BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25860_g1_i2 len=4323 path=[4335:0-185 4521:186-201 4537:202-226
1867:227-263 1904:264-293 1934:294-371 16657:372-385 16671:386-395
4729:396-407 2938:408-454 4786:455-474 4228:475-507 4838:508-509
4840:510-560 2204:561-562 3228:563-586 13150:587-622 3288:623-651
13214:652-704 16848:705-706 16850:707-720 5047:721-725 5052:726-732
5059:733-758 16887:759-764 16156:765-803 5129:804-840 16912:841-973
5296:974-1058 5381:1059-1102 5424:1103-1104 4334:1105-1139
345:1140-1163 17012:1164-1510 5820:1511-1525 5835:1526-1565
5875:1566-3062 3860:3063-4322]

Length=4323
                                                                      Score     E

ref|XP_009803731.1|  PREDICTED: cadmium/zinc-transporting ATPase ...   1001   0.0      
emb|CCQ77797.1|  heavy metal ATPase                                    1001   0.0      
ref|XP_009803733.1|  PREDICTED: cadmium/zinc-transporting ATPase ...   1000   0.0      
ref|XP_009803730.1|  PREDICTED: cadmium/zinc-transporting ATPase ...   1000   0.0      
ref|XP_006360252.1|  PREDICTED: cadmium/zinc-transporting ATPase ...   1000   0.0      
ref|XP_010323360.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    999   0.0      
ref|XP_004242843.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    999   0.0      
ref|XP_009605988.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    996   0.0      
ref|XP_009605987.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    996   0.0      
emb|CCW03242.1|  heavy metal ATPase                                     994   0.0      
ref|XP_011094082.1|  PREDICTED: putative inactive cadmium/zinc-tr...    965   0.0      
gb|EYU25729.1|  hypothetical protein MIMGU_mgv1a000994mg                955   0.0      
emb|CDP15634.1|  unnamed protein product                                952   0.0      
ref|XP_011077705.1|  PREDICTED: putative inactive cadmium/zinc-tr...    934   0.0      
ref|XP_010656780.1|  PREDICTED: putative inactive cadmium/zinc-tr...    924   0.0      
ref|XP_002886241.1|  hypothetical protein ARALYDRAFT_480822             921   0.0      
ref|XP_007014368.1|  Cadmium/zinc-transporting ATPase 3 isoform 1       917   0.0      
ref|XP_010447768.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    916   0.0      
gb|ACC68153.1|  Zn/Cd P(IB)-type ATPase                                 916   0.0      Arabidopsis halleri subsp. halleri
ref|XP_007014369.1|  Cadmium/zinc-transporting ATPase 3 isoform 2       915   0.0      
ref|XP_006381163.1|  hypothetical protein POPTR_0006s07650g             915   0.0      
ref|XP_011019985.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    915   0.0      
ref|XP_006381161.1|  hypothetical protein POPTR_0006s07650g             915   0.0      
gb|AID81883.1|  heavy metal ATPase transporter 2                        914   0.0      
ref|XP_006381162.1|  hypothetical protein POPTR_0006s07650g             914   0.0      
ref|XP_011019984.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    914   0.0      
gb|AAY29151.1|  P1B-type ATPase 4                                       914   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_006381160.1|  hypothetical protein POPTR_0006s07650g             913   0.0      
ref|XP_010438218.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    913   0.0      
ref|XP_006381159.1|  hypothetical protein POPTR_0006s07650g             913   0.0      
ref|XP_010433028.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    912   0.0      
ref|XP_006283079.1|  hypothetical protein CARUB_v10004075mg             912   0.0      
ref|XP_006283080.1|  hypothetical protein CARUB_v10004075mg             911   0.0      
ref|XP_006412749.1|  hypothetical protein EUTSA_v10024341mg             911   0.0      
ref|XP_009128090.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    910   0.0      
gb|ACC68152.1|  Zn/Cd P(IB)-type ATPase                                 908   0.0      Arabidopsis halleri subsp. halleri
emb|CBI40117.3|  unnamed protein product                                907   0.0      
ref|NP_194740.1|  cadmium/zinc-transporting ATPase HMA2                 907   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ABB29495.1|  P1B-type ATPase 4                                       906   0.0      Arabidopsis halleri
ref|XP_008223789.1|  PREDICTED: putative inactive cadmium/zinc-tr...    905   0.0      
gb|ADZ73050.1|  P1B-type ATPase 4-1                                     905   0.0      
gb|ACC68167.1|  Zn/Cd P(IB)-type ATPase                                 905   0.0      Arabidopsis halleri subsp. halleri
gb|KHG01286.1|  Cadmium/zinc-transporting ATPase 3 -like protein        905   0.0      
ref|XP_007213711.1|  hypothetical protein PRUPE_ppa000656mg             905   0.0      
gb|AAL14248.1|  putative heavy-metal transporter                        904   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011094148.1|  PREDICTED: putative inactive cadmium/zinc-tr...    904   0.0      
gb|ADZ73053.1|  P1B-type ATPase 4-2                                     904   0.0      
ref|XP_004296475.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    903   0.0      
ref|XP_010467746.1|  PREDICTED: putative cadmium/zinc-transportin...    903   0.0      
ref|XP_010548593.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    901   0.0      
gb|AFM38016.1|  heavy metal ATPase 4-2                                  901   0.0      
gb|KHF97510.1|  Cadmium/zinc-transporting ATPase 3 -like protein        901   0.0      
emb|CDY30170.1|  BnaA03g50000D                                          901   0.0      
gb|AFM38015.1|  heavy metal ATPase 4-1                                  901   0.0      
gb|AFM38014.1|  heavy metal ATPase 4-3                                  900   0.0      
gb|AFD32368.1|  HMA2 transporter                                        900   0.0      
gb|KDO61855.1|  hypothetical protein CISIN_1g001837mg                   900   0.0      
gb|AFM38010.1|  heavy metal ATPase 4-1                                  899   0.0      
gb|ADZ73051.1|  P1B-type ATPase 4-1                                     899   0.0      
gb|AFM38011.1|  heavy metal ATPase 4-2                                  898   0.0      
ref|XP_002867367.1|  predicted protein                                  898   0.0      
gb|AID81884.1|  heavy metal ATPase transporter 4                        897   0.0      
ref|XP_009137890.1|  PREDICTED: LOW QUALITY PROTEIN: cadmium/zinc...    895   0.0      
emb|CDY62400.1|  BnaC07g50890D                                          893   0.0      
gb|EYU38759.1|  hypothetical protein MIMGU_mgv1a026280mg                883   0.0      
gb|AFM38013.1|  heavy metal ATPase 4-2                                  897   0.0      
ref|XP_010489457.1|  PREDICTED: putative cadmium/zinc-transportin...    899   0.0      
gb|AAL84162.1|AF412407_1  putative heavy metal transporter              894   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_179501.1|  putative cadmium/zinc-transporting ATPase HMA4        894   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006474239.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    887   0.0      
ref|XP_010688419.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    891   0.0      
gb|KHN22672.1|  Cadmium/zinc-transporting ATPase 3                      889   0.0      
gb|AAS89468.1|  P1B-type heavy metal transporting ATPase                892   0.0      Noccaea caerulescens
ref|XP_006593523.1|  PREDICTED: putative cadmium/zinc-transportin...    889   0.0      
emb|CAD98808.1|  putative heavy metal transporting P-type ATPase        892   0.0      Noccaea caerulescens
gb|AFM38012.1|  heavy metal ATPase 4-1                                  891   0.0      
ref|XP_006296837.1|  hypothetical protein CARUB_v10012822mg             895   0.0      
gb|ADZ73052.1|  P1B-type ATPase 4-2                                     890   0.0      
gb|AFD32367.1|  HMA2 transporter                                        883   0.0      
gb|KDP46636.1|  hypothetical protein JCGZ_04570                         881   0.0      
gb|AFJ94635.1|  P1B-ATPase 4                                            890   0.0      
ref|XP_009344843.1|  PREDICTED: putative inactive cadmium/zinc-tr...    882   0.0      
ref|XP_010415052.1|  PREDICTED: putative cadmium/zinc-transportin...    891   0.0      
ref|XP_008451413.1|  PREDICTED: putative inactive cadmium/zinc-tr...    875   0.0      
ref|XP_008382647.1|  PREDICTED: putative inactive cadmium/zinc-tr...    879   0.0      
ref|XP_008451398.1|  PREDICTED: putative inactive cadmium/zinc-tr...    872   0.0      
ref|XP_004165203.1|  PREDICTED: LOW QUALITY PROTEIN: cadmium/zinc...    881   0.0      
emb|CDY51090.1|  BnaA07g36130D                                          878   0.0      
ref|NP_001288715.1|  cadmium/zinc-transporting ATPase HMA2-like         883   0.0      
ref|XP_008376270.1|  PREDICTED: putative inactive cadmium/zinc-tr...    875   0.0      
gb|AIJ19560.1|  heavy metal ATPase 3                                    867   0.0      
ref|XP_009102202.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    877   0.0      
ref|XP_008377888.1|  PREDICTED: putative inactive cadmium/zinc-tr...    868   0.0      
ref|XP_004507887.1|  PREDICTED: putative cadmium/zinc-transportin...    867   0.0      
ref|XP_010046956.1|  PREDICTED: putative inactive cadmium/zinc-tr...    867   0.0      
ref|XP_010046953.1|  PREDICTED: putative inactive cadmium/zinc-tr...    867   0.0      
ref|XP_002532236.1|  heavy metal cation transport atpase, putative      863   0.0      Ricinus communis
ref|XP_010277178.1|  PREDICTED: putative inactive cadmium/zinc-tr...    862   0.0      
emb|CDY36489.1|  BnaC03g48480D                                          867   0.0      
ref|XP_004148337.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    868   0.0      
gb|KCW80883.1|  hypothetical protein EUGRSUZ_C02245                     853   0.0      
ref|XP_010048588.1|  PREDICTED: putative inactive cadmium/zinc-tr...    855   0.0      
gb|KGN61164.1|  hypothetical protein Csa_2G060450                       851   0.0      
ref|XP_003550652.2|  PREDICTED: putative cadmium/zinc-transportin...    851   0.0      
gb|AES92266.2|  heavy metal transporting P-type ATPase, putative        859   0.0      
ref|XP_010048587.1|  PREDICTED: putative inactive cadmium/zinc-tr...    855   0.0      
gb|KHN17622.1|  Cadmium/zinc-transporting ATPase 3                      847   0.0      
emb|CDY08717.1|  BnaA06g25070D                                          871   0.0      
ref|XP_007154730.1|  hypothetical protein PHAVU_003G142700g             859   0.0      
ref|XP_004297538.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    842   0.0      
ref|XP_003610069.1|  Zn/Cd P(IB)-type ATPase                            850   0.0      
ref|XP_006303912.1|  hypothetical protein CARUB_v10008389mg             832   0.0      
gb|EPS72056.1|  hypothetical protein M569_02696                         829   0.0      
ref|XP_010110715.1|  Cadmium/zinc-transporting ATPase 3                 838   0.0      
emb|CAD89012.1|  putative cadmium/zinc-transporting ATPase 3            829   0.0      Arabidopsis halleri subsp. halleri
ref|XP_002867366.1|  predicted protein                                  825   0.0      
ref|XP_006431587.1|  hypothetical protein CICLE_v10000354mg             825   0.0      
ref|XP_006492557.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    824   0.0      
ref|NP_001289917.1|  cadmium/zinc-transporting ATPase HMA3-like         822   0.0      
ref|NP_001289919.1|  cadmium/zinc-transporting ATPase HMA3              822   0.0      
ref|XP_009137892.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    822   0.0      
sp|P0CW78.1|HMA3B_ARATH  RecName: Full=Cadmium/zinc-transporting ...    820   0.0      
gb|KFK29565.1|  hypothetical protein AALP_AA7G151300                    820   0.0      
ref|XP_010927214.1|  PREDICTED: putative inactive cadmium/zinc-tr...    825   0.0      
ref|XP_006412748.1|  hypothetical protein EUTSA_v10026996mg             814   0.0      
ref|XP_008798128.1|  PREDICTED: putative inactive cadmium/zinc-tr...    820   0.0      
ref|XP_008453702.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    829   0.0      
ref|XP_008354231.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    808   0.0      
gb|KHN45233.1|  Cadmium/zinc-transporting ATPase 3                      813   0.0      
ref|XP_009128077.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    808   0.0      
emb|CDX68627.1|  BnaC01g08260D                                          808   0.0      
emb|CDY28160.1|  BnaA01g06890D                                          808   0.0      
ref|XP_008360509.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    820   0.0      
ref|XP_003534884.1|  PREDICTED: putative cadmium/zinc-transportin...    811   0.0      
gb|AJF37114.1|  heavy metal ATPase                                      805   0.0      
gb|AET09961.1|  heavy metal atpase 3a                                   808   0.0      
ref|XP_009803734.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    796   0.0      
ref|XP_010050934.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    809   0.0      
gb|AJF37113.1|  heavy metal ATPase                                      801   0.0      
ref|XP_010227423.1|  PREDICTED: putative inactive cadmium/zinc-tr...    807   0.0      
ref|XP_010541195.1|  PREDICTED: LOW QUALITY PROTEIN: putative ina...    796   0.0      
ref|XP_006600491.1|  PREDICTED: putative cadmium/zinc-transportin...    795   0.0      
ref|XP_009150707.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    808   0.0      
ref|XP_007138820.1|  hypothetical protein PHAVU_009G240000g             796   0.0      
ref|XP_010677583.1|  PREDICTED: putative inactive cadmium/zinc-tr...    793   0.0      
gb|EAZ38178.1|  hypothetical protein OsJ_22530                          801   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ADL59568.1|  P1B-ATPase 2                                            798   0.0      
gb|AIA57685.1|  heavy metal transporting P1B-ATPase 2                   798   0.0      
ref|XP_009401554.1|  PREDICTED: putative inactive cadmium/zinc-tr...    794   0.0      
gb|EEC81261.1|  hypothetical protein OsI_24354                          800   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002438953.1|  hypothetical protein SORBIDRAFT_10g028920          800   0.0      Sorghum bicolor [broomcorn]
gb|AIA57684.1|  heavy metal transporting P1B-ATPase 2                   798   0.0      
gb|ADU53143.1|  P1B-ATPase heavy-metal transporter                      799   0.0      
gb|AIA57683.1|  heavy metal transporting P1B-ATPase 2                   794   0.0      
gb|ABF55693.1|  putative ATPase-like zinc transporter                   795   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_003594931.1|  Zn/Cd P(IB)-type ATPase                            787   0.0      
ref|XP_009415522.1|  PREDICTED: putative inactive cadmium/zinc-tr...    789   0.0      
ref|XP_004488108.1|  PREDICTED: putative cadmium/zinc-transportin...    787   0.0      
ref|XP_004487939.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    787   0.0      
gb|AFJ94191.1|  P1B-ATPase 2                                            793   0.0      
ref|XP_009402027.1|  PREDICTED: putative inactive cadmium/zinc-tr...    783   0.0      
ref|XP_006656442.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    791   0.0      
ref|XP_004488107.1|  PREDICTED: putative cadmium/zinc-transportin...    776   0.0      
ref|XP_004966112.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    783   0.0      
ref|XP_003636710.1|  Zn/Cd P(IB)-type ATPase                            771   0.0      
gb|ADG56570.1|  heavy metal transporter                                 775   0.0      
gb|EMS48900.1|  Cadmium/zinc-transporting ATPase 3                      771   0.0      
emb|CAB81005.1|  cadmium-transporting ATPase-like protein               759   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006492558.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    760   0.0      
emb|CDY69511.1|  BnaAnng30640D                                          750   0.0      
ref|XP_008644205.1|  PREDICTED: uncharacterized protein LOC100501...    762   0.0      
emb|CDX68625.1|  BnaC01g08280D                                          748   0.0      
ref|XP_010438219.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    746   0.0      
ref|XP_006850918.1|  hypothetical protein AMTR_s00025p00176690          749   0.0      
emb|CDY69827.1|  BnaAnng31630D                                          733   0.0      
pir||T00532  probable cadmium-transporting ATPase (EC 3.6.1.-) - ...    739   0.0   
ref|XP_010415068.1|  PREDICTED: putative cadmium/zinc-transportin...    743   0.0      
ref|XP_008382648.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    736   0.0      
gb|KEH37413.1|  heavy metal ATPase transporter                          728   0.0      
ref|XP_010415060.1|  PREDICTED: putative cadmium/zinc-transportin...    742   0.0      
gb|AIA57681.1|  heavy metal transporting P1B-ATPase 3                   717   0.0      
emb|CAB43847.1|  cadmium-transporting ATPase-like protein               711   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AIA57678.1|  heavy metal transporting P1B-ATPase 3                   714   0.0      
gb|AIA57682.1|  heavy metal transporting P1B-ATPase 3                   712   0.0      
ref|XP_008451420.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    697   0.0      
ref|XP_006853047.1|  hypothetical protein AMTR_s00038p00036580          707   0.0      
ref|XP_002459579.1|  hypothetical protein SORBIDRAFT_02g006950          709   0.0      Sorghum bicolor [broomcorn]
ref|XP_002894071.1|  hypothetical protein ARALYDRAFT_473917             709   0.0      
dbj|BAK00726.1|  predicted protein                                      702   0.0      
gb|AFP87422.1|  putative cadmium/zinc-transporting ATPase               694   0.0      
gb|AIA57675.1|  heavy metal transporting P1B-ATPase 3                   694   0.0      
ref|XP_008801401.1|  PREDICTED: putative inactive cadmium/zinc-tr...    674   0.0      
ref|XP_003561282.1|  PREDICTED: putative inactive cadmium/zinc-tr...    679   0.0      
ref|XP_008670003.1|  PREDICTED: putative inactive cadmium/zinc-tr...    682   0.0      
tpg|DAA39458.1|  TPA: hypothetical protein ZEAMMB73_904745              681   0.0      
ref|XP_008650804.1|  PREDICTED: uncharacterized protein LOC100191...    675   0.0      
ref|XP_004487940.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    664   0.0      
ref|XP_006303913.1|  hypothetical protein CARUB_v10008389mg             656   0.0      
ref|XP_004959104.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    666   0.0      
ref|XP_006431594.1|  hypothetical protein CICLE_v10003938mg             653   0.0      
ref|XP_006658417.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    662   0.0      
gb|AFW69330.1|  hypothetical protein ZEAMMB73_904472                    654   0.0      
gb|EAZ03300.1|  hypothetical protein OsI_25443                          652   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAL46411.1|  P-type ATPase                                          633   0.0      
ref|NP_001059240.2|  Os07g0232900                                       648   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ25745.1|  heavy metal transporter 3                              647   0.0      
dbj|BAJ23049.1|  cadmium selective transporter for low entry to s...    642   0.0      
gb|KEH37412.1|  heavy metal ATPase transporter                          630   0.0      
ref|NP_194741.2|  putative inactive cadmium/zinc-transporting ATP...    624   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002983485.1|  hypothetical protein SELMODRAFT_118425             633   0.0      
gb|KEH37414.1|  heavy metal ATPase transporter                          625   0.0      
ref|XP_002974006.1|  hypothetical protein SELMODRAFT_149298             627   0.0      
gb|EAZ39201.1|  hypothetical protein OsJ_23627                          632   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007138819.1|  hypothetical protein PHAVU_009G240000g             622   0.0      
ref|XP_002976118.1|  hypothetical protein SELMODRAFT_104244             624   0.0      
ref|XP_002968260.1|  hypothetical protein SELMODRAFT_89397              622   0.0      
ref|XP_002459578.1|  hypothetical protein SORBIDRAFT_02g006940          618   0.0      Sorghum bicolor [broomcorn]
ref|XP_001762170.1|  predicted protein                                  612   0.0      
ref|XP_001778390.1|  predicted protein                                  607   0.0      
tpg|DAA39460.1|  TPA: hypothetical protein ZEAMMB73_512198              605   0.0      
gb|ABK28660.1|  unknown                                                 589   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010919016.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    597   0.0      
ref|XP_008670004.1|  PREDICTED: putative inactive cadmium/zinc-tr...    604   0.0      
gb|AIG13052.1|  putative heavy metal transporting P1B-ATPase 2          594   0.0      
ref|XP_008808279.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    591   0.0      
gb|AIG13046.1|  putative heavy metal transporting P1B-ATPase 2          590   0.0      
ref|XP_008650805.1|  PREDICTED: uncharacterized protein LOC100191...    589   0.0      
ref|XP_009397553.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    589   0.0      
gb|EMT10353.1|  Putative cadmium/zinc-transporting ATPase 3             598   0.0      
ref|XP_006409084.1|  hypothetical protein EUTSA_v10022526mg             574   3e-179   
ref|XP_006453290.1|  hypothetical protein CICLE_v100073872mg            550   2e-178   
ref|XP_010110710.1|  Cadmium/zinc-transporting ATPase 3                 548   8e-178   
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           541   6e-174   
gb|EMS46115.1|  Cadmium/zinc-transporting ATPase 3                      543   2e-173   
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               537   3e-172   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           536   1e-171   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           534   6e-171   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               532   3e-170   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           529   5e-169   
ref|XP_006431591.1|  hypothetical protein CICLE_v10001150mg             524   2e-168   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               520   7e-166   
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               516   3e-164   
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               516   4e-164   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           516   4e-164   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               515   7e-164   
ref|XP_002970998.1|  hypothetical protein SELMODRAFT_60724              516   1e-161   
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           508   4e-161   
gb|EMT27081.1|  Putative cadmium/zinc-transporting ATPase 3             512   1e-159   
ref|XP_006366469.1|  PREDICTED: cytochrome P450 82A3-like               499   7e-159   
ref|XP_002962088.1|  hypothetical protein SELMODRAFT_60690              508   1e-158   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                500   4e-158   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           491   1e-154   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     488   6e-154   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           489   7e-154   
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           489   8e-154   
ref|XP_007017413.1|  Cytochrome P450                                    486   9e-153   
gb|KDP38429.1|  hypothetical protein JCGZ_04354                         484   2e-152   
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         485   2e-152   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    485   2e-152   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           485   4e-152   
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             483   8e-152   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           484   9e-152   
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           482   3e-151   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     483   3e-151   
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           480   9e-151   
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    481   1e-150   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             482   1e-150   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   480   1e-150   
ref|XP_002510311.1|  cytochrome P450, putative                          479   2e-150   Ricinus communis
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             480   2e-150   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           489   2e-150   
ref|XP_002510308.1|  cytochrome P450, putative                          479   3e-150   Ricinus communis
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               479   3e-150   
gb|KEH30993.1|  cytochrome P450 family protein                          479   4e-150   
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             479   5e-150   
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     477   6e-150   
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    478   7e-150   
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               478   9e-150   
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           478   1e-149   
ref|XP_007017415.1|  Cytochrome P450, putative                          477   2e-149   
ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           477   2e-149   
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               476   3e-149   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           477   3e-149   
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             476   3e-149   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           477   4e-149   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             476   5e-149   
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         476   5e-149   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             476   6e-149   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             475   7e-149   
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   475   9e-149   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               476   9e-149   
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               476   9e-149   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               475   1e-148   
gb|AGO03797.1|  cytochrome P450-like protein                            473   5e-148   
ref|XP_002510312.1|  cytochrome P450, putative                          473   5e-148   
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               473   8e-148   
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             473   1e-147   
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     472   2e-147   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           472   2e-147   
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   472   2e-147   
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               471   6e-147   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           471   7e-147   
ref|XP_010106079.1|  Cytochrome P450 82A3                               470   9e-147   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               469   1e-146   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     469   1e-146   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               468   3e-146   
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             468   4e-146   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           468   6e-146   
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             467   8e-146   
emb|CBI19611.3|  unnamed protein product                                481   9e-146   
gb|KHG26594.1|  Cytochrome P450                                         467   1e-145   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     475   1e-145   
emb|CBI40977.3|  unnamed protein product                                467   2e-145   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               467   2e-145   
gb|ABB20912.1|  P450 mono-oxygenase                                     466   3e-145   
ref|XP_004163704.1|  PREDICTED: cadmium/zinc-transporting ATPase ...    477   6e-145   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    465   8e-145   
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             462   9e-145   
emb|CAN74205.1|  hypothetical protein VITISV_031127                     464   1e-144   
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     468   2e-144   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               463   2e-144   
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           464   2e-144   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             464   2e-144   
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               463   2e-144   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         463   3e-144   
gb|KDP38430.1|  hypothetical protein JCGZ_04355                         463   3e-144   
dbj|BAF98469.1|  cytochrome P450                                        462   4e-144   
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             462   5e-144   
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     462   5e-144   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               462   7e-144   
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             462   7e-144   
ref|XP_002510313.1|  cytochrome P450, putative                          462   1e-143   
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               461   2e-143   
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             461   2e-143   
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         461   5e-143   
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               459   7e-143   
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             459   7e-143   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    467   8e-143   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             460   8e-143   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             459   1e-142   
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   459   1e-142   
ref|XP_010106080.1|  Cytochrome P450 82A3                               461   4e-142   
ref|XP_010092357.1|  Cytochrome P450 82A3                               457   5e-142   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               457   5e-142   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    456   7e-142   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               456   2e-141   
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             456   2e-141   
ref|XP_007017411.1|  Cytochrome P450, putative                          455   3e-141   
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    455   4e-141   
gb|KHN44000.1|  Cytochrome P450 82A4                                    454   4e-141   
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           454   5e-141   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                453   1e-140   
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           453   1e-140   
ref|XP_010106088.1|  Cytochrome P450 82A4                               453   2e-140   
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    453   2e-140   
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             453   2e-140   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            452   3e-140   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           451   5e-140   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               452   6e-140   
emb|CDP07595.1|  unnamed protein product                                464   6e-140   
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         451   6e-140   
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             451   7e-140   
gb|KHG24650.1|  Cytochrome P450 protein                                 451   8e-140   
ref|XP_010106082.1|  Cytochrome P450 82A3                               451   8e-140   
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    451   9e-140   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     451   1e-139   
gb|KHN13272.1|  Cytochrome P450 82A4                                    450   2e-139   
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           450   2e-139   
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               451   2e-139   
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             450   3e-139   
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             449   4e-139   
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             449   4e-139   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       449   5e-139   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               449   6e-139   
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               449   6e-139   
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           448   1e-138   
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           448   1e-138   
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           448   1e-138   
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               448   1e-138   
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               465   1e-138   
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             448   1e-138   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           448   1e-138   
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    447   2e-138   
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                447   3e-138   
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             447   3e-138   
gb|AII31759.1|  cytochrome P450 monooxygenase                           447   3e-138   
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               447   4e-138   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    446   6e-138   
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             446   7e-138   
gb|KHN22283.1|  Cytochrome P450 82C4                                    443   9e-138   
gb|KHG29695.1|  Cytochrome P450                                         446   9e-138   
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           445   1e-137   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   445   1e-137   
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               445   2e-137   
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               445   2e-137   
gb|AFE89626.1|  heavy metal ATPase 4                                    437   2e-137   
ref|XP_004147822.1|  PREDICTED: uncharacterized protein LOC101212976    462   2e-137   
gb|AII31758.1|  cytochrome P450 monooxygenase                           444   2e-137   
gb|KHN16363.1|  Cytochrome P450 82A4                                    444   3e-137   
gb|KHG29694.1|  Cytochrome P450                                         444   3e-137   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           444   4e-137   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             444   4e-137   
gb|KEH30997.1|  cytochrome P450 family protein                          443   5e-137   
ref|XP_007047111.1|  Cytochrome P450                                    444   7e-137   
ref|XP_008796321.1|  PREDICTED: cytochrome P450 CYP82D47-like           443   8e-137   
gb|KGN59915.1|  Cytochrome P450                                         443   8e-137   
gb|KHG01290.1|  Cytochrome P450                                         443   1e-136   
ref|XP_007151896.1|  hypothetical protein PHAVU_004G085000g             442   1e-136   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           443   1e-136   
ref|XP_007151149.1|  hypothetical protein PHAVU_004G022000g             443   2e-136   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   441   2e-136   
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           442   2e-136   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               458   2e-136   
emb|CBI19610.3|  unnamed protein product                                456   2e-136   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           442   3e-136   
gb|KDP38436.1|  hypothetical protein JCGZ_04361                         441   4e-136   
gb|AII31760.1|  cytochrome P450 monooxygenase                           441   4e-136   
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               441   6e-136   
ref|XP_002522370.1|  cytochrome P450, putative                          441   6e-136   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               441   7e-136   
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               441   7e-136   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               441   8e-136   
gb|AIG13049.1|  putative heavy metal transporting P1B-ATPase 2          438   8e-136   
ref|XP_009341185.1|  PREDICTED: cytochrome P450 CYP82D47-like           439   3e-135   
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               440   3e-135   
ref|XP_010089020.1|  Cytochrome P450 82A3                               438   3e-135   
gb|KHN34164.1|  Cytochrome P450 82A4                                    439   4e-135   
ref|XP_006432705.1|  hypothetical protein CICLE_v10001118mg             436   4e-135   
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           438   4e-135   
gb|AFW69329.1|  hypothetical protein ZEAMMB73_904472                    446   7e-135   
ref|XP_010106083.1|  Cytochrome P450 82A3                               438   8e-135   
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                437   1e-134   
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               437   1e-134   
ref|XP_003619137.1|  Cytochrome P450                                    437   2e-134   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    437   2e-134   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               437   2e-134   
gb|KHN36187.1|  Cytochrome P450 82A3                                    436   3e-134   
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    436   3e-134   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               436   4e-134   
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               436   5e-134   
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                435   9e-134   
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     434   1e-133   
ref|XP_010919967.1|  PREDICTED: cytochrome P450 CYP82D47-like           434   2e-133   
ref|XP_002510298.1|  cytochrome P450, putative                          434   2e-133   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             434   2e-133   
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           434   2e-133   
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               434   2e-133   
ref|XP_004293232.1|  PREDICTED: cytochrome P450 82A3-like               432   3e-133   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         433   3e-133   
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               434   3e-133   
ref|XP_004154898.1|  PREDICTED: cytochrome P450 82A3-like               432   3e-133   
gb|KHN19614.1|  Cytochrome P450 82A4                                    433   4e-133   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     433   4e-133   
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               433   5e-133   
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             433   5e-133   
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               433   5e-133   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             433   6e-133   
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           432   8e-133   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               432   9e-133   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             432   9e-133   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             432   1e-132   
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               432   1e-132   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               431   1e-132   
ref|XP_008355522.1|  PREDICTED: cytochrome P450 CYP82D47-like           432   2e-132   
ref|XP_004308852.1|  PREDICTED: cytochrome P450 82A3-like               429   2e-132   
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               431   2e-132   
gb|KHN42044.1|  Cytochrome P450 82A3                                    432   2e-132   
ref|XP_010686293.1|  PREDICTED: cytochrome P450 CYP82D47-like           431   2e-132   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    431   3e-132   
ref|XP_003554857.2|  PREDICTED: cytochrome P450 82A4-like               442   3e-132   
ref|XP_008355533.1|  PREDICTED: cytochrome P450 CYP82D47-like           431   4e-132   
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             431   4e-132   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               431   4e-132   
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                430   4e-132   
ref|XP_008464768.1|  PREDICTED: cytochrome P450 CYP82D47-like           431   4e-132   
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               430   5e-132   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           430   6e-132   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    430   6e-132   
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               430   7e-132   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                433   7e-132   
ref|XP_010106089.1|  Cytochrome P450 82C4                               430   7e-132   
emb|CBI32510.3|  unnamed protein product                                433   7e-132   
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     446   1e-131   
gb|AFK38862.1|  unknown                                                 429   1e-131   
gb|KHN22284.1|  Cytochrome P450 82A3                                    426   2e-131   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               429   2e-131   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           429   2e-131   
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             428   2e-131   
gb|KHN36186.1|  Cytochrome P450 82A3                                    429   2e-131   
gb|KHG07801.1|  Cytochrome P450                                         428   3e-131   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             428   3e-131   
ref|XP_007047112.1|  Cytochrome P450                                    434   3e-131   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    428   3e-131   
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               428   4e-131   
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               427   5e-131   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         429   5e-131   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   427   6e-131   
emb|CBI32505.3|  unnamed protein product                                443   6e-131   
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           427   8e-131   
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               427   8e-131   



>ref|XP_009803731.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3 isoform X2 [Nicotiana 
sylvestris]
Length=1403

 Score =  1001 bits (2587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/693 (73%), Positives = 590/693 (85%), Gaps = 3/693 (0%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEV L++KILK L+GV EVSV+VTTKTV+V+HD LLI+  QIV+ALN+
Sbjct  15    KSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDSLLISPQQIVKALNQ  74

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEASI+V GE N   K  PSP+A+  GILL LSFLKY +AP +WLA+AA   G  P++
Sbjct  75    ARLEASIRVKGEKN-YQKKWPSPFAIGSGILLGLSFLKYFFAPFQWLALAAVAVGIPPII  133

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              R VAA+RNLTLDINIL++I+V GSIVLHDYWEA TIVFLF   EWLESRASHKA AAMS
Sbjct  134   FRGVAAVRNLTLDINILVLIAVAGSIVLHDYWEAGTIVFLFAIAEWLESRASHKATAAMS  193

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SLVN+V   AVLAE+GE+++ ++VKV++ILAVKAGE IPIDG+VVEGEC+VDEKTLTGES
Sbjct  194   SLVNIVPPTAVLAESGEVVNVDEVKVNSILAVKAGETIPIDGVVVEGECDVDEKTLTGES  253

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F V KQ+DSTVWA T NLNGYIS+KTTA+AEDCAVARMA+LVE+AQ+ KS+ QR IDK A
Sbjct  254   FPVSKQRDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQNKKSKTQRYIDKCA  313

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAIVAISA LAI  +A++V NR+E Y LALV LVSACPCALVLSTPVAM CALS+A
Sbjct  314   KYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVLSTPVAMCCALSKA  373

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLLFKGAEYLE LAK+K++AFDKTGTIT+GEF V  F SL+DG + NTLL WVSSIE
Sbjct  374   ATSGLLFKGAEYLETLAKIKIMAFDKTGTITKGEFMVTEFKSLIDGFSLNTLLYWVSSIE  433

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKS HPMA A++DYAQS+SVEP P++VE FQNFPGEGI+G IDGMEIY+GN+KIS+RAGC
Sbjct  434   SKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEIYVGNRKISSRAGC  493

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             T+VPE + D  +GKS+ YIF+GSS AG+FSLSD CR G +EA+R+LK MGIKT MLTGD 
Sbjct  494   TTVPEIEGDSFKGKSVGYIFLGSSPAGIFSLSDVCRIGVKEAMRELKQMGIKTAMLTGDC  553

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
             YAAA HVQ+QLGGALDEF AELLPE+KA IIK FQK   T MIGDGLNDAPALATAD+GI
Sbjct  554   YAAANHVQDQLGGALDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDAPALATADIGI  613

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK++ N+++++ TKAAI+ALAIA
Sbjct  614   SMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIVENMIISVVTKAAIVALAIA  673

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             G+PLVWAAVL D GTCL+VI NS LLLRGG R 
Sbjct  674   GYPLVWAAVLADTGTCLLVILNSMLLLRGGTRR  706



>emb|CCQ77797.1| heavy metal ATPase [Nicotiana tabacum]
 emb|CCQ77798.1| heavy metal ATPase [Nicotiana tabacum]
Length=1403

 Score =  1001 bits (2587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/693 (73%), Positives = 590/693 (85%), Gaps = 3/693 (0%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEV L++KILK L+GV EVSV+VTTKTV+V+HD LLI+  QIV+ALN+
Sbjct  15    KSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDSLLISPQQIVKALNQ  74

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEASI+V GE N   K  PSP+A+  GILL LSFLKY +AP +WLA+AA   G  P++
Sbjct  75    ARLEASIRVKGEKN-YQKKWPSPFAIGSGILLGLSFLKYFFAPFQWLALAAVAVGIPPII  133

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              R VAA+RNLTLDINIL++I+V GSIVLHDYWEA TIVFLF   EWLESRASHKA AAMS
Sbjct  134   FRGVAAVRNLTLDINILVLIAVAGSIVLHDYWEAGTIVFLFAIAEWLESRASHKATAAMS  193

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SLVN+V   AVLAE+GE+++ ++VKV++ILAVKAGE IPIDG+VVEGEC+VDEKTLTGES
Sbjct  194   SLVNIVPPTAVLAESGEVVNVDEVKVNSILAVKAGETIPIDGVVVEGECDVDEKTLTGES  253

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F V KQ+DSTVWA T NLNGYIS+KTTA+AEDCAVARMA+LVE+AQ+ KS+ QR IDK A
Sbjct  254   FPVSKQRDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQNKKSKTQRYIDKCA  313

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAIVAISA LAI  +A++V NR+E Y LALV LVSACPCALVLSTPVAM CALS+A
Sbjct  314   KYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVLSTPVAMCCALSKA  373

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLLFKGAEYLE LAK+K++AFDKTGTIT+GEF V  F SL+DG + NTLL WVSSIE
Sbjct  374   ATSGLLFKGAEYLETLAKIKIMAFDKTGTITKGEFMVTEFKSLIDGFSLNTLLYWVSSIE  433

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKS HPMA A++DYAQS+SVEP P++VE FQNFPGEGI+G IDGMEIY+GN+KIS+RAGC
Sbjct  434   SKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEIYVGNRKISSRAGC  493

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             T+VPE + D  +GKS+ YIF+GSS AG+FSLSD CR G +EA+R+LK MGIKT MLTGD 
Sbjct  494   TTVPEIEGDSFKGKSVGYIFLGSSPAGIFSLSDVCRIGVKEAMRELKQMGIKTAMLTGDC  553

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
             YAAA HVQ+QLGGALDEF AELLPE+KA IIK FQK   T MIGDGLNDAPALATAD+GI
Sbjct  554   YAAANHVQDQLGGALDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDAPALATADIGI  613

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK++ N+++++ TKAAI+ALAIA
Sbjct  614   SMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIVENMIISVVTKAAIVALAIA  673

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             G+PLVWAAVL D GTCL+VI NS LLLRGG R 
Sbjct  674   GYPLVWAAVLADTGTCLLVILNSMLLLRGGTRR  706



>ref|XP_009803733.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3 isoform X3 [Nicotiana 
sylvestris]
Length=1366

 Score =  1000 bits (2586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/693 (73%), Positives = 590/693 (85%), Gaps = 3/693 (0%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEV L++KILK L+GV EVSV+VTTKTV+V+HD LLI+  QIV+ALN+
Sbjct  15    KSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDSLLISPQQIVKALNQ  74

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEASI+V GE N   K  PSP+A+  GILL LSFLKY +AP +WLA+AA   G  P++
Sbjct  75    ARLEASIRVKGEKN-YQKKWPSPFAIGSGILLGLSFLKYFFAPFQWLALAAVAVGIPPII  133

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              R VAA+RNLTLDINIL++I+V GSIVLHDYWEA TIVFLF   EWLESRASHKA AAMS
Sbjct  134   FRGVAAVRNLTLDINILVLIAVAGSIVLHDYWEAGTIVFLFAIAEWLESRASHKATAAMS  193

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SLVN+V   AVLAE+GE+++ ++VKV++ILAVKAGE IPIDG+VVEGEC+VDEKTLTGES
Sbjct  194   SLVNIVPPTAVLAESGEVVNVDEVKVNSILAVKAGETIPIDGVVVEGECDVDEKTLTGES  253

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F V KQ+DSTVWA T NLNGYIS+KTTA+AEDCAVARMA+LVE+AQ+ KS+ QR IDK A
Sbjct  254   FPVSKQRDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQNKKSKTQRYIDKCA  313

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAIVAISA LAI  +A++V NR+E Y LALV LVSACPCALVLSTPVAM CALS+A
Sbjct  314   KYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVLSTPVAMCCALSKA  373

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLLFKGAEYLE LAK+K++AFDKTGTIT+GEF V  F SL+DG + NTLL WVSSIE
Sbjct  374   ATSGLLFKGAEYLETLAKIKIMAFDKTGTITKGEFMVTEFKSLIDGFSLNTLLYWVSSIE  433

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKS HPMA A++DYAQS+SVEP P++VE FQNFPGEGI+G IDGMEIY+GN+KIS+RAGC
Sbjct  434   SKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEIYVGNRKISSRAGC  493

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             T+VPE + D  +GKS+ YIF+GSS AG+FSLSD CR G +EA+R+LK MGIKT MLTGD 
Sbjct  494   TTVPEIEGDSFKGKSVGYIFLGSSPAGIFSLSDVCRIGVKEAMRELKQMGIKTAMLTGDC  553

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
             YAAA HVQ+QLGGALDEF AELLPE+KA IIK FQK   T MIGDGLNDAPALATAD+GI
Sbjct  554   YAAANHVQDQLGGALDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDAPALATADIGI  613

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK++ N+++++ TKAAI+ALAIA
Sbjct  614   SMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIVENMIISVVTKAAIVALAIA  673

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             G+PLVWAAVL D GTCL+VI NS LLLRGG R 
Sbjct  674   GYPLVWAAVLADTGTCLLVILNSMLLLRGGTRR  706



>ref|XP_009803730.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3 isoform X1 [Nicotiana 
sylvestris]
Length=1408

 Score =  1000 bits (2586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/693 (73%), Positives = 590/693 (85%), Gaps = 3/693 (0%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEV L++KILK L+GV EVSV+VTTKTV+V+HD LLI+  QIV+ALN+
Sbjct  15    KSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDSLLISPQQIVKALNQ  74

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEASI+V GE N   K  PSP+A+  GILL LSFLKY +AP +WLA+AA   G  P++
Sbjct  75    ARLEASIRVKGEKN-YQKKWPSPFAIGSGILLGLSFLKYFFAPFQWLALAAVAVGIPPII  133

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              R VAA+RNLTLDINIL++I+V GSIVLHDYWEA TIVFLF   EWLESRASHKA AAMS
Sbjct  134   FRGVAAVRNLTLDINILVLIAVAGSIVLHDYWEAGTIVFLFAIAEWLESRASHKATAAMS  193

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SLVN+V   AVLAE+GE+++ ++VKV++ILAVKAGE IPIDG+VVEGEC+VDEKTLTGES
Sbjct  194   SLVNIVPPTAVLAESGEVVNVDEVKVNSILAVKAGETIPIDGVVVEGECDVDEKTLTGES  253

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F V KQ+DSTVWA T NLNGYIS+KTTA+AEDCAVARMA+LVE+AQ+ KS+ QR IDK A
Sbjct  254   FPVSKQRDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQNKKSKTQRYIDKCA  313

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAIVAISA LAI  +A++V NR+E Y LALV LVSACPCALVLSTPVAM CALS+A
Sbjct  314   KYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVLSTPVAMCCALSKA  373

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLLFKGAEYLE LAK+K++AFDKTGTIT+GEF V  F SL+DG + NTLL WVSSIE
Sbjct  374   ATSGLLFKGAEYLETLAKIKIMAFDKTGTITKGEFMVTEFKSLIDGFSLNTLLYWVSSIE  433

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKS HPMA A++DYAQS+SVEP P++VE FQNFPGEGI+G IDGMEIY+GN+KIS+RAGC
Sbjct  434   SKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEIYVGNRKISSRAGC  493

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             T+VPE + D  +GKS+ YIF+GSS AG+FSLSD CR G +EA+R+LK MGIKT MLTGD 
Sbjct  494   TTVPEIEGDSFKGKSVGYIFLGSSPAGIFSLSDVCRIGVKEAMRELKQMGIKTAMLTGDC  553

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
             YAAA HVQ+QLGGALDEF AELLPE+KA IIK FQK   T MIGDGLNDAPALATAD+GI
Sbjct  554   YAAANHVQDQLGGALDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDAPALATADIGI  613

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK++ N+++++ TKAAI+ALAIA
Sbjct  614   SMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIVENMIISVVTKAAIVALAIA  673

