANHIQLRKFLLSENLESSCVDNFCQKLRHL  456



>ref|XP_004505528.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cicer arietinum]
 gb|AGU14090.1| UDP-glycosyltransferase [Cicer arietinum]
Length=465

 Score =   306 bits (783),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 194/455 (43%), Positives = 278/455 (61%), Gaps = 14/455 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAMFPW A GH   FL L+N LAK+GH+I+   P  A  KLK  NL+P+ ITF  +T+
Sbjct  7     LHIAMFPWFAMGHQTAFLHLSNKLAKKGHKITFFTPQKAESKLKPFNLHPESITFITITV  66

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+ LPP ++TTAD    L   +  A+D  + ++++ LL + KP++VFYDF +WIP + 
Sbjct  67    PHVDPLPPNSQTTADVPYPLQPHIMTAMDLTRPDIESHLLNL-KPHIVFYDFTHWIPSVT  125

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA-  849
               +G K + +   S  +   +L  ++   KG+ +T  D+MEPPPG+P DS + L +HEA 
Sbjct  126   KALGIKCLHYCTASSVMVGYTLSPARY-SKGKDLTEFDLMEPPPGYP-DSSIKLFQHEAK  183

Query  850   -YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
              +   R      N +  +DR   AL   DA+ +R C E+EG Y +YI     KPV  +GP
Sbjct  184   SFAAKRTEYFGSN-VLFYDRQSIALNEADALGYRTCREIEGPYLDYIQKVFNKPVLASGP  242

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
             ++ E P      +K      +FE NSV++C FGSE  L  +QF +L+LGLELTG PF  A
Sbjct  243   VILEKPNSCLE-EKGTYGFNRFEKNSVVYCCFGSECTLKPDQFTELVLGLELTGKPFFAA  301

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP   +++E+ALPEGF++R  GK  V GGWV Q +IL H ++G F+ H GSGS+ E+L
Sbjct  302   LKPPFGFATVEEALPEGFKKRVAGKGAVFGGWVQQQLILEHSSIGCFITHCGSGSLSEAL  361

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQ-  1563
              + C++++  PN  D  LNAR+M   L+  VEV  DEN  F KE++C A+K VM +  + 
Sbjct  362   VNKCQLVLL-PNVGDQILNARMMGNNLKVGVEVVKDENGFFTKESVCEAVKIVMDDENEI  420

Query  1564  ----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                 + NH K R++LL      +YID+F  KL E+
Sbjct  421   SKEVRGNHAKIREMLLNKDLESSYIDTFCKKLQEI  455



>gb|EYU19000.1| hypothetical protein MIMGU_mgv1a021196mg [Erythranthe guttata]
Length=464

 Score =   305 bits (782),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 295/457 (65%), Gaps = 13/457 (3%)
 Frame = +1

Query  313   MLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALT  492
             +LHIAMFPW+  GH   FL L N+L++RGHRIS LLP  AL+KL H + +   I F  L 
Sbjct  12    LLHIAMFPWIGMGHVTTFLHLGNELSQRGHRISFLLPMKALVKLDHNHDHSHPIKFHILN  71

Query  493   IPQVEGLPPGAETTAD---TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             +P V+GLPPGAET +D    +     L VA D + ++V+A+L  +  P++VFYDFA+WIP
Sbjct  72    VPHVDGLPPGAETCSDIDDNLTEKNPLAVAFDAMSEQVEALLRSL-NPDIVFYDFAHWIP  130

Query  664   ELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREH  843
              L + +G KTV +   S +  + +++ ++   K R +TA ++ EPP G+PS S VVLR  
Sbjct  131   RLAAVIGFKTVCYNTVSASCMSYTVVPARRIPKDRMMTAEELAEPPEGYPS-STVVLRGQ  189

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             E   +S F+      +    R+  AL  CDAI  R C+EMEG  C Y++ + GKPV   G
Sbjct  190   EGLMMS-FICEDYGDVKFDVRMSTALWGCDAIGVRTCSEMEGPMCEYVSRQYGKPVILTG  248

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+LP    E PLE+K   WL KF+  SV++CAFGS+ +L K+QF ++LLG E+TGLPF+V
Sbjct  249   PVLPRVQEEVPLEEKWDTWLSKFDEKSVVYCAFGSQTILQKKQFQEMLLGFEMTGLPFIV  308

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             A+  P  + +IE+ALPEGF ER  G+ +VHGGWV Q+ IL H +VG FV+H G GSM ES
Sbjct  309   AMSKPHGADTIEEALPEGFTERVGGRGVVHGGWVQQTQILNHPSVGCFVSHCGFGSMCES  368

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSV---MGE  1554
             L S  + IVA P   D  LNARLMA EL+ AVEV+  E   F KE+L NA+KS    +G 
Sbjct  369   LMSDAQ-IVAVPQFGDQVLNARLMAAELKVAVEVERGEMGWFSKEDLSNAVKSSVMDVGS  427

Query  1555  NIQKV---NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             ++ ++   NH KW++  + P F D+YID FI +LY L
Sbjct  428   DVGEIVRENHAKWKETFVAPKFMDDYIDRFIKQLYHL  464



>ref|XP_006401636.1| hypothetical protein EUTSA_v10013536mg [Eutrema salsugineum]
 gb|ESQ43089.1| hypothetical protein EUTSA_v10013536mg [Eutrema salsugineum]
Length=447

 Score =   305 bits (780),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 201/453 (44%), Positives = 287/453 (63%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  PFL LAN LA++GHR++ LLP  A  +L+H+NL+P  I F  LTI
Sbjct  5     FHAFMFPWFAFGHMTPFLHLANKLAEKGHRVTFLLPKKAQKQLEHLNLFPDSIVFHPLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
               V+GLP GAET +D  ++L   L +A+D  +D+V+A +  + +P+L+ +D A+W+P++ 
Sbjct  65    FPVDGLPAGAETASDIPVSLVRFLSIAMDLSRDQVEAAVRAL-RPDLILFDIAHWVPDMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E G KT+ + V S   +A  L           V   ++  PPPG+PS SKV+ RE +A+
Sbjct  124   KEHGVKTMMYNVISANCTAHDL-----------VPGGELGVPPPGYPS-SKVLYREQDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +S F    +     ++RV   L  CD I+ R C E+EG +C+YI  +  K V   GP+L
Sbjct  172   ALSSFSTYYKR---FYNRVTTGLMNCDFISIRTCQEIEGKFCDYIERQYQKKVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP + +PLED+ + WL  F   SV+FCA GS++ L K+QF +L LG+ELTGLPFLVAV 
Sbjct  229   PEPEKSKPLEDQWSHWLSGFGQGSVVFCALGSQITLEKDQFQELCLGMELTGLPFLVAVT  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I++ALPEGF++R K + +V G WV Q +IL H +VG FV+H G GSMWESL S
Sbjct  289   PPKGAKTIQEALPEGFEDRVKSRGVVWGEWVQQPLILAHSSVGCFVSHCGFGSMWESLMS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQKVN  1572
              C+I++  P  +D  LN RLM EELE +VEV+ +E   F KENL  AI SVM ++ +  N
Sbjct  349   DCQIVLL-PYLNDQVLNTRLMTEELEVSVEVKREETGWFSKENLSCAIMSVMEKDSEVGN  407

Query  1573  -----HKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  H   ++++++ G    Y D F+  L +L
Sbjct  408   RVRRSHANLKEVVVSAGLLTGYTDKFVDTLEKL  440



>ref|XP_003596667.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
Length=463

 Score =   305 bits (781),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 198/463 (43%), Positives = 283/463 (61%), Gaps = 12/463 (3%)
 Frame = +1

Query  292   KHMMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQL  471
             K M   S LHIAMFPW A GH  P+L L+N LAKRGH+IS  +P     KL+  NLYP L
Sbjct  3     KAMESPSSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFIPKKTQTKLEQFNLYPNL  62

Query  472   ITFCALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDF  648
             ITF  L +P + GLP GAETT+D + +L   +  A+D  Q +V+ +L Q+  P +VF+DF
Sbjct  63    ITFYPLNVPHIHGLPFGAETTSDVSFSLGPLIMTAMDQTQPQVELLLTQL-NPEIVFFDF  121

Query  649   AYWIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKV  828
              +W+P++   +G K+++  + SP   + +   S+   +G  +T  D+M+PP G+P  S  
Sbjct  122   TFWLPKIAHNLGIKSLQCWIVSPATVSYNASPSR-MCEGTNLTEFDLMKPPKGYPISS-F  179

Query  829   VLREHEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGK  1005
              L  HEA  ++    L   + I  +DR+   L   DAI F+   E+EG Y +Y+  E GK
Sbjct  180   NLYYHEAKHLALKRKLEFGSGIFFYDRIYYGLSLSDAIGFKGIREIEGPYVDYLEQEFGK  239

Query  1006  PVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglelt  1185
             PV  +GP+LPEPP+     +K   WL  F+  S+++CA GSE  L ++QFH+LLLGLELT
Sbjct  240   PVLLSGPVLPEPPKTVLD-EKWGSWLNGFKDGSLVYCALGSESKLSQKQFHELLLGLELT  298

Query  1186  glpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGS  1365
             G PFL  +KPP    ++EDA PEGF+ER K K IVH GW+ Q +IL H +VG FV H G+
Sbjct  299   GYPFLAILKPPIGFETVEDAFPEGFEERVKEKGIVHSGWIQQQLILEHSSVGCFVTHCGA  358

Query  1366  GSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEV-QTDENDKFFKENLCNAIKS  1542
             GS+ E L ++C+I++ P    D+  N ++M  EL+  VEV + DE+  F KE++C A+K 
Sbjct  359   GSLTEGLINNCQIVLMPHLDGDHITNTKIMGRELKVGVEVNKGDEDGLFTKESVCEAVKI  418

Query  1543  VMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             VM +  +     + NH K R+LLL      + +D F  KL +L
Sbjct  419   VMDDENEIGREVRNNHDKLRNLLLNQDLESSCVDGFCEKLQKL  461



>ref|XP_010455375.1| PREDICTED: UDP-glycosyltransferase 79B8-like [Camelina sativa]
Length=444

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 197/453 (43%), Positives = 286/453 (63%), Gaps = 26/453 (6%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AF H IPFL LAN LA++GHR++ LLP  A  +L+H NL+P  I F  L I
Sbjct  5     FHAFMFPWFAFVHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDRIVFHPLAI  64

Query  496   PQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT+D ++++D  L  ALD  +D+V+A +  + +P+L+F+DFA+WIPE+ 
Sbjct  65    PHVNGLPAGAETTSDISISMDNFLSEALDLTRDQVEAAVRAL-RPDLIFFDFAHWIPEVA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + +     SA ++  S + G    V        PPG+PS SKV  R ++A+
Sbjct  124   KEHMIKSVSYMI----ASATAVAHSHAHGSALGVI-------PPGYPS-SKVFFRGNDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +S F     + +T+        K CD IA R C E+EG +C+YI+++  K V   GP+L
Sbjct  172   TMSTFFERVCHLLTI------GFKSCDVIALRTCKEIEGKFCDYISSQYQKKVILTGPML  225

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PE    +PL++  +++   F P SV+FCAFG++ VL K+QF +L LGLELTGLPFL+ V 
Sbjct  226   PELDTSKPLDEHWSQFPSGFPPGSVVFCAFGNQTVLEKDQFQELCLGLELTGLPFLLVVN  285

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS++++ LPE F+ER KG+  V GGWV Q +IL H +VG FVNH G G++WE L +
Sbjct  286   PPRGSSTVQEGLPEEFEERVKGRGEVWGGWVQQPLILSHPSVGCFVNHCGPGTIWECLMT  345

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C++++  P   D  L  RL+ EE E +VEV  ++   F KE+L +AIKSVM +      
Sbjct  346   DCQMVLI-PYIGDQVLFTRLLTEEFEVSVEVSREKTGWFSKESLRDAIKSVMDKESDVGK  404

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + + NH K +++L++PG    Y+D+F+  L +L
Sbjct  405   LVRSNHAKLKEILVSPGLFAGYVDNFVEALADL  437



>ref|XP_006393134.1| hypothetical protein EUTSA_v10011473mg [Eutrema salsugineum]
 gb|ESQ30420.1| hypothetical protein EUTSA_v10011473mg [Eutrema salsugineum]
Length=449

 Score =   303 bits (777),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 198/454 (44%), Positives = 283/454 (62%), Gaps = 25/454 (6%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M P   FGH IP+L LAN LA++GHR+++LLP  A  +L+ +NL+P  I +  +
Sbjct  3     SKFHAFMCPSFGFGHMIPYLHLANKLAEKGHRVTVLLPKKAQKQLEPLNLFPNSIVYDPV  62

Query  490   TIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P V+GLP GAETT+D  N   + L  A+D L+DE++  + +  KP+L+F+DFA WIPE
Sbjct  63    TLPHVDGLPVGAETTSDLSNSPKNVLYYAMDLLRDEIEEKV-RTSKPDLIFFDFADWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  + G K+V + + S    A+ L              A++  PPPG+PS SKVVLR H+
Sbjct  122   IAKQFGAKSVSYQIVSAAFVAMFL-----------APGAELGFPPPGYPS-SKVVLRGHD  169

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             A   S F+N    R  +FDRV   LK CD I+ R C E+EG  C++I  +  K V   GP
Sbjct  170   ANLYSLFVN---TRQWLFDRVTTGLKNCDIISIRTCAEIEGKLCSFIEAQCQKKVLLTGP  226

Query  1027  l--lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             +   P+    + LED+   WL  FEP SV++C+ G+   + K QF +L LG+ELTGLPFL
Sbjct  227   MFPKPQEKSVKTLEDRWNHWLNGFEPGSVVYCSLGTHCFIEKHQFQELCLGMELTGLPFL  286

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             +   PP  +S+ ++ALP+GF+ER KG+ IV GGWV Q +IL H +VG FVN  G GSMWE
Sbjct  287   IRAMPPIGASTTQEALPDGFEERVKGRGIVWGGWVEQPLILSHPSVGCFVNQCGFGSMWE  346

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             SL + C+I+   P  +D AL  RLM EEL+ +V+VQ +++  F KE+L +A+KSV+ +  
Sbjct  347   SLVNDCQIVFI-PLLADQALTTRLMTEELQVSVKVQREDSGWFSKESLRDAVKSVIDKDN  405

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                N+ + NHK  ++ L+ PG  + Y D F+  L
Sbjct  406   EIGNLVRRNHKMLKETLVDPGLLNGYADKFVEAL  439



>ref|NP_176671.1| UDP-glycosyltransferase 79B10 [Arabidopsis thaliana]
 sp|Q9XIQ5.1|U7B10_ARATH RecName: Full=UDP-glycosyltransferase 79B10 [Arabidopsis thaliana]
 gb|AAD38265.1|AC006193_21 Similar to Flavonol 3-O-Glucosyltransferase [Arabidopsis thaliana]
 gb|AEE34304.1| UDP-glycosyltransferase 79B10 [Arabidopsis thaliana]
 gb|AHL38893.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=447

 Score =   303 bits (776),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 200/453 (44%), Positives = 286/453 (63%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  P+L LAN LA+RGHRI+ L+P  A  +L+H+NL+P  I F +LTI
Sbjct  5     FHAFMFPWFAFGHMTPYLHLANKLAERGHRITFLIPKKAQKQLEHLNLFPDSIVFHSLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  M L   L  A+D  +D+V+A +  +  P+L+ +D A W+PE+ 
Sbjct  65    PHVDGLPAGAETFSDIPMPLWKFLPPAIDLTRDQVEAAVSAL-SPDLILFDIASWVPEVA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K++ + + S T  A              V   ++  PPPG+PS SK++ R+H+A+
Sbjct  124   KEYRVKSMLYNIISATSIAHDF-----------VPGGELGVPPPGYPS-SKLLYRKHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F ++   R +   R++  L  CD I+ R C E+EG +C Y+  +  K V+  GP+L
Sbjct  172   ALLSF-SVYYKRFS--HRLITGLMNCDFISIRTCKEIEGKFCEYLERQYHKKVFLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP + +PLED+ + WL  FE  SV+FCA GS+V L K+QF +L LG+ELTGLPF VAV 
Sbjct  229   PEPNKGKPLEDRWSHWLNGFEQGSVVFCALGSQVTLEKDQFQELCLGIELTGLPFFVAVT  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I+DALPEGF+ER K + +V G WV Q ++L H +VG F++H G GSMWES+ S
Sbjct  289   PPKGAKTIQDALPEGFEERVKDRGVVLGEWVQQPLLLAHPSVGCFLSHCGFGSMWESIMS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P  +D  LN RLM EEL+ +VEVQ +E   F KE+L  AI SVM +     N
Sbjct  349   DCQIVLL-PFLADQVLNTRLMTEELKVSVEVQREETGWFSKESLSVAITSVMDQASEIGN  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + + NH K +++L++ G    Y D F+  L  L
Sbjct  408   LVRRNHSKLKEVLVSDGLLTGYTDKFVDTLENL  440



>gb|AES66921.2| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=434

 Score =   302 bits (774),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 185/465 (40%), Positives = 275/465 (59%), Gaps = 44/465 (9%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAMFPW A GH  P+L  +N LA RGH+IS  +P N L KL+H+NL+P LIT
Sbjct  1     MDAPSPLHIAMFPWFAMGHLTPYLHFSNKLAIRGHKISFFIPKNTLNKLQHLNLHPNLIT  60

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  +T+P V GLP  AETT+D   +L   +  A+D    +++ +LL+  KP +VF+DF Y
Sbjct  61    FFPITVPHVNGLPHNAETTSDVPFSLFPLIATAMDQTDKQIE-LLLKELKPQIVFFDFQY  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVL  834
             W+P L  ++G K++++ +++P IS+  L     K +G+ +T  D+ +PP GFP DS +  
Sbjct  120   WLPNLTQKLGIKSLQYLIWNP-ISSAYLGNIPRKSQGKYLTKDDLKKPPAGFP-DSSIKF  177

Query  835   REHEAYQVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATEL  999
               HE     RFL   R     + + ++DRV    K  DA++F+ C E++G Y +Y+ T  
Sbjct  178   HSHEL----RFLASTRKIEFGSGVLLYDRVDTGTKSSDAVSFKGCREIDGLYADYLETVF  233

Query  1000  GKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgle  1179
             GKPV  +G  L   P +  LE+K   WL++F+  SVIFCA+GSE                
Sbjct  234   GKPVLLSG-PLLPEPPKATLEEKWLTWLKEFKHGSVIFCAYGSE----------------  276

Query  1180  ltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHG  1359
                     A+KPP    SIE+ALPEGF ER KGK IV+G W+ Q +IL H +VG F+ H 
Sbjct  277   --------ALKPPIGFESIEEALPEGFNERIKGKGIVYGSWIQQQLILEHPSVGCFITHC  328

Query  1360  GSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAI  1536
             G+ S+ E L + C++++ P   +D+ +NAR+M+  L+  +EV+  E D  F KE++ NA+
Sbjct  329   GAASITEGLVNTCQLVLLPRAGADHIMNARMMSSTLKVGIEVERGEEDGLFTKESVGNAV  388

Query  1537  KSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + VM +  +     + NH K R+ LL+     + ++SF  KLY+L
Sbjct  389   RIVMDDENEVGKEVRANHAKMRNFLLSSNLESSCVNSFCQKLYDL  433



>ref|XP_006361070.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Solanum tuberosum]
Length=460

 Score =   303 bits (776),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 193/464 (42%), Positives = 281/464 (61%), Gaps = 23/464 (5%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             MED  L   M+PW A GH   FL L+N LA RGH+I  + PTN L KL+  N YP+LI F
Sbjct  1     MEDKKLTFIMYPWYAMGHLTSFLHLSNKLAHRGHKIFFVHPTNTLSKLEKFNRYPELINF  60

Query  481   CALTIPQVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
              ++T+P V+GLP GAETT+D    + +L   ALD    ++++ L+Q  KP+ +FYDFAYW
Sbjct  61    KSVTVPHVDGLPLGAETTSDVPIFNQNLLCQALDLTLPKIES-LIQEIKPHFIFYDFAYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P +  +   K+V +   +P     S +    +G+  + + A++MEPPPGFP DS + L 
Sbjct  120   VPSIARKYKVKSVHYCSITP-----SSVGYLMRGENPS-SEAEMMEPPPGFPVDSSIKLH  173

Query  838   EHEAYQVSRFLNLPRNRITVF-------DRVVEALKRCDAIAFRACNEMEGHYCNYIATE  996
             +HEA  +    ++ +N             R++ A +  DAIAF+   E+EG Y  ++  +
Sbjct  174   KHEARLIVALHSMGKNSSNSGSGSVSFTQRLLLAFQDGDAIAFKTTREIEGPYYEFVEHK  233

Query  997   LGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlll-g  1173
               KPV  AGP+LPEP      E+  ++WLEKF+  +VI CAFGSE  L K+QF +L    
Sbjct  234   FKKPVVLAGPVLPEPIESSNTEENWSKWLEKFQEKTVILCAFGSECNLKKDQFQELGFWD  293

Query  1174  leltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVN  1353
             L L  + F  A+KPP  + +IE+ALPEGF+ERT+GK IVH GW  Q ++L H +VG FV 
Sbjct  294   LNLLVIRFFAALKPPIEAETIEEALPEGFKERTQGKGIVHSGWAEQQLMLSHPSVGCFVT  353

Query  1354  HGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQ-TDENDKFFKENLCN  1530
             H G  S+ E + + C++++  PN  D  +N+RL   +L+A VEV+  +EN  F K+ +C 
Sbjct  354   HCGGNSLSEVMINECQLVLV-PNFGDQFINSRLFGGDLKAGVEVERNEENGSFTKDGVCK  412

Query  1531  AIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
             AIK VM +  +     + N  KWR+ LL+ G  D+YID+ +HKL
Sbjct  413   AIKMVMNDESEEGCKIRANRAKWREFLLSKGLEDSYIDALVHKL  456



>ref|NP_175473.1| UDP-glycosyltransferase 79B5 [Arabidopsis thaliana]
 sp|Q9LPS8.1|U79B5_ARATH RecName: Full=UDP-glycosyltransferase 79B5 [Arabidopsis thaliana]
 gb|AAF87877.1|AC012561_10 Putative glucosyl transferase [Arabidopsis thaliana]
 gb|AAG51184.1|AC079279_5 UDP rhamnose: anthocyanidin-3-glucoside rhamnosyltransferase, 
putative [Arabidopsis thaliana]
 gb|AEE32566.1| UDP-glycosyltransferase 79B5 [Arabidopsis thaliana]
 gb|AHL38908.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=448

 Score =   303 bits (775),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 194/454 (43%), Positives = 276/454 (61%), Gaps = 26/454 (6%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+PW  FGH IP+L LAN LA++GHR++  LP  A  +L+ +NL+P  I F  L
Sbjct  3     SKFHAFMYPWFGFGHMIPYLHLANKLAEKGHRVTFFLPKKAHKQLQPLNLFPDSIVFEPL  62

Query  490   TIPQVEGLPPGAETTADTMN-LDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P V+GLP GAET +D  N     + VA+D L+D+++A +  + KP+L+F+DF +W+PE
Sbjct  63    TLPPVDGLPFGAETASDLPNSTKKPIFVAMDLLRDQIEAKVRAL-KPDLIFFDFVHWVPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G K+V + + S    A+ L              A++  PPP +P  SKV LR HE
Sbjct  122   MAEEFGIKSVNYQIISAACVAMVL-----------APRAELGFPPPDYPL-SKVALRGHE  169

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             A   S F     N   +F  + + LK CD ++ R C E+EG  C +I  E  K +   GP
Sbjct  170   ANVCSLF----ANSHELFGLITKGLKNCDVVSIRTCVELEGKLCGFIEKECQKKLLLTGP  225

Query  1027  llp--eppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             +LP  +    + LED+   WL  FEP SV+FCAFG++    K+QF +  LG+EL GLPFL
Sbjct  226   MLPEPQNKSGKFLEDRWNHWLNGFEPGSVVFCAFGTQFFFEKDQFQEFCLGMELMGLPFL  285

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             ++V PP+ S ++++ALP+GF+ER K   IV  GW+ Q +IL H +VG FVNH G GSMWE
Sbjct  286   ISVMPPKGSPTVQEALPKGFEERVKKHGIVWEGWLEQPLILSHPSVGCFVNHCGFGSMWE  345

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG---  1551
             SL S C+I+   P  +D  L  RL+ EELE +V+VQ +++  F KE+L + +KSVM    
Sbjct  346   SLVSDCQIVFI-PQLADQVLITRLLTEELEVSVKVQREDSGWFSKEDLRDTVKSVMDIDS  404

Query  1552  --ENIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                N+ K NHKK ++ L++PG    Y D F+  L
Sbjct  405   EIGNLVKRNHKKLKETLVSPGLLSGYADKFVEAL  438



>ref|XP_003530810.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
Length=466

 Score =   303 bits (776),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 194/459 (42%), Positives = 287/459 (63%), Gaps = 12/459 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S+ H+AM+PW A GH   FL ++N LA+RGH+IS L+P N + +L H NL+P LI F  +
Sbjct  7     SLFHVAMYPWFALGHLTSFLHISNKLAERGHKISFLMPKNTIPRLSHFNLHPHLIFFVPI  66

Query  490   TIPQVEGLPPGAETTADTMNLDGS--LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             T+P V+GLP G+ETT+D  N      L  A+D L + V    L+  KP++VF+DF +W+P
Sbjct  67    TVPHVDGLPLGSETTSDLPNYSKHSLLMTAMD-LTEPVIETCLKHLKPHMVFFDFTHWLP  125

Query  664   ELVSEMGCKTVKFTVFSP-TISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
              L  ++G K + +   SP T+  L     K   +  ++T AD++ PPP FP  S + L  
Sbjct  126   ALACKLGIKALHYCTISPATVGYLISPERKLLLEKNSLTEADLINPPPSFPPSSTIRLHP  185

Query  841   HEAYQVSR--FLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
             HEA +++     N     I+  +R + +   C A+ F+ C EMEG YC+Y+  ++ K V+
Sbjct  186   HEARELATAAVKNYGNGGISFVERQLISFASCHAVVFKTCREMEGPYCDYLERQMRKQVF  245

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              AGP+LP+ P    LE+K   WL  F+P +VIFCAFGSE  L  +QF +LLLG ELTG+P
Sbjct  246   LAGPVLPDTPLRSKLEEKWVTWLGSFKPKTVIFCAFGSECFLKSDQFKELLLGFELTGMP  305

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL A+KPP  + +IE ALPEGF ERTKG+ +VHG WV Q +IL H +VG FV H GSGS+
Sbjct  306   FLAALKPPIGAEAIESALPEGFNERTKGRGVVHGDWVQQLLILSHPSVGCFVTHCGSGSL  365

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
              E++ + C++++  P+  D  +NAR+M+ +L+  VEV+  E+  F +E +C  +++VM  
Sbjct  366   TEAMVNECQLVLL-PHAGDQFINARIMSGDLKVGVEVEKSEDGLFTREAVCKVLRAVMDS  424

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + +     + NH KWR  L + G  ++Y+D F   L+ L
Sbjct  425   DSEVGQMVRTNHAKWRKFLFSKGLENSYVDHFNQNLHSL  463



>ref|XP_007149722.1| hypothetical protein PHAVU_005G093600g [Phaseolus vulgaris]
 gb|ESW21716.1| hypothetical protein PHAVU_005G093600g [Phaseolus vulgaris]
Length=458

 Score =   303 bits (776),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 197/464 (42%), Positives = 285/464 (61%), Gaps = 20/464 (4%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M+ S LHIAMFPW A GH  P+L L+N LAKRGH+IS  +P     KL+  NL+P LITF
Sbjct  1     MDGSSLHIAMFPWFAMGHLTPYLHLSNKLAKRGHKISFFVPRRTQSKLEQFNLFPDLITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P VEGLP GAETT+D + +L   +  A+D  + +++ +LL + KP +VF+DF YW
Sbjct  61    FPINVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTERDIELLLLDL-KPQIVFFDFTYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P + S +G K+ ++ + SP   + +    +   KG ++T  D+M+PP G+P  S + L 
Sbjct  120   LPNITSRLGIKSFQYFIVSPATVSYTTAPPRMNHKG-SLTELDLMQPPLGYPVSS-IKLH  177

Query  838   EHEAYQVSRFLNLPRN-----RITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELG  1002
              HEA    +FL   RN      +  +DR+   L   DAI F+ C E+EG + +Y+A + G
Sbjct  178   AHEA----KFLASKRNWEFGSGVLFYDRLNNGLMLSDAIGFKGCREIEGPFVDYLAEQFG  233

Query  1003  KPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglel  1182
             K V  +GP++PEPP      +K + WL  F+  SV+FCA GSE  L   QF +LLLGLEL
Sbjct  234   KSVVLSGPIIPEPPNTVLD-EKWSAWLGSFKDGSVVFCALGSEWKLPHGQFQELLLGLEL  292

Query  1183  tglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGG  1362
             TGLPFL  VK P    +IE ALPEGF+ER +G+ IVH GW+ Q +IL H +VG F+ H G
Sbjct  293   TGLPFLAVVKVPIGFETIEAALPEGFKERIEGRGIVHSGWIQQQLILEHSSVGCFITHCG  352

Query  1363  SGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIK  1539
             +GS+ E+L + C++++ P    D+ +NAR+M   L+  VEV+  E D +F KE++  A+K
Sbjct  353   AGSLTEALVNKCQMVLLPQLDGDHIINARMMGSNLKVGVEVEKGEEDGWFTKESVSKAVK  412

Query  1540  SVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              VM E  +     + NH K R+ L++       +D+F  KL  L
Sbjct  413   IVMDEENEVGREVRENHAKLRNFLVSHDLESICVDNFCQKLQNL  456



>gb|ABL74480.1| glucosyltransferase [Ipomoea batatas]
Length=459

 Score =   303 bits (776),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 194/454 (43%), Positives = 277/454 (61%), Gaps = 13/454 (3%)
 Frame = +1

Query  319   HIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIP  498
             H+AM+PW   GH   F +LAN LA +GHRIS L+P N   KL   NL+P L++F  +T+P
Sbjct  9     HMAMYPWFGVGHLTAFFRLANKLASKGHRISFLIPKNTQSKLASFNLHPHLVSFVPITVP  68

Query  499   QVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVS  675
              + GLPPGAETT+D   +    L  A+D  Q +++ IL  +E  ++VF+DF +W+P L  
Sbjct  69    SIPGLPPGAETTSDVPFSSTHLLMEAMDKTQTDIEIILKNLEV-DVVFFDFTHWLPGLAR  127

Query  676   EMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQ  855
             ++G K+V ++  SP +   +L + + +  G+ +T AD+M+ P  FP D  + L  HEA  
Sbjct  128   KIGIKSVFYSTISPLMHGFAL-SPERRVAGKQLTEADMMKAPASFP-DPSIKLHAHEARG  185

Query  856   -VSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
               +R +      IT FDR+  A+   D +A+  C E+EG +C+YI T+  KPV  AGP L
Sbjct  186   FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFKKPVLLAGPAL  245

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             P P +      K + WL KF+  SVI+CAFGSE  L KEQF +LL GLELTG+PF  A+K
Sbjct  246   PVPSKSTME-QKWSDWLGKFKEGSVIYCAFGSECTLRKEQFQELLWGLELTGMPFFAALK  304