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             G+PLVWAAVL D GTCL+VI NS LLLRGG R 
Sbjct  674   GYPLVWAAVLADTGTCLLVILNSMLLLRGGTRR  706



>ref|XP_006360252.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Solanum 
tuberosum]
Length=1298

 Score =  1000 bits (2586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/696 (73%), Positives = 587/696 (84%), Gaps = 3/696 (0%)
 Frame = -1

Query  4314  NGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVR  4135
             N   KSYFDV+GICC SEV L++KILK LDGV EVSV+VTTKTV+V HD LLI+Q QIV+
Sbjct  12    NKLSKSYFDVLGICCTSEVVLVEKILKNLDGVKEVSVIVTTKTVIVTHDSLLISQQQIVK  71

Query  4134  ALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGS  3955
             ALN+A LEASI+V G  N   K  PSP+A+  GILL LSFLKY + PL+WLA+ A V G 
Sbjct  72    ALNQARLEASIRVKGLQN-YQKKWPSPFAIGSGILLALSFLKYFFLPLQWLALVAVVVGI  130

Query  3954  FPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAM  3775
              P++ R +AA+RN TLDINIL++I+V GSIVLHDYWEAATIVFLFT  EWLESRASHKA 
Sbjct  131   PPIIFRGIAAIRNFTLDINILVLIAVAGSIVLHDYWEAATIVFLFTIAEWLESRASHKAT  190

Query  3774  AAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTL  3595
             A MSSLVN+V   AVLAE GE+++ +QVK+++ILAVKAGE IPIDGIVVEGEC+VDEKTL
Sbjct  191   AVMSSLVNIVPPTAVLAENGEVVNVDQVKLNSILAVKAGETIPIDGIVVEGECDVDEKTL  250

Query  3594  TGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSI  3415
             TGESF V KQKDSTVWA T NLNGYIS+KTTA+AEDCAVARMAKLVE+AQ+ KS+ +R I
Sbjct  251   TGESFPVSKQKDSTVWAGTTNLNGYISVKTTALAEDCAVARMAKLVEDAQNKKSKTERYI  310

Query  3414  DKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCA  3241
             DK AKYYTPAIV I+A LA+  +A++V NR E Y LALV LVSACPCALVLSTPVAM CA
Sbjct  311   DKCAKYYTPAIVVIAAGLAVVPTALRVHNRKEWYRLALVALVSACPCALVLSTPVAMCCA  370

Query  3240  LSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWV  3061
             LS+AA  GLLFKGAEYLE LAK+K++AFDKTGTITRGEF V  F SL+DG++ NTLL WV
Sbjct  371   LSKAATSGLLFKGAEYLETLAKIKIMAFDKTGTITRGEFAVTEFRSLIDGLSLNTLLYWV  430

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             SSIESKS HPMA A++DYAQS+SVEP P++VE FQNF GEGIYG IDGMEIY+GN+KIS+
Sbjct  431   SSIESKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFTGEGIYGRIDGMEIYVGNRKISS  490

Query  2880  RAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
             RAGCT+VPE + D  EGKS+ YIF+GSS AG+F+LSD CRTG ++A+R+LK MGIKTVML
Sbjct  491   RAGCTTVPELEGDSIEGKSVGYIFLGSSPAGIFTLSDVCRTGVKDAMRELKQMGIKTVML  550

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATA  2521
             TGD YAAA HVQ+QLGGALDEF AELLPE+KA IIK FQK   T MIGDGLNDAPALATA
Sbjct  551   TGDCYAAANHVQDQLGGALDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDAPALATA  610

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             D+GISMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK+I N+++AI TK AI+A
Sbjct  611   DIGISMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIIENMIIAIGTKGAIVA  670

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             LAIAGHPLVWAAVL D GTCL+VI NS LLLRG  R
Sbjct  671   LAIAGHPLVWAAVLADAGTCLLVILNSMLLLRGATR  706



>ref|XP_010323360.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like isoform 
X1 [Solanum lycopersicum]
Length=1307

 Score =   999 bits (2584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/703 (73%), Positives = 585/703 (83%), Gaps = 6/703 (1%)
 Frame = -1

Query  4323  INN--NGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQ  4150
             INN  N   KSYFDV+GICC SEV L++KILK LDGV EVSV+VTTKTV+V HD LLI+Q
Sbjct  7     INNDINKLSKSYFDVLGICCTSEVVLVEKILKNLDGVREVSVIVTTKTVIVTHDALLISQ  66

Query  4149  HQIVRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAA  3970
              QIV+ALN+A LEASI+V G  N   K  PSP+A+  GILL LSFLKY Y PL+WLA+ A
Sbjct  67    QQIVKALNQARLEASIRVKGLQN-YQKKWPSPFAIGSGILLALSFLKYFYQPLQWLALVA  125

Query  3969  AVAGSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRA  3790
                G  P++ R +AA+RN TLDINIL++I+V GSIVLHDYWEAATIVFLFT  EWLESRA
Sbjct  126   VAVGIPPIIFRGIAAIRNFTLDINILVLIAVAGSIVLHDYWEAATIVFLFTIAEWLESRA  185

Query  3789  SHKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEV  3610
             SHKA A MSSLVN+V   AVLAE GE+++ +QVK++++LAVKAGE IPIDGIVVEGEC+V
Sbjct  186   SHKANAVMSSLVNIVPPTAVLAENGEVVNVDQVKLNSVLAVKAGETIPIDGIVVEGECDV  245

Query  3609  DEKTLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSR  3430
             DEKTLTGESF V KQKDSTVWA T NLNGYIS+KTTA+AEDCAVARMAKLVE+AQ+ KS+
Sbjct  246   DEKTLTGESFPVSKQKDSTVWAGTTNLNGYISVKTTALAEDCAVARMAKLVEDAQNKKSK  305

Query  3429  AQRSIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPV  3256
             A+R IDK AKYYTP IV I+A  AI  +A++V N  E Y LALV LVSACPCALVLSTPV
Sbjct  306   AERYIDKCAKYYTPVIVVIAAGFAIVPTALRVHNLKEWYRLALVALVSACPCALVLSTPV  365

Query  3255  AMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNT  3076
             AM CALS+AA  GLLFKGAEYLE LAK+K++AFDKTGTITRGEF V  F SL+DG++ NT
Sbjct  366   AMCCALSKAATSGLLFKGAEYLETLAKIKIMAFDKTGTITRGEFAVTEFRSLIDGLSLNT  425

Query  3075  LLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGN  2896
             LL WVSSIESKS HPMA A++DYAQS+SVEP P++VE FQNF GEGIYG IDGMEIY+GN
Sbjct  426   LLYWVSSIESKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFTGEGIYGRIDGMEIYVGN  485

Query  2895  KKISARAGCTSVPEFD-VDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMG  2719
             +KIS+RAGCT+VPE +  D  +GKS+ YIF+GSS AG+F LSD CRTG ++A+R+LK MG
Sbjct  486   RKISSRAGCTTVPEIEGGDSLQGKSVGYIFLGSSPAGLFRLSDVCRTGVKDAMRELKQMG  545

Query  2718  IKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDA  2539
             IKTVMLTGD YAAA HVQ+QL GALDEF AELLPE+KA IIK FQK   T MIGDGLNDA
Sbjct  546   IKTVMLTGDCYAAANHVQDQLHGALDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDA  605

Query  2538  PALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICT  2359
             PALATAD+GISMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK+I N+++AI T
Sbjct  606   PALATADIGISMGISGSALAKETGHVILMTNDIGRIPKAACLARRVRRKIIENMIIAIGT  665

Query  2358  KAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             K AI+ALAIAGHPLVWAAVL D GTCL+VI NS LLLRG  R 
Sbjct  666   KGAIVALAIAGHPLVWAAVLADAGTCLLVILNSMLLLRGATRR  708



>ref|XP_004242843.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like isoform 
X2 [Solanum lycopersicum]
Length=1302

 Score =   999 bits (2584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/703 (73%), Positives = 585/703 (83%), Gaps = 6/703 (1%)
 Frame = -1

Query  4323  INN--NGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQ  4150
             INN  N   KSYFDV+GICC SEV L++KILK LDGV EVSV+VTTKTV+V HD LLI+Q
Sbjct  7     INNDINKLSKSYFDVLGICCTSEVVLVEKILKNLDGVREVSVIVTTKTVIVTHDALLISQ  66

Query  4149  HQIVRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAA  3970
              QIV+ALN+A LEASI+V G  N   K  PSP+A+  GILL LSFLKY Y PL+WLA+ A
Sbjct  67    QQIVKALNQARLEASIRVKGLQN-YQKKWPSPFAIGSGILLALSFLKYFYQPLQWLALVA  125

Query  3969  AVAGSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRA  3790
                G  P++ R +AA+RN TLDINIL++I+V GSIVLHDYWEAATIVFLFT  EWLESRA
Sbjct  126   VAVGIPPIIFRGIAAIRNFTLDINILVLIAVAGSIVLHDYWEAATIVFLFTIAEWLESRA  185

Query  3789  SHKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEV  3610
             SHKA A MSSLVN+V   AVLAE GE+++ +QVK++++LAVKAGE IPIDGIVVEGEC+V
Sbjct  186   SHKANAVMSSLVNIVPPTAVLAENGEVVNVDQVKLNSVLAVKAGETIPIDGIVVEGECDV  245

Query  3609  DEKTLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSR  3430
             DEKTLTGESF V KQKDSTVWA T NLNGYIS+KTTA+AEDCAVARMAKLVE+AQ+ KS+
Sbjct  246   DEKTLTGESFPVSKQKDSTVWAGTTNLNGYISVKTTALAEDCAVARMAKLVEDAQNKKSK  305

Query  3429  AQRSIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPV  3256
             A+R IDK AKYYTP IV I+A  AI  +A++V N  E Y LALV LVSACPCALVLSTPV
Sbjct  306   AERYIDKCAKYYTPVIVVIAAGFAIVPTALRVHNLKEWYRLALVALVSACPCALVLSTPV  365

Query  3255  AMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNT  3076
             AM CALS+AA  GLLFKGAEYLE LAK+K++AFDKTGTITRGEF V  F SL+DG++ NT
Sbjct  366   AMCCALSKAATSGLLFKGAEYLETLAKIKIMAFDKTGTITRGEFAVTEFRSLIDGLSLNT  425

Query  3075  LLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGN  2896
             LL WVSSIESKS HPMA A++DYAQS+SVEP P++VE FQNF GEGIYG IDGMEIY+GN
Sbjct  426   LLYWVSSIESKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFTGEGIYGRIDGMEIYVGN  485

Query  2895  KKISARAGCTSVPEFD-VDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMG  2719
             +KIS+RAGCT+VPE +  D  +GKS+ YIF+GSS AG+F LSD CRTG ++A+R+LK MG
Sbjct  486   RKISSRAGCTTVPEIEGGDSLQGKSVGYIFLGSSPAGLFRLSDVCRTGVKDAMRELKQMG  545

Query  2718  IKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDA  2539
             IKTVMLTGD YAAA HVQ+QL GALDEF AELLPE+KA IIK FQK   T MIGDGLNDA
Sbjct  546   IKTVMLTGDCYAAANHVQDQLHGALDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDA  605

Query  2538  PALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICT  2359
             PALATAD+GISMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK+I N+++AI T
Sbjct  606   PALATADIGISMGISGSALAKETGHVILMTNDIGRIPKAACLARRVRRKIIENMIIAIGT  665

Query  2358  KAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             K AI+ALAIAGHPLVWAAVL D GTCL+VI NS LLLRG  R 
Sbjct  666   KGAIVALAIAGHPLVWAAVLADAGTCLLVILNSMLLLRGATRR  708



>ref|XP_009605988.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=1486

 Score =   996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/690 (73%), Positives = 588/690 (85%), Gaps = 3/690 (0%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEV L++KILK L+GV EVSV+VTTKTV+V+HD LLI+Q QIV+ALN+
Sbjct  15    KSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDSLLISQQQIVKALNQ  74

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEASI+V GE N   K  PSP+A+  GILL  SFLKY +AP +WLA+AA   G  P++
Sbjct  75    ARLEASIRVKGEKN-YQKKWPSPFAIGSGILLGFSFLKYFFAPFQWLALAAVAVGIPPII  133

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              R VAA+RNLTLDINIL++I+V GSIVLHDYWEA TIVFLFT  EWLESRASHKA AAMS
Sbjct  134   FRGVAAVRNLTLDINILVLIAVTGSIVLHDYWEAGTIVFLFTIAEWLESRASHKATAAMS  193

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SLVN+V   AVLAE+GE+++ ++VK+++ILAVKAGE IPIDG+V+EGEC+VDEKTLTGES
Sbjct  194   SLVNIVPPTAVLAESGEVVNVDEVKLNSILAVKAGETIPIDGVVMEGECDVDEKTLTGES  253

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F V KQ DSTVWA T NLNGYIS+KTTA+AEDCAVARMA+LVE+AQ+ KS+ QR IDK A
Sbjct  254   FPVSKQIDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQNKKSKTQRYIDKCA  313

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAIVAISA LAI  +A++V NR+E Y LALV LVSACPCALVLSTPVAM CALS+A
Sbjct  314   KYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVLSTPVAMCCALSKA  373

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLLFKGAEYLE LAK+K++AFDKTGTITRGEF V  F SL+DG+  NTLL WVSSIE
Sbjct  374   ATSGLLFKGAEYLETLAKIKIMAFDKTGTITRGEFMVTEFKSLVDGLGLNTLLYWVSSIE  433

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKS HPMA A++DYAQS+SVEP P++VE FQNFPGEGI+G IDGMEIY+GN+KIS+RAGC
Sbjct  434   SKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEIYVGNRKISSRAGC  493

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             T+VPE + D  +GKS+ YIF+GSS AG+FSLSD CR G +EA+R+LK MGIKT MLTGD 
Sbjct  494   TTVPEIEGDSFQGKSVGYIFLGSSPAGIFSLSDVCRIGVKEAMRELKQMGIKTAMLTGDC  553

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
             YAAA HVQ+QLGGA+DEF AELLPE+KA IIK FQK   T MIGDGLNDAPALATAD+GI
Sbjct  554   YAAANHVQDQLGGAMDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDAPALATADIGI  613

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK++ N+++++ TKAAI+ALAIA
Sbjct  614   SMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIVENMIISVVTKAAIVALAIA  673

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGG  2239
             G+PLVWAAVL D GTCL+VI NS LLLR G
Sbjct  674   GYPLVWAAVLADTGTCLLVILNSMLLLRVG  703



>ref|XP_009605987.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like isoform 
X1 [Nicotiana tomentosiformis]
Length=1491

 Score =   996 bits (2574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/690 (73%), Positives = 588/690 (85%), Gaps = 3/690 (0%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEV L++KILK L+GV EVSV+VTTKTV+V+HD LLI+Q QIV+ALN+
Sbjct  15    KSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDSLLISQQQIVKALNQ  74

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEASI+V GE N   K  PSP+A+  GILL  SFLKY +AP +WLA+AA   G  P++
Sbjct  75    ARLEASIRVKGEKN-YQKKWPSPFAIGSGILLGFSFLKYFFAPFQWLALAAVAVGIPPII  133

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              R VAA+RNLTLDINIL++I+V GSIVLHDYWEA TIVFLFT  EWLESRASHKA AAMS
Sbjct  134   FRGVAAVRNLTLDINILVLIAVTGSIVLHDYWEAGTIVFLFTIAEWLESRASHKATAAMS  193

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SLVN+V   AVLAE+GE+++ ++VK+++ILAVKAGE IPIDG+V+EGEC+VDEKTLTGES
Sbjct  194   SLVNIVPPTAVLAESGEVVNVDEVKLNSILAVKAGETIPIDGVVMEGECDVDEKTLTGES  253

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F V KQ DSTVWA T NLNGYIS+KTTA+AEDCAVARMA+LVE+AQ+ KS+ QR IDK A
Sbjct  254   FPVSKQIDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQNKKSKTQRYIDKCA  313

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAIVAISA LAI  +A++V NR+E Y LALV LVSACPCALVLSTPVAM CALS+A
Sbjct  314   KYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVLSTPVAMCCALSKA  373

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLLFKGAEYLE LAK+K++AFDKTGTITRGEF V  F SL+DG+  NTLL WVSSIE
Sbjct  374   ATSGLLFKGAEYLETLAKIKIMAFDKTGTITRGEFMVTEFKSLVDGLGLNTLLYWVSSIE  433

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKS HPMA A++DYAQS+SVEP P++VE FQNFPGEGI+G IDGMEIY+GN+KIS+RAGC
Sbjct  434   SKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEIYVGNRKISSRAGC  493

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             T+VPE + D  +GKS+ YIF+GSS AG+FSLSD CR G +EA+R+LK MGIKT MLTGD 
Sbjct  494   TTVPEIEGDSFQGKSVGYIFLGSSPAGIFSLSDVCRIGVKEAMRELKQMGIKTAMLTGDC  553

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
             YAAA HVQ+QLGGA+DEF AELLPE+KA IIK FQK   T MIGDGLNDAPALATAD+GI
Sbjct  554   YAAANHVQDQLGGAMDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDAPALATADIGI  613

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK++ N+++++ TKAAI+ALAIA
Sbjct  614   SMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIVENMIISVVTKAAIVALAIA  673

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGG  2239
             G+PLVWAAVL D GTCL+VI NS LLLR G
Sbjct  674   GYPLVWAAVLADTGTCLLVILNSMLLLRVG  703



>emb|CCW03242.1| heavy metal ATPase [Nicotiana tabacum]
 emb|CCW03243.1| heavy metal ATPase, partial [Nicotiana tabacum]
Length=1444

 Score =   994 bits (2571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/690 (73%), Positives = 588/690 (85%), Gaps = 3/690 (0%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEV L++KILK L+GV EVSV+VTTKTV+V+HD LLI+Q QIV+ALN+
Sbjct  15    KSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDSLLISQQQIVKALNQ  74

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEASI+V GE N   K  PSP+A+  GILL LSFLKY +AP +WLA+AA   G  P++
Sbjct  75    ARLEASIRVKGEKN-YQKKWPSPFAIGSGILLGLSFLKYFFAPFQWLALAAVAVGIPPII  133

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              R VAA+RNLTLDINIL++I+V GSIVLHDYWEA TIVFLFT  EWLESRASHKA AAMS
Sbjct  134   FRGVAAVRNLTLDINILVLIAVTGSIVLHDYWEAGTIVFLFTIAEWLESRASHKATAAMS  193

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SLVN+V   AVLAE+GE+++ ++VK+++ILAVKAGE IPIDG+V+EGEC+VDEKTLTGES
Sbjct  194   SLVNIVPPTAVLAESGEVVNVDEVKLNSILAVKAGETIPIDGVVMEGECDVDEKTLTGES  253

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F V KQ DSTVWA T NLNGYIS+KTTA+AEDCAVARMA+LVE+AQ+ KS+ QR IDK A
Sbjct  254   FPVSKQIDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQNKKSKTQRYIDKCA  313

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAIVAISA LAI  +A++V NR+E Y LALV LVSACPCALVLSTPVAM CALS+A
Sbjct  314   KYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVLSTPVAMCCALSKA  373

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLLFKGAEYLE LAK+K++AFDKTGTITRGEF V  F SL+DG+  NTLL WVSSIE
Sbjct  374   ATSGLLFKGAEYLETLAKIKIMAFDKTGTITRGEFMVTEFKSLVDGLGLNTLLYWVSSIE  433

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKS HPMA A++DYAQS+SVEP P++VE FQNFPGEGI+G IDGMEIY+GN+KIS+RAGC
Sbjct  434   SKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEIYVGNRKISSRAGC  493

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             T+VPE + D  +GKS+ YIF+GSS AG+F LSD CR G +EA+R+LK MGIKT MLTGD 
Sbjct  494   TTVPEIEGDSFQGKSVGYIFLGSSPAGIFGLSDVCRIGVKEAMRELKQMGIKTAMLTGDC  553

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
             YAAA HVQ+QLGGA+DEF AELLPE+KA IIK FQK   T MIGDGLNDAPALATAD+GI
Sbjct  554   YAAANHVQDQLGGAMDEFQAELLPEDKATIIKGFQKEAPTAMIGDGLNDAPALATADIGI  613

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LA+ETGHVILMTNDIGRI KA  L RRV RK++ N+++++ TKAAI+ALAIA
Sbjct  614   SMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIVENMIISVVTKAAIVALAIA  673

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGG  2239
             G+PLVWAAVL D GTCL+VI NS LLLR G
Sbjct  674   GYPLVWAAVLADTGTCLLVILNSMLLLRVG  703



>ref|XP_011094082.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Sesamum indicum]
Length=929

 Score =   965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/690 (70%), Positives = 580/690 (84%), Gaps = 3/690 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SE+P+I++IL  LDGV + SV+V TKTV+VVHD LLI+Q QIV+ALN
Sbjct  13    QKSYFDVLGLCCSSEIPMIERILSSLDGVKDFSVIVPTKTVIVVHDSLLISQIQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+  GE N   K  PSPYAV+ G+LLLLSFLKYVY+PL WLA+ A   G  P+
Sbjct  73    QARLEANIRAYGEPNYKNKW-PSPYAVISGVLLLLSFLKYVYSPLGWLAIGAIAVGIIPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AV+A+RNLTLDINIL++I+V GSI LHDYWEAATIVFLFT  EWLESRASHKA A M
Sbjct  132   LLKAVSAVRNLTLDINILVLIAVSGSIALHDYWEAATIVFLFTIAEWLESRASHKATAVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSLVNVV QRAV+A+TGE ++A++VK++T+LAVKAGEVIPIDG+VVEG CEVDEK LTGE
Sbjct  192   SSLVNVVPQRAVMADTGEEINADEVKLNTVLAVKAGEVIPIDGVVVEGNCEVDEKFLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDS VWA+TINLNGYI++KTTAV EDC VARMAKLVE+AQ+ KSR QR IDK 
Sbjct  252   SFPVAKQKDSIVWASTINLNGYITVKTTAVTEDCVVARMAKLVEDAQNKKSRTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPAIV ISA LAI   A KVEN+ E YHL+LVVLVS CPCAL+LSTPVAMFCALS+
Sbjct  312   AKYYTPAIVVISAFLAIVPVAFKVENKKEWYHLSLVVLVSGCPCALLLSTPVAMFCALSK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA LG+LFKGAE+LE LA++K+ AFDKTGTITRGEF VA F SL D ++ NTLL W+SS+
Sbjct  372   AARLGVLFKGAEHLETLARIKITAFDKTGTITRGEFLVADFKSLQDNVSLNTLLYWISSV  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++D+A++  +EP PEKVE FQ FPGEGI G I+  +IY+GN K+++RAG
Sbjct  432   ESKSSHPMAAALVDFARAQGIEPTPEKVEKFQIFPGEGILGRIEDNDIYVGNWKVASRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             CT VP+ +    EGKS+ Y+F+G S AG+F LSDACRTGA+EA+++LK +GIKTVMLTGD
Sbjct  492   CTIVPKLEGYDVEGKSVGYVFLGPSPAGIFCLSDACRTGAKEALKELKSIGIKTVMLTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S  AA+H Q QLGGAL+  HAELLPE+K +IIK+ QK G T MIGDG+NDAPALATAD+G
Sbjct  552   SCTAAKHAQAQLGGALEVVHAELLPEDKERIIKELQKEGPTAMIGDGVNDAPALATADIG  611

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMG+SGS LA ETG V+LM+NDI RI KA+ + ++V RK++ N+V+AI TKAAI+ LAI
Sbjct  612   ISMGVSGSALATETGDVVLMSNDIQRIPKALRIAKKVRRKIVENVVIAISTKAAILGLAI  671

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VIFNS LLL+G
Sbjct  672   AGHPLVWAAVLTDVGTCLLVIFNSMLLLQG  701



>gb|EYU25729.1| hypothetical protein MIMGU_mgv1a000994mg [Erythranthe guttata]
Length=918

 Score =   955 bits (2469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/693 (69%), Positives = 580/693 (84%), Gaps = 4/693 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+KIL  LDGV   SV+V TKTVVVVHD LLI+Q QIV+ALN
Sbjct  17    QKSYFDVLGLCCTSEVPLIEKILNSLDGVKGFSVIVPTKTVVVVHDSLLISQIQIVKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+  GETN   K  PSPYA+ CG LLLLSFLKY Y PL+WLAVAA   G  PV
Sbjct  77    QARLEANIRAFGETNYKNKW-PSPYAIACGTLLLLSFLKYFYNPLRWLAVAAIAVGILPV  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A AA+RNLTLDINIL++I+V GS+ LHDYWEAATIVFLFT  EWLESRASHKA A M
Sbjct  136   LLKAFAAVRNLTLDINILVLIAVSGSLALHDYWEAATIVFLFTIAEWLESRASHKATAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSLVNVV QRAVLAETGE ++A++VK+ +ILAVKAGEVIPIDG+VV+G+CEVDEK LTGE
Sbjct  196   SSLVNVVPQRAVLAETGEEVNADEVKLGSILAVKAGEVIPIDGVVVDGKCEVDEKFLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKD  VWA+TINLNGYI++KTTA+ +DC VARMAKLVE++Q+NKS+ QR IDK 
Sbjct  256   SFPVAKQKDDVVWASTINLNGYITVKTTAITDDCVVARMAKLVEDSQNNKSKTQRVIDKC  315

Query  3405  AKYYTPAIVAISACLAISA--VKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY+PAI+ ISA LAI    + V++  + YHLALVVLVS CPC+L+LSTPVAMFCALS+
Sbjct  316   AKYYSPAILVISASLAIVPFLLHVQDTKKWYHLALVVLVSGCPCSLLLSTPVAMFCALSK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G+LFKGAE++E LA++K++AFDKTGTITRGEF V+ F SL D I+ +TLL W+SSI
Sbjct  376   AAGDGVLFKGAEHVETLARIKIMAFDKTGTITRGEFVVSDFRSLHDNISLDTLLYWISSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++D+A+SH+V+P  E+VE F+ FPGEGIYG I+  ++Y+GN KI+ RAG
Sbjct  436   ESKSSHPMAAALVDFARSHTVDPKSEQVEKFEIFPGEGIYGRIEDNDVYVGNWKIALRAG  495

Query  2871  C-TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
             C T+VP+ +    EGKS+ Y+FVG SL+G+F LSDACRTGA+EA+++LK MGIKTVMLTG
Sbjct  496   CSTAVPKLEGYNVEGKSIGYVFVGPSLSGIFCLSDACRTGAKEALKELKSMGIKTVMLTG  555

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             DSYAAA+H Q QLGG LDE HAELLPE+K +I+K+ QK G T MIGDG+NDAPAL T+D+
Sbjct  556   DSYAAAKHAQSQLGGGLDEVHAELLPEDKDRIVKELQKTGPTAMIGDGVNDAPALVTSDI  615

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMG++GS LA ETG V+LM+NDI RI KA +L R+V RK+I N+V++I TKAAI+ L 
Sbjct  616   GISMGVAGSALATETGDVVLMSNDIRRIPKAYKLARKVRRKIIENVVISISTKAAIIGLG  675

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             IAGHPLVWAAVL DVGTCL+VIFNS LLLRG D
Sbjct  676   IAGHPLVWAAVLADVGTCLLVIFNSMLLLRGVD  708



>emb|CDP15634.1| unnamed protein product [Coffea canephora]
Length=1102

 Score =   952 bits (2460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/690 (70%), Positives = 573/690 (83%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICCPSEVPLI+ ILK +DGV +VSV+V TKTV+V+HD +L +Q QIV+ALN
Sbjct  19    QKSYFDVLGICCPSEVPLIENILKSMDGVKDVSVIVPTKTVIVLHDSILTSQLQIVKALN  78

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEASI+V G  N   K  PSPYA+  G+LLLLSFLKY Y P  WLA+ +   G  P+
Sbjct  79    KARLEASIRVQG-VNSAQKKWPSPYAIASGVLLLLSFLKYFYYPFHWLALGSVAFGIIPI  137

Query  3945  LRRAVAALRNLTL-DINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
             + RA++ALRNLTL DINIL++I+V GSIVL DYWEAATIVFLFT  EWLES ASHKA AA
Sbjct  138   IFRALSALRNLTLGDINILLVITVAGSIVLRDYWEAATIVFLFTISEWLESLASHKATAA  197

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSL+N+V QRAVLAETGE +D N VKV+++LAVK GE+IPIDG+VVEG C+VDEKTLTG
Sbjct  198   MSSLLNLVPQRAVLAETGEEVDVNDVKVNSVLAVKGGEIIPIDGVVVEGNCDVDEKTLTG  257

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF   KQKDS VWA TIN+NGYISI+TT +AEDC VARM KLVEEAQ+NKSR QR I+K
Sbjct  258   ESFPAIKQKDSNVWAGTINVNGYISIRTTELAEDCVVARMTKLVEEAQNNKSRTQRFIEK  317

Query  3408  IAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYYTPAIV +SA LA+  ++++V N+ + YH+ALVVLVSACPCAL+LSTPVA+FCAL+
Sbjct  318   FAKYYTPAIVLMSAALAVIPASLRVHNQKQWYHIALVVLVSACPCALILSTPVAIFCALT  377

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  G+ FKGA+YLE LA VKV+AFDKTGT+TR EF V  F SLLD  + + +L WVSS
Sbjct  378   KAAKSGVFFKGADYLETLANVKVMAFDKTGTVTRAEFEVTEFRSLLDDCSLSNMLYWVSS  437

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IESKSSHPMA A++D AQSH VEP P+KVE FQ++PGEGIYG IDG EIYIGN KISARA
Sbjct  438   IESKSSHPMAAALVDLAQSHQVEPKPDKVEKFQDYPGEGIYGRIDGKEIYIGNSKISARA  497

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
             GC SVP+   +  EGKS+ YIFVGS+ AG+FSL+D CRTGA+EA+++LK  GIKTVMLTG
Sbjct  498   GCPSVPKLGGNIDEGKSVGYIFVGSTPAGIFSLADVCRTGAKEALKELKSAGIKTVMLTG  557

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             DSYAAARH Q+QLGGALD  HAELLP++KA+II+ +QK   T MIGDG+NDAPALATAD+
Sbjct  558   DSYAAARHAQDQLGGALDAVHAELLPQDKAKIIEDYQKLAYTAMIGDGINDAPALATADI  617

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LA ETGHVILMTNDI RI K   L RRV RK++ N+++++ TK +I+ALA
Sbjct  618   GISMGISGSALATETGHVILMTNDIRRIPKVARLARRVRRKILENMILSVATKGSIVALA  677

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             IAGHPLVWAAVL DVGTCL+VI NS LLLR
Sbjct  678   IAGHPLVWAAVLADVGTCLLVILNSMLLLR  707



>ref|XP_011077705.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Sesamum indicum]
Length=999

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/691 (68%), Positives = 571/691 (83%), Gaps = 3/691 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SE+P+I+KIL  LDG+ + SV++ TKT++VVHD LLI+Q QIV+ALN
Sbjct  52    QKSYFDVLGLCCSSEIPIIEKILASLDGIKDFSVVLPTKTLIVVHDSLLISQLQIVKALN  111

Query  4125  KASLEASIK-VNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFP  3949
             +A LEA+++ V G         PSPYAV  G LLLLSFLKYVY+P++WLAV A   G  P
Sbjct  112   QARLEANVRSVYGGGESYKNKWPSPYAVASGTLLLLSFLKYVYSPMRWLAVGAIAVGIPP  171

Query  3948  VLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
             V+ +AVAA+RN  LDINIL++I+V GSI L DYWEA TIVFLFT  EWLES+  + A A 
Sbjct  172   VVLKAVAAVRNFRLDINILVLITVAGSIALRDYWEAGTIVFLFTISEWLESKQMNLATAV  231

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSLV+VV QRAVLA+TGE +DA++VK++T+LAVKAGEVIPIDG+VVEG CEVDEKT+TG
Sbjct  232   MSSLVSVVPQRAVLADTGEEVDADEVKLNTVLAVKAGEVIPIDGVVVEGTCEVDEKTMTG  291

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF V KQKDSTVWA+TINLNGYISIKTTAVAEDC VARMAK+VEEAQ+ KSR QR +DK
Sbjct  292   ESFPVAKQKDSTVWASTINLNGYISIKTTAVAEDCVVARMAKIVEEAQNKKSRTQRFMDK  351

Query  3408  IAKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYYTPAIVAISA LAI   AV V N+ E YHLALVVLVS CPCAL+LSTPVAMFCAL+
Sbjct  352   CAKYYTPAIVAISAALAIVPLAVHVRNKKEWYHLALVVLVSGCPCALLLSTPVAMFCALT  411

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA LG+LFKGAE+LE LA++K++AFDKTGTITRGEF V  F SL D I+ NTLL W+SS
Sbjct  412   KAATLGVLFKGAEHLENLAQIKIMAFDKTGTITRGEFLVVDFKSLRDDISLNTLLYWISS  471

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             +E KSSHPMA A++++A++H+V P P++VE FQNFPGEGI G+I+  EIYIGN+KI++RA
Sbjct  472   VECKSSHPMAAALVEFARAHAVAPKPDRVEKFQNFPGEGICGKIEDNEIYIGNRKIASRA  531

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
             G T+VP  +    EGKS+ Y+F+GSS AG+F LSD CRTGA+EAI +LK +GIKTVMLTG
Sbjct  532   GSTAVPNLEGYDTEGKSVGYVFLGSSPAGIFYLSDMCRTGAKEAIEELKSVGIKTVMLTG  591

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             D + AA+  QEQLGGAL+  HAELLPE+KA IIK+ QK GRT MIGDGLNDAPALATAD+
Sbjct  592   DCHGAAKRAQEQLGGALEVVHAELLPEDKASIIKELQKEGRTAMIGDGLNDAPALATADI  651

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMG+SGS LA E+G ++LM+ND+ RI KA+ + + V  K+I N++V+I TK AI+ LA
Sbjct  652   GISMGVSGSALATESGDIVLMSNDMRRIPKALRIAKEVRWKIIQNVMVSISTKTAILVLA  711

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             ++GHPLVWAA+L DVGTCL+VI NS LLL+G
Sbjct  712   VSGHPLVWAALLADVGTCLLVILNSMLLLKG  742



>ref|XP_010656780.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Vitis vinifera]
Length=986

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/690 (67%), Positives = 575/690 (83%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+KILK LDGV E+SV+V ++T++VVHD LLI+Q QIV+ALN
Sbjct  7     QKSYFDVLGLCCSSEVPLIEKILKPLDGVKEISVIVPSRTLIVVHDNLLISQIQIVKALN  66

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA++++ GE     K  PSP+A+V GILLLLSFLKYVY P +WLA+ A  AG FP+
Sbjct  67    QARLEANVRIYGEVAY-QKKWPSPFAIVSGILLLLSFLKYVYQPFRWLALGAVAAGIFPI  125

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               R + A+RN TLDINIL++I+V+G+I L+DYWEA +IVFLFT  EWLESRASHKA A M
Sbjct  126   AWRGIVAIRNFTLDINILVLIAVIGTIALNDYWEAGSIVFLFTIAEWLESRASHKATAVM  185

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+A+TGEI++AN V VDTI+AVK GEVIPIDGIVVEG+CEVDEK+LTGE
Sbjct  186   SSLMSIAPQKAVIADTGEIVEANSVLVDTIIAVKTGEVIPIDGIVVEGKCEVDEKSLTGE  245

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDC VA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  246   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVVAKMAKLVEEAQNSKSKTQRFIDKC  305

Query  3405  AKYYTPAIVAISACLA--ISAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
              K+YTP +V ISA LA   +A++V + S  +HL+LVVLVSACPCAL+LSTPVA FCALS+
Sbjct  306   TKFYTPVVVLISAGLAGIPAALRVHDLSHWFHLSLVVLVSACPCALILSTPVATFCALSK  365

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG EYLEILAK++++AFDKTGTITRGEF V  F SL D ++ +TLL WVSSI
Sbjct  366   AAVSGLLIKGGEYLEILAKIRIMAFDKTGTITRGEFVVKDFQSLRDDVSSDTLLYWVSSI  425

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+ DY  S SVEP PE VE FQNFPGEGI+G+IDG +IY+GN+KI+ RAG
Sbjct  426   ESKSSHPMAAALFDYGLSQSVEPKPENVEEFQNFPGEGIHGKIDGKDIYVGNRKIALRAG  485

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP    D +EGK++ Y++  ++  G+F+LSDACRTG  EAI++LK++GIK+ MLTGD
Sbjct  486   CETVPTIGED-KEGKTIGYVYSDATPTGIFTLSDACRTGVVEAIKELKLLGIKSAMLTGD  544

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S+A+A H Q+QLG  L+  HAELLPE+KA+IIK F++ G T MIGDG+NDAPALATAD+G
Sbjct  545   SHASAMHTQDQLGHTLEVVHAELLPEDKARIIKDFKEEGPTAMIGDGVNDAPALATADIG  604

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGI+GS LA ETGHV+LMTNDI +I KA+ L R+  RKV+ N++++I TKAAI+ALAI
Sbjct  605   ISMGIAGSALATETGHVVLMTNDIRKIPKAVRLARKTHRKVVENVILSITTKAAILALAI  664

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPL+WAAVL DVGTCL+VIFNS LLLRG
Sbjct  665   AGHPLIWAAVLADVGTCLLVIFNSMLLLRG  694



>ref|XP_002886241.1| hypothetical protein ARALYDRAFT_480822 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62500.1| hypothetical protein ARALYDRAFT_480822 [Arabidopsis lyrata subsp. 
lyrata]
Length=1175

 Score =   921 bits (2381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/687 (65%), Positives = 568/687 (83%), Gaps = 3/687 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SEVP+I+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  19    SYFDVLGICCTSEVPIIENILKALDGVKEYSVIVPSRTVIVVHDSLLISPFQIGKALNQA  78

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA+++VNGETN   K  PSP+AVV GILLLLSFLK+VY+PL+WLAVAA  AG +P+L 
Sbjct  79    RLEANVRVNGETNFKNKW-PSPFAVVSGILLLLSFLKFVYSPLRWLAVAAVAAGIYPILA  137

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +A A++R L +DINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS+KA + M S
Sbjct  138   KAFASIRRLRIDINILVIITVIATLAMQDFMEAAAVVFLFTISDWLETRASYKANSVMQS  197

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+A++AETGE ++ ++VK+ T++AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  198   LMSLAPQKAIIAETGEEVEVDEVKISTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  257

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTVWA TINLNGYIS+KTT++A DC VA+MAKLVEEAQS+K+++QR IDK ++
Sbjct  258   PVPKQRDSTVWAGTINLNGYISVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKCSQ  317

Query  3399  YYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ +SAC+AI  V  KV N    +HLALVVLVS CPC L+LSTPVA FCAL++AA
Sbjct  318   YYTPAIIVVSACVAIVPVIMKVHNLKHWFHLALVVLVSGCPCGLILSTPVATFCALTKAA  377

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+ES
Sbjct  378   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDISLRSLLYWVSSVES  437

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEGIYG+IDG +IYIGNK+I++RAGC+
Sbjct  438   KSSHPMAATIVDYAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIYIGNKRIASRAGCS  497

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE ++D + GK++ Y++VG  LAGVF+LSDACR+G  +A+ +LK +GIKT MLTGDS 
Sbjct  498   TVPETEIDTKGGKTVGYVYVGERLAGVFNLSDACRSGVSQAMTELKSLGIKTAMLTGDSQ  557

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
             AAA H QEQLG  LD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+GIS
Sbjct  558   AAAMHAQEQLGNVLDVVHGELLPEDKSKIIQEFKKEGPTAMVGDGVNDAPALATADIGIS  617

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +A++L RR  RKV+ N+ ++I  KA I+ALA AG
Sbjct  618   MGISGSALATQTGHIILMSNDIRRIPQAVKLARRARRKVVENVFLSIVLKAGILALAFAG  677

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             HPL+WAAVLVDVGTCL+VI NS LLLR
Sbjct  678   HPLIWAAVLVDVGTCLLVILNSMLLLR  704



>ref|XP_007014368.1| Cadmium/zinc-transporting ATPase 3 isoform 1 [Theobroma cacao]
 gb|EOY31987.1| Cadmium/zinc-transporting ATPase 3 isoform 1 [Theobroma cacao]
Length=1058

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/699 (67%), Positives = 570/699 (82%), Gaps = 4/699 (1%)
 Frame = -1

Query  4317  NNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIV  4138
             N   +KSYFDV+GICC SEV  I+ ILK L+GV EVSV+V T+TV+V+HD LL++Q QIV
Sbjct  4     NKKLQKSYFDVLGICCSSEVAQIENILKSLEGVKEVSVIVPTRTVIVLHDNLLVSQLQIV  63

Query  4137  RALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             +ALN+A LEA+++  GE     K  PSP+A+ CG+LLL S LKY Y PL+WLAV A   G
Sbjct  64    KALNQARLEANVRARGEIK-YQKKWPSPFAIACGLLLLFSLLKYAYHPLQWLAVGAVAVG  122

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
              +P+L +  AA+RN  LDINILM+ +V+GS+ + DY EA TIVFLFTT EWLESRASHKA
Sbjct  123   IYPMLLKGYAAVRNFRLDINILMLSAVIGSVAMKDYTEAGTIVFLFTTAEWLESRASHKA  182

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
              A MSSL+++  Q+AV+AETGE +DA++VK+ T+LAVKAGEVIPIDGIVV+G+CEVDEKT
Sbjct  183   TAVMSSLMSIAPQKAVIAETGEEVDADEVKLSTVLAVKAGEVIPIDGIVVDGKCEVDEKT  242

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             LTGES  V K+KDSTVWA TINLNGYIS+KTTAVAEDC VA+MAKLVEEAQ+NKSR QR 
Sbjct  243   LTGESLPVTKEKDSTVWAGTINLNGYISVKTTAVAEDCVVAKMAKLVEEAQNNKSRTQRF  302

Query  3417  IDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             IDK A++YTPAIV +SA +A+  +A++V N    ++LALVVLVSACPCAL+LSTPVA FC
Sbjct  303   IDKCAQFYTPAIVIVSAAIAVIPAALRVHNLHNWFYLALVVLVSACPCALILSTPVASFC  362

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL++AA  GLL KG +YLEIL+K+K+ AFDKTGT+TRGEF V  F SL + I+ NTLL W
Sbjct  363   ALTKAATSGLLVKGGDYLEILSKIKITAFDKTGTLTRGEFVVTDFRSLCEDISLNTLLYW  422

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSS+ESKSSHPMA A+++Y +SHS+EPNPE VE + NFPGEGIYG IDG +IYIG++KIS
Sbjct  423   VSSVESKSSHPMAAALVEYGRSHSIEPNPETVEDYHNFPGEGIYGRIDGRDIYIGSRKIS  482

Query  2883  ARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVM  2704
              RA  T VP  + +  EGK++ Y+F G++ AG+FSLSDACRTGA EA+ +LK MGIK  M
Sbjct  483   LRAHGT-VPSLEGNMIEGKTIGYVFSGATPAGIFSLSDACRTGAAEAVNELKSMGIKAAM  541

Query  2703  LTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALAT  2524
             LTGD+ AAA HVQEQLG  LDE HAELLPE+KA+II++ +K G T MIGDG+NDAPALAT
Sbjct  542   LTGDNQAAAIHVQEQLGNRLDEVHAELLPEDKARIIEELRKEGPTAMIGDGINDAPALAT  601

Query  2523  ADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIM  2344
             AD+GISMGISGS LA ETGHVILM+NDI +I KAI+L R+  RKVI N++++I TKAAI+
Sbjct  602   ADIGISMGISGSALATETGHVILMSNDIRKIPKAIQLARKAHRKVIENVILSISTKAAIL  661