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
              P  + SIE A+PE  +E+  GK IVHGGWV Q + L+H +VG FV+H G  S+ E+L +
Sbjct  305   APFGTDSIEAAIPEELREKIHGKGIVHGGWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  364

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGENIQ--  1563
              C+I++  P   D  +NAR+M+  L+  VEV+  E D  F +E++C A+K+VM E  +  
Sbjct  365   DCQIVLL-PQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKSEIG  423

Query  1564  ---KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                + NH K R  LL       Y+DSF  KL +L
Sbjct  424   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQDL  457



>ref|XP_007132948.1| hypothetical protein PHAVU_011G138500g [Phaseolus vulgaris]
 gb|ESW04942.1| hypothetical protein PHAVU_011G138500g [Phaseolus vulgaris]
Length=448

 Score =   302 bits (774),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 204/464 (44%), Positives = 287/464 (62%), Gaps = 30/464 (6%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M+ S LHIAMFPW A GH  PFL L+N LAKRGH+IS  +PT    KL+  NL+P LITF
Sbjct  1     MDSSSLHIAMFPWFAMGHLTPFLHLSNKLAKRGHKISFFIPTRTQSKLEQFNLFPDLITF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               + +P VEGLP GAETT+D + +L   +  A+D  + +++ +LL + KP +VF+DF YW
Sbjct  61    FPINVPHVEGLPHGAETTSDVSFSLGPLIMTAMDRTEKDIELLLLDL-KPQIVFFDFTYW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P + S +G K+ ++ + SP  + +S I S           +D+M+PPPG+P  S + L 
Sbjct  120   LPNITSRLGIKSFQYFIVSP--ATVSYIRSPQ---------SDLMQPPPGYPV-SSIKLH  167

Query  838   EHEAYQVSRFLNLPRN-----RITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELG  1002
               EA    +FL   RN      +  +DR    L   DAI F+ C E+EG Y +Y+A +LG
Sbjct  168   LDEA----KFLASKRNWEFGSGVLFYDRFEYGLMLSDAIGFKGCREIEGPYVDYLAEQLG  223

Query  1003  KPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllglel  1182
             K V  +GP++PEPP     E+  A WL  F+  SVIFCA GSE  L   QF +LLLGLEL
Sbjct  224   KSVLLSGPIIPEPPNTVLEENWSA-WLGGFKDGSVIFCALGSEWKLPHGQFQELLLGLEL  282

Query  1183  tglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGG  1362
             TGLPFL  VK P    +IE ALPEGF+E  +G+ IVH GW+ Q +IL H +VG F+ H G
Sbjct  283   TGLPFLAVVKVPVGFETIEAALPEGFKEGVEGRGIVHSGWIQQQLILEHSSVGCFITHCG  342

Query  1363  SGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIK  1539
             +GS+ E+L + C++++ P   +D+ +NAR+M   L+  VEVQ  E D +F KE++  A+K
Sbjct  343   AGSLTEALVNKCQMVLLPQLDADHIINARMMGSNLKVGVEVQKGEEDGWFTKESVSKAVK  402

Query  1540  SVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             +VM E  +     + NH K R+ L++P      +D+F  KL +L
Sbjct  403   TVMDEENEVGREVRENHAKLRNCLVSPDLESICVDNFCQKLQDL  446



>ref|XP_010479520.1| PREDICTED: UDP-glycosyltransferase 79B5 [Camelina sativa]
Length=448

 Score =   302 bits (774),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 197/454 (43%), Positives = 279/454 (61%), Gaps = 26/454 (6%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+PW  FGH IP+L LAN LA++GH I+  LP  A  +L+ +NL+P  I    L
Sbjct  3     SKFHAFMYPWFGFGHMIPYLHLANKLAEKGHTITFFLPKKAHKQLEPLNLFPDSIVLEPL  62

Query  490   TIPQVEGLPPGAETTADTMN-LDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P V+GLP GAET +D  N     +  A+D L+D+++A +  + KP+L+F+DF +W+P+
Sbjct  63    TLPHVDGLPSGAETASDLPNSTKKPIFDAMDLLRDQIEAKVRAL-KPDLIFFDFIHWVPD  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G K+V + + S    A+ L              A++  PPP +P  SKV LR HE
Sbjct  122   MAKEFGFKSVNYQIISAACLAMVL-----------APCAELGFPPPDYPL-SKVALRGHE  169

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             A   S F     +   +F  +   LK CD ++ R C E+EG  C +I  E  K V   GP
Sbjct  170   ANVCSLF----ASSHELFGLITTGLKNCDVVSIRTCVELEGKLCGFIERECQKKVLLTGP  225

Query  1027  llpeppreepl--eDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             +LPEP  +     ED+ ++WL  FEP SV+FCAFG++    K+QF +L LG+ELTGLPFL
Sbjct  226   MLPEPQSKSGKPLEDRWSQWLNGFEPGSVVFCAFGTQFFFEKDQFQELCLGMELTGLPFL  285

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             + V P + SS++++ALP+GF+ER KG+ IV  GWV Q +IL H +VG FVNH G GSMWE
Sbjct  286   IVVMPRKGSSTVQEALPKGFEERVKGRGIVWEGWVEQPLILSHPSVGCFVNHCGFGSMWE  345

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             SL S C+I+   P  +D  L  RL+ EELE +V+VQ +++  F KE+L + +KSVM +  
Sbjct  346   SLVSDCQIVFI-PQLADQILITRLLTEELEVSVKVQREDSGWFSKESLMDTVKSVMDKDS  404

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                N+ K NHKK ++ L++PGF   Y D F+  L
Sbjct  405   EIGNLVKRNHKKLKETLVSPGFFSGYADKFVETL  438



>ref|XP_002891582.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67841.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=430

 Score =   301 bits (772),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 192/452 (42%), Positives = 270/452 (60%), Gaps = 40/452 (9%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+PW  FGH IP+L LAN LA++GH I+  LP  A  +L+ +NL+P  I    L
Sbjct  3     SKFHAFMYPWFGFGHMIPYLHLANKLAEKGHTITFFLPKKAHKQLQPLNLFPDSIVLEPL  62

Query  490   TIPQVEGLPPGAETTADTMN-LDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             ++P  +GLP GAET +D  N     + +A+D L+D+++A +L + KP+L+F+DF +W+PE
Sbjct  63    SLPPADGLPFGAETASDLPNSTKKPIFLAMDLLRDQIEAKVLAL-KPDLIFFDFVHWVPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G K+V + + S    A+ L  S           A++  PPP +P  SKV LR H+
Sbjct  122   MAKEFGIKSVNYQIISAACVAMVLAPS-----------AELGFPPPDYPL-SKVALRGHD  169

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             A   S F     N   +F  + + LK CD ++ R C E+EG        + GKP+     
Sbjct  170   ANVCSLF----ANSHELFGLITKGLKNCDVVSIRTCVELEGPMLPEPQNKSGKPL-----  220

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
                        ED+   WL  FEP SV+FCAFG++    K+QF +  LG+ELTGLPFL+A
Sbjct  221   -----------EDRWNHWLNVFEPGSVVFCAFGTQFFFEKDQFQEFCLGMELTGLPFLIA  269

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             V PP+ SS++++ALPEGF+ER KG+ IV  GWV Q +IL H +VG FVNH G GSMWESL
Sbjct  270   VMPPKGSSTVQEALPEGFEERVKGRGIVWEGWVEQPLILSHPSVGCFVNHCGFGSMWESL  329

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE----  1554
              S C+I+   P  +D  L  RL+ EEL+ +V+VQ +++  F KENL +A+KSVM      
Sbjct  330   VSDCQIVFI-PQLADQVLITRLLTEELQVSVKVQREDSGWFSKENLRDAVKSVMDRDSEI  388

Query  1555  -NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
              N+ K NHKK +D L++PG      D F+  L
Sbjct  389   GNLVKKNHKKLKDTLVSPGLLSGCADKFVEAL  420



>ref|XP_010446347.1| PREDICTED: UDP-glycosyltransferase 79B6-like isoform X2 [Camelina 
sativa]
Length=422

 Score =   301 bits (771),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 199/456 (44%), Positives = 283/456 (62%), Gaps = 44/456 (10%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  MFPW  FGH   FL LAN LA++GH+I+ LLP  AL +L+ +NL+P  I F  L
Sbjct  3     SKFHAFMFPWFGFGHMTAFLHLANKLAEKGHKITFLLPKKALKQLEPLNLFPDYIFFHTL  62

Query  490   TIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             TIP V+GLP GAETT+D     GS L  A+D  +++V+  +  + KP+L+F+DFA+WIPE
Sbjct  63    TIPSVDGLPAGAETTSDIQISSGSFLASAMDRTRNQVQEAV-SIGKPDLIFFDFAHWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  E G ++V F   S    A+S +  +S          D+  PPPG+PS SKV+LR  E
Sbjct  122   IAGEYGARSVNFITISAACVAISFVPGRSPD--------DLAVPPPGYPS-SKVLLRGQE  172

Query  847   AYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
                 S FL+ P  +  T ++R++  L  CD I+ R C EME +          KP+    
Sbjct  173   TNCFS-FLSHPFGDNTTFYERIMIGLTNCDVISIRTCQEMEDN---------SKPL----  218

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
                         ED+  +WL +FEP SV++CA GS+++L K+QF +L LG+ELTGLPFLV
Sbjct  219   ------------EDQWMQWLSRFEPGSVVYCALGSQIILEKDQFQELCLGMELTGLPFLV  266

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             AVKPP+ SS+I++ALP GF+ER KG+ +V G WV Q +IL H ++G FV+H G GSMWE 
Sbjct  267   AVKPPKGSSTIQEALPNGFEERVKGRGVVWGRWVQQPLILAHPSIGCFVSHCGFGSMWEG  326

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE---  1554
             L + C+I+   P+  +   N RLM+EELE +VEV+ ++   F KE+L  +I+SVM +   
Sbjct  327   LVNDCQIVFI-PHLGEQIFNTRLMSEELEVSVEVEREDTGWFSKESLSGSIRSVMDKDSE  385

Query  1555  --NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               N+ + NH KW+D L++ G  + Y++ FI  L +L
Sbjct  386   LGNLVRRNHAKWKDSLVSTGLMNGYVNKFIEALQKL  421



>ref|XP_008465522.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=479

 Score =   303 bits (775),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 200/458 (44%), Positives = 284/458 (62%), Gaps = 14/458 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             + LHIAM+PW A GH  PFL L+N LAK+GH+IS  +PT  L K + +NL+P LITF  +
Sbjct  16    TCLHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPI  75

Query  490   TIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
              +P V+GLP GAETT D    L   +  ++D  Q ++  +LLQ  KP+L+ +DF +W+P+
Sbjct  76    IVPHVDGLPRGAETTCDVPYPLHNLIMTSMDLTQPQI-TLLLQSLKPHLILFDFTHWLPK  134

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             L S++G K++ + V S  + A +L  S+   K   +T  D+M+PP G+PS S + L  HE
Sbjct  135   LASQLGIKSIHYCVTSAAMIAYTLTPSRQFSKNE-LTEEDLMKPPIGYPS-STINLHPHE  192

Query  847   A--YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCA  1020
             A  +   R      + +  +DR   +   CDAI FR C+E+EG + NY+ TE  KP+   
Sbjct  193   ARVFASKRKWKFGSD-VLFYDRQFVSFSDCDAIGFRTCHEIEGDFVNYLQTEFRKPILLT  251

Query  1021  GpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             G +LPEP   E LE+K   WL  F+  SV++CAFGSE  L  EQF +LL+G EL  +PFL
Sbjct  252   GSVLPEPLNPEALEEKWESWLLGFKEGSVVYCAFGSECTLQMEQFQELLMGFELLDMPFL  311

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
              A+KPP  + ++E ALPEGF +R  G+ +V+GGW+ Q  IL H +VG FV H GS S+ E
Sbjct  312   AALKPPFGAETVEAALPEGFTKRVGGRGVVYGGWIQQERILEHPSVGCFVTHCGSNSLKE  371

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGEN  1557
             +L + C++++  P   D  +NAR+M   L   VEV+  E D +F KE++C A+K VM E+
Sbjct  372   ALVNKCQLVLL-PQVGDQIINARMMGSNLRVGVEVEKREEDGWFTKESVCKAVKIVMDED  430

Query  1558  IQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              +     + NH K RDLLL      +YIDSF H L +L
Sbjct  431   NEIGKEVRTNHSKIRDLLLKKDLEQSYIDSFSHNLCDL  468



>ref|NP_176672.1| UDP-glycosyltransferase 79B11 [Arabidopsis thaliana]
 sp|Q9XIQ4.1|U7B11_ARATH RecName: Full=UDP-glycosyltransferase 79B11 [Arabidopsis thaliana]
 gb|AAD38266.1|AC006193_22 Similar to Flavonol 3-O-Glucosyltransferase [Arabidopsis thaliana]
 gb|AEE34305.1| UDP-glycosyltransferase 79B11 [Arabidopsis thaliana]
 gb|AHL38892.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=452

 Score =   301 bits (772),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 200/457 (44%), Positives = 279/457 (61%), Gaps = 27/457 (6%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             +H  MFPW AFGH  P+L L N LA++GHR++ LLP  A  +L+H NL+P  I F  L I
Sbjct  5     IHAFMFPWFAFGHMTPYLHLGNKLAEKGHRVTFLLPKKAQKQLEHQNLFPHGIVFHPLVI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  ++L   L +A+D  +D+++A +  + +P+L+ +D A+W+PE+ 
Sbjct  65    PHVDGLPAGAETASDIPISLVKFLSIAMDLTRDQIEAAIGAL-RPDLILFDLAHWVPEMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +  K++ + V S T  A  L+     G             PPG+PS SK + REH+A+
Sbjct  124   KALKVKSMLYNVMSATSIAHDLVPGGELGVA-----------PPGYPS-SKALYREHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F    +     + R    L  CD I+ R C E+EG +C+YI ++  K V   GP+L
Sbjct  172   ALLTFSGFYKR---FYHRFTTGLMNCDFISIRTCEEIEGKFCDYIESQYKKKVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP + +PLED+ + WL  F   SV+FCA GS+ +L K QF +L LG+ELTGLPFLVAVK
Sbjct  229   PEPDKSKPLEDQWSHWLSGFGQGSVVFCALGSQTILEKNQFQELCLGIELTGLPFLVAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVP----QSMILRHKAVGYFVNHGGSGSMWE  1380
             PP+ +++I +ALPEGF+ER KG+ IV G WV     Q +IL H +VG FV+H G GSMWE
Sbjct  289   PPKGANTIHEALPEGFEERVKGRGIVWGEWVQQPSWQPLILAHPSVGCFVSHCGFGSMWE  348

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             SL S C+I+   P  +D  L  R+M EELE +VEVQ +E   F KENL  AI S+M +  
Sbjct  349   SLMSDCQIVFI-PVLNDQVLTTRVMTEELEVSVEVQREETGWFSKENLSGAIMSLMDQDS  407

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                N  + NH K ++ L +PG    Y D F+  L  L
Sbjct  408   EIGNQVRRNHSKLKETLASPGLLTGYTDKFVDTLENL  444



>ref|XP_008455478.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Cucumis melo]
Length=460

 Score =   302 bits (773),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 188/459 (41%), Positives = 284/459 (62%), Gaps = 15/459 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S LHIAM+PW A GH I FLQ+ N LA +GHRIS  +P+    KL+  N +P LITF  +
Sbjct  6     SGLHIAMYPWFALGHLIAFLQIGNKLANKGHRISFFIPSKTQPKLQPFNHFPNLITFVPI  65

Query  490   TIPQVEGLPPGAETTADTMNLDGS--LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             T+P V+GLP GAETTAD  +      +  ++D  + E+ A  LQ  KP ++FYD AYW+P
Sbjct  66    TVPHVDGLPLGAETTADVSHPSQIPLIMTSMDRTEPEI-ASRLQDIKPEVIFYDLAYWVP  124

Query  664   ELVSEMGCKTVKFTVFSP-TISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             +L   +G K+V FT  S  T+S +     K  G    +T  D++ PPP FP  S + L  
Sbjct  125   KLAHPLGIKSVYFTAVSAVTMSYIQCKLWKFPGH-YNLTRDDLLHPPPDFPCSS-IKLHA  182

Query  841   HEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
             HEA  ++ F  +     IT F+R+  AL +C+AIA ++C E+EG + +Y+ + + +P+  
Sbjct  183   HEAQYLASFGRMKFGGDITFFERISNALSQCNAIALKSCREIEGPFIDYLESIVERPILL  242

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
              G +  EP       ++ A WL +F+  SVI+CAFGSE +L K QF +LLLGLEL+ LPF
Sbjct  243   PGTVNLEPLTTSLE-ERWANWLSEFKSGSVIYCAFGSECILTKNQFQELLLGLELSNLPF  301

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
              VA+KPP+   ++E ALP+GF++R +G+ IV+GGWV Q  IL H ++G F+ H G+ S+ 
Sbjct  302   FVALKPPDGIDTVEAALPKGFKQRIEGRGIVYGGWVQQQQILDHPSIGCFITHCGAESLS  361

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE  1554
             E++   C++++     +D    AR M++ L+  VE++  E D  F KE++C A+K+VM E
Sbjct  362   EAVVKKCQLVLF-SRTTDQLFRARSMSKFLKVGVEIEKGEEDGVFSKESVCKAVKTVMDE  420

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + N +K R+LL+     ++YI++FIH L+ +
Sbjct  421   ENESGKEIRANKEKLRELLVDKDLEESYINNFIHSLHSM  459



>emb|CBI20245.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   300 bits (768),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 207/460 (45%), Positives = 285/460 (62%), Gaps = 58/460 (13%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   + LHIA++PW AFGH  P+L L+N+LA+RGH+I+ +LP  A  +L+H+NL+P LIT
Sbjct  3     MARSTKLHIALYPWFAFGHLTPYLHLSNELAERGHKITFILPKKAQSQLQHLNLHPTLIT  62

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  LTIP V+GLPPGAET +D    +   L  A+D   D+V+A L  + KP+ + +DF Y
Sbjct  63    FHPLTIPHVDGLPPGAETASDVPFFMHHLLVTAMDRTADQVEAALRAL-KPDFLLFDFPY  121

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIME-PPPGFPSDSKVV  831
             W P L S++G K++ ++                     AV AA +   P PG        
Sbjct  122   WAPALASKLGIKSIYYS---------------------AVCAAALARHPVPG--------  152

Query  832   LREHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
                                + ++ R+   +K CDAI+ R C+E+EG +C+Y+A++ GKPV
Sbjct  153   -------------------VNLYQRLTTGMKCCDAISIRTCHEIEGAFCDYLASQYGKPV  193

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
                GP+LP+P       D+ A+WL  F+P SVIFCAFGS+    K+QF +LLLGLELTGL
Sbjct  194   LLTGPVLPKPLPTPSE-DRWAQWLSGFKPGSVIFCAFGSQNFPEKDQFQELLLGLELTGL  252

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFLVA+KPP  +++IE+A PEGFQER  G+ +VHGGWVPQ  IL H +VG FV+H G GS
Sbjct  253   PFLVALKPPTGAATIEEAFPEGFQERVGGRGVVHGGWVPQPSILSHPSVGCFVSHCGFGS  312

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMG  1551
             MWESL S  +I++  P   D  LN RL AE L+ AVE++ +EN  F KE+LC  +KSVM 
Sbjct  313   MWESLTSDPQIVLV-PELLDQILNTRLFAEVLKVAVEIEKEENGWFSKESLCRTVKSVMD  371

Query  1552  E-----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E      + + NH KW++ L + GF  NYID+F H+L +L
Sbjct  372   EESSVGGLVRKNHAKWKETLTSQGFMSNYIDNFAHQLQQL  411



>ref|XP_009340549.1| PREDICTED: UDP-glycosyltransferase 79B3-like [Pyrus x bretschneideri]
Length=456

 Score =   301 bits (770),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 188/453 (42%), Positives = 273/453 (60%), Gaps = 14/453 (3%)
 Frame = +1

Query  328   MFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIPQVE  507
             MFPW A GH  PFL L+N+LA RGHRI+ LLP  A  KL+H+N +P LITF ++T+P VE
Sbjct  1     MFPWFAMGHLTPFLHLSNELAARGHRITFLLPKKAQTKLQHLNHHPHLITFHSITVPHVE  60

Query  508   GLPPGAETTADT-MNLDGSLEVALDGLQDEVKAIL-LQMEKP----NLVFYDFAYWIPEL  669
             GLP  AET ++  ++    L +A+D  +D++ A L      P    +++ +D A+WIP++
Sbjct  61    GLPKSAETASEIPLSSIHFLTIAMDRTRDQIHAFLKASAADPKHIIDMIVFDLAHWIPDI  120

Query  670   VSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIME--PPPGFPSDSKVVLREH  843
                +G K++ + V    + A +L+ +            +     PP  +PS + V+ R++
Sbjct  121   ARGLGIKSIYYGVICAAVYAAALVPAPECNSVPMTVTEERQRRNPPSTYPSSTVVMTRDY  180

Query  844   EAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
             E   +          +T + RV+ + K CDA   R C E+EG +C+Y+  +  KPV   G
Sbjct  181   EVRSLIAIREPCGEGVTFYQRVITSTKECDAFCLRTCRELEGDFCDYLEAKYQKPVLLTG  240

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P+L      + LED+ A W   FE  S++FCA GS+ +  K+QF ++LLG ELTGLPFLV
Sbjct  241   PVLGLNKIPQQLEDRWAEWFAGFEAGSLVFCAVGSQWIFEKDQFQEVLLGFELTGLPFLV  300

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             A+KPP    +IE+ALP+GF+ER +G+ +V GGWV Q +IL H AVG FV+H G GSMWES
Sbjct  301   ALKPPLGCETIEEALPDGFEERVRGRGVVFGGWVQQPLILSHPAVGCFVHHCGFGSMWES  360

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN--  1557
             L S  +I++  P   D  L  +LMA+EL+ AVEV+ +E+    KENL  AIKSVM     
Sbjct  361   LLSKKQIVLV-PQWPDQILGTKLMAKELKVAVEVEREESGWISKENLKEAIKSVMDTESE  419

Query  1558  ---IQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                + K NH+KWR+++   GF   Y+D F+  L
Sbjct  420   VGVVVKRNHEKWREIVSEAGFMSGYVDRFVQNL  452



>ref|XP_008386212.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B3-like 
[Malus domestica]
Length=472

 Score =   301 bits (772),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 194/467 (42%), Positives = 279/467 (60%), Gaps = 14/467 (3%)
 Frame = +1

Query  295   HMMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLI  474
             H +  S  HIAMFPW A GH  PFL L N+LA RGHRI+ LLP  A  KL+H+N +P LI
Sbjct  6     HDLVRSNFHIAMFPWFAMGHLTPFLHLXNELAARGHRITFLLPKKAQTKLQHLNHHPHLI  65

Query  475   TFCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAIL-LQMEKP----NLV  636
             TF ++T+P VEGLP GAET ++  ++    L +A+D  +D++   L      P    +++
Sbjct  66    TFHSITVPHVEGLPKGAETASEIPLSSIHFLTIAMDRTRDQIHDFLKASAADPKHIIDMI  125

Query  637   FYDFAYWIPELVSEMGCKTVKFTVFSPTISALSLI-TSKSKGKGRAVTAA-DIMEPPPGF  810
              +D A+WIP++   +G K++ + V    + A +L+ T +       VT       PPP +
Sbjct  126   VFDLAHWIPDIARGLGIKSIYYGVICAAVYAAALVPTPECNSVPMTVTEERQRRNPPPPY  185

Query  811   PSDSKVVLREHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIA  990
             PS + V+ R++E   +          +T + RV+ + K CDA   R C E+EG +C+Y+ 
Sbjct  186   PSSTVVMTRDYEVRSLIAIREPCGEGVTFYQRVITSTKECDAFCLRTCRELEGDFCDYLE  245

Query  991   TELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlll  1170
              +  KPV   GP+L      + LED+ A W   FE  SV+FCA GS+ +  K+QF + LL
Sbjct  246   AKYQKPVLLTGPVLGLNKIPQQLEDRWAEWFAGFEAGSVVFCAVGSQWIFEKDQFQEXLL  305

Query  1171  gleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFV  1350
             G ELTGLPFLVA+KP     +IE+ALP+GF+ER +G+ +V  GWV Q +IL H AVG FV
Sbjct  306   GFELTGLPFLVALKPLLGCETIEEALPDGFEERVRGRGVVFXGWVQQPLILSHPAVGCFV  365

Query  1351  NHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCN  1530
             +H G GSMWESL S  +I++  P   D  L  +LMA+EL+ AVEV+ +E+    K +L  
Sbjct  366   HHCGFGSMWESLLSKKQIVLV-PQWPDQILGTKLMAKELKVAVEVEREESGWISKGSLKE  424

Query  1531  AIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             AIKSVM    +     K NH+KWR+++   GF   Y+D F+  L ++
Sbjct  425   AIKSVMDTESEVGVMVKRNHEKWREIVSEAGFMSGYVDRFVQNLKQI  471



>ref|XP_010686377.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=466

 Score =   301 bits (770),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 200/458 (44%), Positives = 281/458 (61%), Gaps = 18/458 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM PW AFGH   FL LAN LA++GH IS  +PT   LK    N +P LIT   +T+
Sbjct  11    LHIAMCPWFAFGHITSFLHLANKLAEKGHTISFFIPTKTKLKFVSHNHHPHLITLIPITL  70

Query  496   PQVEGLPPGAETTADTMNLDGSL-EVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GL  GAETTAD      SL   A+D  QD +++ L  + KP+ +F+DF  WIP++ 
Sbjct  71    PSVHGLHVGAETTADVPASSRSLIMAAMDQTQDTIESHLAHI-KPDFIFFDFTEWIPKVA  129

Query  673   SEMGCKTVKF-TVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
              +   K+V + TV+  T++   L+    K      +  D+ +PPPGFP  S + LR HEA
Sbjct  130   RKHQIKSVFYSTVYLVTVA--YLLPQPRKLAINCFSEEDMKQPPPGFPLPS-IRLRAHEA  186

Query  850   YQVSRF--LNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAG  1023
               +S           +++ +RV EA ++CDA+  + C EMEG YC+++    GKPV  AG
Sbjct  187   RSLSSASKAEFGGGGMSLLERVSEAFQQCDAVCIKTCREMEGSYCDFMQKNYGKPVLLAG  246

Query  1024  pllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflV  1203
             P++PE P  +   +   RWL+     SV++CA GSE  L K+QF +L+LGLELTG+PFL 
Sbjct  247   PVVPELPATQLD-EYFDRWLKGCGNGSVVYCALGSECTLQKDQFQELILGLELTGMPFLA  305

Query  1204  AVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWES  1383
             A+K P   S++E ALPEGF+ERTKG+ IVH GWV Q ++L+H +VG F+ H G+GS+ E+
Sbjct  306   ALKLPTECSTLESALPEGFKERTKGRGIVHIGWVQQQLVLQHSSVGCFLTHCGAGSLSEA  365

Query  1384  LASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM----  1548
             + S C+II+  P   D ++NARLM+ +L   VEV+  + D FF +E +C A+ +VM    
Sbjct  366   MVSQCQIIML-PQAVDQSVNARLMSLDLRLGVEVEMRDRDGFFTREAVCKAVVTVMDAEN  424

Query  1549  --GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               G  + + NH KWR+ LL  G  D YI+ FI  L +L
Sbjct  425   EVGREV-RANHAKWREFLLKEGLEDAYINGFIQSLQDL  461



>ref|XP_006286772.1| hypothetical protein CARUB_v10003323mg [Capsella rubella]
 gb|EOA19670.1| hypothetical protein CARUB_v10003323mg [Capsella rubella]
Length=445

 Score =   300 bits (767),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 201/459 (44%), Positives = 290/459 (63%), Gaps = 27/459 (6%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             ME    H  MFPW AFGH IPFL LAN LA++GHR++ L+P  A  +L+H N++P  I F
Sbjct  1     MEPPKFHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLVPKKAQKQLEHHNMFPDSIVF  60

Query  481   CALTIPQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               LT+P V GLP GAETT+D ++++D  L  ALD  +D+V+A +  + KP+L+F+DFA W
Sbjct  61    HPLTVPHVNGLPVGAETTSDISISVDNFLSEALDLTRDQVEAAVRAL-KPDLIFFDFARW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             IPEL  E   K+V + +     SA S+    + G    ++       PP +PS SKV  R
Sbjct  120   IPELAREHKIKSVSYMI----ASATSVAHIHAPGGPLGIS-------PPSYPS-SKVFFR  167

Query  838   EHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
              ++A+ ++ F         V  ++    K CD IA R C E+EG +C+YI++   K V  
Sbjct  168   GNDAHTMTAFYK------RVCHQLTTGFKSCDVIALRTCKEIEGKFCDYISSLYHKKVLL  221

Query  1018  AGpllpeppreepleDKI-ARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              GP+LPEP   +PLE++  +++L  F   SV+FCAFG + VL K+QF +L LG+E+TGLP
Sbjct  222   TGPMLPEPDTSKPLEEQYWSQFLSGFPHGSVVFCAFGRQTVLEKDQFQELCLGMEMTGLP  281

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL+AV  P  SS++++ LPEGF+ER KG+ +V  GWV  ++IL H +VG FVNH G G++
Sbjct  282   FLLAVNRPRGSSTVQEGLPEGFEERVKGRGLVLEGWVHHTLILSHPSVGCFVNHCGPGAI  341

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE  1554
             WE L S C+I++  P  +D  L  RLM EELE +VEV  ++   F KE+L +AIKSVM +
Sbjct  342   WECLMSDCQIVLV-PILNDQVLFTRLMTEELEISVEVLREKTGWFTKESLRDAIKSVMDK  400

Query  1555  -----NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                   + + NH K +++L +PG  D Y+D+F+  L +L
Sbjct  401   ESDLGKLVRSNHAKLKEVLGSPGLLDGYVDNFVEALSDL  439



>sp|Q53UH4.1|DUSKY_IPONI RecName: Full=Anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase; 
AltName: Full=3-O-glucoside-2''-O-glucosyltransferase; 
Short=In3GGT; AltName: Full=Protein dusky; Short=Dy [Ipomoea 
nil]
 dbj|BAD95881.1| glucosyltransferase [Ipomoea nil]
 dbj|BAD95883.1| glucosyltransferase [Ipomoea nil]
Length=459

 Score =   300 bits (768),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 192/454 (42%), Positives = 279/454 (61%), Gaps = 13/454 (3%)
 Frame = +1

Query  319   HIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIP  498
             H+AM+PW   GH   F +LAN LA +GHRIS L+P N   KL+  NL+P LI+F  + +P
Sbjct  9     HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  68

Query  499   QVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVS  675
              + GLPPGAETT+D       L + A+D  Q++++ IL  + K ++VFYDF +W+P L  
Sbjct  69    SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDL-KVDVVFYDFTHWLPSLAR  127

Query  676   EMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQ  855
             ++G K+V ++  SP +   +L + + +  G+ +T AD+M+ P  FP D  + L  HEA  
Sbjct  128   KIGIKSVFYSTISPLMHGYAL-SPERRVVGKQLTEADMMKAPASFP-DPSIKLHAHEARG  185

Query  856   -VSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
               +R +      IT FDR+  A+   D +A+  C E+EG +C+YI T+  KPV  AGP L
Sbjct  186   FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLLAGPAL  245