Query  2343  ALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             ALA AGHPLVWAAVL DVGTCL+VI NS LLLRG  + A
Sbjct  662   ALAFAGHPLVWAAVLADVGTCLLVICNSMLLLRGTHKHA  700



>ref|XP_010447768.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Camelina 
sativa]
Length=1015

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/693 (64%), Positives = 569/693 (82%), Gaps = 3/693 (0%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     KSYFDV+GICC SEVPLI+ ILK +DGV E SV+V T+TV+VVHD L+++Q QI
Sbjct  6     NEKKMTKSYFDVLGICCTSEVPLIENILKSMDGVKEYSVIVPTRTVIVVHDTLILSQFQI  65

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V GETN   K  PSP+AVV G+LLLLSF KY+Y+P +WLAVAA VA
Sbjct  66    VKALNQARLEANVRVTGETNFKNKW-PSPFAVVTGVLLLLSFFKYLYSPFRWLAVAAVVA  124

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+  +A+A+L    +DINIL++I+V  ++ + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  125   GIYPIFAKAIASLARCRIDINILVVITVGATVAMRDYTEAAVVVFLFTIAEWLQSRASYK  184

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETG+ ++ +++K++T++AVKAGE IPIDG+VV+G CEVDEK
Sbjct  185   ASAVMQSLMSLAPQKAVIAETGQEVEVDELKINTVIAVKAGETIPIDGVVVDGNCEVDEK  244

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA T NLNGYI++KTTA+AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  245   TLTGEAFPVPKLRDSTVWAGTFNLNGYITVKTTALAEDCVVAKMAKLVEEAQNSKTETQR  304

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS C A+   A+KV N    +HLALVVLVSACPC L+LSTPVA F
Sbjct  305   FIDECSKYYTPAIMVISICFAVIPLALKVHNPKHWFHLALVVLVSACPCGLILSTPVATF  364

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE L+K+K++AFDKTGTITRGEF V  F SL   I+ ++LL 
Sbjct  365   CALTKAATSGLLIKGADYLETLSKIKIVAFDKTGTITRGEFIVMDFKSLSSDISLHSLLY  424

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS ESKSSHPMA A++DYA+S SVEP PE VE +QNFPGEGIYG+IDG ++YIGNK+I
Sbjct  425   WVSSAESKSSHPMAAALVDYAKSVSVEPKPEAVEDYQNFPGEGIYGKIDGKQVYIGNKRI  484

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+ DVD + GK++ Y++VG +LAGVF+LSDACR+G  +A+++LK +GIKT 
Sbjct  485   ASRAGCSSVPDIDVDTKGGKTVGYVYVGETLAGVFNLSDACRSGVAQAMKELKSLGIKTA  544

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ AAA H QEQLG A+D   AELLPE K++IIK+F++ G TGM+GDGLNDAPALA
Sbjct  545   MLTGDNQAAAMHAQEQLGNAMDIVRAELLPEGKSEIIKEFKREGPTGMVGDGLNDAPALA  604

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMG+SGS LA ETG++ILM+NDI RI +AI+L RR  RKV+ N++++I  K AI
Sbjct  605   TADIGISMGVSGSALATETGNIILMSNDIRRIPQAIKLARRAKRKVVENVIISITMKGAI  664

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             +ALA AGHPL+WAAVL DVGTCL+VI NS LLL
Sbjct  665   LALAFAGHPLIWAAVLADVGTCLLVILNSMLLL  697



>gb|ACC68153.1| Zn/Cd P(IB)-type ATPase [Arabidopsis halleri subsp. halleri]
Length=1163

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/689 (65%), Positives = 569/689 (83%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  17    QKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGETN   K  PSP+AVV GILLLLSFLK+VY PL+WLAV A  AG +P+
Sbjct  77    QARLEANVRVNGETNFKNKW-PSPFAVVSGILLLLSFLKFVYPPLRWLAVVAVAAGIYPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A A++R L LDINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS++A A M
Sbjct  136   LAKAFASIRRLRLDINILVIITVIATLAMQDFMEAAAVVFLFTIADWLETRASYRATAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  196   QSLMSLAPQKAIIAETGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQKDS+VWA TINLNGYIS+KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  256   AFPVPKQKDSSVWAGTINLNGYISVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  315

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ +SAC+AI  V  KV N    +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  316   SQYYTPAIIVVSACVAIVPVIMKVHNLKHWFHLALVVLVSGCPCGLILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I   +LL WVSS+
Sbjct  376   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDITLRSLLYWVSSV  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEGIYG+IDG +IYIGNK+I++RAG
Sbjct  436   ESKSSHPMAATIVDYAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIYIGNKRIASRAG  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE ++D + GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD
Sbjct  496   CSTVPETEIDTKGGKTVGYVYVGERLAGVFNLSDACRSGVSQAMKELKSLGIKTAMLTGD  555

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA H QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+G
Sbjct  556   SQAAAMHAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTAMVGDGVNDAPALATADIG  615

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI RI +A++L RR  RKVI N+ ++I  KA I+ALA 
Sbjct  616   ISMGISGSALATQTGHIILMSNDIRRIPQAVKLARRARRKVIENVCLSIILKAGILALAF  675

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VI NS LLLR
Sbjct  676   AGHPLIWAAVLVDVGTCLLVILNSMLLLR  704



>ref|XP_007014369.1| Cadmium/zinc-transporting ATPase 3 isoform 2, partial [Theobroma 
cacao]
 gb|EOY31988.1| Cadmium/zinc-transporting ATPase 3 isoform 2, partial [Theobroma 
cacao]
Length=870

 Score =   915 bits (2366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/699 (67%), Positives = 570/699 (82%), Gaps = 4/699 (1%)
 Frame = -1

Query  4317  NNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIV  4138
             N   +KSYFDV+GICC SEV  I+ ILK L+GV EVSV+V T+TV+V+HD LL++Q QIV
Sbjct  4     NKKLQKSYFDVLGICCSSEVAQIENILKSLEGVKEVSVIVPTRTVIVLHDNLLVSQLQIV  63

Query  4137  RALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             +ALN+A LEA+++  GE     K  PSP+A+ CG+LLL S LKY Y PL+WLAV A   G
Sbjct  64    KALNQARLEANVRARGEIKY-QKKWPSPFAIACGLLLLFSLLKYAYHPLQWLAVGAVAVG  122

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
              +P+L +  AA+RN  LDINILM+ +V+GS+ + DY EA TIVFLFTT EWLESRASHKA
Sbjct  123   IYPMLLKGYAAVRNFRLDINILMLSAVIGSVAMKDYTEAGTIVFLFTTAEWLESRASHKA  182

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
              A MSSL+++  Q+AV+AETGE +DA++VK+ T+LAVKAGEVIPIDGIVV+G+CEVDEKT
Sbjct  183   TAVMSSLMSIAPQKAVIAETGEEVDADEVKLSTVLAVKAGEVIPIDGIVVDGKCEVDEKT  242

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             LTGES  V K+KDSTVWA TINLNGYIS+KTTAVAEDC VA+MAKLVEEAQ+NKSR QR 
Sbjct  243   LTGESLPVTKEKDSTVWAGTINLNGYISVKTTAVAEDCVVAKMAKLVEEAQNNKSRTQRF  302

Query  3417  IDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             IDK A++YTPAIV +SA +A+  +A++V N    ++LALVVLVSACPCAL+LSTPVA FC
Sbjct  303   IDKCAQFYTPAIVIVSAAIAVIPAALRVHNLHNWFYLALVVLVSACPCALILSTPVASFC  362

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL++AA  GLL KG +YLEIL+K+K+ AFDKTGT+TRGEF V  F SL + I+ NTLL W
Sbjct  363   ALTKAATSGLLVKGGDYLEILSKIKITAFDKTGTLTRGEFVVTDFRSLCEDISLNTLLYW  422

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSS+ESKSSHPMA A+++Y +SHS+EPNPE VE + NFPGEGIYG IDG +IYIG++KIS
Sbjct  423   VSSVESKSSHPMAAALVEYGRSHSIEPNPETVEDYHNFPGEGIYGRIDGRDIYIGSRKIS  482

Query  2883  ARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVM  2704
              RA  T VP  + +  EGK++ Y+F G++ AG+FSLSDACRTGA EA+ +LK MGIK  M
Sbjct  483   LRAHGT-VPSLEGNMIEGKTIGYVFSGATPAGIFSLSDACRTGAAEAVNELKSMGIKAAM  541

Query  2703  LTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALAT  2524
             LTGD+ AAA HVQEQLG  LDE HAELLPE+KA+II++ +K G T MIGDG+NDAPALAT
Sbjct  542   LTGDNQAAAIHVQEQLGNRLDEVHAELLPEDKARIIEELRKEGPTAMIGDGINDAPALAT  601

Query  2523  ADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIM  2344
             AD+GISMGISGS LA ETGHVILM+NDI +I KAI+L R+  RKVI N++++I TKAAI+
Sbjct  602   ADIGISMGISGSALATETGHVILMSNDIRKIPKAIQLARKAHRKVIENVILSISTKAAIL  661

Query  2343  ALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             ALA AGHPLVWAAVL DVGTCL+VI NS LLLRG  + A
Sbjct  662   ALAFAGHPLVWAAVLADVGTCLLVICNSMLLLRGTHKHA  700



>ref|XP_006381163.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
 gb|ERP58960.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
Length=1188

 Score =   915 bits (2365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/690 (66%), Positives = 566/690 (82%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK LDGV + SV+V T+TV+V HD LLI+Q QIV+ALN
Sbjct  17    QKSYFDVLGLCCSSEVPLIENILKSLDGVKDFSVIVPTRTVIVFHDDLLISQLQIVKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++  GET    K  PSPYA+ CG+LLLLS LKYVY PL+W A+ A   G  P+
Sbjct  77    QARLEANVRAYGETKH-QKKWPSPYAMACGVLLLLSLLKYVYHPLRWFAIGAVAVGILPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +AVA+LRN  LD N+LM+I+V+G+I + DY EA TIVFLFT  EWLESRASHKA A M
Sbjct  136   CLKAVASLRNFRLDTNVLMLIAVIGTIAMDDYIEAGTIVFLFTIAEWLESRASHKASAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+AETGE +DA++VK++T+LAVKAGEVIPIDG+VV+G CEVDEKTLTGE
Sbjct  196   SSLMSIAPQKAVIAETGEEVDADEVKLNTVLAVKAGEVIPIDGVVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ DSTVWA TINLNGY+S++TTA+AEDC VA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  256   SFPVPKQVDSTVWAGTINLNGYMSVRTTALAEDCVVAKMAKLVEEAQNSKSKTQRFIDKF  315

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTPA++ ISA +A+   A+++ +R+  + LALVVLVSACPCAL+LSTPVA FCAL++
Sbjct  316   AQYYTPAVIIISASVAVIPLALRLHDRNRWFRLALVVLVSACPCALILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA+ GLL KG +YLE L K+KV+AFDKTGTITRGEF V  F  L + I+ +TLL WVSSI
Sbjct  376   AASAGLLIKGGDYLETLGKIKVMAFDKTGTITRGEFVVTDFQPLCNDISVDTLLYWVSSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDY + HS+EP PEKVE FQNFPGEGI G+I+G +IYIGN+KI+ RA 
Sbjct  436   ESKSSHPMAAALIDYGKMHSIEPQPEKVEEFQNFPGEGIQGKIEGKDIYIGNRKIAHRAS  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
              T VP  + D + GKS+ Y++ G++LAG+FSLSD+CRTG  EAI++LK +GIKT MLTGD
Sbjct  496   GT-VPTLEGDKKTGKSVGYVYCGATLAGIFSLSDSCRTGVAEAIKELKSLGIKTAMLTGD  554

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA +  EQL  AL+  HAELLPE+KA IIK+ +K G T MIGDGLNDAPALATAD+G
Sbjct  555   SEAAAMYAHEQLEHALEVVHAELLPEDKATIIKELKKEGPTAMIGDGLNDAPALATADIG  614

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+ND+ ++ KAI LGR+  RKVI N+++++ TK+AI+ALA 
Sbjct  615   ISMGISGSALATETGHVILMSNDLRKVPKAIRLGRKSHRKVIENVIMSMTTKSAILALAF  674

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VI NS LLLRG
Sbjct  675   AGHPLVWAAVLADVGTCLLVILNSMLLLRG  704



>ref|XP_011019985.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like isoform 
X2 [Populus euphratica]
Length=1119

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/690 (67%), Positives = 565/690 (82%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK LDGV E SV+V T+TV+V HD L+I+Q QIV+ALN
Sbjct  17    QKSYFDVLGLCCSSEVPLIENILKSLDGVKEFSVIVPTRTVIVFHDDLIISQLQIVKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+  GET    K  PSPYA+ CG+LLLLS LKYVY PL+W A+ A   G  P+
Sbjct  77    QARLEANIRAYGETKHR-KKWPSPYAMACGVLLLLSLLKYVYHPLRWFAIGAVAVGILPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +AVA+LRN  LD N+LM+I+V+G+I + DY EA TIVFLFT  EWLESRASHKA A M
Sbjct  136   CLKAVASLRNFRLDTNVLMLIAVIGTIAMDDYIEAGTIVFLFTIAEWLESRASHKANAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+AETGE +DA++VK++T+LAVKAGEVIPIDG+VV+G CEVDEKTLTGE
Sbjct  196   SSLMSIAPQKAVIAETGEEVDADEVKLNTVLAVKAGEVIPIDGVVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ DSTVWA TINLNGY+S++TTA+AEDC VA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  256   SFPVPKQVDSTVWAGTINLNGYMSVRTTALAEDCVVAKMAKLVEEAQNSKSKTQRFIDKF  315

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTPA++ ISA  A+   A+++ NR+  + LALVVLVSACPCAL+LSTPVA FCAL++
Sbjct  316   AQYYTPAVIIISASFAVIPLALRLHNRNRWFRLALVVLVSACPCALILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA+ GLL KG +YLE L K+KV+AFDKTGTITRGEF V  F  L + I+ +TLL WVSSI
Sbjct  376   AASAGLLIKGGDYLETLGKIKVMAFDKTGTITRGEFVVTDFQPLCNDISVDTLLYWVSSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DY + HS+EP PEKVE FQNFPGEGI G+I+G +IYIGN+KI+ RA 
Sbjct  436   ESKSSHPMAAALVDYGKMHSIEPQPEKVEEFQNFPGEGIQGKIEGKDIYIGNRKIAHRAS  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
              T VP  + D + GKS+ Y++ G++LAG+FSLSD+CRTG  EAI++LK +GIKT MLTGD
Sbjct  496   GT-VPTLEGDKKTGKSVGYVYYGATLAGIFSLSDSCRTGVAEAIKELKSLGIKTAMLTGD  554

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA +  EQL  AL+  HAELLPE+KA IIK+ +K G T MIGDGLNDAPALATAD+G
Sbjct  555   SEAAAMYAHEQLEHALEVVHAELLPEDKAAIIKELKKEGPTAMIGDGLNDAPALATADIG  614

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+ND+ ++ KAI LGR+  RKVI N+++++ TK+AI+ALA 
Sbjct  615   ISMGISGSALATETGHVILMSNDLRKVPKAIRLGRKSHRKVIENVIMSMSTKSAILALAF  674

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VI NS LLLRG
Sbjct  675   AGHPLVWAAVLADVGTCLLVILNSMLLLRG  704



>ref|XP_006381161.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
 gb|ERP58958.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
Length=1167

 Score =   915 bits (2364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/690 (66%), Positives = 566/690 (82%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK LDGV + SV+V T+TV+V HD LLI+Q QIV+ALN
Sbjct  17    QKSYFDVLGLCCSSEVPLIENILKSLDGVKDFSVIVPTRTVIVFHDDLLISQLQIVKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++  GET    K  PSPYA+ CG+LLLLS LKYVY PL+W A+ A   G  P+
Sbjct  77    QARLEANVRAYGETKH-QKKWPSPYAMACGVLLLLSLLKYVYHPLRWFAIGAVAVGILPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +AVA+LRN  LD N+LM+I+V+G+I + DY EA TIVFLFT  EWLESRASHKA A M
Sbjct  136   CLKAVASLRNFRLDTNVLMLIAVIGTIAMDDYIEAGTIVFLFTIAEWLESRASHKASAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+AETGE +DA++VK++T+LAVKAGEVIPIDG+VV+G CEVDEKTLTGE
Sbjct  196   SSLMSIAPQKAVIAETGEEVDADEVKLNTVLAVKAGEVIPIDGVVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ DSTVWA TINLNGY+S++TTA+AEDC VA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  256   SFPVPKQVDSTVWAGTINLNGYMSVRTTALAEDCVVAKMAKLVEEAQNSKSKTQRFIDKF  315

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTPA++ ISA +A+   A+++ +R+  + LALVVLVSACPCAL+LSTPVA FCAL++
Sbjct  316   AQYYTPAVIIISASVAVIPLALRLHDRNRWFRLALVVLVSACPCALILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA+ GLL KG +YLE L K+KV+AFDKTGTITRGEF V  F  L + I+ +TLL WVSSI
Sbjct  376   AASAGLLIKGGDYLETLGKIKVMAFDKTGTITRGEFVVTDFQPLCNDISVDTLLYWVSSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDY + HS+EP PEKVE FQNFPGEGI G+I+G +IYIGN+KI+ RA 
Sbjct  436   ESKSSHPMAAALIDYGKMHSIEPQPEKVEEFQNFPGEGIQGKIEGKDIYIGNRKIAHRAS  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
              T VP  + D + GKS+ Y++ G++LAG+FSLSD+CRTG  EAI++LK +GIKT MLTGD
Sbjct  496   GT-VPTLEGDKKTGKSVGYVYCGATLAGIFSLSDSCRTGVAEAIKELKSLGIKTAMLTGD  554

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA +  EQL  AL+  HAELLPE+KA IIK+ +K G T MIGDGLNDAPALATAD+G
Sbjct  555   SEAAAMYAHEQLEHALEVVHAELLPEDKATIIKELKKEGPTAMIGDGLNDAPALATADIG  614

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+ND+ ++ KAI LGR+  RKVI N+++++ TK+AI+ALA 
Sbjct  615   ISMGISGSALATETGHVILMSNDLRKVPKAIRLGRKSHRKVIENVIMSMTTKSAILALAF  674

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VI NS LLLRG
Sbjct  675   AGHPLVWAAVLADVGTCLLVILNSMLLLRG  704



>gb|AID81883.1| heavy metal ATPase transporter 2 [Camelina sativa]
Length=954

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/687 (64%), Positives = 568/687 (83%), Gaps = 3/687 (0%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEVPLI+ ILK +DGV E SV+V T+TV+VVHD L+++Q QIV+ALN+
Sbjct  8     KSYFDVLGICCTSEVPLIENILKSMDGVKEYSVIVPTRTVIVVHDTLILSQFQIVKALNQ  67

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEA+++V GETN   K  PSP+AVV G+LLLLSF KY+Y+P +WLAVAA VAG +P+ 
Sbjct  68    ARLEANVRVTGETNFKNKW-PSPFAVVTGVLLLLSFFKYLYSPFRWLAVAAVVAGIYPIF  126

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              +A+A+L    +DINIL++I+V  ++ + DY EAA +VFLFT  EWL+SRAS+KA A M 
Sbjct  127   AKAIASLARCRIDINILVVITVGATVAMRDYTEAAVVVFLFTIAEWLQSRASYKASAVMQ  186

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SL+++  Q+AV+AETG+ ++ +++K++T++AVKAGE IPIDG+VV+G CEVDEKTLTGE+
Sbjct  187   SLMSLAPQKAVIAETGQEVEVDELKINTVIAVKAGETIPIDGVVVDGNCEVDEKTLTGEA  246

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F VPK +DSTVWA T NLNGYI++KTTA+AEDC VA+MAKLVEEAQ++K+  QR ID+ +
Sbjct  247   FPVPKLRDSTVWAGTFNLNGYITVKTTALAEDCVVAKMAKLVEEAQNSKTETQRFIDECS  306

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAI+ IS C A+   A+KV N    +HLALVVLVSACPC L+LSTPVA FCAL++A
Sbjct  307   KYYTPAIMVISICFAVIPLALKVHNPKHWFHLALVVLVSACPCGLILSTPVATFCALTKA  366

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLL KGA+YLE L+K+K++AFDKTGTITRGEF V  F SL   I+ ++LL WVSS E
Sbjct  367   ATSGLLIKGADYLETLSKIKIVAFDKTGTITRGEFIVMDFKSLSSDISLHSLLYWVSSAE  426

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKSSHPMA A++DYA+S SVEP PE VE +QNFPGEGIYG+IDG ++YIGNK+I++RAGC
Sbjct  427   SKSSHPMAAALVDYAKSVSVEPKPEAVEDYQNFPGEGIYGKIDGKQVYIGNKRIASRAGC  486

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             +SVP+ DVD + GK++ Y++VG +LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+
Sbjct  487   SSVPDIDVDTKGGKTVGYVYVGETLAGVFNLSDACRSGVAQAMKELKSLGIKTAMLTGDN  546

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
              AAA H QEQLG A+D   AELLPE K++IIK+F++ G TGM+GDGLNDAPALATAD+GI
Sbjct  547   QAAAMHAQEQLGNAMDIVRAELLPEGKSEIIKEFKREGPTGMVGDGLNDAPALATADIGI  606

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMG+SGS LA ETG++ILM+NDI RI +AI+L RR  RKV+ N++++I  K AI+ALA A
Sbjct  607   SMGVSGSALATETGNIILMSNDIRRIPQAIKLARRAKRKVVENVIISITMKGAILALAFA  666

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             GHPL+WAAVL DVGTCL+VI NS LLL
Sbjct  667   GHPLIWAAVLADVGTCLLVILNSMLLL  693



>ref|XP_006381162.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
 gb|ERP58959.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
Length=1168

 Score =   914 bits (2363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/690 (66%), Positives = 566/690 (82%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK LDGV + SV+V T+TV+V HD LLI+Q QIV+ALN
Sbjct  17    QKSYFDVLGLCCSSEVPLIENILKSLDGVKDFSVIVPTRTVIVFHDDLLISQLQIVKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++  GET    K  PSPYA+ CG+LLLLS LKYVY PL+W A+ A   G  P+
Sbjct  77    QARLEANVRAYGETKH-QKKWPSPYAMACGVLLLLSLLKYVYHPLRWFAIGAVAVGILPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +AVA+LRN  LD N+LM+I+V+G+I + DY EA TIVFLFT  EWLESRASHKA A M
Sbjct  136   CLKAVASLRNFRLDTNVLMLIAVIGTIAMDDYIEAGTIVFLFTIAEWLESRASHKASAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+AETGE +DA++VK++T+LAVKAGEVIPIDG+VV+G CEVDEKTLTGE
Sbjct  196   SSLMSIAPQKAVIAETGEEVDADEVKLNTVLAVKAGEVIPIDGVVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ DSTVWA TINLNGY+S++TTA+AEDC VA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  256   SFPVPKQVDSTVWAGTINLNGYMSVRTTALAEDCVVAKMAKLVEEAQNSKSKTQRFIDKF  315

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTPA++ ISA +A+   A+++ +R+  + LALVVLVSACPCAL+LSTPVA FCAL++
Sbjct  316   AQYYTPAVIIISASVAVIPLALRLHDRNRWFRLALVVLVSACPCALILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA+ GLL KG +YLE L K+KV+AFDKTGTITRGEF V  F  L + I+ +TLL WVSSI
Sbjct  376   AASAGLLIKGGDYLETLGKIKVMAFDKTGTITRGEFVVTDFQPLCNDISVDTLLYWVSSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDY + HS+EP PEKVE FQNFPGEGI G+I+G +IYIGN+KI+ RA 
Sbjct  436   ESKSSHPMAAALIDYGKMHSIEPQPEKVEEFQNFPGEGIQGKIEGKDIYIGNRKIAHRAS  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
              T VP  + D + GKS+ Y++ G++LAG+FSLSD+CRTG  EAI++LK +GIKT MLTGD
Sbjct  496   GT-VPTLEGDKKTGKSVGYVYCGATLAGIFSLSDSCRTGVAEAIKELKSLGIKTAMLTGD  554

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA +  EQL  AL+  HAELLPE+KA IIK+ +K G T MIGDGLNDAPALATAD+G
Sbjct  555   SEAAAMYAHEQLEHALEVVHAELLPEDKATIIKELKKEGPTAMIGDGLNDAPALATADIG  614

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+ND+ ++ KAI LGR+  RKVI N+++++ TK+AI+ALA 
Sbjct  615   ISMGISGSALATETGHVILMSNDLRKVPKAIRLGRKSHRKVIENVIMSMTTKSAILALAF  674

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VI NS LLLRG
Sbjct  675   AGHPLVWAAVLADVGTCLLVILNSMLLLRG  704



>ref|XP_011019984.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like isoform 
X1 [Populus euphratica]
Length=1141

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/690 (67%), Positives = 565/690 (82%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK LDGV E SV+V T+TV+V HD L+I+Q QIV+ALN
Sbjct  17    QKSYFDVLGLCCSSEVPLIENILKSLDGVKEFSVIVPTRTVIVFHDDLIISQLQIVKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+  GET    K  PSPYA+ CG+LLLLS LKYVY PL+W A+ A   G  P+
Sbjct  77    QARLEANIRAYGETKHR-KKWPSPYAMACGVLLLLSLLKYVYHPLRWFAIGAVAVGILPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +AVA+LRN  LD N+LM+I+V+G+I + DY EA TIVFLFT  EWLESRASHKA A M
Sbjct  136   CLKAVASLRNFRLDTNVLMLIAVIGTIAMDDYIEAGTIVFLFTIAEWLESRASHKANAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+AETGE +DA++VK++T+LAVKAGEVIPIDG+VV+G CEVDEKTLTGE
Sbjct  196   SSLMSIAPQKAVIAETGEEVDADEVKLNTVLAVKAGEVIPIDGVVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ DSTVWA TINLNGY+S++TTA+AEDC VA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  256   SFPVPKQVDSTVWAGTINLNGYMSVRTTALAEDCVVAKMAKLVEEAQNSKSKTQRFIDKF  315

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTPA++ ISA  A+   A+++ NR+  + LALVVLVSACPCAL+LSTPVA FCAL++
Sbjct  316   AQYYTPAVIIISASFAVIPLALRLHNRNRWFRLALVVLVSACPCALILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA+ GLL KG +YLE L K+KV+AFDKTGTITRGEF V  F  L + I+ +TLL WVSSI
Sbjct  376   AASAGLLIKGGDYLETLGKIKVMAFDKTGTITRGEFVVTDFQPLCNDISVDTLLYWVSSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DY + HS+EP PEKVE FQNFPGEGI G+I+G +IYIGN+KI+ RA 
Sbjct  436   ESKSSHPMAAALVDYGKMHSIEPQPEKVEEFQNFPGEGIQGKIEGKDIYIGNRKIAHRAS  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
              T VP  + D + GKS+ Y++ G++LAG+FSLSD+CRTG  EAI++LK +GIKT MLTGD
Sbjct  496   GT-VPTLEGDKKTGKSVGYVYYGATLAGIFSLSDSCRTGVAEAIKELKSLGIKTAMLTGD  554

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA +  EQL  AL+  HAELLPE+KA IIK+ +K G T MIGDGLNDAPALATAD+G
Sbjct  555   SEAAAMYAHEQLEHALEVVHAELLPEDKAAIIKELKKEGPTAMIGDGLNDAPALATADIG  614

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+ND+ ++ KAI LGR+  RKVI N+++++ TK+AI+ALA 
Sbjct  615   ISMGISGSALATETGHVILMSNDLRKVPKAIRLGRKSHRKVIENVIMSMSTKSAILALAF  674

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VI NS LLLRG
Sbjct  675   AGHPLVWAAVLADVGTCLLVILNSMLLLRG  704



>gb|AAY29151.1| P1B-type ATPase 4 [Arabidopsis halleri subsp. gemmifera]
Length=1161

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/689 (65%), Positives = 568/689 (82%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  17    QKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGETN   K  PSP+AVV GILLLLSFLK+VY PL+WLAV A  AG +P+
Sbjct  77    QARLEANVRVNGETNFKNKW-PSPFAVVSGILLLLSFLKFVYPPLRWLAVVAVAAGIYPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A A++R L LDINIL+ I+V+ ++ + D+ EAA +VFLFT  +WLE+RAS++A A M
Sbjct  136   LAKAFASIRRLRLDINILVTITVIATLAMQDFMEAAAVVFLFTIADWLETRASYRATAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  196   QSLMSLAPQKAIIAETGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQKDS+VWA TINLNGYIS+KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  256   AFPVPKQKDSSVWAGTINLNGYISVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  315

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ +SAC+AI  V  KV N     HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  316   SQYYTPAIIVVSACVAIVPVIMKVHNLKHWSHLALVVLVSGCPCGLILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+
Sbjct  376   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDISLRSLLYWVSSV  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEGIYG+IDG +IYIGNK+I++RAG
Sbjct  436   ESKSSHPMAATIVDYAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIYIGNKRIASRAG  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE +VD + GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD
Sbjct  496   CSTVPEIEVDTKGGKTVGYVYVGERLAGVFNLSDACRSGVSQAMKELKSLGIKTAMLTGD  555

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA H QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+G
Sbjct  556   SQAAAMHAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGLTAMVGDGVNDAPALATADIG  615

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI RI +A++L RR  RKVI N+ ++I  KA I+ALA 
Sbjct  616   ISMGISGSALATQTGHIILMSNDIRRIPQAVKLARRARRKVIENVCLSIILKAGILALAF  675

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VI NS LLLR
Sbjct  676   AGHPLIWAAVLVDVGTCLLVILNSMLLLR  704



>ref|XP_006381160.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
 gb|ERP58957.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
Length=1124

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/690 (66%), Positives = 566/690 (82%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK LDGV + SV+V T+TV+V HD LLI+Q QIV+ALN
Sbjct  17    QKSYFDVLGLCCSSEVPLIENILKSLDGVKDFSVIVPTRTVIVFHDDLLISQLQIVKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++  GET    K  PSPYA+ CG+LLLLS LKYVY PL+W A+ A   G  P+
Sbjct  77    QARLEANVRAYGETKH-QKKWPSPYAMACGVLLLLSLLKYVYHPLRWFAIGAVAVGILPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +AVA+LRN  LD N+LM+I+V+G+I + DY EA TIVFLFT  EWLESRASHKA A M
Sbjct  136   CLKAVASLRNFRLDTNVLMLIAVIGTIAMDDYIEAGTIVFLFTIAEWLESRASHKASAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+AETGE +DA++VK++T+LAVKAGEVIPIDG+VV+G CEVDEKTLTGE
Sbjct  196   SSLMSIAPQKAVIAETGEEVDADEVKLNTVLAVKAGEVIPIDGVVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ DSTVWA TINLNGY+S++TTA+AEDC VA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  256   SFPVPKQVDSTVWAGTINLNGYMSVRTTALAEDCVVAKMAKLVEEAQNSKSKTQRFIDKF  315

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTPA++ ISA +A+   A+++ +R+  + LALVVLVSACPCAL+LSTPVA FCAL++
Sbjct  316   AQYYTPAVIIISASVAVIPLALRLHDRNRWFRLALVVLVSACPCALILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA+ GLL KG +YLE L K+KV+AFDKTGTITRGEF V  F  L + I+ +TLL WVSSI
Sbjct  376   AASAGLLIKGGDYLETLGKIKVMAFDKTGTITRGEFVVTDFQPLCNDISVDTLLYWVSSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDY + HS+EP PEKVE FQNFPGEGI G+I+G +IYIGN+KI+ RA 
Sbjct  436   ESKSSHPMAAALIDYGKMHSIEPQPEKVEEFQNFPGEGIQGKIEGKDIYIGNRKIAHRAS  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
              T VP  + D + GKS+ Y++ G++LAG+FSLSD+CRTG  EAI++LK +GIKT MLTGD
Sbjct  496   GT-VPTLEGDKKTGKSVGYVYCGATLAGIFSLSDSCRTGVAEAIKELKSLGIKTAMLTGD  554

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA +  EQL  AL+  HAELLPE+KA IIK+ +K G T MIGDGLNDAPALATAD+G
Sbjct  555   SEAAAMYAHEQLEHALEVVHAELLPEDKATIIKELKKEGPTAMIGDGLNDAPALATADIG  614

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+ND+ ++ KAI LGR+  RKVI N+++++ TK+AI+ALA 
Sbjct  615   ISMGISGSALATETGHVILMSNDLRKVPKAIRLGRKSHRKVIENVIMSMTTKSAILALAF  674

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VI NS LLLRG
Sbjct  675   AGHPLVWAAVLADVGTCLLVILNSMLLLRG  704



>ref|XP_010438218.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like isoform 
X1 [Camelina sativa]
Length=951

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/694 (64%), Positives = 567/694 (82%), Gaps = 4/694 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     KSYFDV+GICC SEVPLI+ ILK +DGV E SV+V T+TV+VVHD L+++Q QI
Sbjct  6     NEKKMTKSYFDVLGICCTSEVPLIENILKSMDGVKEYSVIVPTRTVIVVHDTLILSQFQI  65

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V GETN   K  PSP+AVV G+LLLLSF KY+Y PL+WLAVAA VA
Sbjct  66    VKALNQARLEANVRVTGETNFKNKW-PSPFAVVTGVLLLLSFFKYLYPPLRWLAVAAVVA  124

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+  +A+A+L    +DINIL++I+V  ++ + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  125   GIYPIFAKAIASLARCRIDINILVVITVGATVAMRDYTEAAVVVFLFTIAEWLQSRASYK  184

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETGE ++ +++K++T++AVKAGE IPIDG+VV+G CEVDEK
Sbjct  185   ASAVMQSLMSLAPQKAVIAETGEEVEVDELKINTVIAVKAGETIPIDGVVVDGNCEVDEK  244

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA T NLNGYI++KTTA+AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  245   TLTGEAFPVPKLRDSTVWAGTFNLNGYITVKTTALAEDCVVAKMAKLVEEAQNSKTETQR  304

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS   A+   A+KV N    +HLALVVLVSACPC L+LSTPVA F
Sbjct  305   FIDECSKYYTPAIMVISIFFAVIPLALKVHNPKHWFHLALVVLVSACPCGLILSTPVATF  364

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE LAK+K++AFDKTGTITRGEF V  F SL   I+ N LL 
Sbjct  365   CALTKAATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFKSLSSDISLNNLLY  424

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS ESKSSHPMA A++DYA+S SVEP PE VE +QNFPGEGIYG+IDG ++YIGNK+I
Sbjct  425   WVSSAESKSSHPMAAALVDYAKSVSVEPKPEAVEDYQNFPGEGIYGKIDGKQVYIGNKRI  484

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+ DVD + GK++ Y++VG +LAGVF+LSDACR+G  +A+++LK +GIKT 
Sbjct  485   ASRAGCSSVPDIDVDTKGGKTVGYVYVGETLAGVFNLSDACRSGVAQAMKELKSLGIKTA  544

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQK-GGRTGMIGDGLNDAPAL  2530
             MLTGD+ AAA H QEQLG A+D   AELLPE K++IIK+F++  G TGM+GDGLNDAPAL
Sbjct  545   MLTGDNEAAAMHAQEQLGNAMDIVRAELLPEGKSEIIKEFKREEGPTGMVGDGLNDAPAL  604

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             ATAD+GISMG+SGS LA ETG++ILM+NDI RI +AI+L RR  RKV+ N++++I  K A
Sbjct  605   ATADIGISMGVSGSALATETGNIILMSNDIRRIPQAIKLARRAKRKVVENVIISITMKVA  664

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             I+ALA AGHPL+WAAVL DVGTCL+VI NS LLL
Sbjct  665   ILALAFAGHPLIWAAVLADVGTCLLVILNSMLLL  698



>ref|XP_006381159.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
 gb|ERP58956.1| hypothetical protein POPTR_0006s07650g [Populus trichocarpa]
Length=871

 Score =   913 bits (2359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/690 (66%), Positives = 566/690 (82%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK LDGV + SV+V T+TV+V HD LLI+Q QIV+ALN
Sbjct  17    QKSYFDVLGLCCSSEVPLIENILKSLDGVKDFSVIVPTRTVIVFHDDLLISQLQIVKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++  GET    K  PSPYA+ CG+LLLLS LKYVY PL+W A+ A   G  P+
Sbjct  77    QARLEANVRAYGETKHQKKW-PSPYAMACGVLLLLSLLKYVYHPLRWFAIGAVAVGILPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +AVA+LRN  LD N+LM+I+V+G+I + DY EA TIVFLFT  EWLESRASHKA A M
Sbjct  136   CLKAVASLRNFRLDTNVLMLIAVIGTIAMDDYIEAGTIVFLFTIAEWLESRASHKASAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+AETGE +DA++VK++T+LAVKAGEVIPIDG+VV+G CEVDEKTLTGE
Sbjct  196   SSLMSIAPQKAVIAETGEEVDADEVKLNTVLAVKAGEVIPIDGVVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ DSTVWA TINLNGY+S++TTA+AEDC VA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  256   SFPVPKQVDSTVWAGTINLNGYMSVRTTALAEDCVVAKMAKLVEEAQNSKSKTQRFIDKF  315

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTPA++ ISA +A+   A+++ +R+  + LALVVLVSACPCAL+LSTPVA FCAL++
Sbjct  316   AQYYTPAVIIISASVAVIPLALRLHDRNRWFRLALVVLVSACPCALILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA+ GLL KG +YLE L K+KV+AFDKTGTITRGEF V  F  L + I+ +TLL WVSSI
Sbjct  376   AASAGLLIKGGDYLETLGKIKVMAFDKTGTITRGEFVVTDFQPLCNDISVDTLLYWVSSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDY + HS+EP PEKVE FQNFPGEGI G+I+G +IYIGN+KI+ RA 
Sbjct  436   ESKSSHPMAAALIDYGKMHSIEPQPEKVEEFQNFPGEGIQGKIEGKDIYIGNRKIAHRAS  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
              T VP  + D + GKS+ Y++ G++LAG+FSLSD+CRTG  EAI++LK +GIKT MLTGD
Sbjct  496   GT-VPTLEGDKKTGKSVGYVYCGATLAGIFSLSDSCRTGVAEAIKELKSLGIKTAMLTGD  554

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA +  EQL  AL+  HAELLPE+KA IIK+ +K G T MIGDGLNDAPALATAD+G
Sbjct  555   SEAAAMYAHEQLEHALEVVHAELLPEDKATIIKELKKEGPTAMIGDGLNDAPALATADIG  614

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+ND+ ++ KAI LGR+  RKVI N+++++ TK+AI+ALA 
Sbjct  615   ISMGISGSALATETGHVILMSNDLRKVPKAIRLGRKSHRKVIENVIMSMTTKSAILALAF  674

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VI NS LLLRG
Sbjct  675   AGHPLVWAAVLADVGTCLLVILNSMLLLRG  704



>ref|XP_010433028.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Camelina 
sativa]
Length=940

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/693 (64%), Positives = 563/693 (81%), Gaps = 3/693 (0%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     KSYFDV+GICC SEVPLI+ ILK +DGV E SV+V T+TV+VVHD L+++Q QI
Sbjct  6     NEKKMTKSYFDVLGICCTSEVPLIENILKSMDGVKEYSVIVPTRTVIVVHDTLILSQFQI  65

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA ++V GETN   K  PSP+AVV G+LLLLSF KY+Y P +WLAVAA VA
Sbjct  66    VKALNQARLEADVRVTGETNFKNKW-PSPFAVVTGVLLLLSFFKYLYPPFRWLAVAAVVA  124

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+  +A+A+L    +DINIL++I+V  +I + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  125   GIYPIFAKAIASLARCRIDINILVVITVGATIAMRDYTEAAVVVFLFTIAEWLQSRASYK  184

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETGE ++ +++K++T++AVKAGE IPIDG+VV+G CEVDEK
Sbjct  185   ASAVMQSLMSLAPQKAVIAETGEEVEVDELKINTVIAVKAGETIPIDGVVVDGNCEVDEK  244

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA T NLNGYI++KTTA+AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  245   TLTGEAFPVPKLRDSTVWAGTFNLNGYITVKTTALAEDCVVAKMAKLVEEAQNSKTETQR  304

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS C A+   A+KV N    +HLALVVLVSACPC L+LSTPVA F
Sbjct  305   FIDECSKYYTPAIMVISICFAVIPLALKVHNPKHWFHLALVVLVSACPCGLILSTPVATF  364

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE LAK+K++AFDKTGTITRGEF V  F SL   I+ ++LL 
Sbjct  365   CALTKAATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFKSLSSDISLHSLLY  424

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS ESKSSHPMA A++DYA+S SVEP PE VE +QN PGEGIYG+ID  ++YIGNK+I
Sbjct  425   WVSSAESKSSHPMAAALVDYAKSVSVEPKPEAVEDYQNIPGEGIYGKIDDKQVYIGNKRI  484

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+ D D + GK++ Y++VG +LAGVF+LSDACR+G  +A+++LK +GIKT 
Sbjct  485   ASRAGCSSVPDIDADTKGGKTVGYVYVGETLAGVFNLSDACRSGVDQAMKELKSLGIKTA  544

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ AAA H QEQLG A+D   AELLPE K++IIK F++ G TGM+GDGLNDAPALA
Sbjct  545   MLTGDNQAAAMHAQEQLGNAMDIVRAELLPEGKSEIIKAFKREGPTGMVGDGLNDAPALA  604

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMG+SGS LA ETG++ILM+NDI RI +AI+L RR  RKV+ N++++I  K AI
Sbjct  605   TADIGISMGVSGSALATETGNIILMSNDIRRIPQAIKLARRAKRKVVENVIISITMKVAI  664

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             +ALA AGHPL+WAAVL DVGTCL+VI NS LLL
Sbjct  665   LALAFAGHPLIWAAVLADVGTCLLVILNSMLLL  697



>ref|XP_006283079.1| hypothetical protein CARUB_v10004075mg [Capsella rubella]
 gb|EOA15977.1| hypothetical protein CARUB_v10004075mg [Capsella rubella]
Length=945

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/693 (64%), Positives = 565/693 (82%), Gaps = 3/693 (0%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     KSYFDV+GICC SEVPLI+ ILK +DGV E SV+V ++TV+VVHD L+++Q QI
Sbjct  5     NEKKMTKSYFDVLGICCTSEVPLIENILKSMDGVKEYSVIVPSRTVIVVHDTLILSQFQI  64

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V GET    K  PSP+AVV G+LLLLSF KY+Y+P +WLAV A VA
Sbjct  65    VKALNQARLEANVRVTGETKFKNKW-PSPFAVVSGVLLLLSFFKYLYSPFRWLAVVAVVA  123

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+L +AVA+L    +DINIL++I+V  +I + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  124   GIYPILAKAVASLARFRIDINILVVITVGATIGMQDYTEAAVVVFLFTIAEWLQSRASYK  183

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETGE ++ +++K++T++AVKAGE IPIDG+VV+G CEVDEK
Sbjct  184   ASAVMQSLMSLAPQKAVIAETGEEVEVDELKINTVIAVKAGETIPIDGVVVDGNCEVDEK  243

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA T NLNGYI++KTTA+AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  244   TLTGEAFPVPKLRDSTVWAGTFNLNGYITVKTTALAEDCVVAKMAKLVEEAQNSKTETQR  303

Query  3420  SIDKIAKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS C A    A+KV N+   +HLALVVLVSACPC L+LSTPVA F
Sbjct  304   FIDECSKYYTPAIILISVCFAAVPFALKVHNQKHWFHLALVVLVSACPCGLILSTPVATF  363

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE LAK+K++AFDKTGTITRGEF V  F SL    + ++LL 
Sbjct  364   CALTKAATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFQSLSSDTSLHSLLY  423

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS ESKSSHPMA A++DYA+S SVE  PE VE +QNFPGEGIYG+IDG ++YIGNK+I
Sbjct  424   WVSSAESKSSHPMAAALVDYAKSVSVELKPEAVEDYQNFPGEGIYGKIDGKQVYIGNKRI  483

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+ DVD + G ++ Y++VG +LAGVF+LSDACR+G  +A+++LK MGIKT 
Sbjct  484   ASRAGCSSVPDIDVDTKGGTTVGYVYVGETLAGVFNLSDACRSGVAQAMKELKSMGIKTA  543

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ A+A H QEQLG A+D   AELLPE K++IIK+F++ G TGM+GDGLNDAPALA
Sbjct  544   MLTGDNQASAMHAQEQLGNAMDIVRAELLPEGKSEIIKEFKREGPTGMVGDGLNDAPALA  603

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMG+SGS LA ETG++ILM+NDI RI +AI+L RR  RKV+ N++++I  K AI
Sbjct  604   TADIGISMGVSGSALATETGNIILMSNDIRRIPQAIKLARRAKRKVVENVIISISMKGAI  663

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             +ALA AGHP++WAAVL DVGTCL+VI NS LLL
Sbjct  664   LALAFAGHPMIWAAVLADVGTCLLVILNSMLLL  696



>ref|XP_006283080.1| hypothetical protein CARUB_v10004075mg [Capsella rubella]
 gb|EOA15978.1| hypothetical protein CARUB_v10004075mg [Capsella rubella]
Length=962

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/693 (64%), Positives = 565/693 (82%), Gaps = 3/693 (0%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     KSYFDV+GICC SEVPLI+ ILK +DGV E SV+V ++TV+VVHD L+++Q QI
Sbjct  5     NEKKMTKSYFDVLGICCTSEVPLIENILKSMDGVKEYSVIVPSRTVIVVHDTLILSQFQI  64

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V GET    K  PSP+AVV G+LLLLSF KY+Y+P +WLAV A VA
Sbjct  65    VKALNQARLEANVRVTGETKFKNKW-PSPFAVVSGVLLLLSFFKYLYSPFRWLAVVAVVA  123

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+L +AVA+L    +DINIL++I+V  +I + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  124   GIYPILAKAVASLARFRIDINILVVITVGATIGMQDYTEAAVVVFLFTIAEWLQSRASYK  183

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETGE ++ +++K++T++AVKAGE IPIDG+VV+G CEVDEK
Sbjct  184   ASAVMQSLMSLAPQKAVIAETGEEVEVDELKINTVIAVKAGETIPIDGVVVDGNCEVDEK  243

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA T NLNGYI++KTTA+AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  244   TLTGEAFPVPKLRDSTVWAGTFNLNGYITVKTTALAEDCVVAKMAKLVEEAQNSKTETQR  303

Query  3420  SIDKIAKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS C A    A+KV N+   +HLALVVLVSACPC L+LSTPVA F
Sbjct  304   FIDECSKYYTPAIILISVCFAAVPFALKVHNQKHWFHLALVVLVSACPCGLILSTPVATF  363

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE LAK+K++AFDKTGTITRGEF V  F SL    + ++LL 
Sbjct  364   CALTKAATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFQSLSSDTSLHSLLY  423

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS ESKSSHPMA A++DYA+S SVE  PE VE +QNFPGEGIYG+IDG ++YIGNK+I
Sbjct  424   WVSSAESKSSHPMAAALVDYAKSVSVELKPEAVEDYQNFPGEGIYGKIDGKQVYIGNKRI  483

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+ DVD + G ++ Y++VG +LAGVF+LSDACR+G  +A+++LK MGIKT 
Sbjct  484   ASRAGCSSVPDIDVDTKGGTTVGYVYVGETLAGVFNLSDACRSGVAQAMKELKSMGIKTA  543

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ A+A H QEQLG A+D   AELLPE K++IIK+F++ G TGM+GDGLNDAPALA
Sbjct  544   MLTGDNQASAMHAQEQLGNAMDIVRAELLPEGKSEIIKEFKREGPTGMVGDGLNDAPALA  603

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMG+SGS LA ETG++ILM+NDI RI +AI+L RR  RKV+ N++++I  K AI
Sbjct  604   TADIGISMGVSGSALATETGNIILMSNDIRRIPQAIKLARRAKRKVVENVIISISMKGAI  663

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             +ALA AGHP++WAAVL DVGTCL+VI NS LLL
Sbjct  664   LALAFAGHPMIWAAVLADVGTCLLVILNSMLLL  696



>ref|XP_006412749.1| hypothetical protein EUTSA_v10024341mg [Eutrema salsugineum]
 gb|ESQ54202.1| hypothetical protein EUTSA_v10024341mg [Eutrema salsugineum]
Length=928

 Score =   911 bits (2354),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/701 (64%), Positives = 569/701 (81%), Gaps = 5/701 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     KSYFDV+GICC SEVPLI+ ILK LDG+ E SV+V ++TV+VVHD L+I+Q  I
Sbjct  5     NEKKMTKSYFDVLGICCTSEVPLIENILKSLDGIKEYSVIVPSRTVIVVHDSLIISQFHI  64

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V GET+   K  PSP+AVV G+LLLLSF KYVY+P +WLAVAA VA
Sbjct  65    VKALNQARLEANVRVTGETHFKNKW-PSPFAVVSGVLLLLSFFKYVYSPFRWLAVAAVVA  123

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+L ++VA++    +DINIL++I+V  ++ + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  124   GIYPILAKSVASIARSRIDINILVVITVGATLGMRDYTEAAAVVFLFTIAEWLQSRASYK  183

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETGE ++ +++K++T++AVKAGE IPIDG+VV+G CEVDEK
Sbjct  184   ASAVMQSLMSLAPQKAVIAETGEEVEVDELKINTVIAVKAGETIPIDGVVVDGNCEVDEK  243

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA TINLNGYI++KT+A+AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  244   TLTGEAFPVPKLRDSTVWAGTINLNGYITVKTSALAEDCVVAKMAKLVEEAQNSKTETQR  303

Query  3420  SIDKIAKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS C A+   A+KV N    +HLALVVLVSACPC L+LSTPVA F
Sbjct  304   FIDECSKYYTPAIILISLCFAVVPLALKVHNPKHWFHLALVVLVSACPCGLILSTPVATF  363

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE LAK+K +AFDKTGTITRGEF V  F SL   I+ ++LL 
Sbjct  364   CALTKAATSGLLIKGADYLETLAKIKTVAFDKTGTITRGEFIVMDFKSLSRDISLHSLLY  423

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS ESKSSHPMA A++DYA+S SV+P PE VE +QNFPGEGIYG+IDG E+YIGNK+I
Sbjct  424   WVSSAESKSSHPMASALVDYAKSVSVQPKPEAVEDYQNFPGEGIYGKIDGKEVYIGNKRI  483

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+ DV+ + GK++ Y++VG +LAG+F+LSDACR+G  +A+++LK +GIKT 
Sbjct  484   ASRAGCSSVPDIDVNTKGGKTVGYVYVGETLAGIFNLSDACRSGVAQAMKELKSLGIKTA  543

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ A+A   QEQLG A+D   AELLPE K++IIK+F++ G T M+GDGLNDAPALA
Sbjct  544   MLTGDNQASAMQAQEQLGNAMDIIRAELLPEGKSEIIKEFKREGPTAMVGDGLNDAPALA  603

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMGISGS LA ETGH+ILM+NDI RI +AI L RR  RKV+ N+V++I  K AI
Sbjct  604   TADIGISMGISGSALATETGHIILMSNDIRRIPQAIRLARRAKRKVVENVVLSITLKGAI  663

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREAP  2224
             +ALA AGHPL+WAAVL DVGTCL+VI NS LLLR  D   P
Sbjct  664   LALAFAGHPLIWAAVLADVGTCLLVILNSMLLLR--DTNTP  702



>ref|XP_009128090.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2 [Brassica rapa]
Length=872

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/694 (64%), Positives = 564/694 (81%), Gaps = 3/694 (0%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     KSYFDV+GICC SEVPLI+ IL  LDGV E SV+V ++TV+VVHD L+I+Q  I
Sbjct  5     NEKKMTKSYFDVLGICCTSEVPLIENILNSLDGVKEYSVIVPSRTVIVVHDSLIISQFNI  64

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V GETN   K  PSP+AVV G+LLLLSF KYVY+P +WLAVAA VA
Sbjct  65    VKALNQARLEANVRVTGETNFKNKW-PSPFAVVSGVLLLLSFFKYVYSPFRWLAVAAVVA  123

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+L ++VA++    +DINIL++I+V  ++ + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  124   GIYPILAKSVASIARARIDINILVVITVGATLGMRDYTEAAAVVFLFTIAEWLQSRASYK  183

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETGE ++ +++K++T++AVKAGE I IDG+VV+G CEVDEK
Sbjct  184   ASAVMQSLMSLAPQKAVIAETGEEVEVDELKINTVIAVKAGETISIDGVVVDGNCEVDEK  243

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA TINLNGYI++KTTA+AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  244   TLTGEAFPVPKLRDSTVWAGTINLNGYITVKTTALAEDCVVAKMAKLVEEAQNSKTETQR  303

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS C  +   A+KV N     HLALVVLVSACPC L+LSTPVA F
Sbjct  304   FIDECSKYYTPAIILISLCFVVIPFALKVHNMKHWLHLALVVLVSACPCGLILSTPVATF  363

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE LAK+K +AFDKTGTITRGEF V  F SL   I+ ++LL 
Sbjct  364   CALTKAATSGLLIKGADYLETLAKIKTVAFDKTGTITRGEFIVMDFKSLSRDISLHSLLY  423

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS+ESKSSHPMA A++DYA+S SVEP PE VE +QNFPGEGI+G+I G E+YIGNK+I
Sbjct  424   WVSSVESKSSHPMAAALVDYAKSISVEPKPEAVEDYQNFPGEGIHGKIGGKEVYIGNKRI  483

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+ DVD + GK++ Y+++G +LAGVF+LSDACR+G  +A+++LK MGIKT 
Sbjct  484   ASRAGCSSVPDIDVDTKGGKTVGYVYLGETLAGVFNLSDACRSGVAQAMKELKSMGIKTA  543

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ A+A H QEQLG  +D  HAELLPE K+QIIK+F++ G T M+GDGLNDAPALA
Sbjct  544   MLTGDNQASAMHAQEQLGNVMDVVHAELLPEGKSQIIKEFKREGPTAMVGDGLNDAPALA  603

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMG+SGS LA ETGH+ILM+NDI RI +AI L RR  RKV+ N+V++I  K AI
Sbjct  604   TADIGISMGVSGSALATETGHIILMSNDIRRIPQAIRLARRGKRKVVENVVLSITMKGAI  663

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             +ALA AGHPL+WAAVL DVGTCL+VI NS LLLR
Sbjct  664   LALAFAGHPLIWAAVLADVGTCLLVILNSMLLLR  697



>gb|ACC68152.1| Zn/Cd P(IB)-type ATPase [Arabidopsis halleri subsp. halleri]
Length=1161

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/689 (65%), Positives = 572/689 (83%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  17    QKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGETN   K  PSP+AVV GILLLLSFLK+VY+PL+W+AVAA  AG +P+
Sbjct  77    QARLEANVRVNGETNFKNKW-PSPFAVVSGILLLLSFLKFVYSPLRWVAVAAVAAGIYPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A A++R L LDINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS++A A M
Sbjct  136   LAKAFASIRRLRLDINILVIITVIATLAMQDFMEAAAVVFLFTIADWLETRASYRATAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  196   QSLMSLAPQKAIIAETGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQKDS+VWA TINLNGYIS+KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  256   AFPVPKQKDSSVWAGTINLNGYISVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  315

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ +SAC+AI  V  KV N    +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  316   SQYYTPAIIVVSACVAIVPVIMKVHNLKHWFHLALVVLVSGCPCGLILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+
Sbjct  376   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDISLRSLLYWVSSV  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEGIYG+IDG +IYIGNK+I++RAG
Sbjct  436   ESKSSHPMAATIVDYAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIYIGNKRIASRAG  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE ++D + GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD
Sbjct  496   CSTVPETEIDTKGGKTVGYVYVGERLAGVFNLSDACRSGVSQAMKELKSLGIKTAMLTGD  555

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA H QEQLG  LD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+G
Sbjct  556   SQAAAMHAQEQLGNVLDVVHGELLPEDKSKIIQEFKKEGPTAMVGDGVNDAPALATADIG  615

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI RI +A++L RR  RKVI N+ ++I  KA I+ALA 
Sbjct  616   ISMGISGSALATQTGHIILMSNDIRRIPQAVKLARRARRKVIENVSLSIILKAGILALAF  675

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VIFNS LLLR
Sbjct  676   AGHPLIWAAVLVDVGTCLLVIFNSMLLLR  704



>emb|CBI40117.3| unnamed protein product [Vitis vinifera]
Length=718

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/681 (67%), Positives = 565/681 (83%), Gaps = 4/681 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+KILK LDGV E+SV+V ++T++VVHD LLI+Q QIV+ALN
Sbjct  7     QKSYFDVLGLCCSSEVPLIEKILKPLDGVKEISVIVPSRTLIVVHDNLLISQIQIVKALN  66

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA++++ GE     K  PSP+A+V GILLLLSFLKYVY P +WLA+ A  AG FP+
Sbjct  67    QARLEANVRIYGEVAYQKKW-PSPFAIVSGILLLLSFLKYVYQPFRWLALGAVAAGIFPI  125

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               R + A+RN TLDINIL++I+V+G+I L+DYWEA +IVFLFT  EWLESRASHKA A M
Sbjct  126   AWRGIVAIRNFTLDINILVLIAVIGTIALNDYWEAGSIVFLFTIAEWLESRASHKATAVM  185

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+A+TGEI++AN V VDTI+AVK GEVIPIDGIVVEG+CEVDEK+LTGE
Sbjct  186   SSLMSIAPQKAVIADTGEIVEANSVLVDTIIAVKTGEVIPIDGIVVEGKCEVDEKSLTGE  245

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDC VA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  246   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVVAKMAKLVEEAQNSKSKTQRFIDKC  305

Query  3405  AKYYTPAIVAISACLA--ISAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
              K+YTP +V ISA LA   +A++V + S  +HL+LVVLVSACPCAL+LSTPVA FCALS+
Sbjct  306   TKFYTPVVVLISAGLAGIPAALRVHDLSHWFHLSLVVLVSACPCALILSTPVATFCALSK  365

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG EYLEILAK++++AFDKTGTITRGEF V  F SL D ++ +TLL WVSSI
Sbjct  366   AAVSGLLIKGGEYLEILAKIRIMAFDKTGTITRGEFVVKDFQSLRDDVSSDTLLYWVSSI  425

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+ DY  S SVEP PE VE FQNFPGEGI+G+IDG +IY+GN+KI+ RAG
Sbjct  426   ESKSSHPMAAALFDYGLSQSVEPKPENVEEFQNFPGEGIHGKIDGKDIYVGNRKIALRAG  485

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP    D +EGK++ Y++  ++  G+F+LSDACRTG  EAI++LK++GIK+ MLTGD
Sbjct  486   CETVPTIGED-KEGKTIGYVYSDATPTGIFTLSDACRTGVVEAIKELKLLGIKSAMLTGD  544

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S+A+A H Q+QLG  L+  HAELLPE+KA+IIK F++ G T MIGDG+NDAPALATAD+G
Sbjct  545   SHASAMHTQDQLGHTLEVVHAELLPEDKARIIKDFKEEGPTAMIGDGVNDAPALATADIG  604

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGI+GS LA ETGHV+LMTNDI +I KA+ L R+  RKV+ N++++I TKAAI+ALAI
Sbjct  605   ISMGIAGSALATETGHVVLMTNDIRKIPKAVRLARKTHRKVVENVILSITTKAAILALAI  664

Query  2331  AGHPLVWAAVLVDVGTCLVVI  2269
             AGHPL+WAAVL DV T L++I
Sbjct  665   AGHPLIWAAVLADVATHLIII  685



>ref|NP_194740.1| cadmium/zinc-transporting ATPase HMA2 [Arabidopsis thaliana]
 sp|Q9SZW4.1|HMA2_ARATH RecName: Full=Cadmium/zinc-transporting ATPase HMA2; AltName: 
Full=Cadmium/zinc-transporting ATPase 3; AltName: Full=Protein 
HEAVY METAL ATPASE 2 [Arabidopsis thaliana]
 emb|CAB43846.1| cadmium-transporting ATPase-like protein [Arabidopsis thaliana]
 emb|CAB81004.1| cadmium-transporting ATPase-like protein [Arabidopsis thaliana]
 gb|AEE85722.1| cadmium/zinc-transporting ATPase HMA2 [Arabidopsis thaliana]
Length=951

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/688 (65%), Positives = 564/688 (82%), Gaps = 4/688 (1%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEVPLI+ IL  +DGV E SV+V ++TV+VVHD L+++Q QIV+ALN+
Sbjct  8     KSYFDVLGICCTSEVPLIENILNSMDGVKEFSVIVPSRTVIVVHDTLILSQFQIVKALNQ  67

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEA+++V GETN   K  PSP+AVV GILLLLSF KY+Y+P +WLAVAA VAG +P+L
Sbjct  68    AQLEANVRVTGETNFKNKW-PSPFAVVSGILLLLSFFKYLYSPFRWLAVAAVVAGIYPIL  126

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              +AVA+L    +DINIL++++V  +I + DY EAA +VFLFT  EWL+SRAS+KA A M 
Sbjct  127   AKAVASLARFRIDINILVVVTVGATIGMQDYTEAAVVVFLFTIAEWLQSRASYKASAVMQ  186

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SL+++  Q+AV+AETGE ++ +++K +T++AVKAGE IPIDG+VV+G CEVDEKTLTGE+
Sbjct  187   SLMSLAPQKAVIAETGEEVEVDELKTNTVIAVKAGETIPIDGVVVDGNCEVDEKTLTGEA  246

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F VPK KDSTVWA TINLNGYI++ TTA+AEDC VA+MAKLVEEAQ++K+  QR IDK +
Sbjct  247   FPVPKLKDSTVWAGTINLNGYITVNTTALAEDCVVAKMAKLVEEAQNSKTETQRFIDKCS  306

Query  3402  KYYTPAIVAISACL-AIS-AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAI+ IS C  AI  A+KV N     HLALVVLVSACPC L+LSTPVA FCAL++A
Sbjct  307   KYYTPAIILISICFVAIPFALKVHNLKHWVHLALVVLVSACPCGLILSTPVATFCALTKA  366

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLL KGA+YLE LAK+K++AFDKTGTITRGEF V  F SL + I+  +LL WVSS E
Sbjct  367   ATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFQSLSEDISLQSLLYWVSSTE  426

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKSSHPMA A++DYA+S SVEP PE VE +QNFPGEGIYG+IDG E+YIGNK+I++RAGC
Sbjct  427   SKSSHPMAAAVVDYARSVSVEPKPEAVEDYQNFPGEGIYGKIDGKEVYIGNKRIASRAGC  486

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
              SVP+ DVD + GK++ Y++VG +LAGVF+LSDACR+G  +A+++LK +GIK  MLTGD+
Sbjct  487   LSVPDIDVDTKGGKTIGYVYVGETLAGVFNLSDACRSGVAQAMKELKSLGIKIAMLTGDN  546

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQK-GGRTGMIGDGLNDAPALATADVG  2512
             +AAA H QEQLG A+D   AELLPE+K++IIK+ ++  G T M+GDGLNDAPALATAD+G
Sbjct  547   HAAAMHAQEQLGNAMDIVRAELLPEDKSEIIKQLKREEGPTAMVGDGLNDAPALATADIG  606

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMG+SGS LA ETG++ILM+NDI RI +AI+L +R  RKV+ N+V++I  K AI+ALA 
Sbjct  607   ISMGVSGSALATETGNIILMSNDIRRIPQAIKLAKRAKRKVVENVVISITMKGAILALAF  666

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             AGHPL+WAAVL DVGTCL+VI NS LLL
Sbjct  667   AGHPLIWAAVLADVGTCLLVILNSMLLL  694



>gb|ABB29495.1| P1B-type ATPase 4 [Arabidopsis halleri]
Length=1161

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/689 (65%), Positives = 570/689 (83%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  17    QKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGETN   K  PSP+AVV GILLLLSFLK+VY+PL W+AVAA  AG +P+
Sbjct  77    QARLEANVRVNGETNFKNKW-PSPFAVVSGILLLLSFLKFVYSPLIWIAVAAVAAGIYPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A A++R L LDINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS++A A M
Sbjct  136   LAKAFASIRRLRLDINILVIITVIATLAMQDFMEAAAVVFLFTISDWLETRASYRATAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  196   QSLMSLAPQKAIIAETGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQKDS+VWA TINLNGYIS+KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  256   AFPVPKQKDSSVWAGTINLNGYISVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  315

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ +SAC+AI  V  KV N    +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  316   SQYYTPAIIVVSACVAIVPVIMKVHNLKHWFHLALVVLVSGCPCGLILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+
Sbjct  376   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDISLRSLLYWVSSV  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEGIYG+IDG +IYIGNK+I++RAG
Sbjct  436   ESKSSHPMAATIVDYAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIYIGNKRIASRAG  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE ++D + GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD
Sbjct  496   CSTVPETEIDTKGGKTVGYVYVGERLAGVFNLSDACRSGVSQAMKELKSLGIKTAMLTGD  555

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA H QEQLG  LD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+G
Sbjct  556   SQAAAMHAQEQLGNVLDVVHGELLPEDKSKIIQEFKKEGPTAMVGDGVNDAPALATADIG  615

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI RI +A++L RR  RKVI N+ ++I  KA I+ALA 
Sbjct  616   ISMGISGSALATQTGHIILMSNDIRRIPQAVKLARRARRKVIENVCLSIILKAGILALAF  675

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VI NS LLLR
Sbjct  676   AGHPLIWAAVLVDVGTCLLVILNSMLLLR  704



>ref|XP_008223789.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Prunus mume]
Length=1067

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/692 (65%), Positives = 568/692 (82%), Gaps = 5/692 (1%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+G+CC SEVPL++ ILK L+GV EVSV+V ++TV+VVHD LLI+Q QIV+ALN+A
Sbjct  17    SYFDVLGLCCSSEVPLVENILKPLEGVKEVSVIVPSRTVIVVHDSLLISQIQIVKALNQA  76

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++++ G  ++  K  PSPYA+  G+LLLLSFLKY Y PL WLA+ A V G FP+  
Sbjct  77    RLEANVRLYGAEDNYKKKWPSPYAIASGVLLLLSFLKYAYRPLGWLALGAVVVGIFPIAM  136

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             + VAA+R+L LDINIL+I++V+G+I L+DY EA TIVFLFT  EWLESRA H+A A MSS
Sbjct  137   KGVAAIRHLRLDINILVIVAVIGTIALNDYMEAGTIVFLFTIAEWLESRAGHRAKAVMSS  196

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AVLAETGE++D ++VK++T +AVKAGEVIPIDGIVVEG+ EVDEKTLTGES+
Sbjct  197   LMSMAPQKAVLAETGEVVDVDEVKLNTTVAVKAGEVIPIDGIVVEGKGEVDEKTLTGESY  256

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              V K+KDSTVWA TINLNGY+S+KTTA+AEDCAVA+MAKLVEEAQ++K+R QR IDK AK
Sbjct  257   PVAKEKDSTVWAGTINLNGYLSVKTTALAEDCAVAKMAKLVEEAQNSKTRTQRFIDKCAK  316

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             +YTP+++ IS  +A+  +A+ V N S+ +HLALVVLVSACPCAL+LSTPV  FC L++AA
Sbjct  317   FYTPSVLVISVSIAVIPAALHVHNWSKWFHLALVVLVSACPCALILSTPVVTFCTLTKAA  376

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL KG +Y+EILAKVK++AFDKTGTIT GEF V  F SL D I+ NTLL WV+SIE 
Sbjct  377   TSGLLIKGGDYIEILAKVKIMAFDKTGTITSGEFVVMDFQSLRDDISLNTLLYWVASIER  436

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA A++DY +SHSVEP PE VE FQNFPGEGI+G+IDG  IYIGN+KI+ RA C 
Sbjct  437   KSSHPMADALVDYGRSHSVEPKPENVEEFQNFPGEGIHGKIDGQYIYIGNRKIALRANCK  496

Query  2865  SVPEFDVDGRE-GKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             +VP   ++GR+ GK++ YI+ G + AG+F++SD CR+GA EA R+LK +GIKT MLTGDS
Sbjct  497   TVP--TIEGRKGGKTIGYIYSGGNPAGIFTISDTCRSGAAEACRELKKLGIKTAMLTGDS  554

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
             +AAA H  EQL  AL+  HAELLPE+KA+II +F+  G T M+GDG+NDAPALATAD+GI
Sbjct  555   HAAALHTNEQLKQALEVVHAELLPEDKARIITEFKTEGSTAMVGDGINDAPALATADIGI  614

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LAQETG++IL++NDI ++ KA++L RR  RKVI N+V++I TK AI+AL  A
Sbjct  615   SMGISGSALAQETGNIILLSNDIRKLAKAVKLARRANRKVIQNVVLSITTKVAILALGFA  674

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             GHPLVWAAVL DVGTC++VI NS LLL+G  +
Sbjct  675   GHPLVWAAVLADVGTCMLVILNSMLLLKGTQK  706



>gb|ADZ73050.1| P1B-type ATPase 4-1 [Noccaea caerulescens]
Length=1198

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/691 (63%), Positives = 562/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+PLI+ ILK LDGV E +V+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPLIENILKSLDGVKEYTVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K   SP+AVV GI LLLSFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-DSPFAVVSGIFLLLSFLKFVYPPLRWLAVVGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             ++VA+++ L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M S
Sbjct  142   KSVASIKRLRVDINILIIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTVWA TINLNGYIS+ TTA+A DC VA+MAKLVEEAQS+K+++QR IDK ++
Sbjct  262   PVPKQRDSTVWAGTINLNGYISVNTTALASDCVVAKMAKLVEEAQSSKTKSQRLIDKYSQ  321

Query  3399  YYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  +  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPLIMKVRNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+ ++LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLSSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE DVD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIDVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA ++GH+ILM+NDI RI KAI+L RR  RKV+ N+ ++I  K  I+ LA AG
Sbjct  622   MGISGSALATQSGHIILMSNDIRRIPKAIKLARRAQRKVLENVFISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VIFNS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVIFNSMLLLREKDK  712



>gb|ACC68167.1| Zn/Cd P(IB)-type ATPase [Arabidopsis halleri subsp. halleri]
Length=1161

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/689 (65%), Positives = 571/689 (83%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  17    QKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGETN   K  PSP+AVV G+LLLLSFLK+VY+PL+WLAVAA  AG +P+
Sbjct  77    QARLEANVRVNGETNFKNKW-PSPFAVVSGLLLLLSFLKFVYSPLRWLAVAAVAAGIYPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A A++R   +DINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS++A A M
Sbjct  136   LAKAFASIRRPRIDINILVIITVIATLAMQDFMEAAAVVFLFTIADWLETRASYRATAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  196   QSLMSLAPQKAIIAETGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQKDS+VWA TINLNGYIS+KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  256   AFPVPKQKDSSVWAGTINLNGYISVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  315

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ +SAC+AI  V  KV N    +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  316   SQYYTPAIIVVSACVAIVPVIMKVHNLKHWFHLALVVLVSGCPCGLILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+
Sbjct  376   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDISLRSLLYWVSSV  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEGIYG+IDG +IYIGNK+I++RAG
Sbjct  436   ESKSSHPMAATIVDYAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIYIGNKRIASRAG  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE +VD + GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD
Sbjct  496   CSTVPEIEVDTKGGKTVGYVYVGERLAGVFNLSDACRSGVSQAMKELKSLGIKTAMLTGD  555

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA H QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+G
Sbjct  556   SQAAAMHAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTAMVGDGVNDAPALATADIG  615

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI RI +A++L RR  RKVI N+ ++I  KA I+ALA 
Sbjct  616   ISMGISGSALATQTGHIILMSNDIRRIPQAVKLARRARRKVIENVCLSIILKAGILALAF  675

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VI NS LLLR
Sbjct  676   AGHPLIWAAVLVDVGTCLLVILNSMLLLR  704



>gb|KHG01286.1| Cadmium/zinc-transporting ATPase 3 -like protein [Gossypium arboreum]
Length=958

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/700 (65%), Positives = 571/700 (82%), Gaps = 4/700 (1%)
 Frame = -1

Query  4323  INNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQ  4144
             + N   +KSYFDV+G+CC SEVPLI+ ILK L+GV EVSV+V T+TV+V+HD LL++Q Q
Sbjct  2     VANKNLQKSYFDVLGLCCSSEVPLIENILKSLEGVKEVSVIVPTRTVIVLHDNLLLSQLQ  61

Query  4143  IVRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAV  3964
             IV+ALN+A LEA+++ +GE     K  PSP+AVVCG+LLLLSFLKYVY PL+WLAV A V
Sbjct  62    IVKALNQARLEANVRAHGEIK-YQKKWPSPFAVVCGLLLLLSFLKYVYHPLQWLAVGAVV  120

Query  3963  AGSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASH  3784
              G +PVL +  AA+ +  +DINIL++I+V+GS+ + DY EA TIVFLFTT EWLESRASH
Sbjct  121   IGIYPVLFKGFAAITHFRIDINILILIAVIGSVAMKDYTEAGTIVFLFTTAEWLESRASH  180

Query  3783  KAMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDE  3604
             KA A MSSL+ +  Q+AV+AE GE +DA++VK++T+LAVKAGEVIPIDGIVV+G CEVDE
Sbjct  181   KASAVMSSLMRITPQKAVIAENGEEVDADEVKLNTLLAVKAGEVIPIDGIVVDGRCEVDE  240

Query  3603  KTLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQ  3424
             K+LTGES  V K+KDSTVWA TINLNGYIS+KTTAVAEDC VA+MAKLVEEAQ++KS  Q
Sbjct  241   KSLTGESLPVTKEKDSTVWAGTINLNGYISVKTTAVAEDCVVAKMAKLVEEAQNSKSNTQ  300

Query  3423  RSIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAM  3250
             R IDK A++YTP I+ +SA +A+  +A++V+N    +HLALVVLVSACPCAL+LSTPVA 
Sbjct  301   RFIDKCAQFYTPVIIVVSAAIAVIPAALRVQNLHHWFHLALVVLVSACPCALILSTPVAS  360

Query  3249  FCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLL  3070
             FCAL++AA  GLL KG +YLE L+K+++ AFDKTGT+TRGEF V  F SL   I+ +TLL
Sbjct  361   FCALTKAATSGLLVKGGDYLETLSKIRITAFDKTGTLTRGEFIVTDFQSLSQDISLDTLL  420

Query  3069  SWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKK  2890
              WVSSIESKSSHPMA A++DY +SHS+EPNPE VE +QNFPGEGIYG +DG +IYIG+ K
Sbjct  421   YWVSSIESKSSHPMAAALVDYGRSHSIEPNPETVEDYQNFPGEGIYGRVDGRDIYIGSLK  480

Query  2889  ISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKT  2710
             IS RA  T VP  + +  +GK++ +++ G++ AG+FSLSDACRTG  EA+ +LK M IK 
Sbjct  481   ISVRAHGT-VPTLEGNMMKGKTIGFVYSGATPAGIFSLSDACRTGVPEAVEELKSMRIKV  539

Query  2709  VMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPAL  2530
              MLTGD+ +AA HVQEQLG  LD  HAELLPE+KA+IIK+F+K G T MIGDG+NDAPAL
Sbjct  540   AMLTGDNQSAAIHVQEQLGNRLDVVHAELLPEDKARIIKEFKKEGATAMIGDGVNDAPAL  599

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             ATAD+GISMGISGS LA ETGHV+LM+NDI +I KAI+L R+  RKVI N++++I TK A
Sbjct  600   ATADIGISMGISGSALATETGHVVLMSNDIRKIPKAIKLARKAHRKVIENVILSISTKTA  659

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             I+ALA AGHPLVWAAVL DVGTCL+VI NS LLLRG  ++
Sbjct  660   ILALAFAGHPLVWAAVLADVGTCLLVICNSMLLLRGKHKD  699



>ref|XP_007213711.1| hypothetical protein PRUPE_ppa000656mg [Prunus persica]
 gb|EMJ14910.1| hypothetical protein PRUPE_ppa000656mg [Prunus persica]
Length=1050

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/692 (65%), Positives = 568/692 (82%), Gaps = 5/692 (1%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+G+CC SEVPL++ ILK L+GV EVSV+V ++TV+VVHD LLI+Q QIV+ALN+A
Sbjct  17    SYFDVLGLCCSSEVPLVENILKPLEGVKEVSVIVPSRTVIVVHDSLLISQIQIVKALNQA  76

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++++ G  ++  K  PSPYA+  G+LLLLSFLKY Y PL WLA+ A V G FP+  
Sbjct  77    RLEANVRLYGAEDNYKKKWPSPYAIASGVLLLLSFLKYAYRPLGWLALGAVVVGIFPIAM  136

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             + VAA+R+L LDINIL+I++V+G+I L+DY EA TIVFLFT  EWLESRA H+A A MSS
Sbjct  137   KGVAAIRHLRLDINILVIVAVIGTIALNDYMEAGTIVFLFTVAEWLESRAGHRAKAVMSS  196

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AVLAETGE++D ++VK++T +AVKAGEVIPIDGIVVEG+ EVDEKTLTGES+
Sbjct  197   LMSMAPQKAVLAETGEVVDVDEVKLNTTVAVKAGEVIPIDGIVVEGKGEVDEKTLTGESY  256

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              V K+KDSTVWA TINLNGY+S+KTTA+AEDCAVA+MAKLVEEAQ++K+R QR IDK AK
Sbjct  257   PVAKEKDSTVWAGTINLNGYLSVKTTALAEDCAVAKMAKLVEEAQNSKTRTQRFIDKCAK  316

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             +YTP+++ IS  +A+  +A+ V N S+ +HLALVVLVSACPCAL+LSTPV  FC L++AA
Sbjct  317   FYTPSVLVISVSIAVIPAALHVHNWSKWFHLALVVLVSACPCALILSTPVVTFCTLTKAA  376

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL KG +Y+E+LAKVK++AFDKTGTIT GEF V  F SL D I+ NTLL WV+SIE 
Sbjct  377   TSGLLIKGGDYIEVLAKVKIMAFDKTGTITSGEFVVIDFQSLRDDISLNTLLYWVASIER  436

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA A++DY +SHSVEP PE VE FQNFPGEGI+G+IDG  IYIGN+KI+ RA C 
Sbjct  437   KSSHPMADALVDYGRSHSVEPKPENVEEFQNFPGEGIHGKIDGQYIYIGNRKIALRANCV  496

Query  2865  SVPEFDVDGRE-GKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             +VP   ++GR+ GK++ YI+ G + AG+F++SD CR+GA EA R+LK +GIKT MLTGDS
Sbjct  497   TVP--TIEGRKGGKTIGYIYSGGTPAGIFTISDTCRSGAAEACRELKKLGIKTAMLTGDS  554

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
             +AAA H  EQL  AL+  HAELLPE+KA+II +F+  G T M+GDG+NDAPALATAD+GI
Sbjct  555   HAAALHANEQLKQALEVVHAELLPEDKARIITEFKTEGSTAMVGDGINDAPALATADIGI  614

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LAQETG++IL++NDI ++ KA++  RR  RKVI N+V++I TK AI+AL  A
Sbjct  615   SMGISGSALAQETGNIILLSNDIRKLAKAVKHARRANRKVIQNVVLSITTKVAILALGFA  674

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             GHPLVWAAVL DVGTC++VI NS LLL+G ++
Sbjct  675   GHPLVWAAVLADVGTCMLVILNSMLLLKGTEK  706



>gb|AAL14248.1| putative heavy-metal transporter [Arabidopsis thaliana]
 gb|AAR10767.1| potential Zn/Cd heavy metal transporter [Arabidopsis thaliana]
Length=951

 Score =   904 bits (2337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/688 (65%), Positives = 563/688 (82%), Gaps = 4/688 (1%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEVPLI+ IL  +DGV E SV+V ++TV+VVHD L+++Q QIV+ALN+
Sbjct  8     KSYFDVLGICCTSEVPLIENILNSMDGVKEFSVIVPSRTVIVVHDTLILSQFQIVKALNQ  67

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEA+++V GETN   K  PSP+AVV GILLLLSF KY+Y+P +WLAVAA VAG +P+L
Sbjct  68    AQLEANVRVTGETNFKNKW-PSPFAVVSGILLLLSFFKYLYSPFRWLAVAAVVAGIYPIL  126

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              +AVA+L    +DINIL++++V  +I + DY EAA +VFLFT  EWL+SRAS+KA A M 
Sbjct  127   AKAVASLARFRIDINILVVVTVGATIGMQDYTEAAVVVFLFTIAEWLQSRASYKASAVMQ  186

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SL+++  Q+AV+AETGE ++ +++K +T++AVKAGE IPIDG+VV+G CEVDEKTLTGE+
Sbjct  187   SLMSLAPQKAVIAETGEEVEVDELKTNTVIAVKAGETIPIDGVVVDGNCEVDEKTLTGEA  246

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F VPK KDSTVWA TINLNGYI++ TTA+AEDC VA+MAKLVEEAQ++K+  QR IDK +
Sbjct  247   FPVPKLKDSTVWAGTINLNGYITVNTTALAEDCVVAKMAKLVEEAQNSKTETQRFIDKCS  306

Query  3402  KYYTPAIVAISACL-AIS-AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAI+ IS C  AI  A+KV N     HLALVVLVSACPC L+LSTPVA FCAL++A
Sbjct  307   KYYTPAIILISICFVAIPFALKVHNLKHWVHLALVVLVSACPCGLILSTPVATFCALTKA  366

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLL KGA+YLE LAK+K++AFDKTGTITRGEF V  F SL + I+  +LL WVSS E
Sbjct  367   ATSGLLIKGADYLETLAKIKIVAFDKTGTITRGEFIVMDFQSLSEDISLQSLLYWVSSTE  426

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKSSHPMA A++DYA+S SVEP PE VE +QN PGEGIYG+IDG E+YIGNK+I++RAGC
Sbjct  427   SKSSHPMAAAVVDYARSVSVEPKPEAVEDYQNLPGEGIYGKIDGKEVYIGNKRIASRAGC  486

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
              SVP+ DVD + GK++ Y++VG +LAGVF+LSDACR+G  +A+++LK +GIK  MLTGD+
Sbjct  487   LSVPDIDVDTKGGKTIGYVYVGETLAGVFNLSDACRSGVAQAMKELKSLGIKIAMLTGDN  546

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQK-GGRTGMIGDGLNDAPALATADVG  2512
             +AAA H QEQLG A+D   AELLPE+K++IIK+ ++  G T M+GDGLNDAPALATAD+G
Sbjct  547   HAAAMHAQEQLGNAMDIVRAELLPEDKSEIIKQLKREEGPTAMVGDGLNDAPALATADIG  606

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMG+SGS LA ETG++ILM+NDI RI +AI+L +R  RKV+ N+V++I  K AI+ALA 
Sbjct  607   ISMGVSGSALATETGNIILMSNDIRRIPQAIKLAKRAKRKVVENVVISITMKGAILALAF  666

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             AGHPL+WAAVL DVGTCL+VI NS LLL
Sbjct  667   AGHPLIWAAVLADVGTCLLVILNSMLLL  694



>ref|XP_011094148.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Sesamum indicum]
Length=883

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/695 (66%), Positives = 564/695 (81%), Gaps = 3/695 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+ C SE P I++ L  LDGV + SV+V TKTV+VVHD LLI+Q QIV+ALN
Sbjct  13    QKSYFDVLGLFCSSESPTIERTLSSLDGVKDFSVIVPTKTVIVVHDSLLISQIQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++V+GE N   K  P PYA++  +LLLLSFLKY+Y+PL WLA+ A   G  P+
Sbjct  73    RARLEANVRVHGEPNYKNKW-PRPYAIISSVLLLLSFLKYIYSPLGWLAIGAVAMGVLPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AV A+ NLTLDIN+L++I+V GSI LHDYWEA T+VFLFT  +WLESRASHKA A M
Sbjct  132   LSKAVLAVHNLTLDINVLVVIAVSGSIALHDYWEAGTMVFLFTIAQWLESRASHKATAVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSLVNVV QRAVLA+TGE ++A++V ++ +LAVKAGEVIPIDGIVV+G CEVDEK LTGE
Sbjct  192   SSLVNVVPQRAVLADTGEEINADEVMLNMVLAVKAGEVIPIDGIVVDGGCEVDEKFLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K+KDS VWA TINLNGYI++KTTA+AEDC VAR AKLVE+A++ KSR QR +DK 
Sbjct  252   SFPVAKEKDSLVWAGTINLNGYITVKTTAIAEDCVVARTAKLVEDARNKKSRTQRFMDKC  311

Query  3405  AKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY PAI+AI+A L I   A +V N+ E Y LALVVLVS CPCALVLSTPVAMFCALS+
Sbjct  312   AKYYAPAILAIAAFLVIVPVAFRVRNKKEWYQLALVVLVSGCPCALVLSTPVAMFCALSK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA LG+LFKG E+LE LA +K++AFDKTGTITRGEF VA F SL D ++ + LL W+SSI
Sbjct  372   AARLGVLFKGTEHLESLAHIKIMAFDKTGTITRGEFLVADFISLQDNVSLSRLLYWISSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+ID+A++H++EP PEKVE FQ FPGEGI G I+  ++Y+GN K+++RAG
Sbjct  432   ESKSSHPMAAALIDFARAHAIEPKPEKVEKFQIFPGEGICGRIEDKDVYVGNWKVASRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             CT+VP+ +    EGKS+ YIF+GSS AG+F LSDACRTGA+EA+ +LK MGIKTVMLTGD
Sbjct  492   CTAVPKLEGYDIEGKSIGYIFLGSSPAGIFCLSDACRTGAKEALEELKSMGIKTVMLTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             SY AA+H Q QL G LD  H ELLPE+K +IIK+ QK G T M GDG NDAPAL+ A+VG
Sbjct  552   SYTAAKHAQSQLAGILDVVHVELLPEDKVRIIKELQKEGPTAMTGDGFNDAPALSAAEVG  611

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGI+GS LA ETG ++LM+NDI RI KA+   +RV RK+I N+++AI TKAA++ LAI
Sbjct  612   ISMGINGSALATETGDIVLMSNDIQRIPKALRTAKRVQRKIIENVIIAISTKAAVLGLAI  671

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             AGHPLVWAAVL DVGTCL+VIFNS LLL+G   +A
Sbjct  672   AGHPLVWAAVLTDVGTCLLVIFNSMLLLQGTPTQA  706



>gb|ADZ73053.1| P1B-type ATPase 4-2 [Noccaea caerulescens]
Length=1037

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/691 (63%), Positives = 562/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+P+I+ ILK LDGV E +V+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPVIENILKSLDGVKEYTVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K   SP+AVV GI LLLSFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-DSPFAVVSGIFLLLSFLKFVYPPLRWLAVVGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             ++VA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M S
Sbjct  142   KSVASIRRLRVDINILIIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTVWA TINLNGYIS+ TTA+A DC VA+MAKLVEEAQS+K+++QR IDK ++
Sbjct  262   PVPKQRDSTVWAGTINLNGYISVNTTALASDCVVAKMAKLVEEAQSSKTKSQRLIDKYSQ  321