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             P P +      K + WL KF+  SVI+CAFGSE  L K++F +LL GLELTG+PF  A+K
Sbjct  246   PVPSKSTME-QKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  304

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  + SIE A+PE  +E+ +G+ IVHG WV Q + L+H +VG FV+H G  S+ E+L +
Sbjct  305   PPFEAESIEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  364

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGENIQ--  1563
              C+I++  P   D  +NAR+M+  L+  VEV+  E D  F +E++C A+K+VM E  +  
Sbjct  365   DCQIVLL-PQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKSEIG  423

Query  1564  ---KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                + NH K R  LL       Y+DSF  KL +L
Sbjct  424   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQDL  457



>ref|XP_004293911.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Fragaria vesca 
subsp. vesca]
Length=451

 Score =   300 bits (767),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 197/462 (43%), Positives = 286/462 (62%), Gaps = 23/462 (5%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M D  LHIAM+PW A GH   FL ++N LA+RG++IS  LP     KL+H NL+P+LITF
Sbjct  1     MSDQTLHIAMYPWFAMGHLTAFLHISNKLAERGNKISFFLPLKTRSKLQHYNLHPRLITF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               L++P V+GLP G ETTAD  ++L   L  A+D  + +++  L+++ KP+ VF+D +YW
Sbjct  61    IPLSVPHVDGLPLGTETTADIDLSLGSLLATAMDLTRPQIEQSLIEL-KPDFVFFDLSYW  119

Query  658   IPELVSEMGC--KTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
             +P ++  +    K++ ++V +P      L         R +      +    + S S + 
Sbjct  120   LPAMLRGLATNIKSIYYSVINPATIWFGL---------RNLVLPRKNQLDEAYRSFS-IK  169

Query  832   LREHEAYQVSRFLNLPR-NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             L+ HE       +N+   + +T   R++ +   CDAI F++C E+   + NYI   + KP
Sbjct  170   LQTHEVRAYDAMMNMKYGSEVTFSKRLMTSRSDCDAICFQSCRELAEPFSNYIEIRMNKP  229

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V  AGP++P+PP  +   +K ARWL  FEP +VIFCA GSE +L K+Q  QLLLG ELTG
Sbjct  230   VILAGPVMPDPPSSQLE-EKWARWLGGFEPRTVIFCALGSEYILTKQQLQQLLLGFELTG  288

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
              PF  A+KPP    SIE ALPEGF+ER KGK +V+G WV Q +IL+H +VG FV H GSG
Sbjct  289   FPFFAALKPPTGVESIESALPEGFEERVKGKGVVYGSWVQQPLILKHPSVGCFVTHCGSG  348

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSV  1545
             S+ E+L + C+++   PN  D  +NAR+M+ EL+  VEV+  DE+  F KE +C A+K+V
Sbjct  349   SLNEALLNECQLVFL-PNILDQIINARMMSGELKVGVEVEKGDEDGLFTKEGVCKAVKAV  407

Query  1546  MGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M EN +     K+NH KWR+ L + G   +YID F+ KL++L
Sbjct  408   MDENSEVGKEVKINHAKWREFLSSKGLESSYIDDFVQKLHKL  449



>gb|AHJ60266.1| anthocyanidin 3-O-glucoside-2''-O-glucosyltransferase [Ipomoea 
purpurea]
Length=459

 Score =   299 bits (766),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 191/454 (42%), Positives = 279/454 (61%), Gaps = 13/454 (3%)
 Frame = +1

Query  319   HIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIP  498
             H+AM+PW   GH   F +LAN LA +GHRIS L+P N   KL+  NL+P LI+F  + +P
Sbjct  9     HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  68

Query  499   QVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVS  675
              + GLPPGAETT+D       L + A+D  Q++++ IL  + K ++VFYDF +W+P L  
Sbjct  69    SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDL-KVDVVFYDFTHWLPSLAR  127

Query  676   EMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQ  855
             ++G K+V ++  SP +   +L + + +  G+ +T AD+M+ P  FP D  + L  HEA  
Sbjct  128   KIGIKSVFYSTISPLMHGYAL-SPERRVVGKQLTEADMMKAPASFP-DPSIKLHAHEARG  185

Query  856   -VSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
               +R +      IT FDR+  A+   D +A+  C E+EG +C+YI T+  KPV  AGP L
Sbjct  186   FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLLAGPAL  245

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             P P +      K + WL KF+  SVI+CAFGSE  L K++F +LL GLELTG+PF  A+K
Sbjct  246   PVPSKSTME-QKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  304

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  + S+E A+PE  +E+ +G+ IVHG WV Q + L+H +VG FV+H G  S+ E+L +
Sbjct  305   PPFEAESVEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  364

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGENIQ--  1563
              C+I++  P   D  +NAR+M+  L+  VEV+  E D  F +E++C A+K+VM E  +  
Sbjct  365   DCQIVLL-PQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKSEIG  423

Query  1564  ---KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                + NH K R  LL       Y+DSF  KL +L
Sbjct  424   REVRGNHDKLRGFLLNADLDSKYMDSFNQKLQDL  457



>ref|XP_006393133.1| hypothetical protein EUTSA_v10012012mg [Eutrema salsugineum]
 gb|ESQ30419.1| hypothetical protein EUTSA_v10012012mg [Eutrema salsugineum]
Length=449

 Score =   298 bits (764),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 195/454 (43%), Positives = 282/454 (62%), Gaps = 25/454 (6%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S  H  M+P   FGH IP+L LAN L ++GHR+++LLP  A  +L+ +N++P  I +  +
Sbjct  3     SKFHAFMYPSFGFGHMIPYLHLANKLVEKGHRVTVLLPKKAQKQLESLNMFPNSIVYDPV  62

Query  490   TIPQVEGLPPGAETTADTMNLDGS-LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPE  666
             T+P V+GLP GAETT+D  N     L  A+D L+DE++   ++  KP+L+F+DFA WIPE
Sbjct  63    TLPCVDGLPVGAETTSDLSNSPKHVLYDAMDLLRDEIEE-KVRASKPDLIFFDFACWIPE  121

Query  667   LVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHE  846
             +  + G K+V + + S    A+ L              A++  PPPG+PS SKV+LR H+
Sbjct  122   VAKKFGAKSVSYQIVSAAFVAMFL-----------APGAELGFPPPGYPS-SKVLLRGHD  169

Query  847   AYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             A   S F+N    R  +FDRV   LK CD I+ R C E+EG  C +I T+  K V   GP
Sbjct  170   ANLYSLFVN---TRQWLFDRVTTGLKNCDIISIRTCAEIEGKLCGFIETQCQKKVLLTGP  226

Query  1027  l--lpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpfl  1200
             +   P+    + LED+   WL  FEP SV++C+ G+   + K QF +L LG+ELTGLPFL
Sbjct  227   MFPKPQEKSVKTLEDRWNHWLNGFEPGSVVYCSLGTHCFIEKHQFQELCLGMELTGLPFL  286

Query  1201  VAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWE  1380
             +   PP  +S+ ++ALP+G++ER KG+ IV GGWV Q +IL H +VG FVN  G GSMWE
Sbjct  287   IRAMPPIGASTTQEALPDGYEERVKGRGIVWGGWVEQPLILSHPSVGCFVNQCGFGSMWE  346

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             SL + C+I+   P  ++ AL  RLM EEL+ +V+VQ + +  F KE+L +A+ SVM +  
Sbjct  347   SLVNDCQIVFI-PLLAEQALTTRLMTEELQVSVKVQRENSGWFSKESLRDAVISVMDKDS  405

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKL  1647
                N+ K NHK +++ L++PG  + Y D F+  L
Sbjct  406   EIGNLVKRNHKMFKETLVSPGLLNGYADKFVEAL  439



>ref|XP_008350006.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B3-like 
[Malus domestica]
Length=471

 Score =   299 bits (766),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 196/467 (42%), Positives = 279/467 (60%), Gaps = 15/467 (3%)
 Frame = +1

Query  295   HMMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLI  474
             H +  S  HIAMFPW A GH  PFL L N+LA RGHRI+ LLP  A  KL+H+N +P LI
Sbjct  6     HDLVRSNFHIAMFPWFAMGHLTPFLHLPNELAARGHRITFLLPKKAQTKLQHLNHHPHLI  65

Query  475   TFCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAIL-LQMEKP----NLV  636
             TF ++T+P VEGLP GAET ++  ++    L +A+D  +D++   L      P    +++
Sbjct  66    TFHSITVPHVEGLPKGAETASEIPLSSIHFLTIAMDRTRDQIHDFLKASAADPKHIIDMI  125

Query  637   FYDFAYWIPELVSEMGCKTVKFTVFSPTISALSLI-TSKSKGKGRAVTAA-DIMEPPPGF  810
              +D A+WIP++   +G K++ + V    + A +L+ T +       VT       PPP +
Sbjct  126   VFDLAHWIPDIARGLGIKSIYYGVICAAVYAAALVPTPECNSVPMTVTEERQRRNPPPPY  185

Query  811   PSDSKVVLREHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIA  990
             PS S VV R++E   +          +T + RV+ + K CDA   R C E+EG +C+Y+ 
Sbjct  186   PS-STVVTRDYEVRSLIAIREPCGEGVTFYQRVITSTKECDAFCLRTCRELEGDFCDYLE  244

Query  991   TELGKPVYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlll  1170
              +  KPV   GP+L      + LED+ A W   FE  SV+FCA GS+ +  K+QF + LL
Sbjct  245   AKYQKPVLLTGPVLGLNKIPQQLEDRWAEWFAGFEAGSVVFCAVGSQWIFEKDQFQEXLL  304

Query  1171  gleltglpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFV  1350
             G ELTGLPFLVA+KP     +IE+ALP+GF+ER +G+ +V  GWV Q +IL H AVG FV
Sbjct  305   GFELTGLPFLVALKPLLGCETIEEALPDGFEERVRGRGVVFXGWVQQPLILSHPAVGCFV  364

Query  1351  NHGGSGSMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCN  1530
             +H G GSMWESL S  +I++  P   D  L  +LMA+EL+ AVEV+ +E+    K +L  
Sbjct  365   HHCGFGSMWESLLSKKQIVLV-PQWPDQILGTKLMAKELKVAVEVEREESGWISKGSLKE  423

Query  1531  AIKSVMGENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             AIKSVM    +     K NH+KWR+++   GF   Y+D F+  L ++
Sbjct  424   AIKSVMDTESEVGVMVKRNHEKWREIVSEAGFMSGYVDRFVQNLKQI  470



>sp|Q53UH5.1|DUSKY_IPOPU RecName: Full=Anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase; 
AltName: Full=3-O-glucoside-2''-O-glucosyltransferase; 
Short=Ip3GGT; AltName: Full=Protein dusky; Short=Dy [Ipomoea 
purpurea]
 dbj|BAD95882.1| glucosyltransferase [Ipomoea purpurea]
Length=459

 Score =   298 bits (764),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 190/454 (42%), Positives = 279/454 (61%), Gaps = 13/454 (3%)
 Frame = +1

Query  319   HIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTIP  498
             H+AM+PW   GH   F +LAN LA +GHRIS L+P N   KL+  NL+P LI+F  + +P
Sbjct  9     HMAMYPWFGVGHLTGFFRLANKLAGKGHRISFLIPKNTQSKLESFNLHPHLISFVPIVVP  68

Query  499   QVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVS  675
              + GLPPGAETT+D       L + A+D  Q++++ IL  + K ++VFYDF +W+P L  
Sbjct  69    SIPGLPPGAETTSDVPFPSTHLLMEAMDKTQNDIEIILKDL-KVDVVFYDFTHWLPSLAR  127

Query  676   EMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQ  855
             ++G K+V ++  SP +   +L + + +  G+ +T AD+M+ P  FP D  + L  HEA  
Sbjct  128   KIGIKSVFYSTISPLMHGYAL-SPERRVVGKQLTEADMMKAPASFP-DPSIKLHAHEARG  185

Query  856   -VSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
               +R +      IT FDR+  A+   D +A+  C E+EG +C+YI T+  KPV  AGP L
Sbjct  186   FTARTVMKFGGDITFFDRIFTAVSESDGLAYSTCREIEGQFCDYIETQFQKPVLLAGPAL  245

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             P P +      K + WL KF+  SVI+CAFGSE  L K++F +LL GLELTG+PF  A+K
Sbjct  246   PVPSKSTME-QKWSDWLGKFKEGSVIYCAFGSECTLRKDKFQELLWGLELTGMPFFAALK  304

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  + S+E A+PE  +E+ +G+ IVHG WV Q + L+H +VG FV+H G  S+ E+L +
Sbjct  305   PPFETESVEAAIPEELKEKIQGRGIVHGEWVQQQLFLQHPSVGCFVSHCGWASLSEALVN  364

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGENIQ--  1563
              C+I++  P   D  +NAR+M+  L+  VEV+  E D  F +E++C A+K+VM E  +  
Sbjct  365   DCQIVLL-PQVGDQIINARIMSVSLKVGVEVEKGEEDGVFSRESVCKAVKAVMDEKSEIG  423

Query  1564  ---KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                + NH K R  L+       Y+DSF  KL +L
Sbjct  424   REVRGNHDKLRGFLMNADLDSKYMDSFNQKLQDL  457



>ref|XP_004144600.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 ref|XP_004164965.1| PREDICTED: UDP-glycosyltransferase 79B6-like [Cucumis sativus]
 gb|KGN43488.1| hypothetical protein Csa_7G041330 [Cucumis sativus]
Length=461

 Score =   298 bits (764),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 187/459 (41%), Positives = 280/459 (61%), Gaps = 15/459 (3%)
 Frame = +1

Query  310   SMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCAL  489
             S LHIAM+PW A GH I FLQ+ N LA +GHRIS  +P+    KL+  N +P LITF  +
Sbjct  6     SSLHIAMYPWFALGHLIAFLQIGNKLASKGHRISFFIPSKTQPKLQPFNHFPNLITFVPI  65

Query  490   TIPQVEGLPPGAETTADTMNLDGS--LEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIP  663
             T+P V+GLP GAETTAD  +      +  ++D  + E+ A  LQ  KP  +FYD A W+P
Sbjct  66    TVPHVDGLPLGAETTADVSHPSQIPLIMTSMDRTEPEI-ASRLQEIKPEAIFYDLACWVP  124

Query  664   ELVSEMGCKTVKFTVFSP-TISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
             +L   +G K+V F+  SP T+  +     K  G    +T  D++ PPP FP  S + L  
Sbjct  125   KLAHPLGIKSVYFSAVSPVTMGYIQCKLWKFPGH-YNLTQDDLLHPPPDFPCPS-IKLLA  182

Query  841   HEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
             HEA  ++ F  +   + IT F+R   AL +C A+A ++C E+EG +  Y+ + + +P++ 
Sbjct  183   HEAQYLASFGQMKFGSDITFFERNSRALSQCSAMALKSCREIEGPFIEYLESIVKRPIFL  242

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
              G +  EP       ++ A+WL KF   SVI+CAFGSE +L K QF +LLLGLEL+ LPF
Sbjct  243   PGFVNLEPLTTSLE-ERWAKWLSKFNSGSVIYCAFGSECILNKNQFQELLLGLELSNLPF  301

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
              VA+KPP+   ++E ALPEGF++R +G+ IV+GGWV Q  IL H ++G F+ H G+GS+ 
Sbjct  302   FVALKPPDGIDTVEAALPEGFEQRVEGRGIVYGGWVQQQQILDHPSIGCFITHCGAGSLS  361

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE  1554
             E++   C++++     +D    ARLM++  +  VE++  E D  F KE++C A+K+VM E
Sbjct  362   EAVVKKCQLVLF-SRTTDQLFRARLMSKFSKVGVEIEKGEEDGVFSKESVCKAVKTVMDE  420

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + N ++ R+ L+     ++YI++FIH L  L
Sbjct  421   ENESGKEIRANKERLRESLVDKDLEESYINNFIHSLRSL  459