Query  3399  YYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  +  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPLIMKVRNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+ ++LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLSSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE DVD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIDVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA ++GH+ILM+NDI RI KAI+L RR  RKV+ N+ ++I  K  I+ LA AG
Sbjct  622   MGISGSALATQSGHIILMSNDIRRIPKAIKLARRAQRKVLENVFISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VIFNS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVIFNSMLLLREKDK  712



>ref|XP_004296475.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Fragaria 
vesca subsp. vesca]
Length=1070

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/693 (64%), Positives = 567/693 (82%), Gaps = 3/693 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPL++ ILK L GV EVSV+V T+TV+VVHD LLI+Q QIV+ALN
Sbjct  10    QKSYFDVLGLCCSSEVPLVENILKPLLGVKEVSVVVATRTVIVVHDSLLISQLQIVKALN  69

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++V G  N   +  PSPYA+  G+ LLLS LK+VY P+ WLA+ A   G FP+
Sbjct  70    QARLEANVRVYGAENSFKQKWPSPYAIASGVFLLLSLLKFVYRPMGWLALGAVAVGIFPI  129

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               + +A++RNL LDINILMI++V+G+I L+DY EA TIVFLFT  EWLESRA HKA A M
Sbjct  130   AMKGIASIRNLRLDINILMIVAVIGTIALNDYLEAGTIVFLFTIAEWLESRAGHKAKAVM  189

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AVLA+TGE++D ++VK++T+LAVKAGEVIPIDGIVV+G+ EVDEKTLTGE
Sbjct  190   SSLMSMAPQKAVLADTGEVVDVDEVKLNTLLAVKAGEVIPIDGIVVDGKGEVDEKTLTGE  249

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ V K+KDSTVWA T+NLNGY+S+KTTA+AEDC VA+M+KLVEEAQ++KSR +R IDK 
Sbjct  250   SYPVTKEKDSTVWAGTVNLNGYLSVKTTALAEDCVVAKMSKLVEEAQNSKSRTERFIDKC  309

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
              K+YTPA++ IS  +A+  +A++V N S+ +HLALVVLVSACPCAL+LSTPV  FC L++
Sbjct  310   TKFYTPAVLVISISIAVIPAALRVHNWSKWFHLALVVLVSACPCALILSTPVVTFCTLTK  369

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G+L KG +++E LAKVK++AFDKTGTITRGEF V  F SL D I+ N L+ WVSSI
Sbjct  370   AATSGILIKGGDFIETLAKVKIMAFDKTGTITRGEFVVMDFKSLRDDISLNALIYWVSSI  429

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E K+SHPMA A++DY +S S+EPNPE VE+F+NFPGEG++G+IDG +IYIG+K+I+ RA 
Sbjct  430   ERKASHPMAAALVDYGRSFSIEPNPENVENFENFPGEGVHGKIDGQDIYIGSKRIALRAS  489

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP  +   + GK++ YI+ G + AGVF+LSDACRTGA EA+R+LK +GIKT MLTGD
Sbjct  490   CETVPTIE-GSKGGKTIGYIYCGRTPAGVFTLSDACRTGAAEAVRELKKLGIKTAMLTGD  548

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S+AAA    EQL  ALD  HAELLPE+KA+IIK+ +  G+T M+GDG+NDAPALATAD+G
Sbjct  549   SHAAAMQANEQLEQALDVVHAELLPEDKAKIIKELKVEGKTAMVGDGINDAPALATADIG  608

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LAQ+TG++ILM+ND+ ++ KAI+L RR  RKVI N++++I TKA I+ALA 
Sbjct  609   ISMGISGSALAQDTGNIILMSNDVRKLPKAIQLARRAKRKVIENVILSISTKAGILALAF  668

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             AGHPLVWAAVL DVGTCL+VI NS LLLRG  R
Sbjct  669   AGHPLVWAAVLADVGTCLLVILNSMLLLRGAHR  701



>ref|XP_010467746.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4 [Camelina 
sativa]
Length=1313

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/689 (65%), Positives = 569/689 (83%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV + SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  18    QKSYFDVLGICCTSEVPIIENILKSLDGVKDFSVIVPSRTVIVVHDSLLISPFQIAKALN  77

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGETN   K  PSP+AVV GILLLLSFLK+VY+PL+W+AVAA  AG +P+
Sbjct  78    QARLEANVRVNGETNFKNKW-PSPFAVVSGILLLLSFLKFVYSPLRWIAVAAVAAGIYPI  136

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A A+++ L +DINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS+KA + M
Sbjct  137   LAKAFASIKRLRIDINILVIITVIATLAMQDFMEAAAVVFLFTIADWLETRASYKASSVM  196

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A +AE+GE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  197   QSLMSLAPQKATIAESGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  256

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQ+DS VWA TINLNGYI++KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  257   AFPVPKQRDSIVWAGTINLNGYITVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  316

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ ISAC AI  +  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  317   SQYYTPAIIIISACFAIVPIIMKVHNLTHWFHLALVVLVSACPCGLILSTPVATFCALTK  376

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I   +LL WVSS+
Sbjct  377   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDITLRSLLYWVSSV  436

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+D+A+S SVEP PE+VE +QNFPGEGIYG+IDG +IYIGNK+I++RAG
Sbjct  437   ESKSSHPMAATIVDHAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIYIGNKRIASRAG  496

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE +VD + GK++ Y++VG  LAGVFSLSDACR+G  +A+ +LK MGIKT MLTGD
Sbjct  497   CSTVPEIEVDTKGGKTVGYVYVGERLAGVFSLSDACRSGVSQAMTELKSMGIKTAMLTGD  556

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S A+A H QEQLG  LD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+G
Sbjct  557   SQASAMHAQEQLGNVLDVVHGELLPEDKSKIIQEFKKEGPTAMVGDGVNDAPALATADIG  616

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N+ ++I  KA I+ALA 
Sbjct  617   ISMGISGSALATQTGHIILMSNDIRRIPQAIKLARRARRKVVQNVFLSITFKAGILALAF  676

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VIFNS LLLR
Sbjct  677   AGHPLIWAAVLVDVGTCLLVIFNSMLLLR  705



>ref|XP_010548593.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3 [Tarenaya hassleriana]
Length=1126

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/690 (64%), Positives = 564/690 (82%), Gaps = 3/690 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SE+PL++ ILK LDGV E SV+V ++TV+VVHD LLI+  QI  ALN
Sbjct  17    QKSYFDVLGICCSSEIPLVENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPSQIATALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA ++VNGET+   K  PSP+AVV G+LLLLSFLKYVY+PL+WL    A AG FP+
Sbjct  77    QARLEAHVRVNGETSFKNKW-PSPFAVVSGVLLLLSFLKYVYSPLRWLXXXPAAAGIFPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +A A++R   +DINIL+II+VV +I + DY E+A  VFLFT  EWLESRAS+KA A M
Sbjct  136   VAKAFASIRRFRIDINILVIIAVVATIAMKDYTESAATVFLFTIAEWLESRASYKASAVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+AV+AETGE ++ ++VK++T+LAVKAGE IPIDG+VV+G CEVDEKTLTGE
Sbjct  196   QSLMSLAPQKAVIAETGEEVEVDEVKINTVLAVKAGETIPIDGVVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPK +DS+VWA T+NLNGYIS+KTTA+AEDC VA+MAKLVEEAQ++K++ QR IDK 
Sbjct  256   AFPVPKLRDSSVWAGTMNLNGYISVKTTALAEDCVVAKMAKLVEEAQNSKTQTQRFIDKC  315

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ISAC AI   A++V N S  + LALVVLVSACPC L+LSTPVA FCAL++
Sbjct  316   SQYYTPAVVIISACFAIIPVALRVRNPSHWFRLALVVLVSACPCGLLLSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YLE L+K+K+ AFDKTGTITRGEFTV  F SL   I+ ++LL WVSSI
Sbjct  376   AATSGLLIKGGDYLETLSKIKIAAFDKTGTITRGEFTVMDFRSLSGDISVHSLLYWVSSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA AI+DYA+S SVEP  + VE +QNFPGEGI G+IDG ++YIGNK+I++RAG
Sbjct  436   ESKSSHPMAAAIVDYAKSVSVEPKHDAVEEYQNFPGEGICGKIDGKDVYIGNKRIASRAG  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++V + +VD + GK++ YI+VG  LAGVF+LSD+CRTGA +A+++LK +G+KT MLTGD
Sbjct  496   CSTVSDIEVDNKGGKTVGYIYVGERLAGVFNLSDSCRTGAVQAMKELKSLGVKTAMLTGD  555

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA H QEQLG AL+  H+ELLP++KA+II++F++ G T M+GDGLNDAPALATAD+G
Sbjct  556   NQDAAMHAQEQLGNALEVVHSELLPQDKARIIEEFKREGATAMVGDGLNDAPALATADIG  615

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI +I +AIEL RR   KVI N+V++I  K  I+ LA 
Sbjct  616   ISMGISGSALATQTGHIILMSNDIRKIPEAIELARRASWKVIQNVVLSISIKGGILVLAF  675

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPL+WAAVL DVGTCL+VI NS LLLRG
Sbjct  676   AGHPLIWAAVLADVGTCLLVILNSMLLLRG  705



>gb|AFM38016.1| heavy metal ATPase 4-2 [Noccaea caerulescens]
Length=1037

 Score =   901 bits (2329),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/693 (63%), Positives = 565/693 (82%), Gaps = 3/693 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SE+PLI+ ILK LDG+ + +++V ++TV+VVHD LLI+  QI +ALN
Sbjct  21    QKSYFDVLGICCTSEIPLIENILKSLDGIKDYTIIVPSRTVIVVHDSLLISPFQIAKALN  80

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA++KV+GET+   K LPSP+AV  GI LLLSFLK+VY PL+WLAV     G +P+
Sbjct  81    QARLEANVKVDGETSFKNK-LPSPFAVFSGIFLLLSFLKFVYPPLRWLAVVGVATGIYPI  139

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L ++VA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M
Sbjct  140   LAKSVASIRRLRVDINILVIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKASSVM  199

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  200   QSLMSLAPQKAVIAETGEEVEVDEVELNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGE  259

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQ+DSTVWA TINLNGYIS+ TTA+A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  260   AFPVPKQRDSTVWAGTINLNGYISVNTTALASDCVVAKMAKLVEEAQSSKTKSQRLIDKY  319

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ ISA  AI  +  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  320   SQYYTPAIIIISAGFAIVPLIMKVRNLNHWFHLALVVLVSACPCGLILSTPVATFCALTK  379

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+ ++LL WVSS+
Sbjct  380   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLSSLLYWVSSV  439

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAG
Sbjct  440   ESKSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAG  499

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE DVD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD
Sbjct  500   CSTVPEIDVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGD  559

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  +A H QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+G
Sbjct  560   NQDSAMHAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIG  619

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ++GH+ILM+NDI RI KAI+L RR  RKV+ N+ ++I  K  I+ LA 
Sbjct  620   ISMGISGSALATQSGHIILMSNDIRRIPKAIKLARRAQRKVLENVFISITLKVGILVLAF  679

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             AGHPL+WAAVL DVGTCL+VIFNS LLLR  D+
Sbjct  680   AGHPLIWAAVLTDVGTCLIVIFNSMLLLREKDK  712



>gb|KHF97510.1| Cadmium/zinc-transporting ATPase 3 -like protein [Gossypium arboreum]
Length=959

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/726 (63%), Positives = 569/726 (78%), Gaps = 30/726 (4%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N    +KSYFDV+G+CC SEVPLI+ ILK L+GV +VSV+V T+TV+VVHD LL++Q QI
Sbjct  4     NKKKLQKSYFDVLGLCCSSEVPLIENILKPLEGVKQVSVIVPTRTVIVVHDNLLVSQLQI  63

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++ +GE     K  PSP+A+ CG+LLL+SF KYVY PL+W+AV A V 
Sbjct  64    VKALNQARLEANVRAHGEIKY-QKKWPSPFAMACGLLLLISFFKYVYRPLQWVAVGAVVI  122

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G  P+L +  AA+ N  LDINILM+I+V+GSI + DY EAATIVFLFT  EWLESRASHK
Sbjct  123   GICPILLKGYAAITNFRLDINILMLIAVIGSIAMKDYTEAATIVFLFTVAEWLESRASHK  182

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A MSSL+++  Q+AV+A++GE +D ++VK++T+LAVKAGEVIPIDGIVV+G CEVDEK
Sbjct  183   ATAVMSSLMSMSPQKAVIADSGEEVDVDEVKLNTVLAVKAGEVIPIDGIVVDGNCEVDEK  242

Query  3600  TLTGESFSVPKQKDSTVWAATINLNG--------------------------YISIKTTA  3499
             TLTGES  V KQKDSTVWA TINLNG                          YIS+KTTA
Sbjct  243   TLTGESLPVSKQKDSTVWAGTINLNGTYIPSLDASFGAQWLLLISIDNDNVGYISVKTTA  302

Query  3498  VAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAI--SAVKVENRSE  3325
             VAEDC VA+MAKLVEEAQ++KS  QR IDK A++YTPAI+ +S  +A+  +A +V N   
Sbjct  303   VAEDCVVAKMAKLVEEAQNSKSTTQRFIDKCAQFYTPAIIVVSVAIAVIPAAFRVHNLRH  362

Query  3324  RYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTG  3145
              +HLALVVLVSACPCAL+LSTPVA FCAL++AA  GLL KG +YLEIL+ +K+ AFDKTG
Sbjct  363   WFHLALVVLVSACPCALILSTPVASFCALTKAATSGLLVKGGDYLEILSNIKITAFDKTG  422

Query  3144  TITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVE  2965
             T+TRGEF V +F SL   I+ N+LL WVSSIESKSSHP+A A I+Y +SHS+EP PE VE
Sbjct  423   TLTRGEFVVTNFQSLCQDISFNSLLYWVSSIESKSSHPIAAAFIEYGKSHSIEPKPETVE  482

Query  2964  HFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGV  2785
              +QNFPGEGIYG IDG +IYIG++K+S RA  T+ P  + +  EGK++ Y+F G++ AG+
Sbjct  483   DYQNFPGEGIYGRIDGRDIYIGSRKVSVRAHGTA-PNVEGNMMEGKTIGYVFCGATPAGI  541

Query  2784  FSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKA  2605
             FSLSDACRTGA EA+ +LK MGIKT MLTGD+ AAA +VQEQLG  LD  HA+LLP++KA
Sbjct  542   FSLSDACRTGAAEAVNELKSMGIKTAMLTGDNQAAAINVQEQLGNRLDVIHADLLPQDKA  601

Query  2604  QIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIGK  2425
             +I+++F+K G T MIGDG+NDAPALATAD+GISMGISGS LA ETGHVILM+NDI +I K
Sbjct  602   RIVEEFKKEGPTAMIGDGINDAPALATADIGISMGISGSALATETGHVILMSNDIRKIPK  661

Query  2424  AIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AI L R+  RKVI N++++I TKAAI+ALA AGHPLVWAAVL DVGTCL+VIFNS LLL 
Sbjct  662   AIRLARKAHRKVIQNVILSIITKAAILALAFAGHPLVWAAVLADVGTCLLVIFNSMLLLH  721

Query  2244  GGDREA  2227
             G  + A
Sbjct  722   GTHKHA  727



>emb|CDY30170.1| BnaA03g50000D [Brassica napus]
Length=875

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/702 (63%), Positives = 567/702 (81%), Gaps = 7/702 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N+    KSYFDV+GICC SEVPLI+ ILK LDG+ + SV+V ++TV+VVHD L+I+Q  I
Sbjct  5     NDKKMTKSYFDVLGICCTSEVPLIENILKSLDGIKKYSVIVPSRTVIVVHDSLIISQFHI  64

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V GETN   K  PSP+AVV G+LLLLSF KY+Y+P +WLAVAA VA
Sbjct  65    VKALNQARLEANVRVTGETNFKNKW-PSPFAVVSGVLLLLSFFKYLYSPFRWLAVAAVVA  123

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+L +++A++    +DIN+L++I+V  ++ + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  124   GIYPILAKSIASIARTRIDINVLVVITVGATLGMRDYTEAAAVVFLFTIAEWLQSRASYK  183

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETGE +  +++K++T++AVKAGE IP+DG+VV+G CEVDEK
Sbjct  184   ASAVMQSLMSLSPQKAVIAETGEEVKVDELKINTVIAVKAGETIPVDGVVVDGNCEVDEK  243

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA TINLNGYI++KTT++AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  244   TLTGEAFPVPKLRDSTVWAGTINLNGYITVKTTSLAEDCVVAKMAKLVEEAQNSKTETQR  303

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS C  +   A+K  N     HLALVVLVSACPC L+LSTPVA F
Sbjct  304   FIDQCSKYYTPAIIIISLCFVVIPFALKAHNMKHWLHLALVVLVSACPCGLILSTPVATF  363

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE LAK+K +AFDKTGTITRGEF V  F SL   I+ ++LL 
Sbjct  364   CALTKAATSGLLIKGADYLETLAKIKTVAFDKTGTITRGEFIVTDFKSLSRDISLHSLLY  423

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS+ESKSSHPMA A++DYA+S S EP PE VE +QNFPGEGIYG+ID  E+YIGNK+I
Sbjct  424   WVSSVESKSSHPMAAALVDYAKSVSNEPKPEAVEEYQNFPGEGIYGKIDRKEVYIGNKRI  483

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+  VD + GK++ Y++VG +LAG F+LSDACR+G  +A+++LK +GIKT 
Sbjct  484   ASRAGCSSVPDTGVDTKGGKTVGYVYVGETLAGSFNLSDACRSGVAQAMKELKSLGIKTA  543

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ AAA H QEQLG A+D  HAELLPE K++IIK+F++ G T M+GDGLNDAPALA
Sbjct  544   MLTGDNQAAAMHAQEQLGNAIDIIHAELLPEGKSEIIKEFKREGPTAMVGDGLNDAPALA  603

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMGISGS LA ETG++ILM+NDI RI +AI L RR  RKV+ N+V++I  K AI
Sbjct  604   TADIGISMGISGSALATETGNIILMSNDIRRIPQAIRLARRAKRKVVENVVLSITMKGAI  663

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR----GGDR  2233
             + LA AG+PL+WAAVL DVGTCL+VIFNS LLLR    GG++
Sbjct  664   LGLAFAGYPLIWAAVLADVGTCLLVIFNSMLLLRDKQKGGNK  705



>gb|AFM38015.1| heavy metal ATPase 4-1 [Noccaea caerulescens]
Length=1190

 Score =   901 bits (2328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/691 (63%), Positives = 561/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+P+I+ ILK LDGV E +V+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPVIENILKSLDGVKEYTVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K  PSP+AVV GI LLLSFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-PSPFAVVSGIFLLLSFLKFVYPPLRWLAVVGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             ++VA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M S
Sbjct  142   KSVASIRRLRVDINILIIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTV A T+NLNGYIS+ TTA+A DC VA+MAKLVEEAQS+K+++QR IDK ++
Sbjct  262   PVPKQRDSTVLAGTMNLNGYISVNTTALASDCVVAKMAKLVEEAQSSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPAIMKVRNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLRSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE DVD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIDVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N+ ++I  K  I+ LA AG
Sbjct  622   MGISGSALATQTGHIILMSNDIRRIPQAIKLARRAQRKVLQNVFISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVILNSMLLLREKDK  712



>gb|AFM38014.1| heavy metal ATPase 4-3 [Noccaea caerulescens]
Length=1190

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/691 (63%), Positives = 561/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+P+I+ ILK LDGV E +V+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPVIENILKSLDGVKEYTVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K  PSP+AVV GI LLLSFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-PSPFAVVSGIFLLLSFLKFVYPPLRWLAVVGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             ++VA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M S
Sbjct  142   KSVASIRRLRVDINILIIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTV A T+NLNGYIS+ TTA+A DC VA+MAKLVEEAQS+K+++QR ID  ++
Sbjct  262   PVPKQRDSTVLAGTMNLNGYISVNTTALASDCVVAKMAKLVEEAQSSKTKSQRLIDXCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPAIMKVRNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLRSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE DVD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIDVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N++++I  K  I+ LA AG
Sbjct  622   MGISGSALATQTGHIILMSNDIRRIPQAIKLARRAQRKVLQNVIISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVILNSMLLLREKDK  712



>gb|AFD32368.1| HMA2 transporter [Sedum alfredii]
Length=969

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/690 (64%), Positives = 561/690 (81%), Gaps = 3/690 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+YFDV+G+CC SEV LI+ ILK LDGV ++SV+V ++TV+VVHD LLI+  QIV+ALN
Sbjct  21    QKTYFDVLGLCCSSEVVLIENILKNLDGVKDISVIVPSRTVIVVHDELLISSLQIVKALN  80

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++  GE N   K  PSPYAV CG+LL++S  ++++ PL+W+++AA   G FP+
Sbjct  81    QARLEANVRNRGEANYRNKW-PSPYAVFCGVLLVVSLFQFLFPPLRWISLAAVAVGIFPI  139

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               R+V AL+N TLDINIL I +V+G+I+L DY EAATIVFLFT  EWLESRASHKA A M
Sbjct  140   AWRSVIALKNFTLDINILAIFAVIGTIILRDYLEAATIVFLFTIAEWLESRASHKATAVM  199

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+N+  Q+AV+AETGE++DA+ VK++TILAVKAGEV+PIDGIVVEGE EVDEKTLTGE
Sbjct  200   SSLMNMAPQKAVIAETGEVVDADDVKINTILAVKAGEVVPIDGIVVEGESEVDEKTLTGE  259

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ VPKQKDSTV A T+NLNGYIS+KTTA AEDC VA+MAKLVEEAQ++KSR QR IDK 
Sbjct  260   SYPVPKQKDSTVLAGTMNLNGYISVKTTATAEDCVVAKMAKLVEEAQNSKSRTQRFIDKC  319

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTP+++ I+  +A+  + +KV+N    YHLALVVLVSACPC L+LSTPVA FCALS+
Sbjct  320   AKYYTPSVLLIAILVAVIPAVMKVQNIDHWYHLALVVLVSACPCGLILSTPVATFCALSK  379

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YLE LAK+K +AFDKTGTITRGEF V+ F SL   +   TLL WVSSI
Sbjct  380   AATSGLLIKGGDYLETLAKIKTMAFDKTGTITRGEFVVSDFQSLRADLPLQTLLYWVSSI  439

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DY +S SVEP P++V  + ++PGEGI+G+I G  +YIGNK+++ RA 
Sbjct  440   ESKSSHPMATALVDYGRSKSVEPKPDEVGEYHSYPGEGIHGKIQGQHVYIGNKRMATRAN  499

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C S P  +    EGK++ YIF G++LAG+FSLSDACR+GA EA+ +LK MGI+TVMLTGD
Sbjct  500   CASGPIPEAGSMEGKTIGYIFTGTTLAGMFSLSDACRSGAAEAVNELKNMGIRTVMLTGD  559

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             + A+A H Q QL  AL+  HAELLPE+KA+II++ +  GR  MIGDG+NDAPALATAD+G
Sbjct  560   NQASANHAQAQLKNALELVHAELLPEDKARIIQELKSNGRVAMIGDGINDAPALATADIG  619

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGI+GS LA ETG+VILM+NDI ++ +AI+L RR   KV+ N+++++ TK AI+ALAI
Sbjct  620   ISMGIAGSALATETGNVILMSNDIRKVPEAIKLARRAQAKVVQNVILSVVTKGAILALAI  679

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VIFNS LLLRG
Sbjct  680   AGHPLVWAAVLADVGTCLLVIFNSMLLLRG  709



>gb|KDO61855.1| hypothetical protein CISIN_1g001837mg [Citrus sinensis]
Length=1007

 Score =   900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/688 (65%), Positives = 558/688 (81%), Gaps = 3/688 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVPLI+ ILK L+GV EVSV+V ++TV+V+HD LLI+QHQIV+ALN
Sbjct  10    QKSYFDVLGICCSSEVPLIENILKSLEGVKEVSVIVPSRTVIVLHDALLISQHQIVKALN  69

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A  EA+++  G T+   K  PSPYA+ CG+LL +S LKYVY PL+W A+ A   G FP+
Sbjct  70    QARFEANVRAYGGTSY-QKKWPSPYAMACGVLLAISILKYVYHPLRWFALGAVAIGIFPI  128

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + + +AA+RN  LDINIL++I+V+G+I ++DY EA  IVFLFT  EWLESRASHKA A M
Sbjct  129   ILKGLAAIRNFKLDINILVLIAVIGTIAMNDYIEAGIIVFLFTIAEWLESRASHKATAVM  188

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+A++A TGE +DA +VK++T+LAVKAGEVIPIDGIVV+G+CEVDEKTLTGE
Sbjct  189   SSLMSIAPQKAIIAGTGEEVDAGEVKLNTVLAVKAGEVIPIDGIVVDGKCEVDEKTLTGE  248

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ V KQK STVWA TINLNGYIS++TTAVAEDC VA+MAKLVEEAQ++KSR QR +DK 
Sbjct  249   SYPVSKQKGSTVWAGTINLNGYISVETTAVAEDCVVAKMAKLVEEAQNSKSRIQRFVDKF  308

Query  3405  AKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA++ ISAC+A+   A+ V N  + +HLALVVLVSACPCAL+LSTPV  +CAL++
Sbjct  309   SQYYTPAVIFISACVAVIPIALGVSNHKQWFHLALVVLVSACPCALILSTPVVTYCALTK  368

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YL+ LAKV+ +AFDKTGTITRGEF ++ F  L + IN NTLL WVSSI
Sbjct  369   AATSGLLIKGGDYLQTLAKVRFMAFDKTGTITRGEFVMSEFQPLSEDINLNTLLYWVSSI  428

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPM+ A+++Y +S S+EP PE VE +QNFPGEGIYG+I G EIYIGN+KI+ RAG
Sbjct  429   ESKSSHPMSAALVEYGRSLSIEPKPEDVEDYQNFPGEGIYGKIGGEEIYIGNRKIAQRAG  488

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP  D    +G ++ YIF G+S  G+F LSDACRTGA EA+ +LK +GI+T MLTGD
Sbjct  489   CGTVPSVDGPKMKGNTIGYIFSGASPVGIFCLSDACRTGAAEAVNQLKSLGIRTAMLTGD  548

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             + +AA   QEQLG AL+  H+ELLPE+KA+II +F++ G+T MIGDG+NDAPALATAD+G
Sbjct  549   NQSAAMQAQEQLGNALNVVHSELLPEDKAKIINQFKQEGKTAMIGDGINDAPALATADIG  608

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG VILM+NDI ++ +AI L R+   KVI NI V+I TKA I+ALA+
Sbjct  609   ISMGISGSALATETGQVILMSNDIRKVPEAIRLARKAHWKVIENIAVSIATKAGIIALAL  668

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
              GHPLVWAAVL DVGTCL+VI NS LLL
Sbjct  669   GGHPLVWAAVLADVGTCLIVILNSMLLL  696



>gb|AFM38010.1| heavy metal ATPase 4-1 [Noccaea caerulescens]
Length=1187

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/691 (63%), Positives = 560/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+PLI+ ILK LDGV E +V+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPLIENILKSLDGVKEYTVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K  PSP+AVV GI LLLSFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-PSPFAVVSGIFLLLSFLKFVYPPLRWLAVVGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M S
Sbjct  142   KAVASIRRLRVDINILIIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTV A T+NLNGYIS+ TTA+A DC VA+MAKLVEEAQ +K+++QR IDK ++
Sbjct  262   PVPKQRDSTVLAGTMNLNGYISVNTTALASDCVVAKMAKLVEEAQGSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPAIMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLRSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIEVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N+ ++I  K  I+ LA AG
Sbjct  622   MGISGSALATQTGHIILMSNDIRRIPQAIKLARRAQRKVLQNVFISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVILNSMLLLREKDK  712



>gb|ADZ73051.1| P1B-type ATPase 4-1 [Noccaea caerulescens]
Length=1186

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/691 (63%), Positives = 560/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+PLI+ ILK LDGV E +V+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPLIENILKSLDGVKEYTVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K  PSP+AVV GI LLLSFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-PSPFAVVSGIFLLLSFLKFVYPPLRWLAVGGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M S
Sbjct  142   KAVASIRRLRVDINILVIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVK GE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKTGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTV A T+NLNGYIS+ TTA+A DC VA+MAKLVEEAQ +K+++QR IDK ++
Sbjct  262   PVPKQRDSTVLAGTMNLNGYISVNTTALASDCVVAKMAKLVEEAQGSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPAIMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLRSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIEVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N++++I  K  I+ LA AG
Sbjct  622   MGISGSALATQTGHIILMSNDIRRIPQAIKLARRAQRKVLQNVIISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVILNSMLLLREKDK  712



>gb|AFM38011.1| heavy metal ATPase 4-2 [Noccaea caerulescens]
Length=1186

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/691 (63%), Positives = 560/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+PLI+ ILK LDGV E +V+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPLIENILKSLDGVKEYTVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K  PSP+AVV GI LLLSFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-PSPFAVVSGIFLLLSFLKFVYPPLRWLAVVGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M S
Sbjct  142   KAVASIRRLRVDINILIIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTV A T+NLNGYIS+ TTA+A DC VA+MAKLVEEAQ +K+++QR IDK ++
Sbjct  262   PVPKQRDSTVLAGTMNLNGYISVNTTALASDCVVAKMAKLVEEAQGSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPAIMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLRSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIEVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N+ ++I  K  I+ LA AG
Sbjct  622   MGISGSALATQTGHIILMSNDIRRIPQAIKLARRAQRKVLQNVFISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVILNSMLLLREKDK  712



>ref|XP_002867367.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43626.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=944

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/688 (65%), Positives = 563/688 (82%), Gaps = 4/688 (1%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEVPLI+ ILK +DGV E SV+V ++TV+VVHD L+++Q QIV+ALN+
Sbjct  8     KSYFDVLGICCTSEVPLIENILKSMDGVKEYSVIVPSRTVIVVHDTLILSQFQIVKALNQ  67

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEA+++V GETN   K  PSP+A+V G+LLLLSF KY+Y+P +WLAVAA VAG +P+L
Sbjct  68    ARLEANVRVTGETNFRNKW-PSPFAMVSGLLLLLSFFKYLYSPFRWLAVAAVVAGIYPIL  126

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              +AVA+L    +DINIL+II+V  +I + DY EA  +VFLFT  EWL+SRAS+KA A M 
Sbjct  127   AKAVASLARFRIDINILVIITVGATIGMRDYTEAGVVVFLFTIAEWLQSRASYKASAVMQ  186

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SL+++  Q+A++AETGE +  +++K++T++AVKAGE IPIDG+VV+G CEVDEKTLTGE+
Sbjct  187   SLMSLAPQKAMIAETGEEVQVDELKINTVIAVKAGETIPIDGVVVDGNCEVDEKTLTGEA  246

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F VPK +DSTVWA TINLNGYI++KTTA+AEDC VA+MAKLVEEAQ++K+  QR IDK +
Sbjct  247   FPVPKLRDSTVWAGTINLNGYITVKTTALAEDCVVAKMAKLVEEAQNSKTETQRFIDKCS  306

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
              YYTPAI+ IS C A    A+KV N     HLALVVLVSACPC L+LSTPVA FCAL++A
Sbjct  307   MYYTPAIILISVCFAAIPFALKVHNLKHWIHLALVVLVSACPCGLILSTPVATFCALTKA  366

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLL KGA+YLE LAK+KV+AFDKTGTITRGEF V  F SL + I+ ++LL WVSS E
Sbjct  367   ATSGLLIKGADYLETLAKIKVVAFDKTGTITRGEFIVMDFQSLSEDISLHSLLYWVSSAE  426

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKSSHPMA A++DYA+S SVEP PE VE +QNFPGEGIYG+IDG E+YIGNK+I++R+GC
Sbjct  427   SKSSHPMAAALVDYAKSVSVEPKPEAVEDYQNFPGEGIYGKIDGKEVYIGNKRIASRSGC  486

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             +SVP+ DVD + GK++ Y++VG +L+GVF+LSDACR+G  +A+++LK +GIKT MLTGD+
Sbjct  487   SSVPDVDVDTKGGKTIGYVYVGKTLSGVFNLSDACRSGVAQAMKELKALGIKTAMLTGDN  546

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQK-GGRTGMIGDGLNDAPALATADVG  2512
              AAA H QEQLG A+D   AELLPE K++IIK+F +  G T M+GDGLNDAPALATAD+G
Sbjct  547   QAAAMHAQEQLGNAMDIVRAELLPEGKSEIIKEFMREEGSTAMVGDGLNDAPALATADIG  606

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMG+SGS +A ETG++ILM+NDI RI +AI+L RR  RKV+ N+V +I  K AI+ALA 
Sbjct  607   ISMGVSGSAIATETGNIILMSNDIRRIPQAIKLARRAKRKVVENVVTSITMKGAILALAF  666

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             AGHPL+WAAVL DVGTCL+VI NS LLL
Sbjct  667   AGHPLIWAAVLADVGTCLLVILNSMLLL  694



>gb|AID81884.1| heavy metal ATPase transporter 4 [Camelina sativa]
Length=1174

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/689 (64%), Positives = 567/689 (82%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV + SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  18    QKSYFDVLGICCTSEVPIIENILKSLDGVKDFSVIVPSRTVIVVHDSLLISPFQIAKALN  77

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGETN   K  PSP+AVV GILLLLSFLK+VY+PL+W+AVAA  AG +P+
Sbjct  78    QARLEANVRVNGETNFKNKW-PSPFAVVSGILLLLSFLKFVYSPLRWIAVAAVAAGIYPI  136

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L ++ A+++ L +DINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS+KA + M
Sbjct  137   LAKSFASIKRLRIDINILVIITVIATLAMQDFMEAAAVVFLFTIADWLETRASYKASSVM  196

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A +AETGE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  197   QSLMSLAPQKATIAETGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  256

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQ+DS VWA TINLNGY+++KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  257   AFPVPKQRDSIVWAGTINLNGYVTVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  316

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ ISAC AI  +  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  317   SQYYTPAIIIISACFAIVPIIMKVHNLTHWFHLALVVLVSACPCGLILSTPVATFCALTK  376

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I    LL WVSS+
Sbjct  377   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDITLRNLLYWVSSV  436

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+D+A+S SVEP PE+VE + NFPGEGIYG+IDG +IYIGNK+I++RAG
Sbjct  437   ESKSSHPMAATIVDHAKSVSVEPKPEEVEDYHNFPGEGIYGKIDGNDIYIGNKRIASRAG  496

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE +VD + GK++ Y++VG  LAGVFSLSDACR+G  +A+ +LK MGIKT MLTGD
Sbjct  497   CSTVPEIEVDTKGGKTVGYVYVGKRLAGVFSLSDACRSGVSQAMTELKFMGIKTAMLTGD  556

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S A+A H QEQLG  LD  H ELLPE+K++I+++F+K G T M+GDG+NDAPALATAD+G
Sbjct  557   SQASAMHAQEQLGNVLDVVHGELLPEDKSKIVQEFKKEGPTAMVGDGVNDAPALATADIG  616

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N+ ++I  KA I+ALA 
Sbjct  617   ISMGISGSALATQTGHIILMSNDIRRIPQAIKLARRARRKVVQNVFLSITFKAGILALAF  676

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VIFNS LLLR
Sbjct  677   AGHPLIWAAVLVDVGTCLLVIFNSMLLLR  705



>ref|XP_009137890.1| PREDICTED: LOW QUALITY PROTEIN: cadmium/zinc-transporting ATPase 
HMA2-like [Brassica rapa]
Length=904

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/702 (63%), Positives = 571/702 (81%), Gaps = 7/702 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N+    KSYFDV+GICC SEVPLI+ ILK LDG+ + SV+V ++TV+VVHD L+I+Q  I
Sbjct  5     NDKKMTKSYFDVLGICCTSEVPLIENILKSLDGIKKYSVIVPSRTVIVVHDSLIISQFHI  64

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V GETN   K  PSP+AVV G+LLLLSF KY+Y+P +WLAVAA VA
Sbjct  65    VKALNQARLEANVRVTGETNFKNKW-PSPFAVVSGVLLLLSFFKYLYSPFRWLAVAAVVA  123

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+L +++A++    +DIN+L++I+V  ++ + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  124   GIYPILAKSIASIARTRIDINVLVVITVGATLGMQDYTEAAAVVFLFTIAEWLQSRASYK  183

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETGE ++ +++K++TI+AVKAGE IPIDG+VV+G CEVDEK
Sbjct  184   ASAVMQSLMSLSPQKAVIAETGEEVEVDELKINTIIAVKAGETIPIDGVVVDGNCEVDEK  243

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA TINLNGYI++KTT++AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  244   TLTGEAFPVPKLRDSTVWAGTINLNGYITVKTTSLAEDCVVAKMAKLVEEAQNSKTETQR  303

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS C  +   A KV N     HLALVVLVSACPC L+LSTPVA F
Sbjct  304   FIDQCSKYYTPAIILISLCFVVIPFASKVHNMKHXLHLALVVLVSACPCGLILSTPVATF  363

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE LAK+K +AFDKTGTITRGEF V  F S+   I+ ++LL 
Sbjct  364   CALTKAATSGLLIKGADYLETLAKIKTVAFDKTGTITRGEFIVTDFKSISRDISLHSLLY  423

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS+ESKSSHPMA A++DYA+S SVEP PE VE +QNFPGEGIYG+IDG E+YIGNK+I
Sbjct  424   WVSSVESKSSHPMASALVDYAKSVSVEPKPEAVEDYQNFPGEGIYGKIDGKEVYIGNKRI  483

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+ DVD + GK++ Y++VG +LAG F+LSDACR+G  +A+++LK +GIKT 
Sbjct  484   ASRAGCSSVPDTDVDTKGGKTVGYVYVGETLAGSFNLSDACRSGVAQAMKELKSLGIKTA  543

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ AAARH QEQLG A+D  HAELLPE K++IIK+F++ G T M+GDGLNDAPALA
Sbjct  544   MLTGDNQAAARHAQEQLGNAIDIIHAELLPEGKSEIIKEFKREGPTAMVGDGLNDAPALA  603

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMGISGS LA ETG++ILM+NDI RI +AI L RR  RKV+ N+V++I  K AI
Sbjct  604   TADIGISMGISGSALATETGNIILMSNDIRRIPQAIRLARRAKRKVVENVVLSITMKGAI  663

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR----GGDR  2233
             + LA AG+PL+WAAVL DVGTCL+VI NS LLLR    GG++
Sbjct  664   LGLAFAGYPLIWAAVLADVGTCLLVILNSMLLLRDKQKGGNK  705



>emb|CDY62400.1| BnaC07g50890D [Brassica napus]
Length=872

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/702 (62%), Positives = 563/702 (80%), Gaps = 7/702 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     KSYFDV+GICC SEVPLI+ ILK LDG+ E SV+V ++TV+VVHD L+I+Q  I
Sbjct  5     NEKKMTKSYFDVLGICCTSEVPLIENILKSLDGIKEYSVIVPSRTVIVVHDSLIISQFHI  64

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V GET+   K  PSP+AVV G+LLLLSF KY+Y+P +WLAVAA VA
Sbjct  65    VKALNQARLEANVRVTGETSFKNKW-PSPFAVVSGVLLLLSFFKYLYSPFRWLAVAAVVA  123

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+L ++VA++    +DIN+L++I+V  ++ + DY EAA +VFLFT  EWL+SRAS+K
Sbjct  124   GIYPILAKSVASIARTRIDINVLVVITVGATLGIQDYTEAAAVVFLFTIAEWLQSRASYK  183

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A M SL+++  Q+AV+AETGE ++ +++K++T++AVK GE IPIDG+VV+G CEVDEK
Sbjct  184   ASAVMQSLMSLAPQKAVIAETGEEVEVDELKINTVIAVKTGETIPIDGVVVDGNCEVDEK  243

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGE+F VPK +DSTVWA TINLNGYI++KTT++AEDC VA+MAKLVEEAQ++K+  QR
Sbjct  244   TLTGEAFPVPKLRDSTVWAGTINLNGYITVKTTSLAEDCVVAKMAKLVEEAQNSKTETQR  303

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              ID+ +KYYTPAI+ IS    +   A+K  N     HLALVVLVSACPC L+LSTPVA F
Sbjct  304   FIDQCSKYYTPAIIIISLSFVVIPFALKAHNMKHWLHLALVVLVSACPCGLILSTPVATF  363

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  GLL KGA+YLE LAK+K +AFDKTGTITRGEF V  F SL   I+ + LL 
Sbjct  364   CALTKAATSGLLIKGADYLETLAKIKTVAFDKTGTITRGEFIVIDFKSLSRDISLHRLLY  423

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSS+ESKSSHPMA A++DYA+S  VEP PE VE +QNFPGEGIYG+ID  E+YIGNK+I
Sbjct  424   WVSSVESKSSHPMAAALVDYAKSVYVEPKPEAVEDYQNFPGEGIYGKIDDKEVYIGNKRI  483

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++RAGC+SVP+ DVD + GK++ Y++VG +LAG F+LSDACR+G  +A+++LK +GIKT 
Sbjct  484   ASRAGCSSVPDTDVDTKGGKTVGYVYVGETLAGSFNLSDACRSGVAQAMKELKSLGIKTA  543

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ AAA H QEQLG A+D  HAELLPE K++IIK+F++ G T M+GDGLNDAPALA
Sbjct  544   MLTGDNQAAAMHAQEQLGNAIDIIHAELLPEGKSEIIKEFKREGPTAMVGDGLNDAPALA  603

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMG+SGS LA ETG++ILM+NDI RI + I L RR  RKV+ N+V++I  K AI
Sbjct  604   TADIGISMGVSGSALATETGNIILMSNDIRRIPQGIRLARRAKRKVVENVVLSITMKGAI  663

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR----GGDR  2233
             + LA AG+PL+WAAVL DVGTCL+VI NS LLLR    GG++
Sbjct  664   LGLAFAGYPLIWAAVLADVGTCLLVILNSMLLLRDKQKGGNK  705



>gb|EYU38759.1| hypothetical protein MIMGU_mgv1a026280mg [Erythranthe guttata]
Length=762

 Score =   883 bits (2282),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/690 (63%), Positives = 559/690 (81%), Gaps = 4/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SE+ LI+ I+K LDGV + +V+V TKT++VVHD LL++Q QIV+ALN
Sbjct  9     QKSYFDVLGLCCSSEIQLIENIVKSLDGVKDFTVVVPTKTLIVVHDSLLVSQIQIVKALN  68

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++V+GETN   K  PS Y +  G+LLLLSF KY Y+PL+WLAV A V G   +
Sbjct  69    RARLEANVRVSGETNHKHKW-PSTYTIASGVLLLLSFCKYFYSPLRWLAVGAIVVGIPQI  127

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +A AA+RNLT DINIL++I+V GSI L DYWEA T+VFLFT  +WLESRAS+KA A M
Sbjct  128   MLKAFAAIRNLTFDINILVLITVAGSIALQDYWEAGTVVFLFTVSQWLESRASYKATAVM  187

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSLV++V QRAVLAETG+ ++A++V ++T+LAVKAGE IPIDG+VV+G CEVDEKTLTGE
Sbjct  188   SSLVSMVPQRAVLAETGQEVNADEVPLNTVLAVKAGETIPIDGVVVQGNCEVDEKTLTGE  247

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDS VWA TIN+NGYIS+KTTAVAED  VAR+A++VE+AQ  KS+ QR +D+ 
Sbjct  248   SFPVSKQKDSPVWAGTININGYISVKTTAVAEDSVVARIARIVEDAQIKKSKTQRFMDRC  307

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPAIV ISA +A+  +  ++ N+ E +HLALVVLV+ACPCAL+LSTPVAMFCALS+
Sbjct  308   AKYYTPAIVVISASIAVVPLVFQLGNKKEWFHLALVVLVTACPCALLLSTPVAMFCALSK  367

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA LG+LFKGAE+LE L+ +K++AFDKTGTITRGEF V  F SL + ++ NTLL W+SSI
Sbjct  368   AATLGVLFKGAEHLETLSGIKIMAFDKTGTITRGEFLVVDFKSLHNDVSFNTLLHWISSI  427

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E KSSHPMA A++D+A++  +E  P+ VE F+NFPGEGIYG+I+  EI+IGNKKI +RAG
Sbjct  428   ECKSSHPMAAALVDFARARGIEAKPDIVEEFENFPGEGIYGKIEDNEIHIGNKKIVSRAG  487

Query  2871  CTSVPEFD-VDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
             C +VP  +  +  +G S+ Y+F+GS  AG+FSLSD CRTGA+EAI +L  +GIKTVMLTG
Sbjct  488   CNAVPTLEGYETDQGVSVGYVFLGSCPAGIFSLSDTCRTGAKEAIHELNSLGIKTVMLTG  547

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             DS+ AA   Q+QLGG L+  H+ELLPE K++IIK+ Q  G T MIGDG+NDAPALATA++
Sbjct  548   DSHGAAMRAQDQLGGGLEAIHSELLPEGKSRIIKELQAVGPTAMIGDGINDAPALATAEI  607

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMG+SGS LA E+G V+L +NDI +I KA  + ++V RK+I N+V+++ TK  ++ LA
Sbjct  608   GISMGVSGSALAMESGDVVLFSNDIRKIPKAYRIAKKVKRKIIENVVISMVTKVGVLGLA  667

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             +AGHPLVW AVL DVGTCL+VIFNS +LL+
Sbjct  668   VAGHPLVWVAVLTDVGTCLLVIFNSMMLLK  697



>gb|AFM38013.1| heavy metal ATPase 4-2 [Noccaea caerulescens]
Length=1194

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/693 (63%), Positives = 564/693 (81%), Gaps = 3/693 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SE+PLI+ ILK LDG+ + +++V ++TV+VVHD LLI+  QI +ALN
Sbjct  21    QKSYFDVLGLCCTSEIPLIENILKSLDGIKDYTIIVPSRTVIVVHDSLLISPFQIAKALN  80

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA++KV+GET+   K LPSP+AV  GI LLLSFLK+VY PL+WLAV     G +P+
Sbjct  81    QARLEANVKVDGETSFKNK-LPSPFAVFSGIFLLLSFLKFVYPPLRWLAVVGVATGIYPI  139

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L ++VA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M
Sbjct  140   LAKSVASIRRLRVDINILVIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKASSVM  199

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  200   QSLMSLAPQKAVIAETGEEVEVDEVELNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGE  259

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQ+DSTVWA TINLNGYIS+ TTA+A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  260   AFPVPKQRDSTVWAGTINLNGYISVNTTALASDCVVAKMAKLVEEAQSSKTKSQRLIDKY  319

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ ISA  AI  +  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  320   SQYYTPAIIIISAGFAIVPLIMKVRNLNHWFHLALVVLVSACPCGLILSTPVATFCALTK  379

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+ ++LL WVSS+
Sbjct  380   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLSSLLYWVSSV  439

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAG
Sbjct  440   ESKSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAG  499

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE DVD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD
Sbjct  500   CSTVPEIDVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGD  559

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+G
Sbjct  560   NQDSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIG  619

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ++GH+ILM+NDI RI KAI+L RR  RKV+ N+ ++I  K  I+ LA 
Sbjct  620   ISMGISGSALATQSGHIILMSNDIRRIPKAIKLARRAQRKVLENVFISITLKVGILVLAF  679

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             AGHPL+WAAVL DVGTCL+VIFNS LLLR  D+
Sbjct  680   AGHPLIWAAVLTDVGTCLIVIFNSMLLLREKDK  712



>ref|XP_010489457.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4 [Camelina 
sativa]
Length=1311

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/689 (64%), Positives = 567/689 (82%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV + SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  18    QKSYFDVLGICCTSEVPIIENILKSLDGVKDFSVIVPSRTVIVVHDSLLISPFQIAKALN  77

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGETN   K  PSP+AVV GILLLLSFLK+VY+PL+W+AVAA  AG +P+
Sbjct  78    QARLEANVRVNGETNFKNKW-PSPFAVVSGILLLLSFLKFVYSPLRWIAVAAVAAGIYPI  136

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L ++ A+++ L +DINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS+KA + M
Sbjct  137   LAKSFASIKRLRIDINILVIITVIATLAMQDFMEAAAVVFLFTIADWLETRASYKASSVM  196

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A +AETGE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  197   QSLMSLAPQKATIAETGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  256

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQ+DS VWA TINLNGY+++KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  257   AFPVPKQRDSIVWAGTINLNGYVTVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  316

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ ISAC AI  +  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  317   SQYYTPAIIIISACFAIVPIIMKVHNLTHWFHLALVVLVSACPCGLILSTPVATFCALTK  376

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I    LL WVSS+
Sbjct  377   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDITLRNLLYWVSSV  436

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+D+A+S SVEP PE+VE + NFPGEGIYG+IDG +IYIGNK+I++RAG
Sbjct  437   ESKSSHPMAATIVDHAKSVSVEPKPEEVEDYHNFPGEGIYGKIDGNDIYIGNKRIASRAG  496

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE +VD + GK++ Y++VG  LAGVFSLSDACR+G  +A+ +LK MGIKT MLTGD
Sbjct  497   CSTVPEIEVDTKGGKTVGYVYVGKRLAGVFSLSDACRSGVSQAMTELKFMGIKTAMLTGD  556

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S A+A H QEQLG  LD  H ELLPE+K++I+++F+K G T M+GDG+NDAPALATAD+G
Sbjct  557   SQASAMHAQEQLGNVLDVVHGELLPEDKSKIVQEFKKEGPTAMVGDGVNDAPALATADIG  616

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N+ ++I  KA I+ALA 
Sbjct  617   ISMGISGSALATQTGHIILMSNDIRRIPQAIKLARRARRKVVQNVFLSITFKAGILALAF  676

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VIFNS LLLR
Sbjct  677   AGHPLIWAAVLVDVGTCLLVIFNSMLLLR  705



>gb|AAL84162.1|AF412407_1 putative heavy metal transporter [Arabidopsis thaliana]
Length=1172

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/689 (64%), Positives = 570/689 (83%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  17    QKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGET+   K  PSP+AVV G+LLLLSFLK+VY+PL+WLAVAA  AG +P+
Sbjct  77    EARLEANVRVNGETSFKNKW-PSPFAVVSGLLLLLSFLKFVYSPLRWLAVAAVAAGIYPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A A+++   +DINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS+KA + M
Sbjct  136   LAKAFASIKRPRIDINILVIITVIATLAMQDFMEAAAVVFLFTISDWLETRASYKATSVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKVDT++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  196   QSLMSLAPQKAIIAETGEEVEVDEVKVDTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQ+DSTVWA TINLNGYI +KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  256   AFPVPKQRDSTVWAGTINLNGYICVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  315

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ +SAC+AI  V  KV N    +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  316   SQYYTPAIILVSACVAIVPVIMKVHNLKHWFHLALVVLVSGCPCGLILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K++AFDKTGTITRGEF V  F SL   IN  +LL WVSS+
Sbjct  376   AATSGLLIKSADYLDTLSKIKIVAFDKTGTITRGEFIVIDFKSLSRDINLRSLLYWVSSV  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEGIYG+IDG +I+IGNKKI++RAG
Sbjct  436   ESKSSHPMAATIVDYAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIFIGNKKIASRAG  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE +VD + GK++ Y++VG  LAG F+LSDACR+G  +A+ +LK +GIKT MLTGD
Sbjct  496   CSTVPEIEVDTKGGKTVGYVYVGERLAGFFNLSDACRSGVSQAMAELKSLGIKTAMLTGD  555

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             + AAA H QEQLG  LD  H +LLPE+K++II++F+K G T M+GDG+NDAPALATAD+G
Sbjct  556   NQAAAMHAQEQLGNVLDVVHGDLLPEDKSRIIQEFKKEGPTAMVGDGVNDAPALATADIG  615

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TG++ILM+NDI RI +A++L RR  RKV+ N+ ++I  KA I+ALA 
Sbjct  616   ISMGISGSALATQTGNIILMSNDIRRIPQAVKLARRARRKVVENVCLSIILKAGILALAF  675

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VIFNS LLLR
Sbjct  676   AGHPLIWAAVLVDVGTCLLVIFNSMLLLR  704



>ref|NP_179501.1| putative cadmium/zinc-transporting ATPase HMA4 [Arabidopsis thaliana]
 sp|O64474.2|HMA4_ARATH RecName: Full=Putative cadmium/zinc-transporting ATPase HMA4; 
AltName: Full=Protein HEAVY METAL ATPASE 4; AltName: Full=Putative 
cadmium/zinc-transporting ATPase 2 [Arabidopsis thaliana]
 gb|AAD12041.1| putative cadmium-transporting ATPase [Arabidopsis thaliana]
 emb|CAC19544.1| putative heavy metal transporter [Arabidopsis thaliana]
 gb|AAM19954.1| At2g19110/T20K24.12 [Arabidopsis thaliana]
 dbj|BAE99154.1| putative heavy metal transporter [Arabidopsis thaliana]
 gb|AEC06848.1| putative cadmium/zinc-transporting ATPase HMA4 [Arabidopsis thaliana]
Length=1172

 Score =   894 bits (2310),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/689 (64%), Positives = 570/689 (83%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  17    QKSYFDVLGICCTSEVPIIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGET+   K  PSP+AVV G+LLLLSFLK+VY+PL+WLAVAA  AG +P+
Sbjct  77    EARLEANVRVNGETSFKNKW-PSPFAVVSGLLLLLSFLKFVYSPLRWLAVAAVAAGIYPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A A+++   +DINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS+KA + M
Sbjct  136   LAKAFASIKRPRIDINILVIITVIATLAMQDFMEAAAVVFLFTISDWLETRASYKATSVM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKVDT++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  196   QSLMSLAPQKAIIAETGEEVEVDEVKVDTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQ+DSTVWA TINLNGYI +KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  256   AFPVPKQRDSTVWAGTINLNGYICVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  315

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ +SAC+AI  V  KV N    +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  316   SQYYTPAIILVSACVAIVPVIMKVHNLKHWFHLALVVLVSGCPCGLILSTPVATFCALTK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K++AFDKTGTITRGEF V  F SL   IN  +LL WVSS+
Sbjct  376   AATSGLLIKSADYLDTLSKIKIVAFDKTGTITRGEFIVIDFKSLSRDINLRSLLYWVSSV  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEGIYG+IDG +I+IGNKKI++RAG
Sbjct  436   ESKSSHPMAATIVDYAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIFIGNKKIASRAG  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE +VD + GK++ Y++VG  LAG F+LSDACR+G  +A+ +LK +GIKT MLTGD
Sbjct  496   CSTVPEIEVDTKGGKTVGYVYVGERLAGFFNLSDACRSGVSQAMAELKSLGIKTAMLTGD  555

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             + AAA H QEQLG  LD  H +LLPE+K++II++F+K G T M+GDG+NDAPALATAD+G
Sbjct  556   NQAAAMHAQEQLGNVLDVVHGDLLPEDKSRIIQEFKKEGPTAMVGDGVNDAPALATADIG  615

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TG++ILM+NDI RI +A++L RR  RKV+ N+ ++I  KA I+ALA 
Sbjct  616   ISMGISGSALATQTGNIILMSNDIRRIPQAVKLARRARRKVVENVCLSIILKAGILALAF  675

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VIFNS LLLR
Sbjct  676   AGHPLIWAAVLVDVGTCLLVIFNSMLLLR  704



>ref|XP_006474239.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Citrus 
sinensis]
Length=1005

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/688 (65%), Positives = 559/688 (81%), Gaps = 3/688 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVPLI+ ILK L+GV EVSV+V ++TV+V+HD LLI+QHQIV+ALN
Sbjct  10    QKSYFDVLGICCSSEVPLIENILKSLEGVKEVSVIVPSRTVIVLHDALLISQHQIVKALN  69

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A  EA+++  G T+   K  PSPYA+ CG+LL +S LKYVY PL+W A+ A   G FP+
Sbjct  70    QARFEANVRAYGGTSY-QKKWPSPYAMACGVLLAISILKYVYHPLRWFALGAVAIGIFPI  128

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + + +AA+RN  LDINIL++I+V+G+I ++DY EA  IVFLFT  EWLESRASHKA A M
Sbjct  129   ILKGLAAIRNFKLDINILVLIAVIGTIAMNDYIEAGIIVFLFTIAEWLESRASHKATAVM  188

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+A++A TGE +DA +VK++T+LAVKAGEVIPIDGIVV+G+CEVDEKTLTGE
Sbjct  189   SSLMSIAPQKAIIAGTGEEVDAGEVKLNTVLAVKAGEVIPIDGIVVDGKCEVDEKTLTGE  248

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ V KQK STVWA TINLNGYIS++TTAVAEDC VA+MAKLVEEAQ++KSR QR +DK 
Sbjct  249   SYPVSKQKGSTVWAGTINLNGYISVETTAVAEDCVVAKMAKLVEEAQNSKSRIQRFVDKF  308

Query  3405  AKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA++ ISAC+A+   A+ V N  + +HLALVVLVSACPCAL+LSTPV  +CAL++
Sbjct  309   SQYYTPAVIFISACVAVIPIALGVSNHKQWFHLALVVLVSACPCALILSTPVVTYCALTK  368

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YL+ LAKV+ +AFDKTGTITRGEF ++ F  L + IN NTLL WVSSI
Sbjct  369   AATSGLLIKGGDYLQTLAKVRFMAFDKTGTITRGEFVMSEFQPLSEDINLNTLLYWVSSI  428

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPM+ A+++Y +S S+EP PE VE +QNFPGEGIYG+I G EIYIGN+KI+ RAG
Sbjct  429   ESKSSHPMSAALVEYGRSLSIEPKPEDVEDYQNFPGEGIYGKIGGEEIYIGNRKIAQRAG  488

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP  D    +G ++ YIF+G+S  G+F LSDACRTGA EA+ +LK +GI+T MLTGD
Sbjct  489   CGTVPSVDGPKMKGNTIGYIFLGASPVGIFCLSDACRTGAAEAVNQLKSLGIRTAMLTGD  548

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             + AAA   QEQLG AL+  H+ELLPE+KA+II +F++ G+T MIGDG+NDAPALATAD+G
Sbjct  549   NQAAAMQAQEQLGNALNVVHSELLPEDKAKIINQFKQEGKTAMIGDGINDAPALATADIG  608

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG VILM+NDI ++ +AI L R+   KVI NI V+I TKA I+ALA+
Sbjct  609   ISMGISGSALATETGQVILMSNDIRKVPEAIRLARKAHWKVIENIAVSIATKAGIIALAL  668

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
              GHPLVWAAVL DVGTCL+VI NS LLL
Sbjct  669   GGHPLVWAAVLADVGTCLIVILNSMLLL  696



>ref|XP_010688419.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3 [Beta vulgaris 
subsp. vulgaris]
Length=1136

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/698 (65%), Positives = 560/698 (80%), Gaps = 6/698 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             NNN  EKSYFDV+G+CC SEVPLI+KILK L+GV EVSV+V ++TV+V+HD L+I+QHQI
Sbjct  16    NNNSLEKSYFDVLGLCCSSEVPLIEKILKPLEGVIEVSVIVPSRTVIVLHDTLVISQHQI  75

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V G TN   K  PSPY ++ G+LL LSFLKYVY PL+WLAVAA   
Sbjct  76    VKALNQARLEANVRVKGITNYRGKW-PSPYVILSGLLLSLSFLKYVYHPLQWLAVAAVAV  134

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+L R V A+RN TLD+NILM+I+V+G+IVL DY EA TIVFLFT  EWL+SRAS K
Sbjct  135   GIWPILLRGVIAIRNFTLDVNILMLIAVIGTIVLKDYTEAGTIVFLFTIAEWLQSRASQK  194

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A MSSL+++  Q+A +AETGE+++   VK++TILAVKAGE++PIDG+VVEG CEVDEK
Sbjct  195   ATAVMSSLMSMTPQQATIAETGEVVNVKDVKLNTILAVKAGELLPIDGVVVEGTCEVDEK  254

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGESF VPKQKDS VWA T+N+NGY+S+KTTA+AEDCAVA+MA+LVEEAQ+NKS  QR
Sbjct  255   TLTGESFPVPKQKDSNVWAGTVNVNGYVSVKTTALAEDCAVAKMARLVEEAQNNKSNVQR  314

Query  3420  SIDKIAKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              IDK A YYTPA+V ISA LA+   A+K+ +R   +HLALVVLVSACPC L+LSTPVA F
Sbjct  315   LIDKCAMYYTPAVVLISAGLAVVPIAMKLHDRKHWFHLALVVLVSACPCGLILSTPVATF  374

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CALSRAA  GLL KG +YLEILAK+K +AFDKTGTITRGEFT+    SL D +    LL 
Sbjct  375   CALSRAATSGLLVKGGDYLEILAKIKHMAFDKTGTITRGEFTLTDIHSLADYVTLTELLH  434

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSSIESKSSHP+A  ++DY +S  VEP  + VE FQNFPGEG++G+I+G  IYIGN+K+
Sbjct  435   WVSSIESKSSHPVAAVLVDYGRSQGVEPKQDNVEDFQNFPGEGVFGKINGRNIYIGNEKL  494

Query  2886  SARAGCT---SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGI  2716
               RA CT   ++ + D   +E ++  Y++   +L G FSLSD CR+GA EAI++LK MGI
Sbjct  495   GQRANCTVASNIVDADDHTKEARTRGYVYSEGALIGTFSLSDDCRSGAAEAIKELKSMGI  554

Query  2715  KTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAP  2536
             +T +LTGD+++ AR  QEQLG ALD  HAELLPE+KA IIK ++K G T M+GDG+NDAP
Sbjct  555   RTALLTGDNWSTARRAQEQLGQALDAVHAELLPEDKAIIIKDYKKDGFTAMVGDGVNDAP  614

Query  2535  ALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTK  2356
             ALATADVGISMG+SGS LA ETGHVILM+NDI +I KAI+L R+  RKVI NIV +I  K
Sbjct  615   ALATADVGISMGVSGSALATETGHVILMSNDIRKIPKAIKLARKTRRKVIENIVFSITAK  674

Query  2355  AAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             A ++A AIAGHPLVW AVLVDV TCL+VIFNS LLLRG
Sbjct  675   AGVIAFAIAGHPLVWLAVLVDVLTCLMVIFNSMLLLRG  712



>gb|KHN22672.1| Cadmium/zinc-transporting ATPase 3 [Glycine soja]
Length=1096

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/691 (65%), Positives = 564/691 (82%), Gaps = 3/691 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK L+G+ EVSV+V ++TV+VVHD L+I+Q QIV+ALN
Sbjct  9     QKSYFDVLGLCCSSEVPLIENILKPLEGIKEVSVIVPSRTVIVVHDTLVISQLQIVKALN  68

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+V G+     K  PSPY++  G+LLLLS LK+V+ PLK+LA+ A   G++P+
Sbjct  69    QARLEANIRVYGDEKH-QKRWPSPYSIASGVLLLLSLLKFVFHPLKYLALGAVAVGAYPI  127

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +A+ ++RNL LDINILM+I+V+G+IV++DY EA TIVFLF+  EWLESRASHKA A M
Sbjct  128   ILKAIVSIRNLRLDINILMLIAVIGTIVMNDYLEAGTIVFLFSIAEWLESRASHKANAVM  187

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+N+  Q+AV+AETGE++DA++VK+DT+LAVKAGEVIPIDG+V++G CEVDEKTLTGE
Sbjct  188   SSLMNITPQKAVIAETGEVVDADEVKIDTVLAVKAGEVIPIDGVVLDGTCEVDEKTLTGE  247

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDC VA+MAKLVEEAQ++K+  QR IDK 
Sbjct  248   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVVAKMAKLVEEAQNSKTSIQRLIDKF  307

Query  3405  AKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AK+YTP +V ISA +A+  + ++  +E++  H ALVVLVSACPCAL+LSTPVA FCA S+
Sbjct  308   AKFYTPGVVIISALVAVIPLALKQHNEKHWLHFALVVLVSACPCALILSTPVATFCAYSK  367

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG ++LE LAK+KV+AFDKTGTIT+GEF V HF SL D I+ NTL  WVSSI
Sbjct  368   AATSGLLIKGGDHLETLAKIKVMAFDKTGTITKGEFVVTHFQSLSDDIDLNTLAYWVSSI  427

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP+A AI+DY +S SVEP PEKV  F+NFPGEGI G+I+G  IYIGNKKI+ RAG
Sbjct  428   ESKSSHPLAAAIVDYGRSLSVEPEPEKVTEFENFPGEGICGKIEGRVIYIGNKKIATRAG  487

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +VP    +   GK+  YI++G++  G FSLSD CR G QEAI +LK +GIKT MLTGD
Sbjct  488   SETVPILQGEIERGKTTGYIYLGATPLGFFSLSDTCRLGVQEAIGQLKSLGIKTAMLTGD  547

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S +AA   QEQLG +L+  HAELLPE+K +II +F+K G T MIGDGLNDAPALA AD+G
Sbjct  548   SQSAAMQAQEQLGHSLELVHAELLPEDKVKIISEFKKEGPTAMIGDGLNDAPALAAADIG  607

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG++ILM+NDI +I +AI+L R+  RKV+ NIV++I TKAAI+ LAI
Sbjct  608   ISMGISGSALASETGNIILMSNDIRKIPEAIKLARKARRKVLENIVLSIMTKAAILGLAI  667

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGG  2239
              GHPLVWAAV+ DVGTCL+VIFNS LLLR G
Sbjct  668   GGHPLVWAAVVADVGTCLLVIFNSMLLLRKG  698



>gb|AAS89468.1| P1B-type heavy metal transporting ATPase [Noccaea caerulescens]
Length=1186

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/691 (63%), Positives = 558/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+PLI+ ILK LDGV E +V+V ++TV+VVHD LLI   QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPLIENILKSLDGVKEYTVIVPSRTVIVVHDSLLIPPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K  PSP+AVV GI LL SFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-PSPFAVVSGIFLLPSFLKFVYPPLRWLAVVGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++R L +DINIL+II+V  ++ + DY EAA +VFLFTT +WLE+RAS+KA + M S
Sbjct  142   KAVASIRRLRVDINILIIITVAATLAMQDYMEAAAVVFLFTTADWLETRASYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTV A T+NLNGYIS+ TTA+A DC VA+MAKLVEEAQ +K+++QR IDK ++
Sbjct  262   PVPKQRDSTVLAGTMNLNGYISVNTTALASDCVVAKMAKLVEEAQGSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPAIMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A +L+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+ES
Sbjct  382   TSGLLIKSAGHLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLRSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD ++GK++ Y++VG  LAGVF+LSDACR+G  +A++ LK +GIKT MLTGD+ 
Sbjct  502   TVPEIEVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKGLKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N++++I  K  I+ LA AG
Sbjct  622   MGISGSALATQTGHIILMSNDIRRIPQAIKLARRAQRKVLQNVIISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVILNSMLLLREKDK  712



>ref|XP_006593523.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4-like 
[Glycine max]
Length=1096

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/691 (65%), Positives = 564/691 (82%), Gaps = 3/691 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK L+G+ EVSV+V ++TV+VVHD L+I+Q QIV+ALN
Sbjct  9     QKSYFDVLGLCCSSEVPLIENILKPLEGIKEVSVIVPSRTVIVVHDTLVISQLQIVKALN  68

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+V G+     K  PSPY++  G+LLLLS LK+V+ PLK+LA+ A   G++P+
Sbjct  69    QARLEANIRVYGDEKH-QKRWPSPYSIASGVLLLLSLLKFVFHPLKYLALGAVAVGAYPI  127

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +A+ ++RNL LDINILM+I+V+G+IV++DY EA TIVFLF+  EWLESRASHKA A M
Sbjct  128   ILKAIVSIRNLRLDINILMLIAVIGTIVMNDYLEAGTIVFLFSIAEWLESRASHKANAVM  187

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+N+  Q+AV+AETGE++DA++VK+DT+LAVKAGEVIPIDG+V++G CEVDEKTLTGE
Sbjct  188   SSLMNITPQKAVIAETGEVVDADEVKIDTVLAVKAGEVIPIDGVVLDGTCEVDEKTLTGE  247

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDC VA+MAKLVEEAQ++K+  QR IDK 
Sbjct  248   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVVAKMAKLVEEAQNSKTSIQRLIDKF  307

Query  3405  AKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AK+YTP +V ISA +A+  + ++  +E++  H ALVVLVSACPCAL+LSTPVA FCA S+
Sbjct  308   AKFYTPGVVIISALVAVIPLALKQHNEKHWLHFALVVLVSACPCALILSTPVATFCAYSK  367

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG ++LE LAK+KV+AFDKTGTIT+GEF V HF SL D I+ NTL  WVSSI
Sbjct  368   AATSGLLIKGGDHLETLAKIKVMAFDKTGTITKGEFVVTHFQSLSDDIDLNTLAYWVSSI  427

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP+A AI+DY +S SVEP PEKV  F+NFPGEGI G+I+G  IYIGNKKI+ RAG
Sbjct  428   ESKSSHPLAAAIVDYGRSLSVEPEPEKVTEFENFPGEGICGKIEGRVIYIGNKKIATRAG  487

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +VP    +   GK+  YI++G++  G FSLSD CR G QEAI +LK +GIKT MLTGD
Sbjct  488   SETVPILQGEIERGKTTGYIYLGATPLGFFSLSDTCRLGVQEAIGQLKSLGIKTAMLTGD  547

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S +AA   QEQLG +L+  HAELLPE+K +II +F+K G T MIGDGLNDAPALA AD+G
Sbjct  548   SQSAAMQAQEQLGHSLELVHAELLPEDKVKIISEFKKEGPTAMIGDGLNDAPALAAADIG  607

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG++ILM+NDI +I +AI+L R+  RKV+ NIV++I TKAAI+ LAI
Sbjct  608   ISMGISGSALASETGNIILMSNDIRKIPEAIKLARKARRKVLENIVLSIMTKAAILGLAI  667

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGG  2239
              GHPLVWAAV+ DVGTCL+VIFNS LLLR G
Sbjct  668   GGHPLVWAAVVADVGTCLLVIFNSMLLLRKG  698



>emb|CAD98808.1| putative heavy metal transporting P-type ATPase [Noccaea caerulescens]
Length=1186

 Score =   892 bits (2304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/691 (63%), Positives = 557/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+PLI+ ILK LDGV E +V+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPLIENILKSLDGVKEYTVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K  PSP+AVV GI LLLSFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-PSPFAVVSGIFLLLSFLKFVYPPLRWLAVVGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+R S+KA + M S
Sbjct  142   KAVASIRRLRVDINILVIITVAATLAMQDYMEAAAVVFLFTIADWLETRTSYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTV A T+NLNGYIS+ TTA+A DC VA+MAKLVEEAQ +K+++QR IDK ++
Sbjct  262   PVPKQRDSTVLAGTMNLNGYISVNTTALASDCVVAKMAKLVEEAQGSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  + +KV N +  +HLALVVLVSACP  L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPAIMKVHNLNHWFHLALVVLVSACPSGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLRSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIEVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS L  +TGH+ILM+NDI RI +AI+L RR  RKV+ N+ ++I  K  I+ LA AG
Sbjct  622   MGISGSALTTQTGHIILMSNDIRRIPQAIKLARRAQRKVLQNVFISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVILNSMLLLREKDK  712



>gb|AFM38012.1| heavy metal ATPase 4-1 [Noccaea caerulescens]
Length=1190

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/693 (62%), Positives = 560/693 (81%), Gaps = 3/693 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SE+PLI+ ILK LDG+ + +++V ++TV+VVHD LLI+  QI +ALN
Sbjct  21    QKSYFDVLGLCCTSEIPLIENILKSLDGIKDYTIIVPSRTVIVVHDSLLISPFQIAKALN  80

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA++KV+GET+   K LPSP+AV  GI LLLSFLK+VY PL+WLAV     G +P+
Sbjct  81    QARLEANVKVDGETSFKNK-LPSPFAVFSGIFLLLSFLKFVYPPLRWLAVVGVATGIYPI  139

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L ++VA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M
Sbjct  140   LAKSVASIRRLRVDINILVIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKASSVM  199

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  200   QSLMSLAPQKAVIAETGEEVEVDEVELNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGE  259

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQ+DSTVWA TINLNGYIS+ TTA+A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  260   AFPVPKQRDSTVWAGTINLNGYISVNTTALASDCVVAKMAKLVEEAQSSKTKSQRLIDKY  319

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ ISA  AI  +  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  320   SQYYTPAIIIISAGFAIVPLIMKVRNLNHWFHLALVVLVSACPCGLILSTPVATFCALTK  379

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+ ++LL WVSS+
Sbjct  380   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLSSLLYWVSSV  439

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAG
Sbjct  440   ESKSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAG  499

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE DVD ++GK++ Y++VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD
Sbjct  500   CSTVPEIDVDTKKGKTVGYVYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGD  559

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  +A   QEQLG ALD  H ELLPE+K++  K  +K G T M+GDG+NDAPALA AD+G
Sbjct  560   NQDSAMQAQEQLGNALDVVHGELLPEDKSKSYKSLRKKGPTCMVGDGVNDAPALANADIG  619

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ++GH+ILM+NDI RI KAI+L RR  RKV+ N+ ++I  K  I+ LA 
Sbjct  620   ISMGISGSALATQSGHIILMSNDIRRIPKAIKLARRAQRKVLENVFISITLKVGILVLAF  679

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             AGHPL+WAAVL DVGTCL+VIFNS LLLR  D+
Sbjct  680   AGHPLIWAAVLTDVGTCLIVIFNSMLLLREKDK  712



>ref|XP_006296837.1| hypothetical protein CARUB_v10012822mg [Capsella rubella]
 gb|EOA29735.1| hypothetical protein CARUB_v10012822mg [Capsella rubella]
Length=1321

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/687 (65%), Positives = 565/687 (82%), Gaps = 3/687 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SEVP+I+ ILK LDGV + SV+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  20    SYFDVLGICCTSEVPIIENILKSLDGVKDFSVIVPSRTVIVVHDSLLISPSQIAKALNQA  79

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KV GE N   K  PSP+AVV GILLLLSFLK+VY+PL+W+AVAA  AG +P+L 
Sbjct  80    RLEANVKVTGEANFKNKW-PSPFAVVSGILLLLSFLKFVYSPLRWIAVAAVAAGIYPILA  138

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +A A++R L +DINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS+KA A M S
Sbjct  139   KAFASIRRLRVDINILVIITVIATLAMQDFMEAAAVVFLFTIADWLETRASYKASAVMQS  198

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+A++AETGE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  199   LMSLAPQKAIIAETGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  258

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTVWA TINLNGYI++KTT++A DC VA+MAKLVEEAQS+K+++QR IDK ++
Sbjct  259   PVPKQRDSTVWAGTINLNGYITVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKCSQ  318

Query  3399  YYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISAC AI  V  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  319   YYTPAIIIISACFAIVPVIMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  378

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F +L   I   +LL WVSS+ES
Sbjct  379   TSGLLIKSADYLDTLSKIKITAFDKTGTITRGEFIVIDFKTLSKDITLRSLLYWVSSVES  438

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+D+A+S SVEP P++VE +QNFPGEGIYG+IDG  IYIGNK+I++RAGC+
Sbjct  439   KSSHPMAATIVDHAKSVSVEPRPDEVEDYQNFPGEGIYGKIDGNNIYIGNKRIASRAGCS  498

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD + GK++ YI+V   LAGVFSLSDACR+G  +A+ +LK MGIKT MLTGD+ 
Sbjct  499   TVPETEVDIKGGKTVGYIYVEERLAGVFSLSDACRSGVSQAMTELKSMGIKTAMLTGDNQ  558

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
             A+A H QEQLG  LD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+GIS
Sbjct  559   ASAMHAQEQLGNVLDVVHGELLPEDKSKIIQEFKKEGPTAMVGDGVNDAPALATADIGIS  618

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N+ ++I  KA I+ALA AG
Sbjct  619   MGISGSALATQTGHIILMSNDIRRIPQAIKLARRARRKVVQNVFLSITFKAGILALAFAG  678

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             HPL+WAAVLVDVGTCL+VIFNS LLLR
Sbjct  679   HPLIWAAVLVDVGTCLLVIFNSMLLLR  705



>gb|ADZ73052.1| P1B-type ATPase 4-2 [Noccaea caerulescens]
Length=1187

 Score =   890 bits (2301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/691 (63%), Positives = 557/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SE+PLI+ ILK LDGV E +V+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCTSEIPLIENILKSLDGVKEYTVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KVNGET+   K  PSP+AVV GI LLLSFLK+VY PL+WLAV    AG +P+L 
Sbjct  83    RLEANVKVNGETSFKNKW-PSPFAVVSGIFLLLSFLKFVYPPLRWLAVVGVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++R L +DINIL+II+V  ++ + DY EAA +VFLFT  +WLE+RAS+KA + M S
Sbjct  142   KAVASIRRLRVDINILIIITVAATLAMQDYMEAAAVVFLFTIADWLETRASYKANSVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+AV+AETGE ++ ++V+++TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAVIAETGEEVEVDEVQLNTIIAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTV A T+NLNGYIS+ TTA+A DC VA+MAKLVEEAQ +K+++QR IDK ++
Sbjct  262   PVPKQRDSTVLAGTMNLNGYISVNTTALASDCVVAKMAKLVEEAQGSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ ISA  AI  + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIIISAGFAIVPAIMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  +LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIEFKSLSRDISLRSLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S SVEP  E+VE +QNFPGEGIYG+IDG  +YIGNK+I++RAGC+
Sbjct  442   KSSHPMAATIVDYAKSVSVEPRSEEVEDYQNFPGEGIYGKIDGNNVYIGNKRIASRAGCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD ++GK +   +VG  L GVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIEVDTKKGKIVGEDYVGERLTGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              +A   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALA AD+GIS
Sbjct  562   DSAMQAQEQLGNALDVVHGELLPEDKSKIIQEFKKEGPTCMVGDGVNDAPALANADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N++++I  K  I+ LA AG
Sbjct  622   MGISGSALATQTGHIILMSNDIRRIPQAIKLARRAQRKVLQNVIISITLKVGILVLAFAG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLTDVGTCLIVILNSMLLLREKDK  712



>gb|AFD32367.1| HMA2 transporter [Sedum alfredii]
Length=983

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/690 (65%), Positives = 565/690 (82%), Gaps = 3/690 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+YFDV+G+CC SEV LI+ ILK LDGV ++SV+V ++TV+VVHD LLI+  QIV+ALN
Sbjct  21    QKTYFDVLGLCCSSEVVLIENILKNLDGVKDISVIVPSRTVIVVHDELLISSLQIVKALN  80

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++  GE N   K  PSPYAV CG+LL++S  ++++ PL+W+++AA   G FP+
Sbjct  81    QARLEANVRNRGEANYRNKW-PSPYAVFCGVLLVVSLFQFLFRPLRWVSLAAVAVGIFPI  139

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               R+V AL+NLTLDINIL I +V+G+IVL DY EAATIVFLFT  EWLESRASHKA A M
Sbjct  140   AWRSVIALKNLTLDINILAIFAVIGTIVLKDYLEAATIVFLFTIAEWLESRASHKATAVM  199

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+N+  Q+AV+AETGE++DA+ VK++TILAVKAGEV+PIDGIVVEGE EVDEKTLTGE
Sbjct  200   SSLMNMAPQKAVIAETGEVVDADDVKINTILAVKAGEVVPIDGIVVEGESEVDEKTLTGE  259

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ VPK+KDSTV A T+NLNGYIS+KTTA+AEDC VA+MAKLVEEAQ+NKSR QR IDK 
Sbjct  260   SYPVPKRKDSTVLAGTMNLNGYISVKTTAIAEDCVVAKMAKLVEEAQNNKSRTQRFIDKC  319

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA++ I+  +A+  + +KV N  + YHLALVVLVSACPC L+LSTPVA FCALS+
Sbjct  320   AKYYTPAVLLIAIMVAVIPAVMKVHNIDQWYHLALVVLVSACPCGLILSTPVATFCALSK  379

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YLE LAK+K +AFDKTGTITRGEF V+ F SL   +  +TLL WVSSI
Sbjct  380   AATSGLLIKGGDYLETLAKIKTMAFDKTGTITRGEFVVSDFRSLRADLPLSTLLYWVSSI  439

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DY +S S+EP  ++V  + ++PGEGI+G+I G  +YIGNK+++ RA 
Sbjct  440   ESKSSHPMATALVDYGRSKSIEPKADEVGEYHSYPGEGIHGKIHGQHVYIGNKRMATRAH  499

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C S P  + +  EGK++ YI+ G++LAG+FSLSDACR+GA EA+ +LK MGI+TVMLTGD
Sbjct  500   CASGPISEGESMEGKTIGYIYTGTTLAGMFSLSDACRSGAAEAVNELKNMGIRTVMLTGD  559

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA H Q QLG AL+  +AELLPE+KA+II++ ++ GR  MIGDG+NDAPALATA +G
Sbjct  560   SQAAANHAQAQLGNALERVYAELLPEDKARIIEELKRDGRVAMIGDGINDAPALATAYIG  619

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGI+GS LA ETG+VILM+NDI ++ +AI+L RR   KV+ N+++++ TK AI+ALAI
Sbjct  620   ISMGIAGSALATETGNVILMSNDIRKVPEAIKLARRAQTKVVQNVILSVVTKGAILALAI  679

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VIFNS LLLRG
Sbjct  680   AGHPLVWAAVLADVGTCLLVIFNSMLLLRG  709



>gb|KDP46636.1| hypothetical protein JCGZ_04570 [Jatropha curcas]
Length=972

 Score =   881 bits (2276),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/694 (65%), Positives = 561/694 (81%), Gaps = 3/694 (0%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             +N   +KSYFDV+G+CC SEVPLI+ ILK LDGV E SV+V T+TVVVVHD LL++Q QI
Sbjct  13    HNKKFQKSYFDVLGLCCSSEVPLIENILKSLDGVKEYSVIVPTRTVVVVHDNLLLSQLQI  72

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+++V+G+ +   K  PSP+AV  G+LLLLS LKYVY PL WLA+ A   
Sbjct  73    VKALNQARLEANVRVHGDIS-YQKKWPSPFAVASGVLLLLSLLKYVYHPLHWLALGAVAV  131

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G  P+  +A+A++RN  LD NIL++I+V+G++ L DY EA TIVFLFT  EWLESRA HK
Sbjct  132   GIIPIFLKAIASIRNFRLDTNILVLIAVIGTVALKDYAEAGTIVFLFTIAEWLESRAGHK  191

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A MSSL+N+  Q+AV+AETGE +D ++VK++TI+AVKAGE+IPIDG+VV+G  EVDEK
Sbjct  192   ANAVMSSLMNIAPQKAVIAETGEEVDVDEVKLNTIVAVKAGEIIPIDGVVVDGNSEVDEK  251

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGESF VPK KDSTVWA TINLNGY+++KTTA+AEDC VA+MAKLVEEAQ++KS  QR
Sbjct  252   TLTGESFPVPKLKDSTVWAGTINLNGYVNVKTTALAEDCVVAKMAKLVEEAQNSKSTTQR  311

Query  3420  SIDKIAKYYTPAIVAISACLA--ISAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              IDKIA+YYTPA++ ISA LA    A +V+N     HLALVVLVSACPCAL+LSTPVA F
Sbjct  312   FIDKIAQYYTPAVIIISASLAGVPLAFRVDNLKHWLHLALVVLVSACPCALILSTPVATF  371

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  G+L KG +YLE L+K+KV+AFDKTGTITRGEF V  F SL   I+ +TLL 
Sbjct  372   CALTKAATSGVLIKGGDYLETLSKIKVVAFDKTGTITRGEFVVVEFQSLCQDISIDTLLY  431

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVS IESKSSHPMA A++DY +S SVEP PE VE FQNFPGEGI+G+IDG EIYIGN+K+
Sbjct  432   WVSCIESKSSHPMAAALVDYGRSLSVEPRPENVEEFQNFPGEGIHGKIDGKEIYIGNRKM  491

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
               RAGC  +P  ++D + GK++ Y++ G++ AGVFSLSDACRTG  EAI +LK + IKT 
Sbjct  492   GIRAGCERIPLVEMDTKSGKTIGYVYSGATPAGVFSLSDACRTGVAEAIAELKSLRIKTA  551

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD  AAA H Q+QLG AL+  HAELLPE+KA+II+ F+K G+T MIGDGLNDAPALA
Sbjct  552   MLTGDGQAAAMHAQQQLGNALEIVHAELLPEDKARIIEAFKKEGKTAMIGDGLNDAPALA  611

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMGISGS LA ET HVILM+NDI ++ KAI+L ++  + VI N++++I TK+AI
Sbjct  612   TADIGISMGISGSALATETAHVILMSNDIRKVPKAIQLAKKAHKTVIQNVILSISTKSAI  671

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             +ALA AGHPL+WAAVL DVGTCL+VI NS LLLR
Sbjct  672   LALAFAGHPLIWAAVLADVGTCLLVILNSMLLLR  705



>gb|AFJ94635.1| P1B-ATPase 4 [Brassica juncea]
Length=1272

 Score =   890 bits (2300),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/692 (63%), Positives = 557/692 (80%), Gaps = 4/692 (1%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICCPSEVPLI  ILK LDG+ E SV+V T+TV+VVHD +LI+  QIV+ALN+A
Sbjct  23    SYFDVLGICCPSEVPLIVNILKSLDGIKEYSVIVPTRTVIVVHDSVLISPSQIVKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KV+G+T+   K  PSP+A+V GILLLLSF K+  +P +WLAVAA  AG +P+L 
Sbjct  83    RLEANVKVDGKTSFKNKW-PSPFAIVSGILLLLSFFKFACSPFRWLAVAAVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++    +DINIL+II+V  ++ + DY EAA +VFLFT  EWLE+RAS+KA A M S
Sbjct  142   KAVASIWRCRVDINILIIITVAATLAMQDYMEAAAVVFLFTIAEWLETRASYKANAVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+A++AETGE ++ + VKV+T +AVKAGE IPIDG VV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAIIAETGEEVEVDDVKVNTTVAVKAGETIPIDGTVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQKDSTVWA TINLN YIS+KTTA+A DC V +MAKLVEEAQS+++++QR IDK +K
Sbjct  262   PVPKQKDSTVWAGTINLNSYISVKTTALASDCVVTKMAKLVEEAQSSRTKSQRLIDKCSK  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ +S C+A   + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIILVSGCIAAVPAIMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHF-SSLLDGINHNTLLSWVSSIE  3049
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F  SL   I+  TLL WVSS+E
Sbjct  382   TSGLLIKSADYLDTLSKIKITAFDKTGTITRGEFIVVDFFKSLHRDISLRTLLYWVSSVE  441

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKSSHPMA  I+DYA+S  VEP  E+VE +Q FPGEGIYG+IDG ++YIGNK+I+ RA C
Sbjct  442   SKSSHPMAATIVDYAKSVDVEPKTEEVEDYQLFPGEGIYGKIDGNDVYIGNKRIALRAKC  501

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             ++VPE +VD +EGK++ YI+VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+
Sbjct  502   STVPEIEVDTKEGKTVGYIYVGERLAGVFNLSDACRSGVMQAMKELKDLGIKTAMLTGDN  561

Query  2688  YAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGI  2509
               AA H QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+GI
Sbjct  562   QDAAMHAQEQLGNALDVVHGELLPEDKSRIIQEFKKEGPTAMVGDGVNDAPALATADIGI  621