>ref|XP_006282036.1| hypothetical protein CARUB_v10028277mg [Capsella rubella]
 gb|EOA14934.1| hypothetical protein CARUB_v10028277mg [Capsella rubella]
Length=430

 Score =   296 bits (759),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 188/448 (42%), Positives = 270/448 (60%), Gaps = 29/448 (6%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  P+L LAN LA+ GHR++ LLP  A  +L+H NL+P  I F  LTI
Sbjct  5     FHAFMFPWFAFGHMTPYLHLANKLAENGHRVTFLLPKKAQKQLEHHNLFPDNIVFHPLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  ++L   L  A+D  +D+V+A +  + +P+L+F+DFAYW+PE+ 
Sbjct  65    PHVDGLPTGAETASDIPISLGKFLTAAMDLTRDQVEAAVCAL-RPDLIFFDFAYWVPEVA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + V S    A  L+     G             PPG+PS SKVV RE +A+
Sbjct  124   KEHRVKSVLYFVVSANSIAHELVPGSELGVS-----------PPGYPS-SKVVYREQDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F ++   R+  + R+   L  C+ I+ R C E+EG +C+YI ++  + V   GP+L
Sbjct  172   ALFSF-SMFFERL--YHRITTGLMNCNFISVRTCKEVEGKFCDYIESQYQRKVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PE    + LED+ + WL +FEP SVI+CA GS++ L K+QF +L LG ELTGLPFLVAVK
Sbjct  229   PEQDNSKALEDRWSHWLNQFEPGSVIYCALGSQIKLEKDQFQELCLGTELTGLPFLVAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ S +I++ALPEGF+ER K + +V G WV Q +IL H +VG FVNH G GSMWESL S
Sbjct  289   PPKGSETIQEALPEGFEERVKNRGVVWGEWVQQPLILAHPSVGCFVNHCGFGSMWESLVS  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGENIQKVN  1572
              C+I++ P     Y  +  L    +   +E  +        ++      S +G  +++ N
Sbjct  349   DCQIVLLP-----YLCDQVLNTRLMTEELEDGSRRRASVMDKD------SEVGGRVRR-N  396

Query  1573  HKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             H + +++L++PG    Y D F+  L  L
Sbjct  397   HTRMKEILVSPGLLTGYTDKFVETLQNL  424



>ref|XP_003596671.1| Anthocyanidin 3-O-glucosyltransferase [Medicago truncatula]
 gb|AES66922.1| UDP-glucosyltransferase family protein [Medicago truncatula]
 gb|AFK38670.1| unknown [Medicago truncatula]
Length=458

 Score =   297 bits (760),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 195/461 (42%), Positives = 289/461 (63%), Gaps = 24/461 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAMFPW A GHF P+L L+N LAK+GH+IS  +P     KL+H+NL P LITF  L +
Sbjct  7     LHIAMFPWFAMGHFTPYLHLSNKLAKKGHKISFFIPKKTQTKLQHLNLNPNLITFYPLNV  66

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P ++GLP GAET++D   +L   +  A+D  + +++ +L ++  P +VF+DF YW+P L 
Sbjct  67    PHIDGLPDGAETSSDVPFSLVPLIATAMDQTEKQIEHLLKEL-NPQIVFFDFQYWLPNLT  125

Query  673   SEMGCKTVKFTVFSP-TISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
              ++G K++++ + SP +IS        S+GKG  +T  D+ +PP G+P D  + L +HE 
Sbjct  126   QKLGIKSLQYWITSPFSISYFWNGPRHSQGKG--LTVDDLKKPPSGYP-DGSIKLYQHEL  182

Query  850   YQVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
                 +FL+  R     + + ++DR+       DAI F+ C E++  Y  ++    GKP  
Sbjct  183   ----QFLSSTRKLVFGSGVFLYDRLHIGTSLADAIGFKGCKELDEPYAEFLGNFYGKPYL  238

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              +GPLLPE P+     +K   WL+ F+P SV+FCA+GSE  L K QF +LLLGLELTG P
Sbjct  239   LSGPLLPETPKTTLD-EKWESWLKGFKPGSVVFCAYGSEGPLEKNQFQELLLGLELTGFP  297

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             FL A+KPP    SIE+ALPEGF ER KGK IV+G W+ Q +IL H +VG F+ H G+ S+
Sbjct  298   FLAALKPPNGFESIEEALPEGFNERVKGKGIVYGSWIQQQLILEHPSVGCFITHCGAASI  357

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVM-  1548
              E+L + C++++ P    D+ +NAR+M+E+++  VEV+  DE+  F KE++C A+K VM 
Sbjct  358   TEALVNTCQLVLLPRVGVDHIMNARMMSEKMKVGVEVEKGDEDGLFTKESVCEAVKIVMD  417

Query  1549  -----GENIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  G  ++K NH + R  LL+     + +D+F  KL  L
Sbjct  418   DENKVGREVRK-NHSELRKFLLSENLESSCVDNFCEKLQGL  457



>ref|XP_002888295.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64554.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=451

 Score =   296 bits (757),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 200/457 (44%), Positives = 276/457 (60%), Gaps = 27/457 (6%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             +H  MFPW AFGH  P+L LAN   ++GHR++ LLP  A  +L H NL+P  I F  LTI
Sbjct  5     IHAFMFPWFAFGHMTPYLHLANSTQQKGHRVTFLLPKKAQKQLGHQNLFPHGIVFHPLTI  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  ++L   L +A+D  +D+V+A +L + +P+L+ +D A WIPE+ 
Sbjct  65    PHVDGLPAGAETASDIPISLVKFLSIAMDLTRDQVEAAILAL-RPDLILFDLAQWIPEMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
                  K++ + V S T  A  L           V   ++  PPPG+PS SK +  +H+A+
Sbjct  124   KAHKVKSMLYNVMSATSIAHDL-----------VPGGELGVPPPGYPS-SKALYHKHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F    +     + R+   L  CD I+ R C E+EG +C+YI  +  K V   GP+L
Sbjct  172   ALLTFSGFYKR---FYHRLTTGLMNCDFISIRTCKEIEGKFCDYIERQYEKKVLLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             PEP + +PLED+ + WL  F   SV+FCA GS+  L K QF +L LG+ELTGLPFLVAVK
Sbjct  229   PEPDKSKPLEDQWSHWLSGFRQGSVLFCALGSQTTLEKNQFQELCLGIELTGLPFLVAVK  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVP----QSMILRHKAVGYFVNHGGSGSMWE  1380
             PP+ + +I++ALPEGF+ER  G+ +V G WV     Q +IL H +VG FV+H G GSMWE
Sbjct  289   PPKGTKTIQEALPEGFEERVTGRGMVWGEWVQQPYWQPLILAHPSVGCFVSHCGFGSMWE  348

Query  1381  SLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE--  1554
             SL S C+I+   P  +D  L  RL+ EELE +VEVQ +E   F KENL  AI S+M +  
Sbjct  349   SLMSDCQIVFI-PVLNDQVLTTRLLTEELEVSVEVQREETGWFSKENLSGAIMSLMDKDS  407

Query  1555  ---NIQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                N  + NH K ++ L +PG    Y D F+  L  L
Sbjct  408   EIGNQVRRNHSKLKETLGSPGLLTGYTDKFVDTLANL  444



>emb|CAN63798.1| hypothetical protein VITISV_026415 [Vitis vinifera]
Length=420

 Score =   295 bits (754),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 212/461 (46%), Positives = 282/461 (61%), Gaps = 52/461 (11%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M     LHIAM+PW AFGH IP+L L+N+LA+RGH I+ +LP     +L+H+NL+P LI+
Sbjct  3     MARSPKLHIAMYPWFAFGHMIPYLHLSNELAERGHSITFILPKKVQSQLQHLNLHPTLIS  62

Query  478   FCALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  LTIP V+GLPP AET +D  ++L   L  A+D                         
Sbjct  63    FHPLTIPHVDGLPPSAETASDVPISLHHLLAAAMD-------------------------  97

Query  655   WIPELVSEMGCKTVKFT-VFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVV  831
                        +T + T   S +  +  L+  +   K R +       PPPG+PS S VV
Sbjct  98    -----------RTTRLTNAVSASAFSYCLVLDQQISKSRPIPTG----PPPGYPS-STVV  141

Query  832   LREHEAYQVSRFLNLPRNR-ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
             LR HEA ++ +FL  P    IT  +R+  A+K CD ++ R C E+EG +C+YI    GKP
Sbjct  142   LRPHEA-RLLQFLLFPFGEDITFHERLTAAIKLCDVVSIRTCQEIEGPFCDYIERRFGKP  200

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             V+  GP+L EP    P  D+ A+WL  F+P SVIFCAFGS+   GK+QF +LLLG ELTG
Sbjct  201   VFVTGPVLVEPSPLAPE-DRWAQWLSGFKPGSVIFCAFGSQNFPGKDQFQELLLGFELTG  259

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
             LPFL A+KPP  +++IE+ALPEGFQER  G+ +V+GGWVPQ  IL H +VG FV+H G G
Sbjct  260   LPFLAALKPPLGAATIEEALPEGFQERVGGRGVVYGGWVPQPSILSHPSVGCFVSHCGFG  319

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVM  1548
             SMWESL S  +I++  P   D   NARL+AEEL+ AVEV+ +EN    KE LC AIKSVM
Sbjct  320   SMWESLMSDPQIVLV-PELFDQTXNARLLAEELKVAVEVEKEENGWVSKEGLCKAIKSVM  378

Query  1549  GEN-----IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              E      + K NH KW++ L++ GF  NYID+F+ +L +L
Sbjct  379   DEEGEVGCLVKKNHAKWKETLMSQGFMSNYIDNFVRQLLDL  419



>ref|XP_002888294.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64553.1| glycosyltransferase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=447

 Score =   295 bits (756),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 196/453 (43%), Positives = 280/453 (62%), Gaps = 23/453 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH  P+L LAN LA++GHR++ LLP  A  +L+H+NL+P  I F  LT+
Sbjct  5     FHAFMFPWFAFGHMTPYLHLANKLAEKGHRVTFLLPKKAQKQLEHLNLFPDSIVFHPLTM  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP GAET +D  M L   L  A+D  +D+V+A +  + +P+L+ +D A W+PE+ 
Sbjct  65    PHVDGLPAGAETFSDIPMPLWKFLPPAIDLTRDQVEAAVHAL-RPDLILFDLASWVPEMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K++ + + S T  A              V   ++  PPPG+PS SK++ R H+A+
Sbjct  124   KEYRVKSMLYNIISATSIAHDF-----------VPGGELGVPPPGYPS-SKLLYRRHDAH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              +  F ++   R +   R++  L  CD I+ R C E+EG +C YI  +  K V+  GP+L
Sbjct  172   ALLSF-SVYYKRFS--QRLITGLMNCDFISIRTCKEIEGKFCEYIERQYHKKVFLTGPML  228

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
             P   + +PLED+ + WL  F    V+FCA GS++ L K+QF +L LG+ELTGLPFLVAV 
Sbjct  229   PVLEKSKPLEDRWSHWLNGFGQGYVVFCALGSQISLEKDQFQELCLGIELTGLPFLVAVT  288

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP+ + +I++ALPEGF+ER K + +V G WV Q +IL H +VG FV+H G GSMWESL  
Sbjct  289   PPKGAKTIQEALPEGFEERVKDRGVVWGEWVQQPLILAHPSVGCFVSHCGFGSMWESLMG  348

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGE-----N  1557
              C+I++  P  +D  LN RLM EELE +VEVQ +E   F KE+L  AI SVM +     N
Sbjct  349   DCQIVLL-PFLADQVLNTRLMTEELEVSVEVQREETGWFSKESLSVAITSVMDQGSEIGN  407

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + + NH K +++ ++ G    Y D F+  L  L
Sbjct  408   LVRRNHSKLKEVFVSDGLLTGYTDKFVDTLENL  440



>ref|XP_003540019.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
 gb|KHN27788.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=455

 Score =   295 bits (756),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 193/461 (42%), Positives = 281/461 (61%), Gaps = 28/461 (6%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH  PFL LAN LAKRGH+IS  +P     KL+ +NL+P LITF  + +
Sbjct  8     LHIAMYPWFAMGHLTPFLHLANKLAKRGHKISFFIPRRTQAKLEDLNLHPNLITFVPINV  67

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFA-YWIPEL  669
             P V+GLP  AETT+D   +L   +  A+D  +  ++ +LL + KP++V +DF+ YW+P L
Sbjct  68    PHVDGLPYDAETTSDVPSSLFPLIATAMDLTEKNIELLLLDL-KPHIVLFDFSTYWLPNL  126

Query  670   VSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA  849
                +G K++++ + SP  + +  + S ++ +       D+ +PP GFP D  + L  HE 
Sbjct  127   ARRIGIKSLQYWIISP--ATVGYMASPARQR-----EDDMRKPPSGFP-DCSIKLHAHEV  178

Query  850   YQVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
                 RFL   R     N +  +DR+       DAI F+ C E+EG Y +Y+ T+ GKPV 
Sbjct  179   ----RFLAAARKLEFGNGVLFYDRISVGADLSDAIGFKGCREIEGPYVDYLETQFGKPVL  234

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
               GPL+PEP        K   WL +F+  SVI+ AFGSE  L + Q ++LLLGLELTG+P
Sbjct  235   LTGPLVPEPSNSTLDA-KWGEWLGRFKAGSVIYIAFGSEHSLQQNQLNELLLGLELTGMP  293

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             F  A+KPP    SIE ALP+GF+ER + + +V+GGWV Q +IL H +VG F+ H G  S+
Sbjct  294   FFAALKPPIEFESIEKALPKGFKERVQERGVVYGGWVQQQLILAHPSVGCFITHCGGASL  353

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMG  1551
              E+L + C++++ P   SD+ +NAR M  +L   VEV+  E D  F KE++C A+K+VM 
Sbjct  354   TEALVNRCQLVLLPRLGSDFIINARTMGGKLRVGVEVEKGEEDGLFTKESVCKAVKTVMD  413

Query  1552  ENIQKV------NHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             + I ++      NH K R LLL+  F  + +D+F H+L +L
Sbjct  414   DEIDQLGREVRANHNKVRSLLLSNNFETSCVDAFSHRLQDL  454



>ref|XP_011087015.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Sesamum indicum]
Length=452

 Score =   295 bits (756),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 194/462 (42%), Positives = 282/462 (61%), Gaps = 23/462 (5%)
 Frame = +1

Query  301   MEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITF  480
             M ++ L I M+PW A GH   FL +++  A++GH+I  +LPT    KL   NL+P LI F
Sbjct  1     MGENSLKIVMYPWFAMGHLTAFLHISDKFAEKGHKIFFILPTKTQSKLDQFNLHPNLIKF  60

Query  481   CALTIPQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
               +T+PQV+GLP G+ETTAD    +   L  A+D  +  ++  L ++ KP+ VF+DF +W
Sbjct  61    IPITVPQVDGLPDGSETTADVPFPMYSLLRHAMDLTEPVIEGFLREL-KPHFVFFDFTHW  119

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAAD-IMEPPPGFPSDSKVVL  834
             +P L   +G K+V +   SP   A            R   AAD  +EPPPGFP  S + L
Sbjct  120   LPALARRLGIKSVHYCTISPASVAYLF---------RDEPAADAFLEPPPGFPP-SAISL  169

Query  835   REHEAYQVSRFLNLPR--NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKP  1008
              +HEA  V    N+    N +    RV+ A + CDA+ F++CNEMEG +C ++  +  KP
Sbjct  170   HKHEARGVDWINNIKEFGNGMKFVQRVLMAAEECDAMCFKSCNEMEGRFCEFLEKKFKKP  229