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS LA +TGH+ILM+NDI RI +AI+L RR   KV+ N++++I  K  I+ LAI 
Sbjct  622   SMGISGSALATQTGHIILMSNDIRRIPQAIKLARRARSKVVQNVIISIIFKVGILILAIC  681

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             GHPL+WAAVLVDVGTCL+VI NS LLLR  D+
Sbjct  682   GHPLIWAAVLVDVGTCLLVILNSMLLLREKDK  713



>ref|XP_009344843.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344844.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009344845.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X2 [Pyrus x bretschneideri]
Length=1043

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/694 (64%), Positives = 556/694 (80%), Gaps = 4/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI  ILK L+GV EVSV+V ++TV+VVHD LLI+Q QIV+ALN
Sbjct  16    QKSYFDVLGLCCSSEVPLIKNILKPLEGVKEVSVIVPSRTVIVVHDILLISQLQIVKALN  75

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++V G  +   K  PSPYA+  G+LL+LSFLKY Y PL WLA+ A   G FP+
Sbjct  76    QARLEANVRVYGAGDSYKKTWPSPYAIGSGVLLVLSFLKYTYRPLGWLALGAVALGIFPI  135

Query  3945  LRRAVAALRNLTL-DINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
               +  A++RN    DINIL+II+VVG+I L DY EAA+IVFLF   EWL+S A ++A A 
Sbjct  136   AMKGFASIRNFRFHDINILVIIAVVGTIALKDYTEAASIVFLFIIAEWLQSCAGYRAKAV  195

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSL+++  Q+AVLAE GE++D ++VK++TILAVKAGEVIPIDGIVVEG+ EVDEKTLTG
Sbjct  196   MSSLMSMAPQKAVLAENGEVVDVDEVKLNTILAVKAGEVIPIDGIVVEGKSEVDEKTLTG  255

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ES+ V K+KDSTVWA TINLNGYIS+KTTA+AEDCAVA+MAKLVEEAQ++K+R QR IDK
Sbjct  256   ESYPVAKEKDSTVWAGTINLNGYISVKTTALAEDCAVAKMAKLVEEAQNSKTRTQRFIDK  315

Query  3408  IAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              A +YTP+++ IS  +A+  +A+ V N S+ +HLALVVLVSACPC L+LSTPV  FC L+
Sbjct  316   CAMFYTPSVLVISVSIAVIPAALHVHNWSKWFHLALVVLVSACPCGLILSTPVVTFCTLT  375

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  GLL KG +Y+EILAKVK++AFDKTGTITRGEF V  F SL D I+ NTLL WV+S
Sbjct  376   KAATSGLLIKGGDYVEILAKVKIMAFDKTGTITRGEFVVMDFQSLRDDISLNTLLYWVAS  435

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IE KSSHPMA A++DY +S S+EP PE VE FQNFPGEGI G+IDG +IYIGN++I+ RA
Sbjct  436   IERKSSHPMADALVDYGRSLSIEPKPENVEEFQNFPGEGIRGKIDGQDIYIGNRRIALRA  495

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C  VP  +     GK++ YI+ G + AGVF++SDACR+GA EAIR+LK +GIKT MLTG
Sbjct  496   ACEIVPTTE-GSNGGKTIGYIYSGGTPAGVFTISDACRSGAAEAIRELKKLGIKTAMLTG  554

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             DS AA+ H  EQL  AL+  HAELLPE+KA+I+K+F+  G T M+GDG+NDAPALATAD+
Sbjct  555   DSNAASLHTNEQLKQALEVVHAELLPEDKARIVKEFKTEGNTAMVGDGINDAPALATADI  614

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LAQETG++IL++NDI ++ KA+ L RR  RKV+ N+V++I TK  I+AL 
Sbjct  615   GISMGISGSALAQETGNIILLSNDIRKLPKAVRLARRANRKVVENVVLSITTKVGILALG  674

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
              AGHPLVWAAVL DVGTC++VIFNS LLL+G  +
Sbjct  675   FAGHPLVWAAVLADVGTCMLVIFNSMLLLKGTQK  708



>ref|XP_010415052.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4 isoform 
X1 [Camelina sativa]
Length=1309

 Score =   891 bits (2302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/689 (64%), Positives = 569/689 (83%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVP+I+ ILK LDGV + SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  18    QKSYFDVLGICCTSEVPIIENILKSLDGVKDFSVIVPSRTVIVVHDSLLISPFQIAKALN  77

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++VNGETN   K  PSP+AVV G+LLLLSF+K+VY+PL+W+AVAA  AG +P+
Sbjct  78    QARLEANVRVNGETNFKNKW-PSPFAVVSGLLLLLSFIKFVYSPLRWIAVAAVAAGIYPI  136

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A A+++ L +DINIL+II+V+ ++ + D+ EAA +VFLFT  +WLE+RAS+KA + M
Sbjct  137   LAKAFASIKRLRIDINILVIITVIATLAMQDFMEAAAVVFLFTIADWLETRASYKASSVM  196

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  197   QSLMSLAPQKAIIAETGEEVEVDEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  256

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F VPKQ+DS VWA TINLNGY+++KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  257   AFPVPKQRDSMVWAGTINLNGYVTVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKC  316

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ ISAC AI  +  KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  317   SQYYTPAIIIISACFAIVPIIMKVHNLTHWFHLALVVLVSACPCGLILSTPVATFCALTK  376

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I   +LL WVSS+
Sbjct  377   AATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIVIDFKSLSRDITLRSLLYWVSSV  436

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  I+D+A+S SVEP PE+VE +QNFPGEGIYG+IDG +IYIGNK+I++RAG
Sbjct  437   ESKSSHPMAATIVDHAKSVSVEPRPEEVEDYQNFPGEGIYGKIDGNDIYIGNKRIASRAG  496

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C++VPE +VD + GK++ Y++VG  LAGVFSLSDACR+G  +A+ +LK MGIKT MLTGD
Sbjct  497   CSTVPEIEVDTKGGKTVGYVYVGERLAGVFSLSDACRSGVSQAMTELKSMGIKTAMLTGD  556

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S A+A H QEQLG  LD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+G
Sbjct  557   SQASAMHAQEQLGNVLDVVHGELLPEDKSKIIQEFKKEGPTAMVGDGVNDAPALATADIG  616

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA +TGH+ILM+NDI RI +AI+L RR  RKV+ N+ ++I  KA I+A A 
Sbjct  617   ISMGISGSALATQTGHIILMSNDIRRIPQAIKLARRARRKVVQNVFLSITFKAGILAFAF  676

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+WAAVLVDVGTCL+VIFNS LLLR
Sbjct  677   AGHPLIWAAVLVDVGTCLLVIFNSMLLLR  705



>ref|XP_008451413.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X2 [Cucumis melo]
Length=878

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/700 (62%), Positives = 555/700 (79%), Gaps = 8/700 (1%)
 Frame = -1

Query  4317  NNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIV  4138
             N   E+S+FDV+GICC SE+PLI+ ILK L+G+ +++V+V T+T++VVHD LLI+Q QIV
Sbjct  18    NKKFERSHFDVLGICCSSEIPLIENILKPLEGIKQITVIVPTRTLIVVHDSLLISQLQIV  77

Query  4137  RALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             +ALN+A LEA+I++ G+     K  PSPYA+  G+LL  SFLKYVY PL+WLAVAA  AG
Sbjct  78    KALNEARLEANIQLKGK-GIMKKKWPSPYAIASGLLLTASFLKYVYHPLRWLAVAAVAAG  136

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
              FP+L +A++A+R+L +D+NIL II+VVG+I + DY EA +IVFLF+  EWLESRAS KA
Sbjct  137   IFPILLKAISAIRHLRIDVNILAIIAVVGTIAMEDYMEAGSIVFLFSIAEWLESRASQKA  196

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
               AMSSL+ +  Q+A +AE+GE++D   VK+ ++L+VKAGEVIPIDGIVVEG CEVDEKT
Sbjct  197   NGAMSSLMRLAPQKATIAESGEVVDVRDVKLKSVLSVKAGEVIPIDGIVVEGNCEVDEKT  256

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             L+GE+F V KQKDS VWA TINLNGY+S++TT VAEDC VA+MA+LVEEAQ NKS+ Q  
Sbjct  257   LSGETFPVTKQKDSLVWAGTINLNGYVSVQTTVVAEDCVVAKMAELVEEAQKNKSKTQTF  316

Query  3417  IDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             ID+ AKYYTPA++ ISACLA   +A++V N S   HLALVVLVSACPCAL+LSTPVA FC
Sbjct  317   IDECAKYYTPAVIIISACLAAIPAALRVHNLSHWLHLALVVLVSACPCALILSTPVAAFC  376

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL++AA  G+L KG  +LE+LAK+KV+AFDKTGTITRGEF V HF +L D I+ NTLL W
Sbjct  377   ALTKAAMAGVLIKGGNHLEVLAKIKVMAFDKTGTITRGEFVVTHFQALRDDISFNTLLQW  436

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSSIESKSSHPMA A+++Y + HS++  PE VE F+NFPGEG+ G+IDG +IYIG+KKI+
Sbjct  437   VSSIESKSSHPMATALVNYGKLHSIDLKPENVEEFENFPGEGVRGKIDGNDIYIGSKKIA  496

Query  2883  ARAGCTSVPE---FDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIK  2713
             ARAG   +PE   FD + R+ +++ Y+F G ++ G F L D+CR+G +EAI ++K  GIK
Sbjct  497   ARAG-YDIPELNNFDDETRQEQTLGYVFCGGTIIGSFGLLDSCRSGVKEAIEEIKSFGIK  555

Query  2712  TVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAP  2536
             T MLTGD  AAA HVQEQLG   +  H+ELLP+EKA IIK+F+K  G   M+GDGLND P
Sbjct  556   TAMLTGDCRAAAMHVQEQLGNNFEVIHSELLPKEKANIIKEFKKNDGAIAMVGDGLNDTP  615

Query  2535  ALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTK  2356
             ALATAD+G+SMGISGS LA ETG+VILM+ND+ +I K I+L +    KV+ N++++I TK
Sbjct  616   ALATADIGMSMGISGSALATETGNVILMSNDMRKIPKVIKLAKTFHTKVVQNVILSIGTK  675

Query  2355  AAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
              AI+ LA AGHPL+WAAVL DVGTCL+VI NS LLLRG D
Sbjct  676   TAILGLAFAGHPLIWAAVLADVGTCLLVILNSMLLLRGTD  715



>ref|XP_008382647.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X1 [Malus domestica]
Length=1043

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/702 (64%), Positives = 561/702 (80%), Gaps = 9/702 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK L+GV EVSV+V ++TV+VVHD LLI+Q QIV+ALN
Sbjct  16    QKSYFDVLGLCCSSEVPLIENILKPLEGVKEVSVIVPSRTVIVVHDILLISQLQIVKALN  75

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++V G  +   K  PSPYA+  G+LL+LSFLK VY PL WLA+ A   G FP+
Sbjct  76    QARLEANVRVYGAGDSYKKTWPSPYAIGSGVLLVLSFLKSVYRPLGWLALGAVFLGIFPI  135

Query  3945  LRRAVAALRNLTL-DINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
               +  A++RN    DINIL+II+VVG+I L DY EAA+IVFLF   EWL+S A ++A A 
Sbjct  136   AMKGFASIRNFRFHDINILVIIAVVGTIALKDYTEAASIVFLFIIAEWLQSCAGYRAKAV  195

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSL+++  Q+AVLAE+GE++D ++VK+ TILAVKAGEVIPIDGIVVEG+ EVDE+TLTG
Sbjct  196   MSSLMSMAPQKAVLAESGEVVDVDEVKLYTILAVKAGEVIPIDGIVVEGKGEVDEQTLTG  255

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ES+ V K+KDSTVWA TINLNGYIS+KTTA+AEDCAVA+MAKLVEEAQS+K+R QR IDK
Sbjct  256   ESYPVAKEKDSTVWAGTINLNGYISVKTTALAEDCAVAKMAKLVEEAQSSKTRTQRFIDK  315

Query  3408  IAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              A +YTPA++ IS  +A+  +A+ V N S+ +HLALVVLVSACPC L+LSTP+  FC L+
Sbjct  316   CAMFYTPAVLVISVSIAVIPAALHVHNWSKWFHLALVVLVSACPCGLILSTPIVTFCTLT  375

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  GLL KG +Y+EILAKVK++AFDKTGTITRGEF V  F SL D I+ NTLL WV+S
Sbjct  376   KAATSGLLIKGGDYIEILAKVKIMAFDKTGTITRGEFVVMDFQSLRDDISLNTLLYWVAS  435

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IE KSSHPMA A++DY +S S+EP PE VE FQNFPGEGI+G+IDG +IYIGN+KI+ RA
Sbjct  436   IERKSSHPMADALVDYGRSLSIEPKPENVEEFQNFPGEGIHGKIDGQDIYIGNRKIALRA  495

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C  VP  +     GK++ YI+   + AGVF++SDACR+GA EAIR+LK +GIKT MLTG
Sbjct  496   ACEIVPTTE-GSNGGKTIGYIYSRGTPAGVFTISDACRSGAAEAIRELKKLGIKTAMLTG  554

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             DS AAA H  EQL  AL+  HAELLPE+KA+I+K+F+  G T M+GDG+NDAPALATAD+
Sbjct  555   DSNAAALHTNEQLKQALEVVHAELLPEDKARIVKEFKTEGNTAMVGDGINDAPALATADI  614

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LAQETG++IL++NDI ++ KA++L RR  RKV+ N+V++I TK  I+AL 
Sbjct  615   GISMGISGSALAQETGNIILLSNDIRKLPKAVQLARRANRKVVENVVLSITTKVGILALG  674

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLR-----GGDREAP  2224
              AGHPLVWAAVL DVGTC++VIFNS LLL+     GG+  AP
Sbjct  675   FAGHPLVWAAVLADVGTCMLVIFNSMLLLQGTQKHGGNTSAP  716



>ref|XP_008451398.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X1 [Cucumis melo]
 ref|XP_008451404.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X1 [Cucumis melo]
Length=881

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/702 (62%), Positives = 554/702 (79%), Gaps = 9/702 (1%)
 Frame = -1

Query  4317  NNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIV  4138
             N   E+S+FDV+GICC SE+PLI+ ILK L+G+ +++V+V T+T++VVHD LLI+Q QIV
Sbjct  18    NKKFERSHFDVLGICCSSEIPLIENILKPLEGIKQITVIVPTRTLIVVHDSLLISQLQIV  77

Query  4137  RALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             +ALN+A LEA+I++ G+     K  PSPYA+  G+LL  SFLKYVY PL+WLAVAA  AG
Sbjct  78    KALNEARLEANIQLKGK-GIMKKKWPSPYAIASGLLLTASFLKYVYHPLRWLAVAAVAAG  136

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
              FP+L +A++A+R+L +D+NIL II+VVG+I + DY EA +IVFLF+  EWLESRAS KA
Sbjct  137   IFPILLKAISAIRHLRIDVNILAIIAVVGTIAMEDYMEAGSIVFLFSIAEWLESRASQKA  196

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
               AMSSL+ +  Q+A +AE+GE++D   VK+ ++L+VKAGEVIPIDGIVVEG CEVDEKT
Sbjct  197   NGAMSSLMRLAPQKATIAESGEVVDVRDVKLKSVLSVKAGEVIPIDGIVVEGNCEVDEKT  256

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             L+GE+F V KQKDS VWA TINLNGY+S++TT VAEDC VA+MA+LVEEAQ NKS+ Q  
Sbjct  257   LSGETFPVTKQKDSLVWAGTINLNGYVSVQTTVVAEDCVVAKMAELVEEAQKNKSKTQTF  316

Query  3417  IDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             ID+ AKYYTPA++ ISACLA   +A++V N S   HLALVVLVSACPCAL+LSTPVA FC
Sbjct  317   IDECAKYYTPAVIIISACLAAIPAALRVHNLSHWLHLALVVLVSACPCALILSTPVAAFC  376

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL++AA  G+L KG  +LE+LAK+KV+AFDKTGTITRGEF V HF +L D I+ NTLL W
Sbjct  377   ALTKAAMAGVLIKGGNHLEVLAKIKVMAFDKTGTITRGEFVVTHFQALRDDISFNTLLQW  436

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSSIESKSSHPMA A+++Y + HS++  PE VE F+NFPGEG+ G+IDG +IYIG+KKI+
Sbjct  437   VSSIESKSSHPMATALVNYGKLHSIDLKPENVEEFENFPGEGVRGKIDGNDIYIGSKKIA  496

Query  2883  ARAG-----CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMG  2719
             ARAG      + +  FD + R+ +++ Y+F G ++ G F L D+CR+G +EAI ++K  G
Sbjct  497   ARAGYDIPVSSELNNFDDETRQEQTLGYVFCGGTIIGSFGLLDSCRSGVKEAIEEIKSFG  556

Query  2718  IKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLND  2542
             IKT MLTGD  AAA HVQEQLG   +  H+ELLP+EKA IIK+F+K  G   M+GDGLND
Sbjct  557   IKTAMLTGDCRAAAMHVQEQLGNNFEVIHSELLPKEKANIIKEFKKNDGAIAMVGDGLND  616

Query  2541  APALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAIC  2362
              PALATAD+G+SMGISGS LA ETG+VILM+ND+ +I K I+L +    KV+ N++++I 
Sbjct  617   TPALATADIGMSMGISGSALATETGNVILMSNDMRKIPKVIKLAKTFHTKVVQNVILSIG  676

Query  2361  TKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             TK AI+ LA AGHPL+WAAVL DVGTCL+VI NS LLLRG D
Sbjct  677   TKTAILGLAFAGHPLIWAAVLADVGTCLLVILNSMLLLRGTD  718



>ref|XP_004165203.1| PREDICTED: LOW QUALITY PROTEIN: cadmium/zinc-transporting ATPase 
HMA2-like [Cucumis sativus]
Length=1156

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/695 (63%), Positives = 559/695 (80%), Gaps = 3/695 (0%)
 Frame = -1

Query  4311  GAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRA  4132
             G +KSYFDV+GICC SE+P+I+ ILK ++G+ E+ V+V T+TV+V+HD LL++Q QIV+A
Sbjct  13    GLKKSYFDVLGICCSSEIPVIENILKDIEGIKEIRVIVATRTVIVLHDDLLVSQAQIVKA  72

Query  4131  LNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
             LN+A  EA+++  G+  D  K  PSPYAV  G+LLLLS LKYV    +W+A+AA  AG  
Sbjct  73    LNQARFEANVRAYGDQKDHRKKWPSPYAVASGLLLLLSLLKYVNPIFRWVALAAVAAGIL  132

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ ++ AA+R+L +DINIL +I+V+G+IVL DY EAATIVFLFT  EWLESRA+HKA A
Sbjct  133   PIVLKSFAAVRHLRIDINILALIAVIGTIVLKDYLEAATIVFLFTIAEWLESRAAHKANA  192

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q+AVLA+TGE++ A++VK+ T+LAVKAGE IPIDGIVVEG+CEVDEKTLT
Sbjct  193   VMSSLLSIAPQKAVLADTGEVVGADEVKLGTLLAVKAGEDIPIDGIVVEGKCEVDEKTLT  252

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF VPKQK+STVWA TINLNGY+++KTTA+AEDC VA+MAKLVEEAQ+NKSR QR ID
Sbjct  253   GESFPVPKQKNSTVWAGTINLNGYVTVKTTALAEDCVVAKMAKLVEEAQNNKSRTQRFID  312

Query  3411  KIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCAL  3238
             K AK+YTPA++ IS C+ +   A+++ NRS  +HLALVVLVSACPCAL+LSTPVA FCAL
Sbjct  313   KCAKFYTPAVIIISTCIVVIPLALRLPNRSHWFHLALVVLVSACPCALILSTPVASFCAL  372

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSL-LDGINHNTLLSWV  3061
             ++AA  GLL KG +YLE L K+K++AFDKTGTITRGEF V  F  L  D I+ +TLL WV
Sbjct  373   TKAATSGLLIKGGDYLETLGKIKIMAFDKTGTITRGEFMVTEFQVLDKDNISLDTLLYWV  432

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             SSIESKSSHPMA A++D+ +S S++P PE V+ FQNFPGEG++G IDG +IYIGN+KI+ 
Sbjct  433   SSIESKSSHPMAAALVDHGRSLSIDPKPENVDDFQNFPGEGVHGRIDGKDIYIGNRKIAT  492

Query  2880  RAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
             RA C +VPE   + ++G+++ YIF G+  AGVFSLSD+CRTGA+EA+ +L+ +GIKT ML
Sbjct  493   RANCATVPEIKDEAKDGRTVGYIFCGTIAAGVFSLSDSCRTGAKEAMDELRSLGIKTAML  552

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATA  2521
             TGDS AAA   Q++LG AL   HAELLP++K ++I  F+K G T MIGDGLNDAPALATA
Sbjct  553   TGDSSAAALQAQKELGKALQAVHAELLPQDKTRLINDFKKEGPTAMIGDGLNDAPALATA  612

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             D+GISMGISGS  A ETG VILMTNDI ++ KAI L RR   KVI N+++++  + AI+ 
Sbjct  613   DIGISMGISGSAXAIETGDVILMTNDIRKVPKAIRLARRANNKVIENVILSVVPRIAILG  672

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             LA  GHPLVWAAVL DVG C++VI NS LLLRG D
Sbjct  673   LAFGGHPLVWAAVLADVGACVLVILNSMLLLRGTD  707



>emb|CDY51090.1| BnaA07g36130D [Brassica napus]
Length=1088

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/691 (64%), Positives = 561/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICCPSEVP+I+ ILK L+G+ E SV+V T+TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCPSEVPIIENILKSLEGIKEYSVIVPTRTVIVVHDSLLISPSQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KV+G+T+   K  PSP+AV+ GILLLLSF K++Y+P +WLAVAA  AG +P+L 
Sbjct  83    RLEANVKVDGKTSFKNKW-PSPFAVISGILLLLSFFKFLYSPFRWLAVAAVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++R   +DINIL+II+V  ++ + DY EAA +VFLFT  EWLE+RAS+KA A M S
Sbjct  142   KAVASIRRCRVDINILIIITVAATLAMQDYMEAAAVVFLFTIAEWLETRASYKANAVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+A++AETGE ++ + VKV+TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAIIAETGEEVEVDDVKVNTIVAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTVWA TINLNGYIS+KTTA+A DC V +MAKLVEEAQS+K+++QR IDK ++
Sbjct  262   PVPKQRDSTVWAGTINLNGYISVKTTALASDCVVTKMAKLVEEAQSSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ IS C+A   + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIFISGCIAAVPAIMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  TLL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKITAFDKTGTITRGEFIVVDFKSLHGDISLRTLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S  VEP  E+VE +Q FPGEGIYG+IDG +IYIGNK+I++RA C+
Sbjct  442   KSSHPMAATIVDYAKSVDVEPRTEEVEDYQLFPGEGIYGKIDGNDIYIGNKRIASRARCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD + GK++ YI+VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIEVDTKGGKTVGYIYVGERLAGVFNLSDACRSGVIQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              AA   QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+GIS
Sbjct  562   DAAMDAQEQLGNALDVVHGELLPEDKSRIIQEFKKEGPTAMVGDGVNDAPALATADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TG +ILM+NDI RI +AI++ RR  RKV+ N+ ++I  K  I+ LAI G
Sbjct  622   MGISGSALATQTGDIILMSNDIRRIPQAIKIARRARRKVVQNVFISIIFKVGILILAICG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVLVDVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLVDVGTCLLVILNSMLLLREKDK  712



>ref|NP_001288715.1| cadmium/zinc-transporting ATPase HMA2-like [Cucumis sativus]
 gb|AIJ19561.1| heavy metal ATPase 4 [Cucumis sativus]
 gb|KGN65476.1| hypothetical protein Csa_1G423340 [Cucumis sativus]
Length=1231

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/695 (63%), Positives = 560/695 (81%), Gaps = 3/695 (0%)
 Frame = -1

Query  4311  GAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRA  4132
             G +KSYFDV+GICC SE+P+I+ ILK ++G+ E+ V+V T+TV+V+HD LL++Q QIV+A
Sbjct  13    GLKKSYFDVLGICCSSEIPVIENILKDIEGIKEIRVIVATRTVIVLHDDLLVSQAQIVKA  72

Query  4131  LNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
             LN+A  EA+++  G+  D  K  PSPYAV  G+LLLLS LKYV    +W+A+AA  AG  
Sbjct  73    LNQARFEANVRAYGDQKDHRKKWPSPYAVASGLLLLLSLLKYVNPIFRWVALAAVAAGIL  132

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ ++ AA+R+L +DINIL +I+V+G+IVL DY EAATIVFLFT  EWLESRA+HKA A
Sbjct  133   PIVLKSFAAVRHLRIDINILALIAVIGTIVLKDYLEAATIVFLFTIAEWLESRAAHKANA  192

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q+AVLA+TGE++ A++VK+ T+LAVKAGE IPIDGIVVEG+CEVDEKTLT
Sbjct  193   VMSSLLSIAPQKAVLADTGEVVGADEVKLGTLLAVKAGEDIPIDGIVVEGKCEVDEKTLT  252

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF VPKQK+STVWA TINLNGY+++KTTA+AEDC VA+MAKLVEEAQ+NKSR QR ID
Sbjct  253   GESFPVPKQKNSTVWAGTINLNGYVTVKTTALAEDCVVAKMAKLVEEAQNNKSRTQRFID  312

Query  3411  KIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCAL  3238
             K AK+YTPA++ IS C+ +   A+++ NRS  +HLALVVLVSACPCAL+LSTPVA FCAL
Sbjct  313   KCAKFYTPAVIIISTCIVVIPLALRLPNRSHWFHLALVVLVSACPCALILSTPVASFCAL  372

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSL-LDGINHNTLLSWV  3061
             ++AA  GLL KG +YLE L K+K++AFDKTGTITRGEF V  F  L  D I+ +TLL WV
Sbjct  373   TKAATSGLLIKGGDYLETLGKIKIMAFDKTGTITRGEFMVTEFQVLDKDNISLDTLLYWV  432

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             SSIESKSSHPMA A++D+ +S S++P PE V+ FQNFPGEG++G IDG +IYIGN+KI+ 
Sbjct  433   SSIESKSSHPMAAALVDHGRSLSIDPKPENVDDFQNFPGEGVHGRIDGKDIYIGNRKIAT  492

Query  2880  RAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
             RA C +VPE   + ++G+++ YIF G+  AGVFSLSD+CRTGA+EA+ +L+ +GIKT ML
Sbjct  493   RANCATVPEIKDEAKDGRTVGYIFCGTIAAGVFSLSDSCRTGAKEAMDELRSLGIKTAML  552

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATA  2521
             TGDS AAA   Q++LG AL   HAELLP++K ++I  F+K G T MIGDGLNDAPALATA
Sbjct  553   TGDSSAAALQAQKELGKALQAVHAELLPQDKTRLINDFKKEGPTAMIGDGLNDAPALATA  612

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             D+GISMGISGS LA ETG VILMTNDI ++ KAI L RR   KVI N+++++  + AI+ 
Sbjct  613   DIGISMGISGSALAIETGDVILMTNDIRKVPKAIRLARRANNKVIENVILSVVPRIAILG  672

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             LA  GHPLVWAAVL DVG C++VI NS LLLRG D
Sbjct  673   LAFGGHPLVWAAVLADVGACVLVILNSMLLLRGTD  707



>ref|XP_008376270.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Malus domestica]
Length=1058

 Score =   875 bits (2260),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/694 (64%), Positives = 554/694 (80%), Gaps = 4/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK L+GV  VSV V ++TV+VVHD LLI+Q QIV+ALN
Sbjct  16    QKSYFDVLGLCCASEVPLIENILKPLEGVKSVSVXVXSRTVIVVHDSLLISQLQIVKALN  75

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++V G  +   K  PSPYA+  G+LL+LSFLKY Y PL WLA+ A   G FPV
Sbjct  76    QARLEANVRVYGAGDIYKKTWPSPYAIGSGVLLVLSFLKYAYRPLGWLALGAVAVGIFPV  135

Query  3945  LRRAVAALRNLTL-DINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
               +  AA+RN    DINIL+II+V+G+I L DY EAA+IVFLFT  EWL+S A ++A A 
Sbjct  136   ALKCFAAIRNFRFHDINILVIIAVIGTIALKDYTEAASIVFLFTIAEWLQSSAGYRAKAV  195

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSL+++  Q AVLAE+GE++  ++VK++TILAVKAGE IPIDGIVVEG+ EVDEKTLTG
Sbjct  196   MSSLMSMAPQIAVLAESGEVVGVDEVKLNTILAVKAGEKIPIDGIVVEGKAEVDEKTLTG  255

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ES+ V K+KDSTVWA TINLNGYIS+KTT++AEDCAVA+MAKL+EEAQ++KSR QR IDK
Sbjct  256   ESYPVAKEKDSTVWAGTINLNGYISVKTTSLAEDCAVAKMAKLIEEAQNSKSRTQRFIDK  315

Query  3408  IAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              A +YTPA++ IS  +A+  +A+ V N  + +HLALVVLVSACPC L+LSTPV  FC L+
Sbjct  316   CAMFYTPAVLVISVSIAVIPAALHVHNWRKWFHLALVVLVSACPCGLILSTPVVTFCTLT  375

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  GLL KG +Y+EILAKVK++AFDKTGTITRGEF V  F SL D I+ NTLL WVSS
Sbjct  376   KAATSGLLIKGGDYIEILAKVKIMAFDKTGTITRGEFVVMDFQSLRDDISLNTLLYWVSS  435

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IE KSSHPMA A++DY +  SVEPNPE VE FQNFPGEGI+G+IDG +IYIGN+KI+ RA
Sbjct  436   IERKSSHPMADALVDYGRLFSVEPNPENVEEFQNFPGEGIHGKIDGQDIYIGNRKIALRA  495

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C  VP  +   + GK++ YI+ G + AGVF +SDACR+GA EA+++LK +GIKT MLTG
Sbjct  496   ACEIVPTIE-GSKGGKTIGYIYSGGAPAGVFXISDACRSGAAEALKELKKLGIKTAMLTG  554

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             DS AAA H  EQL  AL+   AELLPE+KA+II++F+  G T M+GDG+NDAPALATAD+
Sbjct  555   DSNAAALHTNEQLKQALEVVQAELLPEDKARIIREFKMEGNTAMVGDGINDAPALATADI  614

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LAQETG++IL++NDI ++ KA++L RR  RKVI N+ ++I  KA+I+AL 
Sbjct  615   GISMGISGSALAQETGNIILLSNDIRKLPKAVQLARRANRKVIENVALSITAKASILALG  674

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
              AGHPLVWAAVL D GTCL+VIFNS LLL+G ++
Sbjct  675   FAGHPLVWAAVLADAGTCLLVIFNSMLLLQGTNK  708



>gb|AIJ19560.1| heavy metal ATPase 3 [Cucumis sativus]
Length=869

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/698 (62%), Positives = 550/698 (79%), Gaps = 9/698 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             E+S+FDV+GICC SE+PLI+ ILK L G+ +++V+V T+T++VVHD LLI+Q QIV+ALN
Sbjct  2     ERSHFDVLGICCSSEIPLIENILKPLQGIKQITVIVPTRTLIVVHDSLLISQLQIVKALN  61

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I++ G+     K  PSPYA+  G+LL  SFLKYVY PL+WLAVAA  AG FP+
Sbjct  62    EARLEANIQLKGK-GIMKKKWPSPYAIASGLLLTASFLKYVYHPLRWLAVAAVAAGIFPI  120

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +A++A+R+L +D+NIL II+VVG+I + DY EA +IVFLF+  EWLESRASHKA  AM
Sbjct  121   LLKAISAIRHLRVDVNILAIIAVVGTIAMDDYMEAGSIVFLFSIAEWLESRASHKANGAM  180

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+ +  Q+A +AE+GE++D   VK+ ++L VKAGEVIPIDGIVVEG CEVDEKTL+GE
Sbjct  181   CSLMRLAPQKATIAESGEVVDVRDVKLKSVLGVKAGEVIPIDGIVVEGNCEVDEKTLSGE  240

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             +F V KQKDS VWA TINLNGYIS++TT VAEDC VA+MA+LVEEAQ+NKS+ Q  ID+ 
Sbjct  241   TFPVTKQKDSLVWAGTINLNGYISVQTTVVAEDCVVAKMAELVEEAQNNKSKTQTFIDEC  300

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V ISACLA   +A++V N     HLALVVLVSACPCAL+LSTPVA FCAL++
Sbjct  301   AKYYTPAVVIISACLAAIPAALRVHNLRHWLHLALVVLVSACPCALILSTPVAAFCALTK  360

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G+L KG  +LE+LAK+KV+AFDKTGTITRGEF V HF +L D IN +TLL WVSSI
Sbjct  361   AAMAGVLIKGGNHLEVLAKIKVMAFDKTGTITRGEFVVTHFQALRDDINFHTLLQWVSSI  420

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+++Y + HS++  PE VE F+NF GEG+ G+IDG +IYIG+KKI+ARAG
Sbjct  421   ESKSSHPMATALVNYGKLHSIDLKPENVEEFENFLGEGVRGKIDGNDIYIGSKKIAARAG  480

Query  2871  -----CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
                   + +  FD + R+ +++ Y+F G  + G F L D+CR+G +EAI ++K  GIKT 
Sbjct  481   YDIPVSSKLNNFDDETRQEQTLGYVFCGGMMIGSFGLLDSCRSGVKEAIEEIKSFGIKTA  540

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPAL  2530
             MLTGD  AAA HVQEQLG  LD  H+ELLP+EKA IIK+F+   G   M+GDGLND PAL
Sbjct  541   MLTGDCRAAAMHVQEQLGNTLDVIHSELLPKEKANIIKEFKNNDGAIAMVGDGLNDTPAL  600

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             ATAD+G+SMGISGS LA ETG+VILM+ND+ +I KAI+L +    KV+ N++++I TK A
Sbjct  601   ATADIGMSMGISGSALATETGNVILMSNDMRKIPKAIKLAKTFHTKVVQNVILSIGTKTA  660

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             I+ LA AGHPL+WAAVL DVGTCL+VI NS LLLRG D
Sbjct  661   ILGLAFAGHPLIWAAVLADVGTCLLVILNSMLLLRGMD  698



>ref|XP_009102202.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like [Brassica 
rapa]
Length=1287

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/691 (64%), Positives = 561/691 (81%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICCPSEVP+I+ ILK L+G+ E SV+V T+TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCPSEVPIIENILKSLEGIKEYSVIVPTRTVIVVHDSLLISPSQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEA++KV+G+T+   K  PSP+AV+ GILLLLSF K++Y+P +WLAVAA  AG +P+L 
Sbjct  83    RLEANVKVDGKTSFKNKW-PSPFAVISGILLLLSFFKFLYSPFRWLAVAAVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++    +DINIL+II+V  ++ + DY EAA +VFLFT  EWLE+RAS+KA A M S
Sbjct  142   KAVASIGRCRVDINILIIITVAATLAMQDYMEAAAVVFLFTIAEWLETRASYKANAVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+A++AETGE ++ + VKV+TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE+F
Sbjct  202   LMSLAPQKAIIAETGEEVEVDDVKVNTIVAVKAGETIPIDGIVVDGNCEVDEKTLTGEAF  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTVWA TINLNGYIS+KTTA+A DC V +MAKLVEEAQS+K+++QR IDK ++
Sbjct  262   PVPKQRDSTVWAGTINLNGYISVKTTALASDCVVTKMAKLVEEAQSSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ IS C+A   + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIIFISGCIAAVPAIMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+  TLL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKITAFDKTGTITRGEFIVVDFKSLHGDISLRTLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+S  VEP  E+VE +Q FPGEGIYG+IDG +IYIGNK+I++RA C+
Sbjct  442   KSSHPMAATIVDYAKSVDVEPRTEEVEDYQLFPGEGIYGKIDGNDIYIGNKRIASRAKCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD + GK++ YI+VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIEVDTKGGKTVGYIYVGERLAGVFNLSDACRSGVIQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              AA H QEQLG ALD  H ELLPE+K++II++F+K G T M+GDG+NDAPALATAD+GIS
Sbjct  562   DAAMHAQEQLGNALDVVHGELLPEDKSRIIQEFKKEGPTAMVGDGVNDAPALATADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TG +ILM+NDI RI +AI++ RR  RKV+ N+ ++I  K  I+ LAI G
Sbjct  622   MGISGSALATQTGDIILMSNDIRRIPQAIKIARRARRKVVQNVFISIIFKVGILILAICG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVLVDVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLVDVGTCLLVILNSMLLLREKDK  712



>ref|XP_008377888.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Malus domestica]
Length=1049

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/694 (63%), Positives = 552/694 (80%), Gaps = 4/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK L+GV  VSV+V ++TV+VVHD LLI+Q QIV+ALN
Sbjct  16    QKSYFDVLGLCCASEVPLIENILKPLEGVKXVSVIVPSRTVIVVHDSLLISQLQIVKALN  75

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++V G  +   K  PSPYA+  G+LL+LSFLKY Y PL WLA+ A   G FPV
Sbjct  76    QARLEANVRVYGAGDIYKKTWPSPYAIGSGVLLVLSFLKYAYRPLGWLALGAVAVGIFPV  135

Query  3945  LRRAVAALRNLTL-DINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
               +  AA+RN    DINIL+II+V+G+I L DY EAA+IVFLFT  EWL+S A ++A A 
Sbjct  136   ALKCFAAIRNFRFHDINILVIIAVIGTIALKDYTEAASIVFLFTIAEWLQSSAGYRAKAV  195

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSL+++  Q AVLAE+GE++  ++VK++TILAVKAGE IPIDGIVVEG+ EVDEKTLTG
Sbjct  196   MSSLMSMAPQIAVLAESGEVVGVDEVKLNTILAVKAGEKIPIDGIVVEGKAEVDEKTLTG  255

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ES+ V K+KDSTVWA TINLNGYIS+KTT++AEDCAVA+MAKL+EEAQ++KSR QR IDK
Sbjct  256   ESYPVAKEKDSTVWAGTINLNGYISVKTTSLAEDCAVAKMAKLIEEAQNSKSRTQRFIDK  315

Query  3408  IAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              A +YTPA++ IS  +A+  +A+ V N  + +HLALVVLVSACPC L+LSTPV  FC L+
Sbjct  316   CAMFYTPAVLVISVSIAVIPAALHVHNWRKWFHLALVVLVSACPCGLILSTPVVTFCTLT  375

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  GLL KG +Y+EILAKVK++AFDKTGTITRGEF V  F SL D I+ NTLL WVSS
Sbjct  376   KAATSGLLIKGGDYIEILAKVKIMAFDKTGTITRGEFVVMDFQSLRDDISLNTLLYWVSS  435

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IE KSSHPMA A++DY +  SVEPNPE VE FQNFPGEGI+G+IDG +IYIGN+KI+ RA
Sbjct  436   IERKSSHPMADALVDYGRLFSVEPNPENVEEFQNFPGEGIHGKIDGQDIYIGNRKIALRA  495

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C  VP  +   + GK++ YI+ G + AGVF +SDACR+GA EA+++LK +GIKT MLTG
Sbjct  496   ACEIVPTIE-GSKGGKTIGYIYSGGAPAGVFXISDACRSGAAEALKELKKLGIKTAMLTG  554

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             DS AAA H  EQL  AL+   AELLPE+KA+II +F+  G T M+GDG+NDA ALATAD+
Sbjct  555   DSNAAALHTNEQLKQALEVVQAELLPEDKARIIXEFKMEGNTAMVGDGINDAXALATADI  614

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LAQETG++IL++NDI ++ KA++L RR  RKVI N+ ++I  KA+I+AL 
Sbjct  615   GISMGISGSALAQETGNIILLSNDIRKLPKAVQLARRAXRKVIENVALSITXKASILALG  674

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
              AGHPLVWAAVL D GTC +VIFNS LLL+G ++
Sbjct  675   FAGHPLVWAAVLADXGTCXLVIFNSMLLLQGTNK  708



>ref|XP_004507887.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4-like 
[Cicer arietinum]
Length=1032

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/694 (64%), Positives = 562/694 (81%), Gaps = 4/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSY+DV+G+CC SEVPLI+ ILK L G+ EVSV+V ++TV+VVHD L+I+Q QIV+ALN
Sbjct  5     QKSYYDVVGLCCSSEVPLIENILKPLQGIKEVSVIVPSRTVIVVHDSLVISQLQIVKALN  64

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+V G+     K  PSPY+V  G+LLLLSFLK+VY PLK+LA+ A  AG+FP+
Sbjct  65    QARLEANIRVYGDEKH-EKRWPSPYSVASGLLLLLSFLKFVYLPLKFLALGAVAAGAFPI  123

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +A+ ++RN+  DINIL+II+V+G+I + DY EA TIVFL++  EWLESRASHKA A M
Sbjct  124   ILKAIVSIRNVRFDINILVIIAVIGTIAMEDYLEAGTIVFLYSIAEWLESRASHKANAVM  183

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+N+  Q+AV+AETGE++DA++VK++TILAVKAGEVIPIDG+V++G CE+DEKTLTGE
Sbjct  184   SSLMNMTPQKAVIAETGEVVDADEVKINTILAVKAGEVIPIDGVVLDGNCEIDEKTLTGE  243

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ V KQKDSTVWA TINLNGYIS+KTTA+AEDC VA+MAKLVEEAQ++K+  QR IDK 
Sbjct  244   SYPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVVAKMAKLVEEAQNSKTSTQRLIDKF  303

Query  3405  AKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A +YTPA+V IS  +A+  + ++  +E+Y  H ALVVLVSACPCAL+LSTPVA FCA ++
Sbjct  304   AVFYTPAVVVISTFVAVIPLLLKLHNEKYWLHFALVVLVSACPCALILSTPVATFCAYTK  363

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG   LE LAK+KV+AFDKTGTIT+GEF V +F SL D I+ NTLL WVSSI
Sbjct  364   AATSGLLIKGGHSLETLAKIKVMAFDKTGTITKGEFVVTNFQSLSDDIDLNTLLYWVSSI  423

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP+A AI+D+ +S S++PNPEKV  F+NFPGEGI G+ID   +YIGNKKI+ RAG
Sbjct  424   ESKSSHPLAEAIVDHGRSLSIKPNPEKVTEFENFPGEGICGKIDERVLYIGNKKIARRAG  483

Query  2871  C-TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
               T VP    +  EGK+  YI++G +  G+FSLSD CR+G QEAIR+LK++GIKT MLTG
Sbjct  484   SETEVPTLQGEVHEGKTTGYIYLGPTPVGIFSLSDVCRSGVQEAIRQLKLLGIKTAMLTG  543

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             D  +AA   QEQLG AL+  HAELLPE+K +II +F+K G T M+GDGLNDAPALATAD+
Sbjct  544   DCQSAAVQAQEQLGHALESVHAELLPEDKVKIISEFKKEGPTAMLGDGLNDAPALATADI  603

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LA ETG +ILM+ND+ +I +AI+L R+  RKVI NIV+++ TK AI+ LA
Sbjct  604   GISMGISGSALASETGDIILMSNDLRKIPEAIKLARKSQRKVIENIVLSVITKVAILGLA  663

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             I GHP+VWAAVL DVGTCL+VI NS LLL+ G +
Sbjct  664   IGGHPIVWAAVLADVGTCLLVILNSMLLLQRGHK  697



>ref|XP_010046956.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X2 [Eucalyptus grandis]
Length=1041

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/693 (64%), Positives = 550/693 (79%), Gaps = 7/693 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SE+PL++ IL+ LDGV +VSV+V ++TV+VVHD LL++Q QIV ALN
Sbjct  12    QKSYFDVMGLCCSSEIPLVESILRQLDGVGDVSVIVASRTVIVVHDTLLVSQTQIVNALN  71