Query  1009  VYCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltg  1188
             +  AGP+LPEPP      +K A+WL++F+  SVIFC+FGSE  L ++QF +L+LG ELTG
Sbjct  230   MILAGPVLPEPPTSMLD-EKWAKWLDQFKAKSVIFCSFGSEARLERDQFQELILGFELTG  288

Query  1189  lpflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSG  1368
              PFL A+KPP  + ++E+ALPEGF++R+  +  VHGGWV Q +IL H +VG FV H G G
Sbjct  289   FPFLAALKPPIGAETVEEALPEGFKKRSAERGAVHGGWVQQQLILSHPSVGCFVTHCGWG  348

Query  1369  SMWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSV  1545
             S+ E++ + C++++  P+  D  +NARLM  +L+  VEV+  DE+  F +E + N I+ V
Sbjct  349   SLSEAMVNECQLVLL-PHVGDQPINARLMGGDLKVGVEVEKGDEDGLFTREGVMNVIRLV  407

Query  1546  M--GENIQK---VNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             M  G  I K     H +WR+ LL  G   +Y D F+H+L  L
Sbjct  408   MEDGSEIGKEIRTKHAEWREFLLREGLESSYFDDFVHRLQRL  449



>ref|NP_192688.2| UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
 gb|AEE82757.1| UDP-glycosyltransferase 79B7 [Arabidopsis thaliana]
Length=417

 Score =   294 bits (752),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 192/452 (42%), Positives = 277/452 (61%), Gaps = 48/452 (11%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +L+H NL+P  I F  LT+
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTV  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT+D  ++LD  L  ALD  +D+V+A +  + +P+L+F+DFA WIP++ 
Sbjct  65    PPVNGLPAGAETTSDIPISLDNLLSKALDLTRDQVEAAVRAL-RPDLIFFDFAQWIPDMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + + S T  A + +     G             PPG+PS SKV+ RE++ +
Sbjct  124   KEHMIKSVSYIIVSATTIAHTHVPGGKLGVR-----------PPGYPS-SKVMFRENDVH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              ++  L++   R+  + ++   LK CD IA R C E+E         +  KP+       
Sbjct  172   ALAT-LSIFYKRL--YHQITTGLKSCDVIALRTCKEVE---------DTSKPL-------  212

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
                      E++   +L  F P SV+FC+ GS+V+L K+QF +L LG+ELTGLPFL+AVK
Sbjct  213   ---------EERWNHFLSGFAPKSVVFCSPGSQVILEKDQFQELCLGMELTGLPFLLAVK  263

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS++++ LPEGF+ER K + +V GGWV Q +IL H ++G FVNH G G++WESL S
Sbjct  264   PPRGSSTVQEGLPEGFEERVKDRGVVWGGWVQQPLILAHPSIGCFVNHCGPGTIWESLVS  323

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-----  1557
              C++++  P  SD  L  RLM EE E +VEV  ++   F KE+L NAIKSVM ++     
Sbjct  324   DCQMVLI-PFLSDQVLFTRLMTEEFEVSVEVPREKTGWFSKESLSNAIKSVMDKDSDIGK  382

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
             + + NH K +++L++PG    Y+D F+  L E
Sbjct  383   LVRSNHTKLKEILVSPGLLTGYVDHFVEGLQE  414



>ref|XP_008383670.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Malus domestica]
Length=471

 Score =   295 bits (756),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 193/461 (42%), Positives = 279/461 (61%), Gaps = 18/461 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH  P+L L+N LA+RGHRIS +         + +NL+P LI+F  +T+
Sbjct  10    LHIAMYPWFAMGHLTPYLHLSNKLAERGHRISFVPTKTQQKL-QALNLHPHLISFIPITV  68

Query  496   PQVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GL PGAETT D      SL + A+D  Q  +   + ++  P+ VF+DF  W+P+L+
Sbjct  69    PHVDGLLPGAETTNDVPFPSYSLLMTAMDLTQPAILQAICEL-NPDFVFFDFTPWLPKLL  127

Query  673   SEMGC--KTVKFTVFSPTISALSLITSKSKGKGRAV-TAADIMEP---PPGFPSDSKVVL  834
              ++G   K++ + + +P +        +     ++V T  D++     PP     S + L
Sbjct  128   RQLGTGIKSINYIIITPALVGYVRSPERKVLMEKSVLTEDDLINDLINPPPSFPPSSIKL  187

Query  835   REHEAYQVSRFLNLPRNRIT-VFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
               HEA  ++ FL       T + DR++ +L  CDA+AFR C EMEG YC+Y+ T+L KPV
Sbjct  188   PAHEARMLAPFLLKEFGSGTKLIDRLIISLNDCDAVAFRTCREMEGKYCDYLETQLRKPV  247

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
               AGP++PE P  E   +K A+WLE FE  SVI+CAFG+E VL  +Q  +LLLG ELTGL
Sbjct  248   LLAGPVVPETPTTELD-EKWAKWLESFEAKSVIYCAFGTECVLKIDQLQELLLGFELTGL  306

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PF  A+KPP    ++E ALPEGF+ R KG+ +V  GWV Q +IL+H +VG FV H G  S
Sbjct  307   PFFAALKPPMGVEAVESALPEGFEGRVKGRGVVSWGWVQQPLILKHPSVGCFVTHCGPSS  366

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM  1548
             + E L S C++++  PN +D    AR+M  +L   V+V+  E D  F KE +C A++ VM
Sbjct  367   LMEGLVSECQLVLL-PNVADQLAIARVMGRDLRVGVKVEKGEEDGVFTKEGVCKAVRDVM  425

Query  1549  GENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              E  +     + NH KWR+ L + G  ++Y+DSF+ KL+ L
Sbjct  426   DEESEVGKEVRRNHTKWREFLSSKGLENSYVDSFVEKLHAL  466



>ref|XP_004144610.1| PREDICTED: UDP-glycosyltransferase 79B1-like [Cucumis sativus]
 gb|KGN43443.1| hypothetical protein Csa_7G037470 [Cucumis sativus]
Length=477

 Score =   295 bits (755),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 196/456 (43%), Positives = 281/456 (62%), Gaps = 14/456 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH  PFL L+N LAK+GH+IS  +PT  L K + +NL+P LITF  + +
Sbjct  16    LHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPVIV  75

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT D    L   +  ++D  Q ++  +LLQ  KP+L+ +DF +W+P+L 
Sbjct  76    PHVHGLPHGAETTCDVPYPLHNLIMTSMDLTQPQI-TLLLQTLKPHLILFDFTHWLPKLA  134

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA-  849
             S++G K++ + V S  + A +L  S+   K   +T  D+M+PP G+PS S + L  HEA 
Sbjct  135   SQLGIKSIHYCVTSAAMIAYTLTPSRQFYKNE-LTEEDLMKPPVGYPS-STINLHPHEAR  192

Query  850   -YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
              +   R      + +  +DR   +   CDAI FR C+E+EG + NY+  E  KPV   G 
Sbjct  193   VFASKRKWKFGSD-VLFYDRQFVSFSDCDAIGFRTCHEIEGDFVNYLQFEFRKPVLLTGS  251

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
             +LPE    E LE+K   WL  F+  SV++CAFGSE  L  EQF +LL+G EL  +PFL A
Sbjct  252   VLPETLNPEALEEKWESWLLGFKEGSVVYCAFGSECTLQMEQFQELLMGFELLDMPFLAA  311

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP  + ++E ALPEGF +R  G+ +V+GGW+ Q  IL H +VG FV H GS S+ E+L
Sbjct  312   LKPPFGAETVEAALPEGFAKRVGGRGVVYGGWIQQERILEHPSVGCFVTHCGSNSLKEAL  371

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGENIQ  1563
              + C++++  P   D  +NAR+M   L   VEV+  + D +F KE++C A+K VM E+ +
Sbjct  372   VNKCQLVLL-PQVGDQIINARMMGNNLRVGVEVEKRQEDGWFTKESVCKAVKIVMDEDNE  430

Query  1564  -----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  + NH K RDLLL     ++YIDSF + + +L
Sbjct  431   IGKEVRTNHSKIRDLLLKKDLEESYIDSFSYNICDL  466



>ref|XP_010695817.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=452

 Score =   294 bits (753),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 194/461 (42%), Positives = 271/461 (59%), Gaps = 28/461 (6%)
 Frame = +1

Query  304   EDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFC  483
             E  +L +A +PW A GH   FL+LAN LA+RGH++S  LP N  LKL   N +P  +TF 
Sbjct  6     ESQVLKVAFYPWFALGHLTSFLRLANKLAERGHQVSYFLPKNTQLKLASQNHFPDHLTFI  65

Query  484   ALTIPQVEGLPPGAETTADTMNLDGS--LEVALDGLQDEVKAILLQMEKPNLVFYDFAYW  657
              +T+P V+GLPPGAETT D ++L G+  +  A+D  +D + A  L + KP+ VFYDFAYW
Sbjct  66    PITVPSVDGLPPGAETTND-VSLSGAHLIMAAMDMTRDTIDA-HLALLKPDFVFYDFAYW  123

Query  658   IPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLR  837
             +P+L  + G K+V +   +  I+  +L  S+  G             PP   S     +R
Sbjct  124   MPQLARKHGIKSVHY--ITGLIARYTLAISRITGAY-----------PPDL-SSPIFQMR  169

Query  838   EHEAYQVSRFLNLP--RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
              HE   +      P     +T+ +    + + CDA+  + C EMEG YC +    L KPV
Sbjct  170   AHEMKVMEHISEKPFAPGGVTLPEMFRISFEECDAVGVKTCKEMEGIYCEFAEKTLDKPV  229

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
               AGP++P+ P  +   D +  WL  F   +VIFCA GSE +L + QF  +LLGLELTG 
Sbjct  230   LLAGPVVPKLPSSKLD-DYVDAWLSTFGSGTVIFCALGSECILEQNQFQDILLGLELTGK  288

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL A+KPP+   S+E  LPEGF ER +G+ ++HGGWV Q +IL+H +VG F+ H G GS
Sbjct  289   PFLAALKPPKNCKSLESGLPEGFSERVRGRGMIHGGWVQQQLILQHPSVGCFITHCGVGS  348

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM  1548
             + E++ S C++++  P   D  +NAR M+ EL+  VEV++ E D FF +E LC A+  VM
Sbjct  349   LSEAMVSQCQVVLM-PQAVDQFMNARQMSLELKIGVEVESTETDGFFTREALCKAVSLVM  407

Query  1549  GENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
              E  +     K NH KWRD +LT G  D+YI SFI  L  L
Sbjct  408   DEQSEVAREVKANHAKWRDFILTEGLEDSYISSFIQSLQHL  448



>gb|AAO42032.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 192/452 (42%), Positives = 276/452 (61%), Gaps = 48/452 (11%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
              H  MFPW AFGH IPFL LAN LA++GHR++ LLP  A  +L+H NL+P  I F  LT+
Sbjct  5     FHAFMFPWFAFGHMIPFLHLANKLAEKGHRVTFLLPKKAQKQLEHHNLFPDSIVFHPLTV  64

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT+D  ++LD  L  ALD  +D+V+A +  + +P+L+F+DFA WIP++ 
Sbjct  65    PPVNGLPAGAETTSDIPISLDNLLSKALDLTRDQVEAAVRAL-RPDLIFFDFAQWIPDMA  123

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
              E   K+V + + S T  A + +     G             PPG+PS SKV+ RE++ +
Sbjct  124   KEHMIKSVSYIIVSATTIAHTHVPGGKLGVR-----------PPGYPS-SKVMFRENDVH  171

Query  853   QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGpll  1032
              ++  L++   R+  + ++   LK CD IA R C E+E         +  KP+       
Sbjct  172   ALAT-LSIFYKRL--YHQITTGLKSCDVIALRTCKEVE---------DTSKPL-------  212

Query  1033  peppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVAVK  1212
                      E++   +L  F P SV+FC+ GS+V+L K+QF +L LG+ELTGLPFL+AVK
Sbjct  213   ---------EERWNHFLSGFAPKSVVFCSPGSQVILEKDQFQELCLGMELTGLPFLLAVK  263

Query  1213  PPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESLAS  1392
             PP  SS++++ LPEGF+ER K + +V GGWV Q +IL H ++G FVNH G G++WESL S
Sbjct  264   PPRGSSTVQEGLPEGFEERVKDRGVVWGGWVQQPLILAHPSIGCFVNHCGPGTIWESLVS  323

Query  1393  HCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFFKENLCNAIKSVMGEN-----  1557
              C++++  P  SD  L  RLM EE E +VEV   +   F KE+L NAIKSVM ++     
Sbjct  324   DCQMVLI-PFLSDQVLFTRLMTEEFEVSVEVPRKKTGWFSKESLSNAIKSVMDKDSDIGK  382

Query  1558  IQKVNHKKWRDLLLTPGFADNYIDSFIHKLYE  1653
             + + NH K +++L++PG    Y+D F+  L E
Sbjct  383   LVRSNHTKLKEILVSPGLLTGYVDHFVEGLQE  414



>ref|XP_010093489.1| UDP-glycosyltransferase [Morus notabilis]
 gb|EXB54128.1| UDP-glycosyltransferase [Morus notabilis]
Length=458

 Score =   294 bits (752),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 196/459 (43%), Positives = 278/459 (61%), Gaps = 14/459 (3%)
 Frame = +1

Query  298   MMEDSMLHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLIT  477
             M   S LHIAM PW A GH   FL ++N LAK+GH+IS  +PT    K+ H NL+P LI+
Sbjct  1     MEAHSPLHIAMCPWFALGHITSFLHISNKLAKKGHKISFFIPTKTQSKVSHFNLFPHLIS  60

Query  478   FCALTIPQVEGLPPGAETTADTMN-LDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAY  654
             F  +TIP V+GLPPG+ETT D    L   +  A+D  + + + ILL   KP++VF+D A+
Sbjct  61    FVPITIPLVDGLPPGSETTNDVPRPLIPLIMTAMDRAEPDFE-ILLHDLKPDIVFFDSAH  119

Query  655   WIPELVSEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDS-KVV  831
             WIP+L   +  K+V +   S      +L  +   G+ +A   A+ M+PPPGFP  S K +
Sbjct  120   WIPKLARRLSIKSVFYITVSAVAIGFNLSRNMKLGESKATDVAEAMQPPPGFPDSSIKRL  179

Query  832   LREHEAYQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPV  1011
             L E   Y   R   L    + + DR+   ++ CDA+AF++C E+EG +  Y+   + KP+
Sbjct  180   LHEARDYIDLRSKPLGPTNMRIQDRIYVGVQDCDALAFKSCREIEGPFVEYLERLILKPL  239

Query  1012  YCAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltgl  1191
               AGP+LP  P      +K A WL  F+P +V++CAFGSE  L K+Q  +LLLGLEL+GL
Sbjct  240   LLAGPVLPVRPLSTLE-EKWANWLGGFKPCTVVYCAFGSETALRKDQLQELLLGLELSGL  298

Query  1192  pflVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGS  1371
             PFL A++PP   +++++ALPEGF+ER +G+ +VH GW+ Q ++L HK+VG FV H G GS
Sbjct  299   PFLAALRPPLEVATLKEALPEGFEERVRGRGVVHEGWIQQQLMLEHKSVGCFVTHCGWGS  358

Query  1372  MWESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVM  1548
             + E L + C +++  P   D  LNARLM   L+  VEV   E D  F +E++CNAI++VM
Sbjct  359   LVEGLLNGCELVMI-PQVGDQVLNARLMGNNLKVGVEVAKGEEDGLFTRESVCNAIRTVM  417

Query  1549  GENIQKV------NHKKWRDLLLTPGFADNYIDSFIHKL  1647
              EN  +V      N  K +D L      + YID F  KL
Sbjct  418   EENYSEVGREIRANRAKLQDQLFNKD--EEYIDEFSRKL  454



>ref|XP_003543300.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Glycine max]
 gb|KHN36712.1| UDP-glycosyltransferase 79B6 [Glycine soja]
Length=468

 Score =   294 bits (752),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 197/459 (43%), Positives = 275/459 (60%), Gaps = 20/459 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIA+FPW A GH  P L L+N LA+RGHRIS + P     KL+H+NL+P LITF  + +
Sbjct  9     LHIAIFPWFAMGHLTPSLHLSNKLAQRGHRISFIGPKKTQTKLQHLNLHPHLITFVPIKV  68

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP  AETT+D   +L   +  A+D  + +++ ILL+  KP +VF+DF +W+P L 
Sbjct  69    PHVNGLPHDAETTSDVPFSLFPLIAEAMDRTEKDIE-ILLRELKPQIVFFDFQHWLPNLT  127

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +G K+V + + +P +S         K KGR +T  D+M PP GFP DS +  + HE  
Sbjct  128   RRLGIKSVMYVIINP-LSTAYFANGPRKSKGRELTELDLMVPPQGFP-DSCIKFQPHEL-  184

Query  853   QVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                RFL   R     + + ++DR   A    DAI F+ C E++G Y  Y+ T  GKPV  
Sbjct  185   ---RFLVGVRKLEFGSGVLLYDRYHTAASMADAIGFKGCKEIDGPYAEYLETVYGKPVLL  241

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +GPLLPEPP       K   WL +F P SV+FCA+GSE  L + Q  +LLLGLELTG PF
Sbjct  242   SGPLLPEPPNTTLE-GKWVSWLGRFNPGSVVFCAYGSESRLPQNQLQELLLGLELTGFPF  300

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+KPP    SIE+ALPEGF+ER +G+ IV  GWV Q +IL H +VG F+ H G+ S+ 
Sbjct  301   LAALKPPNGFESIEEALPEGFRERVQGRGIVDEGWVQQQLILGHPSVGCFITHCGAASLT  360

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE  1554
             E+L + CR++  P   +D  +N R+ + +L   VE++  E D  F KE++C A+K VM +
Sbjct  361   EALVNKCRLVFLPHLGADQLINCRMFSRKLRVGVEIEKGEEDGLFTKESVCKAVKIVMDD  420

Query  1555  NIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
               +     + NH K R+ LL+       +D F   L++L
Sbjct  421   GNEVGREVRENHSKLRNFLLSDNVESECVDGFCKGLHDL  459



>ref|XP_004169305.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 79B1-like 
[Cucumis sativus]
Length=477

 Score =   292 bits (748),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 195/456 (43%), Positives = 279/456 (61%), Gaps = 14/456 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH  PFL L+N LAK+GH+IS  +PT  L K + +NL+P LITF  + +
Sbjct  16    LHIAMYPWFALGHLTPFLHLSNKLAKKGHKISFFIPTKTLPKFEPLNLFPNLITFIPVIV  75

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V GLP GAETT D    L   +  ++D  Q ++  +LLQ   P L+ +DF +W+P+L 
Sbjct  76    PHVHGLPHGAETTCDVPYPLHNLIMTSMDLTQPQI-TLLLQTLNPXLILFDFTHWLPKLA  134

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEA-  849
             S++G K++ + V S  + A +L  S+   K   +T  D+M+PP G+PS S + L  HEA 
Sbjct  135   SQLGIKSIHYCVTSAAMIAYTLTPSRQFYKNE-LTEEDLMKPPVGYPS-STINLHPHEAR  192

Query  850   -YQVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
              +   R      + +  +DR   +   CDAI FR C+E+EG + NY+  E  KPV   G 
Sbjct  193   VFASKRKWKFGSD-VLFYDRQFVSFSDCDAIGFRTCHEIEGDFVNYLQFEFRKPVLLTGS  251

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
             +LPE    E LE+K   WL  F+  SV++CAFGSE  L  EQF +LL+G EL  +PFL A
Sbjct  252   VLPETLNPEALEEKWESWLLGFKEGSVVYCAFGSECTLQMEQFQELLMGFELLDMPFLAA  311

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP  + ++E ALPEGF +R  G+ +V+GGW+ Q  IL H +VG FV H GS S+ E+L
Sbjct  312   LKPPFGAETVEAALPEGFAKRVGGRGVVYGGWIQQERILEHPSVGCFVTHCGSNSLKEAL  371

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGENIQ  1563
              + C++++  P   D  +NAR+M   L   VEV+  + D +F KE++C A+K VM E+ +
Sbjct  372   VNKCQLVLL-PQVGDQIINARMMGNNLRVGVEVEKRQEDGWFTKESVCKAVKIVMDEDNE  430

Query  1564  -----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  + NH K RDLLL     ++YIDSF + + +L
Sbjct  431   IGKEVRTNHSKIRDLLLKKDLEESYIDSFSYNICDL  466



>dbj|BAF75891.1| glucosyltransferase [Dianthus caryophyllus]
Length=461

 Score =   291 bits (746),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 196/459 (43%), Positives = 279/459 (61%), Gaps = 20/459 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PWLA GH   FL++ N LA+RGHRIS  LP    L+    N YP+LITF ++T+
Sbjct  9     LHIAMYPWLAMGHITSFLRIGNKLAERGHRISFFLPPKTQLRFTSQNHYPELITFISITL  68

Query  496   PQVEGLPPGAETTAD-TMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+G P  AETT D + +    L  A+D  +D ++A L+ + +PN VF+DF  W+PEL 
Sbjct  69    PPVDGFPAEAETTNDISAHARPLLMTAMDLTKDTIEAHLVDL-RPNFVFFDFTCWMPELA  127

Query  673   SEMGCKTVKFT----VFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLRE  840
              + G K + +     V +  I  LS+IT K    G+ +  A +M P P  PS   +  R 
Sbjct  128   HKHGIKPIYYMSALLVRAAYILHLSVITPK----GQPIKEAHLMSPLPLLPS-PHMTHRA  182

Query  841   HEAYQVSRFLNLP-RNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
             HEA  +    +L     +T+ DRV ++ + CDAI  + C EME  Y  ++  + GKPV  
Sbjct  183   HEARSLIEAFHLDFGGGLTLLDRVGKSSRECDAIGIKTCREMEEIYYEFVEKKYGKPVLT  242

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             AGP+LP+P   +   ++  +WL  F  + VI+CAFGSE  +    F +L+LGLELTG PF
Sbjct  243   AGPVLPDPISTKLD-ERFNKWLASFGFDQVIYCAFGSECTINLVAFQELVLGLELTGSPF  301

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+K P     IE ALPEGF ERTK + IV+GGWV Q +ILRH +VG FV H G+GS+ 
Sbjct  302   LAALKAPTGHDIIESALPEGFLERTKDRGIVYGGWVQQQLILRHPSVGCFVTHCGAGSLS  361

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE  1554
             E++ + C++++  P+  D  +NA++M+ EL   VEV+  + D FF +E++  A++SVM E
Sbjct  362   EAMVNKCQLVMI-PHAVDQFINAKMMSLELRVGVEVERRDEDGFFSREDVRKAVESVMDE  420

Query  1555  NI-----QKVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             N         NH KWR+ +L  G  ++YI  FI KLY+L
Sbjct  421   NSVLGKEVMANHAKWREFILKDGIEESYISGFIDKLYDL  459



>gb|KHN27960.1| UDP-glycosyltransferase 79B3 [Glycine soja]
Length=519

 Score =   292 bits (747),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 180/423 (43%), Positives = 265/423 (63%), Gaps = 15/423 (4%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             +HIAMFPW A GHFIPFL L+N LAKRGH+IS   P     KL+H+NL+P  ITF  + +
Sbjct  8     MHIAMFPWFAMGHFIPFLHLSNKLAKRGHKISFFTPRRTQTKLQHLNLHPHHITFVPINV  67

Query  496   PQVEGLPPGAETTADT-MNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLP  AETT+D   +L   +  A+D  +  ++ +L ++ KP +VF+DF +W+P + 
Sbjct  68    PHVDGLPHDAETTSDVPSSLFPLIATAMDSTEKHIELLLREL-KPQIVFFDFQHWLPNIT  126

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAY  852
               +G K +++ + +P+  A  L     + +G  +T  D+M+PP GFP DS + L  HE  
Sbjct  127   RSLGIKCIQYWILNPSTIAY-LWNGPRQIQGGELTEVDLMKPPKGFP-DSSIKLHAHEL-  183

Query  853   QVSRFLNLPR-----NRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYC  1017
                RFL   R     + + ++DR+       DAI F+ C E++G Y +Y+     KPV  
Sbjct  184   ---RFLAATRKLEFGSGVFLYDRLGLGSSLADAIGFKGCREIDGTYADYLEIVYRKPVLF  240

Query  1018  AGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpf  1197
             +GP+LPEPP      +K   WLE F P SV+FCA+GSE  L + QF +LLLGLE  G PF
Sbjct  241   SGPILPEPPNSTLE-EKWVSWLEGFNPGSVVFCAYGSEGSLPENQFQELLLGLEQAGFPF  299

Query  1198  lVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMW  1377
             L A+KPP    SIE+A+P+GF ER +G+ IV  GWVPQ +IL H++VG F+ H G+ S+ 
Sbjct  300   LAALKPPNGFESIEEAMPKGFGERVQGRGIVDEGWVPQQLILGHRSVGCFITHCGAASVT  359

Query  1378  ESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDENDKFF-KENLCNAIKSVMGE  1554
             E+L + C+++  P   +D+ +NAR+ + +L+  VEV+  E D  F KE++C A+K+VM +
Sbjct  360   EALVNKCQLVFLPRLGADHIINARMFSRKLKVGVEVEKGEEDGLFTKESVCKAVKTVMED  419

Query  1555  NIQ  1563
               +
Sbjct  420   ETE  422



>ref|XP_011096374.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Sesamum indicum]
Length=461

 Score =   290 bits (741),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 184/456 (40%), Positives = 273/456 (60%), Gaps = 22/456 (5%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             L I M+P  A GH  P+L  AN LA+RGH++ +++P  +  KL+ +NL+P LI F  ++I
Sbjct  18    LTILMYPLFAMGHLTPYLLTANKLAQRGHKVFIVVPPKSQSKLRPLNLHPDLIQFKPISI  77

Query  496   PQVEGLPPGAETTADTMNLDGSLEVALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELVS  675
             P+VEGLPP  ETTAD   ++  L +    L       +L   +P+ VF+DF +W+P L  
Sbjct  78    PRVEGLPPDVETTADITIMEHDLLLHALDLTQPAIESMLSDLQPHFVFFDFMHWLPGLAR  137

Query  676   EMGCKTVKFTVFSPTISALSLITSKSKGKGRAVTAADIMEPPPGFPSDSKVVLREHEAYQ  855
              +  K+V ++  SP  +A+  + ++           D+M  PPGFP+  ++ L +H A Q
Sbjct  138   SLKIKSVYYSPASP--AAVGFLFAEGP------FVEDLMNGPPGFPT--RIRLYKHAALQ  187

Query  856   VSRFLNLPRNR---ITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVYCAGp  1026
             +  F N  + R   IT+  R +  +   DAI F  C E EG YC ++  +  KP+  AGP
Sbjct  188   LMWF-NAAKGRGSGITLRQRFMAGMWESDAIGFATCEETEGIYCQFLENKFDKPILLAGP  246

Query  1027  llpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglpflVA  1206
              + +        +K A WL KF+P SV+FCAFGSE VL K+QF QLLLGLELTGLPFL A
Sbjct  247   TVQKIQISSLE-EKWATWLGKFKPKSVVFCAFGSEAVLEKDQFEQLLLGLELTGLPFLAA  305

Query  1207  VKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSMWESL  1386
             +KPP    S+E+ALP GF+ER+  + +V+GGWVPQ +IL H  VG FV H G GS WE L
Sbjct  306   LKPPSGVDSVEEALPNGFKERSGERGVVYGGWVPQPLILNHPCVGCFVTHCGYGSSWEGL  365

Query  1387  ASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQT-DENDKFFKENLCNAIKSVMGENIQ  1563
              S C++++    + D  ++A+L++ +L   VE++  DE+ +F +E +  AI   MG+  +
Sbjct  366   MSECQLVLL-SQQGDQYVDAKLLSGDLGVGVEIEKGDEDGRFTREAVSGAIMGAMGDQSE  424

Query  1564  -----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
                  +  H +WR+LL   GF D+Y+D+F+ +L  L
Sbjct  425   VGKRVRAKHDEWRELLFGEGFQDSYLDNFVGRLSAL  460



>ref|XP_009352834.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like 
[Pyrus x bretschneideri]
Length=471

 Score =   290 bits (741),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 193/460 (42%), Positives = 273/460 (59%), Gaps = 16/460 (3%)
 Frame = +1

Query  316   LHIAMFPWLAFGHFIPFLQLANDLAKRGHRISlllptnallklKHMNLYPQLITFCALTI  495
             LHIAM+PW A GH   +L L+N LA+RGHRIS  +PT    KL+ +NL+P LI+F  +T+
Sbjct  10    LHIAMYPWFAMGHLTSYLHLSNKLAERGHRISFFVPTKTQQKLQALNLHPHLISFIPITV  69

Query  496   PQVEGLPPGAETTADTMNLDGSLEV-ALDGLQDEVKAILLQMEKPNLVFYDFAYWIPELV  672
             P V+GLPPGAETT D      SL + A+D  Q  +  ++ ++  PN VF+DF  W+P+L+
Sbjct  70    PHVDGLPPGAETTNDVPFPSYSLLMDAMDLTQPAILQLICEL-NPNFVFFDFTPWLPKLL  128

Query  673   SEMGCKTVKFTVFSPTISALSLITSKSKG---KGRAVTAADIMEPPPGFPSDSKVVLREH  843
              ++G           + + +  + S  +    +   +T  D++      P        + 
Sbjct  129   RQLGTGIKSIYYIIISPAIVGYVRSPERKVLMEKSVLTEDDLINDLINPPPSFPPSSIKL  188

Query  844   EAY---QVSRFLNLPRNRITVFDRVVEALKRCDAIAFRACNEMEGHYCNYIATELGKPVY  1014
              AY    ++ FL          +R + +L  CDA AFR C EMEG YC+Y+ T+L KPV 
Sbjct  189   PAYGTRMLAPFLLKEFGSGKFIERQIISLNDCDAAAFRTCREMEGKYCDYLETQLRKPVL  248

Query  1015  CAGpllpeppreepleDKIARWLEKFEPNSVIFCAFGSEVVLGKEQFHQlllgleltglp  1194
              AGP++PE P  E   +K A+WLE+FE  SVI+CAFG+E VL  +QF +LLLG ELTGLP
Sbjct  249   LAGPVVPETPTAELD-EKWAKWLERFEAKSVIYCAFGTECVLKIDQFQELLLGFELTGLP  307

Query  1195  flVAVKPPERSSSIEDALPEGFQERTKGKAIVHGGWVPQSMILRHKAVGYFVNHGGSGSM  1374
             F  A+K P    +IE ALPEGF+ R KG+ +V  GWV Q ++L+H +VG FV H G  S+
Sbjct  308   FFAALKLPMGVEAIESALPEGFEGRVKGRGVVSWGWVQQPLMLKHPSVGCFVTHCGPSSL  367

Query  1375  WESLASHCRIIVAPPNRSDYalnarlmaeeleaaVEVQTDEND-KFFKENLCNAIKSVMG  1551
              E L S C++++  PN  D    AR+M  +L   VEV+  E D  F KE +C A++ VM 
Sbjct  368   MEGLVSECQLVLL-PNAVDQISLARVMGRDLRVGVEVEKGEEDGDFTKEGVCKAVRDVMD  426

Query  1552  ENIQ-----KVNHKKWRDLLLTPGFADNYIDSFIHKLYEL  1656
             E  +     + NH KWR+LL + G  ++YIDSF+ KL+ L
Sbjct  427   EESEVGKEVRRNHAKWRELLSSKGLENSYIDSFVEKLHAL  466



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5368531198704