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA++K  GE N   K  PSPYA+  G LLLLS L++VY P KWLA+ A VAG  PV
Sbjct  72    QARLEANVKAYGEINHHKKW-PSPYAIASGGLLLLSLLQFVYHPFKWLALGAVVAGILPV  130

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +  AALRN  ++INIL++I+V+G++ + DY EA TIVFLFTT EWLESRASHKA A M
Sbjct  131   ILKGFAALRNFRIEINILVLIAVIGTVAMRDYLEAGTIVFLFTTAEWLESRASHKASAEM  190

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             S+L+++  Q AV+AETGE+++ +++K++T++AVKAGEVIPIDG+VV+G+ +VDEKTLTGE
Sbjct  191   SALMSIAPQTAVIAETGEVVNVDEIKLNTVVAVKAGEVIPIDGVVVDGKSDVDEKTLTGE  250

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K KDS VWA TINLNGYIS+KTTA+AEDC VA+MAKLVEEAQ+ KSR QR ID+ 
Sbjct  251   SFPVSKHKDSPVWAGTINLNGYISVKTTALAEDCLVAKMAKLVEEAQNKKSRTQRLIDRC  310

Query  3405  AKYYTPAIVAISACLAI------SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             A++YTPA++ IS   A+       A+    R+  +HLALVVLVSACPCALVLSTPVA FC
Sbjct  311   AQFYTPAVLIISIGFAMIPVVFPVALHHHKRNYWFHLALVVLVSACPCALVLSTPVATFC  370

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL++AA  GLL KG +YLE LAK+  +AFDKTGTITRGEF V  F SL +GI+  T+L W
Sbjct  371   ALTKAAKSGLLIKGGDYLETLAKIGNLAFDKTGTITRGEFMVEDFRSLNEGISIETMLYW  430

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSSIESKSSHPMA  ++ Y +S S+EP PE V++FQNFPGEGIYG+IDG +I+IGN+KI+
Sbjct  431   VSSIESKSSHPMAAPLVGYGRSFSIEPKPEDVDNFQNFPGEGIYGKIDGNDIFIGNRKIA  490

Query  2883  ARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVM  2704
              RAGC  VP  +    EGK+M Y+F  +   G+F+LSDACRTGAQEAI+ LK + IKT M
Sbjct  491   LRAGCERVPSIEGLTGEGKTMGYVFCRAKPVGIFTLSDACRTGAQEAIKALKSLKIKTAM  550

Query  2703  LTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALAT  2524
             LTGDS  AA H Q QLG ALD  HAELLPE+KA+IIK+ ++   TGM+GDG+NDAPALAT
Sbjct  551   LTGDSQGAAMHAQNQLGHALDVVHAELLPEDKAKIIKRLKEDAPTGMVGDGINDAPALAT  610

Query  2523  ADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIM  2344
             AD+GISMGISGS LA ETGHVILM+NDI +I KAI L RR  RKV+ N++++I TK AI+
Sbjct  611   ADIGISMGISGSALAMETGHVILMSNDIRKIPKAIMLARRAHRKVVENVILSITTKVAIL  670

Query  2343  ALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
              LA+AGHP +WAAVL D GTCLVVI NS LLLR
Sbjct  671   TLALAGHPFIWAAVLADTGTCLVVILNSMLLLR  703



>ref|XP_010046953.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X1 [Eucalyptus grandis]
 ref|XP_010046955.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X1 [Eucalyptus grandis]
 gb|KCW78674.1| hypothetical protein EUGRSUZ_C00131 [Eucalyptus grandis]
Length=1069

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/693 (64%), Positives = 550/693 (79%), Gaps = 7/693 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SE+PL++ IL+ LDGV +VSV+V ++TV+VVHD LL++Q QIV ALN
Sbjct  12    QKSYFDVMGLCCSSEIPLVESILRQLDGVGDVSVIVASRTVIVVHDTLLVSQTQIVNALN  71

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA++K  GE N   K  PSPYA+  G LLLLS L++VY P KWLA+ A VAG  PV
Sbjct  72    QARLEANVKAYGEINHHKKW-PSPYAIASGGLLLLSLLQFVYHPFKWLALGAVVAGILPV  130

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +  AALRN  ++INIL++I+V+G++ + DY EA TIVFLFTT EWLESRASHKA A M
Sbjct  131   ILKGFAALRNFRIEINILVLIAVIGTVAMRDYLEAGTIVFLFTTAEWLESRASHKASAEM  190

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             S+L+++  Q AV+AETGE+++ +++K++T++AVKAGEVIPIDG+VV+G+ +VDEKTLTGE
Sbjct  191   SALMSIAPQTAVIAETGEVVNVDEIKLNTVVAVKAGEVIPIDGVVVDGKSDVDEKTLTGE  250

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K KDS VWA TINLNGYIS+KTTA+AEDC VA+MAKLVEEAQ+ KSR QR ID+ 
Sbjct  251   SFPVSKHKDSPVWAGTINLNGYISVKTTALAEDCLVAKMAKLVEEAQNKKSRTQRLIDRC  310

Query  3405  AKYYTPAIVAISACLAI------SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             A++YTPA++ IS   A+       A+    R+  +HLALVVLVSACPCALVLSTPVA FC
Sbjct  311   AQFYTPAVLIISIGFAMIPVVFPVALHHHKRNYWFHLALVVLVSACPCALVLSTPVATFC  370

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL++AA  GLL KG +YLE LAK+  +AFDKTGTITRGEF V  F SL +GI+  T+L W
Sbjct  371   ALTKAAKSGLLIKGGDYLETLAKIGNLAFDKTGTITRGEFMVEDFRSLNEGISIETMLYW  430

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSSIESKSSHPMA  ++ Y +S S+EP PE V++FQNFPGEGIYG+IDG +I+IGN+KI+
Sbjct  431   VSSIESKSSHPMAAPLVGYGRSFSIEPKPEDVDNFQNFPGEGIYGKIDGNDIFIGNRKIA  490

Query  2883  ARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVM  2704
              RAGC  VP  +    EGK+M Y+F  +   G+F+LSDACRTGAQEAI+ LK + IKT M
Sbjct  491   LRAGCERVPSIEGLTGEGKTMGYVFCRAKPVGIFTLSDACRTGAQEAIKALKSLKIKTAM  550

Query  2703  LTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALAT  2524
             LTGDS  AA H Q QLG ALD  HAELLPE+KA+IIK+ ++   TGM+GDG+NDAPALAT
Sbjct  551   LTGDSQGAAMHAQNQLGHALDVVHAELLPEDKAKIIKRLKEDAPTGMVGDGINDAPALAT  610

Query  2523  ADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIM  2344
             AD+GISMGISGS LA ETGHVILM+NDI +I KAI L RR  RKV+ N++++I TK AI+
Sbjct  611   ADIGISMGISGSALAMETGHVILMSNDIRKIPKAIMLARRAHRKVVENVILSITTKVAIL  670

Query  2343  ALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
              LA+AGHP +WAAVL D GTCLVVI NS LLLR
Sbjct  671   TLALAGHPFIWAAVLADTGTCLVVILNSMLLLR  703



>ref|XP_002532236.1| heavy metal cation transport atpase, putative [Ricinus communis]
 gb|EEF30145.1| heavy metal cation transport atpase, putative [Ricinus communis]
Length=962

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/690 (65%), Positives = 547/690 (79%), Gaps = 23/690 (3%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK LDGV E SV+V T+TV+VVHD LLI+Q QIV+ALN
Sbjct  14    QKSYFDVLGLCCSSEVPLIENILKSLDGVKEYSVIVPTRTVIVVHDNLLISQLQIVKALN  73

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++V G+T+   K  PSP+AV  G+LLLLS LK+VY PL WLA+ A   G FP+
Sbjct  74    QARLEANVRVKGDTSH-QKKWPSPFAVASGVLLLLSLLKFVYHPLHWLALGAVAIGIFPI  132

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA+LRN  LD NIL++I+VVG+IVL +Y EA  IVFLFT  EWLESRA HKA A M
Sbjct  133   LMKAVASLRNFRLDTNILVLIAVVGTIVLKEYVEAGFIVFLFTIAEWLESRAGHKANAVM  192

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+A++A TGE +DA++VK++T+LAVKAGEVIPIDGIVV+G CEVDEKTLTGE
Sbjct  193   SSLMSITPQKAIIAATGEEVDADEVKLNTVLAVKAGEVIPIDGIVVDGNCEVDEKTLTGE  252

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQKDSTVWA TINLNGYI+++TTA+AEDC VA+MAKL                  
Sbjct  253   SFPVPKQKDSTVWAGTINLNGYINVQTTALAEDCVVAKMAKL------------------  294

Query  3405  AKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
               YYTPA++ IS  L +   A++V NR+  + LALVVLVSACPCAL+LSTPVA FCAL++
Sbjct  295   --YYTPAVIIISVSLVVVPLALRVHNRNRWFRLALVVLVSACPCALILSTPVATFCALTK  352

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G+L KG + LE LAK+KV+AFDKTGTIT+GEF V  F SL + I+ +TL+ WVSSI
Sbjct  353   AATSGVLIKGGDSLETLAKIKVMAFDKTGTITKGEFVVVDFGSLCEDISLDTLVYWVSSI  412

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DYA+S S+EPNPE V  FQNFPGEGI+G+IDG EIYIGNKKI  RAG
Sbjct  413   ESKSSHPMAAALVDYAKSLSIEPNPENVVEFQNFPGEGIHGKIDGKEIYIGNKKIGLRAG  472

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +VP  + + + GK++ Y++ G +  G+FSLSDACRTG  EA+ KLK MG+KT MLTGD
Sbjct  473   YGTVPTLETEMKGGKTVGYVYSGGTPIGIFSLSDACRTGVAEAVTKLKSMGVKTAMLTGD  532

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA H QEQLG AL+   AELLPE+KA+II++F+K G T MIGDG+NDAPALATAD+G
Sbjct  533   SQAAAMHAQEQLGHALEVVKAELLPEDKARIIEEFKKEGTTAMIGDGVNDAPALATADIG  592

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG VILM+NDI +I   I L R+  RKVI N+++++ TK+AI+ALA 
Sbjct  593   ISMGISGSALATETGDVILMSNDIRKIPDVISLARKAHRKVIENVILSMSTKSAILALAF  652

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             AGHPLVWAAVL DVGTCL+VIFNS LLLRG
Sbjct  653   AGHPLVWAAVLADVGTCLLVIFNSMLLLRG  682



>ref|XP_010277178.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Nelumbo nucifera]
Length=989

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/689 (63%), Positives = 547/689 (79%), Gaps = 4/689 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SE+PL++KILK LDG+ EVSV+V ++TV+VVHD LLI+Q QIV+ALN
Sbjct  16    QKSYFDVLGICCTSEIPLVEKILKPLDGIKEVSVIVPSRTVIVVHDTLLISQIQIVKALN  75

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+  GE   G K  PSPY + C ILL LSF K ++ PL WLA+ A + G  P+
Sbjct  76    QARLEANIRGYGEEKSGRKW-PSPYTMGCFILLCLSFFKSLFHPLHWLALGAVLVGLPPI  134

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R+VAA+R LTLD NIL++++V G+I L DY EA  IVFLFT  EWLESRASHKA A+M
Sbjct  135   VMRSVAAIRRLTLDTNILVLLAVGGAIGLGDYGEAGFIVFLFTFAEWLESRASHKANASM  194

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             S L+N+  Q AVLAETG +LDA  VK++T++AVKAGEVIPIDGIVVEG CEVDEKTLTGE
Sbjct  195   SGLMNMTPQTAVLAETGLVLDAKDVKLNTVIAVKAGEVIPIDGIVVEGNCEVDEKTLTGE  254

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ  S VWA +INLNGYIS+KTTA+AE+C VA+MAKLVE+AQ NKS+ QR ID  
Sbjct  255   SFPVAKQIQSNVWAGSINLNGYISVKTTALAENCVVAKMAKLVEDAQKNKSKTQRMIDSC  314

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTP ++  S  + +  +A++V N     +L LV+LVSACPCAL+LSTPVA++ A ++
Sbjct  315   AKYYTPVVILASIGIVVVPTALRVHNLKHWIYLGLVILVSACPCALILSTPVAIYYAFTK  374

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA+ GLLFKG ++LE LAK+KVIAFDKTGTITRGEF V  F S+   ++ N+LL WVSSI
Sbjct  375   AASSGLLFKGGDFLETLAKIKVIAFDKTGTITRGEFVVTDFQSICHDVSLNSLLYWVSSI  434

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DYA+SHS+EP PE V  FQNFPGEGIYG+IDG +I++GN+KI+ RA 
Sbjct  435   ESKSSHPMAEALVDYARSHSIEPKPENVTAFQNFPGEGIYGQIDGKDIFVGNRKIAMRAE  494

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +V   + D + G ++ YI +G++L G FSL+DACR+GA EAI +LK +GIKT MLTGD
Sbjct  495   CRTVDTEEGDSK-GATIGYICLGTTLVGSFSLTDACRSGAAEAINQLKSLGIKTAMLTGD  553

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +Y AA H Q+QLG A++  HAELLPE+K +IIK  ++ G T MIGDG+NDAPALA AD+G
Sbjct  554   TYVAATHAQDQLGHAIEVVHAELLPEDKVRIIKGLKEEGATAMIGDGVNDAPALAVADIG  613

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+ND+ +I +AI L R+  RK++ NI ++I TK AI+ALA 
Sbjct  614   ISMGISGSALATETGHVILMSNDMRKIPQAIRLARKTQRKIVENIALSIITKVAILALAF  673

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AGHPL+W A++ DVGTCL+VIFNS L+LR
Sbjct  674   AGHPLLWGAIVADVGTCLLVIFNSMLVLR  702



>emb|CDY36489.1| BnaC03g48480D [Brassica napus]
Length=1149

 Score =   867 bits (2239),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/691 (63%), Positives = 555/691 (80%), Gaps = 3/691 (0%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             SYFDV+GICC SEVPLI+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN+A
Sbjct  23    SYFDVLGICCSSEVPLIENILKSLDGVKEYSVIVPSRTVIVVHDSLLISPFQIAKALNQA  82

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
               EA+++V+G+ N   K  PSP+AV  GILLLLSFLK+VY PL+W+AVAA  AG +P+L 
Sbjct  83    KFEANVRVDGKANFKNKW-PSPFAVASGILLLLSFLKFVYPPLRWIAVAAVAAGIYPILA  141

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             +AVA++    +DINIL+II+V  ++ + DY EAA +VFLFT  EWLE+RAS+KA A M S
Sbjct  142   KAVASIGRKRVDINILVIITVAATLAMQDYMEAAAVVFLFTIAEWLETRASYKATAVMQS  201

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q+A +AETGE ++ ++VKV+TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE++
Sbjct  202   LMSLAPQKATIAETGEEVEVDEVKVNTIVAVKAGETIPIDGIVVDGNCEVDEKTLTGEAY  261

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ+DSTVWA TINLNGY+S+KTT++A DC VA+MAKLVEEAQS+K+++QR IDK ++
Sbjct  262   PVPKQRDSTVWAGTINLNGYVSVKTTSLASDCVVAKMAKLVEEAQSSKTKSQRLIDKCSQ  321

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPAI+ +S  +A+  + +K+ N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA
Sbjct  322   YYTPAIILVSGGIAVVPAVMKLHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTKAA  381

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+ + LL WVSS+ES
Sbjct  382   TSGLLIKSADYLDTLSKIKITAFDKTGTITRGEFIVIEFRSLSRDISLHNLLYWVSSVES  441

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA  I+DYA+  +VEP  E+VE + NFPGEGIYG+IDG +IYIGNK+I +RA C+
Sbjct  442   KSSHPMAATIVDYAKYVNVEPRTEEVEDYHNFPGEGIYGKIDGNDIYIGNKRIGSRAKCS  501

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE +VD + GK++ YI+VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+ 
Sbjct  502   TVPEIEVDTKGGKTVGYIYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQ  561

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
              AA H QEQLG A+D  H ELLPE+K++II +F+K G T M+GDG+NDAPALATAD+GIS
Sbjct  562   DAAMHAQEQLGNAMDVVHGELLPEDKSKIILEFKKEGPTAMVGDGVNDAPALATADIGIS  621

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA +TGH+ILM+NDI RI +AI L RR  RKV+ N+ ++I  K  I+ LA  G
Sbjct  622   MGISGSALATQTGHIILMSNDIRRIPQAIRLARRSRRKVVENLFISITLKVGILVLAFTG  681

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             HPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  682   HPLIWAAVLADVGTCLLVILNSMLLLRDKDK  712



>ref|XP_004148337.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Cucumis 
sativus]
Length=1202

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/702 (62%), Positives = 551/702 (78%), Gaps = 9/702 (1%)
 Frame = -1

Query  4317  NNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIV  4138
             N   E+S+FDV+GICC SE+PLI+ ILK L G+ +++V+V T+T++VVHD LLI+Q QIV
Sbjct  17    NKKMERSHFDVLGICCSSEIPLIENILKPLQGIKQITVIVPTRTLIVVHDSLLISQLQIV  76

Query  4137  RALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             +ALN+A LEA+I++ G+     K  PSPYA+  G+LL  SFLKYVY PL+WLAVAA  AG
Sbjct  77    KALNEARLEANIQLKGK-GIMKKKWPSPYAIASGLLLTASFLKYVYHPLRWLAVAAVAAG  135

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
              FP+L +A++A+R+L +D+NIL II+VVG+I + DY EA +IVFLF+  EWLESRASHKA
Sbjct  136   IFPILLKAISAIRHLRVDVNILAIIAVVGTIAMDDYMEAGSIVFLFSIAEWLESRASHKA  195

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
               AM SL+ +  Q+A +AE+GE++D   VK+ ++L VKAGEVIPIDGIVVEG CEVDEKT
Sbjct  196   NGAMCSLMRLAPQKATIAESGEVVDVRDVKLKSVLGVKAGEVIPIDGIVVEGNCEVDEKT  255

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             L+GE+F V KQKDS VWA TINLNGYIS++TT VAEDC VA+MA+LVEEAQ+NKS+ Q  
Sbjct  256   LSGETFPVTKQKDSLVWAGTINLNGYISVQTTVVAEDCVVAKMAELVEEAQNNKSKTQTF  315

Query  3417  IDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             ID+ AKYYTPA+V ISACLA   +A++V N     HLALVVLVSACPCAL+LSTPVA FC
Sbjct  316   IDECAKYYTPAVVIISACLAAIPAALRVHNLRHWLHLALVVLVSACPCALILSTPVAAFC  375

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL++AA  G+L KG  +LE+LAK+KV+AFDKTGTITRGEF V HF +L D IN +TLL W
Sbjct  376   ALTKAAMAGVLIKGGNHLEVLAKIKVMAFDKTGTITRGEFVVTHFQALRDDINFHTLLQW  435

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSSIESKSSHPMA A+++Y + HS++  PE VE F+NF GEG+ G+IDG +IYIG+KKI+
Sbjct  436   VSSIESKSSHPMATALVNYGKLHSIDLKPENVEEFENFLGEGVRGKIDGNDIYIGSKKIA  495

Query  2883  ARAG-----CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMG  2719
             ARAG      + +  FD + R+ +++ Y+F G  + G F L D+CR+G +EAI ++K  G
Sbjct  496   ARAGYDIPVSSKLNNFDDETRQEQTLGYVFCGGMMIGSFGLLDSCRSGVKEAIEEIKSFG  555

Query  2718  IKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLND  2542
             IKT MLTGD  AAA HVQEQLG  LD  H+ELLP+EKA IIK+F+   G   M+GDGLND
Sbjct  556   IKTAMLTGDCRAAAMHVQEQLGNTLDVIHSELLPKEKANIIKEFKNNDGAIAMVGDGLND  615

Query  2541  APALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAIC  2362
              PALATAD+G+SMGISGS LA ETG+VILM+ND+ +I KAI+L +    KV+ N++++I 
Sbjct  616   TPALATADIGMSMGISGSALATETGNVILMSNDMRKIPKAIKLAKTFHTKVVQNVILSIG  675

Query  2361  TKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             TK AI+ LA AGHPL+WAAVL DVGTCL+VI NS LLLRG D
Sbjct  676   TKTAILGLAFAGHPLIWAAVLADVGTCLLVILNSMLLLRGMD  717



>gb|KCW80883.1| hypothetical protein EUGRSUZ_C02245, partial [Eucalyptus grandis]
Length=832

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/691 (61%), Positives = 541/691 (78%), Gaps = 8/691 (1%)
 Frame = -1

Query  4314  NGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVR  4135
             +  EK+Y +V+G+CC SEVPL++KIL+  DGV+++SV++ TKTV+V+HDPL+++Q ++V 
Sbjct  3     SSTEKTYLEVLGLCCASEVPLVEKILRAFDGVNDISVIIPTKTVIVLHDPLIVSQSKLVE  62

Query  4134  ALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGS  3955
             ALN+  LEASI+  GE +   K  PSP  ++CG+L  LSFLKYVY PLKWLA+AA V G 
Sbjct  63    ALNRVRLEASIRHRGEIDSATKW-PSPALIICGLLFGLSFLKYVYHPLKWLALAAVVVGL  121

Query  3954  FPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAM  3775
              P+  R++A+++NLTL+IN+L++ISV+G++ L DYWEAA+IVFLF+  +WLE  ASHKAM
Sbjct  122   PPIGLRSLASIKNLTLNINVLVLISVIGTLALQDYWEAASIVFLFSIAQWLELMASHKAM  181

Query  3774  AAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTL  3595
             A MSSL ++  ++AV+AETGE +D N+V+++T+L+VKAGE IPIDGIVV+G+C+VDEK L
Sbjct  182   ATMSSLASMTPEKAVIAETGESVDVNEVRMNTVLSVKAGEAIPIDGIVVDGKCDVDEKML  241

Query  3594  TGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSI  3415
             TGES+ V K   STVWA +INLNGYIS++TTA+A++C VARMAKLVE+A   KS  Q  I
Sbjct  242   TGESYPVAKDIGSTVWAGSINLNGYISMRTTALAKECVVARMAKLVEDAHKKKSHTQGLI  301

Query  3414  DKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCA  3241
             D  AKYY P +  +SAC+A+  +A+K++N    +HLA+VVLV +CPCAL+LSTP+  FCA
Sbjct  302   DNCAKYYIPGVALVSACIAVVPAALKLQNEDHWFHLAIVVLVGSCPCALILSTPITFFCA  361

Query  3240  LSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWV  3061
             LSRAA  GLLFKG EYLEILAKVK +AFDKTGT+TRGEF V +F S+   I+ NTLL WV
Sbjct  362   LSRAAKDGLLFKGGEYLEILAKVKTVAFDKTGTVTRGEFVVTNFQSICKDIDLNTLLYWV  421

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             SSIESKSSHPM+ AIIDYA S S+E  PE VE FQNFPGEGIYG I+   I+IGN++I  
Sbjct  422   SSIESKSSHPMSAAIIDYAHSLSIEAKPEDVEDFQNFPGEGIYGRINSKGIFIGNRRIGL  481

Query  2880  RAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
             RAG  +    + D     +  +I+ G  L G FSLSDACRTG+ EAI  +K +GIKT ML
Sbjct  482   RAGYETESSIETD-----TNGFIYTGQRLVGKFSLSDACRTGSMEAIDDIKSLGIKTAML  536

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATA  2521
             TGDS AAAR  Q QL  ALD  +AELLPE KA+II+ F+KGG T MIGDG+NDAPALATA
Sbjct  537   TGDSQAAARSAQSQLDYALDLVYAELLPENKARIIEDFKKGGPTAMIGDGVNDAPALATA  596

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVGISMGISGS LA ETGHVILM+N+IG+I +AI+L RR +RK++ N++++I  K  I+ 
Sbjct  597   DVGISMGISGSALAMETGHVILMSNNIGKIPEAIKLARRTFRKLVENVLISISLKGVILG  656

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             LA AG+PLVWAAVL DVGTCL+VI NS  LL
Sbjct  657   LAFAGYPLVWAAVLTDVGTCLIVILNSMQLL  687



>ref|XP_010048588.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X2 [Eucalyptus grandis]
Length=918

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/694 (61%), Positives = 541/694 (78%), Gaps = 8/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y +V+G+CC SEVPL++KIL+  DGV+++SV++ TKTV+V+HDPL+++Q ++V ALN
Sbjct  6     EKTYLEVLGLCCASEVPLVEKILRAFDGVNDISVIIPTKTVIVLHDPLIVSQSKLVEALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +  LEASI+  GE +   K  PSP  ++CG+L  LSFLKYVY PLKWLA+AA V G  P+
Sbjct  66    RVRLEASIRHRGEIDSATKW-PSPALIICGLLFGLSFLKYVYHPLKWLALAAVVVGLPPI  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               R++A+++NLTL+IN+L++ISV+G++ L DYWEAA+IVFLF+  +WLE  ASHKAMA M
Sbjct  125   GLRSLASIKNLTLNINVLVLISVIGTLALQDYWEAASIVFLFSIAQWLELMASHKAMATM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++  ++AV+AETGE +D N+V+++T+L+VKAGE IPIDGIVV+G+C+VDEK LTGE
Sbjct  185   SSLASMTPEKAVIAETGESVDVNEVRMNTVLSVKAGEAIPIDGIVVDGKCDVDEKMLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ V K   STVWA +INLNGYIS++TTA+A++C VARMAKLVE+A   KS  Q  ID  
Sbjct  245   SYPVAKDIGSTVWAGSINLNGYISMRTTALAKECVVARMAKLVEDAHKKKSHTQGLIDNC  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY P +  +SAC+A+  +A+K++N    +HLA+VVLV +CPCAL+LSTP+  FCALSR
Sbjct  305   AKYYIPGVALVSACIAVVPAALKLQNEDHWFHLAIVVLVGSCPCALILSTPITFFCALSR  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLLFKG EYLEILAKVK +AFDKTGT+TRGEF V +F S+   I+ NTLL WVSSI
Sbjct  365   AAKDGLLFKGGEYLEILAKVKTVAFDKTGTVTRGEFVVTNFQSICKDIDLNTLLYWVSSI  424

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPM+ AIIDYA S S+E  PE VE FQNFPGEGIYG I+   I+IGN++I  RAG
Sbjct  425   ESKSSHPMSAAIIDYAHSLSIEAKPEDVEDFQNFPGEGIYGRINSKGIFIGNRRIGLRAG  484

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +    + D     +  +I+ G  L G FSLSDACRTG+ EAI  +K +GIKT MLTGD
Sbjct  485   YETESSIETD-----TNGFIYTGQRLVGKFSLSDACRTGSMEAIDDIKSLGIKTAMLTGD  539

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAAR  Q QL  ALD  +AELLPE KA+II+ F+KGG T MIGDG+NDAPALATADVG
Sbjct  540   SQAAARSAQSQLDYALDLVYAELLPENKARIIEDFKKGGPTAMIGDGVNDAPALATADVG  599

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+N+IG+I +AI+L RR +RK++ N++++I  K  I+ LA 
Sbjct  600   ISMGISGSALAMETGHVILMSNNIGKIPEAIKLARRTFRKLVENVLISISLKGVILGLAF  659

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             AG+PLVWAAVL DVGTCL+VI NS  LL     +
Sbjct  660   AGYPLVWAAVLTDVGTCLIVILNSMQLLNATSNQ  693



>gb|KGN61164.1| hypothetical protein Csa_2G060450 [Cucumis sativus]
Length=802

 Score =   851 bits (2198),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/689 (62%), Positives = 541/689 (79%), Gaps = 9/689 (1%)
 Frame = -1

Query  4317  NNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIV  4138
             N   E+S+FDV+GICC SE+PLI+ ILK L G+ +++V+V T+T++VVHD LLI+Q QIV
Sbjct  17    NKKMERSHFDVLGICCSSEIPLIENILKPLQGIKQITVIVPTRTLIVVHDSLLISQLQIV  76

Query  4137  RALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             +ALN+A LEA+I++ G+     K  PSPYA+  G+LL  SFLKYVY PL+WLAVAA  AG
Sbjct  77    KALNEARLEANIQLKGK-GIMKKKWPSPYAIASGLLLTASFLKYVYHPLRWLAVAAVAAG  135

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
              FP+L +A++A+R+L +D+NIL II+VVG+I + DY EA +IVFLF+  EWLESRASHKA
Sbjct  136   IFPILLKAISAIRHLRVDVNILAIIAVVGTIAMDDYMEAGSIVFLFSIAEWLESRASHKA  195

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
               AM SL+ +  Q+A +AE+GE++D   VK+ ++L VKAGEVIPIDGIVVEG CEVDEKT
Sbjct  196   NGAMCSLMRLAPQKATIAESGEVVDVRDVKLKSVLGVKAGEVIPIDGIVVEGNCEVDEKT  255

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             L+GE+F V KQKDS VWA TINLNGYIS++TT VAEDC VA+MA+LVEEAQ+NKS+ Q  
Sbjct  256   LSGETFPVTKQKDSLVWAGTINLNGYISVQTTVVAEDCVVAKMAELVEEAQNNKSKTQTF  315

Query  3417  IDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             ID+ AKYYTPA+V ISACLA   +A++V N     HLALVVLVSACPCAL+LSTPVA FC
Sbjct  316   IDECAKYYTPAVVIISACLAAIPAALRVHNLRHWLHLALVVLVSACPCALILSTPVAAFC  375

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL++AA  G+L KG  +LE+LAK+KV+AFDKTGTITRGEF V HF +L D IN +TLL W
Sbjct  376   ALTKAAMAGVLIKGGNHLEVLAKIKVMAFDKTGTITRGEFVVTHFQALRDDINFHTLLQW  435

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSSIESKSSHPMA A+++Y + HS++  PE VE F+NF GEG+ G+IDG +IYIG+KKI+
Sbjct  436   VSSIESKSSHPMATALVNYGKLHSIDLKPENVEEFENFLGEGVRGKIDGNDIYIGSKKIA  495

Query  2883  ARAG-----CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMG  2719
             ARAG      + +  FD + R+ +++ Y+F G  + G F L D+CR+G +EAI ++K  G
Sbjct  496   ARAGYDIPVSSKLNNFDDETRQEQTLGYVFCGGMMIGSFGLLDSCRSGVKEAIEEIKSFG  555

Query  2718  IKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLND  2542
             IKT MLTGD  AAA HVQEQLG  LD  H+ELLP+EKA IIK+F+   G   M+GDGLND
Sbjct  556   IKTAMLTGDCRAAAMHVQEQLGNTLDVIHSELLPKEKANIIKEFKNNDGAIAMVGDGLND  615

Query  2541  APALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAIC  2362
              PALATAD+G+SMGISGS LA ETG+VILM+ND+ +I KAI+L +    KV+ N++++I 
Sbjct  616   TPALATADIGMSMGISGSALATETGNVILMSNDMRKIPKAIKLAKTFHTKVVQNVILSIG  675

Query  2361  TKAAIMALAIAGHPLVWAAVLVDVGTCLV  2275
             TK AI+ LA AGHPL+WAAVL DVGTCL+
Sbjct  676   TKTAILGLAFAGHPLIWAAVLADVGTCLL  704



>ref|XP_003550652.2| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4-like 
isoform X1 [Glycine max]
Length=809

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/691 (63%), Positives = 550/691 (80%), Gaps = 3/691 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
              KSYFDV+G+CC SEVPLI+ IL+ L G+ EVSV+V ++TV+VVHD L+I+Q QIV+ALN
Sbjct  9     RKSYFDVLGLCCSSEVPLIENILRPLQGIKEVSVIVPSRTVIVVHDTLVISQLQIVKALN  68

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+V G+     K  PSPY++  G+LLLLS LK+V+ PLK+LA+ A     +P+
Sbjct  69    EARLEANIRVYGDEKH-QKRWPSPYSIASGVLLLLSLLKFVFHPLKYLALGAVAVAVYPL  127

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +A+ ++RNL LDINILM+I+V+G+I ++ Y EA TIVFLF+  +WLESRASHKA A M
Sbjct  128   ILKAIVSIRNLRLDINILMLIAVIGTISMNHYLEAGTIVFLFSIAQWLESRASHKATAVM  187

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+N+  Q+AV+AETGE++DA++VK++T+L VKAGEVIPIDG+V++G CEVDEK LTGE
Sbjct  188   SSLMNIAPQKAVIAETGEVVDADEVKINTVLEVKAGEVIPIDGVVIDGICEVDEKKLTGE  247

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDC +A+MAKLVEEAQ++K+  QR IDK 
Sbjct  248   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVMAKMAKLVEEAQNSKTNIQRLIDKF  307

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A++YTP +V ISA +A+   A+K  N       +LVVLVSACPCAL+LSTPVA FCA ++
Sbjct  308   AQFYTPGVVIISALVAVIPLALKQHNHKLWLQFSLVVLVSACPCALILSTPVATFCAYTK  367

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG ++LE LAK+KV+AFDKTGTIT+GEF V HF SL D I+ NTL  WVSSI
Sbjct  368   AATSGLLIKGGDHLETLAKIKVMAFDKTGTITKGEFVVTHFQSLSDDIDFNTLAYWVSSI  427

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP A AI+DY +S SVEP PEKV  F+ FPGEGI G+I+G  IYIGNK+I+ARAG
Sbjct  428   ESKSSHPSAAAIVDYGRSLSVEPEPEKVTEFEIFPGEGICGKIEGRVIYIGNKRIAARAG  487

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +VP    +   GK+  YI++G+   G FSLSDACR   QEAI +LK +GIKT MLTGD
Sbjct  488   FETVPILQGEVERGKTTGYIYLGAIPIGFFSLSDACRLRVQEAIGQLKSLGIKTAMLTGD  547

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             + +AA  VQ++LG +L+  HAELLPE+K +II +F+K G T M+GDGLNDAPALA AD+G
Sbjct  548   NQSAAMQVQDELGHSLELVHAELLPEDKVKIISEFKKEGPTAMVGDGLNDAPALAAADIG  607

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG++ILM+NDI +I +AI+L R+  RKV+ NIV +I TKAAI+ LAI
Sbjct  608   ISMGISGSALASETGNIILMSNDIMKIPEAIKLARKASRKVVENIVFSIMTKAAILDLAI  667

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGG  2239
              GHPLVWAAV+ DVGTCL+VIFNS LLLR G
Sbjct  668   GGHPLVWAAVVADVGTCLLVIFNSMLLLRKG  698



>gb|AES92266.2| heavy metal transporting P-type ATPase, putative [Medicago truncatula]
Length=1033

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/694 (64%), Positives = 557/694 (80%), Gaps = 4/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK L GV EVSV+V ++TV+VVHD LLI+Q QIV+ALN
Sbjct  11    QKSYFDVVGLCCSSEVPLIENILKPLQGVKEVSVIVPSRTVIVVHDTLLISQLQIVKALN  70

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I++ G  N   K  PS Y+V  G+LLLLSFLK+VY P K++A+AA VAG +P+
Sbjct  71    QARLEANIRIYGNENH-KKKWPSIYSVASGLLLLLSFLKFVYTPFKYVALAAVVAGIYPI  129

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +A+ ++RNL +DINIL+II+V G+I ++DY EA TIVFLF+  +WLES ASHK+ A M
Sbjct  130   FLKAIVSIRNLRIDINILVIIAVAGTIAMNDYLEAGTIVFLFSISDWLESSASHKSNAVM  189

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             +SL+++  Q+AV+AETGE +D ++V+V+TILAVKAGE+IPIDGI+V+G+CEVDEKTLTGE
Sbjct  190   TSLMSIAPQKAVIAETGEDVDVDEVRVNTILAVKAGEIIPIDGIIVDGDCEVDEKTLTGE  249

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDC VA+M KLVE+AQ++K+  QR IDK 
Sbjct  250   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVVAKMTKLVEDAQNSKTSTQRLIDKF  309

Query  3405  AKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AK+YTPA++ IS  +A+  V ++  +E+Y  H ALVVLVSACPCAL+LSTPVA FCA ++
Sbjct  310   AKFYTPAVIFISTLVAVVPVVLKVHNEKYWLHFALVVLVSACPCALILSTPVATFCAYTK  369

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG   LE LAK+KV+AFDKTGTIT+GEF V +F SL D I+ NTL+ WVS I
Sbjct  370   AATSGLLIKGGHALETLAKIKVMAFDKTGTITKGEFAVTNFQSLSDDIDLNTLIYWVSCI  429

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP+A AI+D+ +S S+ PNPEKV  F+NFPGEGI G+ID   +YIGNKKI+ RAG
Sbjct  430   ESKSSHPLAEAIVDHGRSLSIVPNPEKVTEFENFPGEGICGKIDERVLYIGNKKIATRAG  489

Query  2871  C-TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
               T VP  + +   GK++ YI+ G +  G+FSLSD CR+G QEAIRKLK++GIKT MLTG
Sbjct  490   SETVVPTLEGEAHGGKTIGYIYSGPTPVGIFSLSDTCRSGVQEAIRKLKLLGIKTAMLTG  549

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             D  +AA   QEQLG AL+  HAELLPE K +II +F+K G T M+GDGLNDAPALA+AD+
Sbjct  550   DCQSAAMQAQEQLGHALELVHAELLPEGKVKIITEFKKDGPTAMLGDGLNDAPALASADI  609

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LA ETG +ILM+ND+ +I +AI+L R+  RKVI NIV+++ TK AI+ALA
Sbjct  610   GISMGISGSALASETGDIILMSNDLRKIPEAIKLARKARRKVIENIVLSVITKVAILALA  669

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             IAGHP+VWAAVL DVGTCL+VI NS LLL  G +
Sbjct  670   IAGHPIVWAAVLADVGTCLLVILNSMLLLPRGHK  703



>ref|XP_010048587.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 isoform X1 [Eucalyptus grandis]
Length=947

 Score =   855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/694 (61%), Positives = 541/694 (78%), Gaps = 8/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y +V+G+CC SEVPL++KIL+  DGV+++SV++ TKTV+V+HDPL+++Q ++V ALN
Sbjct  6     EKTYLEVLGLCCASEVPLVEKILRAFDGVNDISVIIPTKTVIVLHDPLIVSQSKLVEALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +  LEASI+  GE +   K  PSP  ++CG+L  LSFLKYVY PLKWLA+AA V G  P+
Sbjct  66    RVRLEASIRHRGEIDSATKW-PSPALIICGLLFGLSFLKYVYHPLKWLALAAVVVGLPPI  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               R++A+++NLTL+IN+L++ISV+G++ L DYWEAA+IVFLF+  +WLE  ASHKAMA M
Sbjct  125   GLRSLASIKNLTLNINVLVLISVIGTLALQDYWEAASIVFLFSIAQWLELMASHKAMATM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++  ++AV+AETGE +D N+V+++T+L+VKAGE IPIDGIVV+G+C+VDEK LTGE
Sbjct  185   SSLASMTPEKAVIAETGESVDVNEVRMNTVLSVKAGEAIPIDGIVVDGKCDVDEKMLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ V K   STVWA +INLNGYIS++TTA+A++C VARMAKLVE+A   KS  Q  ID  
Sbjct  245   SYPVAKDIGSTVWAGSINLNGYISMRTTALAKECVVARMAKLVEDAHKKKSHTQGLIDNC  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY P +  +SAC+A+  +A+K++N    +HLA+VVLV +CPCAL+LSTP+  FCALSR
Sbjct  305   AKYYIPGVALVSACIAVVPAALKLQNEDHWFHLAIVVLVGSCPCALILSTPITFFCALSR  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLLFKG EYLEILAKVK +AFDKTGT+TRGEF V +F S+   I+ NTLL WVSSI
Sbjct  365   AAKDGLLFKGGEYLEILAKVKTVAFDKTGTVTRGEFVVTNFQSICKDIDLNTLLYWVSSI  424

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPM+ AIIDYA S S+E  PE VE FQNFPGEGIYG I+   I+IGN++I  RAG
Sbjct  425   ESKSSHPMSAAIIDYAHSLSIEAKPEDVEDFQNFPGEGIYGRINSKGIFIGNRRIGLRAG  484

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +    + D     +  +I+ G  L G FSLSDACRTG+ EAI  +K +GIKT MLTGD
Sbjct  485   YETESSIETD-----TNGFIYTGQRLVGKFSLSDACRTGSMEAIDDIKSLGIKTAMLTGD  539

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAAR  Q QL  ALD  +AELLPE KA+II+ F+KGG T MIGDG+NDAPALATADVG
Sbjct  540   SQAAARSAQSQLDYALDLVYAELLPENKARIIEDFKKGGPTAMIGDGVNDAPALATADVG  599

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+N+IG+I +AI+L RR +RK++ N++++I  K  I+ LA 
Sbjct  600   ISMGISGSALAMETGHVILMSNNIGKIPEAIKLARRTFRKLVENVLISISLKGVILGLAF  659

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             AG+PLVWAAVL DVGTCL+VI NS  LL     +
Sbjct  660   AGYPLVWAAVLTDVGTCLIVILNSMQLLNATSNQ  693



>gb|KHN17622.1| Cadmium/zinc-transporting ATPase 3 [Glycine soja]
Length=794

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/691 (63%), Positives = 549/691 (79%), Gaps = 3/691 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
              KSYFDV+G+CC SEVPLI+ IL+ L G+ EVSV+V ++TV+VVHD L+I+Q QIV+ALN
Sbjct  9     RKSYFDVLGLCCSSEVPLIENILRPLQGIKEVSVIVPSRTVIVVHDTLVISQLQIVKALN  68

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+V G+     K  PSPY++  G+LLLLS LK+V+ PLK+LA+ A     +P+
Sbjct  69    EARLEANIRVYGDEKH-QKRWPSPYSIASGVLLLLSLLKFVFHPLKYLALGAVAVAVYPL  127

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +A+ ++RNL LDINILM+I+V+G+I ++ Y EA TIVFLF+  +WLES ASHKA A M
Sbjct  128   ILKAIVSIRNLRLDINILMLIAVIGTISMNHYLEAGTIVFLFSIAQWLESSASHKATAVM  187

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+N+  Q+AV+AETGE++DA++VK++T+L VKAGEVIPIDG+V++G CEVDEK LTGE
Sbjct  188   SSLMNIAPQKAVIAETGEVVDADEVKINTVLEVKAGEVIPIDGVVIDGICEVDEKKLTGE  247

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDC +A+MAKLVEEAQ++K+  QR IDK 
Sbjct  248   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVMAKMAKLVEEAQNSKTNIQRLIDKF  307

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A++YTP +V ISA +A+   A+K  N       +LVVLVSACPCAL+LSTPVA FCA ++
Sbjct  308   AQFYTPGVVIISALVAVIPLALKQHNHKLWLQFSLVVLVSACPCALILSTPVATFCAYTK  367

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG ++LE LAK+KV+AFDKTGTIT+GEF V HF SL D I+ NTL  WVSSI
Sbjct  368   AATSGLLIKGGDHLETLAKIKVMAFDKTGTITKGEFVVTHFQSLSDDIDFNTLAYWVSSI  427

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP A AI+DY +S SVEP PEKV  F+ FPGEGI G+I+G  IYIGNK+I+ARAG
Sbjct  428   ESKSSHPSAAAIVDYGRSLSVEPEPEKVTEFEIFPGEGICGKIEGRVIYIGNKRIAARAG  487

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +VP    +   GK+  YI++G+   G FSLSDACR   QEAI +LK +GIKT MLTGD
Sbjct  488   SETVPILQGEVERGKTTGYIYLGAIPIGFFSLSDACRLRVQEAIGQLKSLGIKTAMLTGD  547

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             + +AA  VQ++LG +L+  HAELLPE+K +II +F+K G T M+GDGLNDAPALA AD+G
Sbjct  548   NQSAAMQVQDELGHSLELVHAELLPEDKVKIISEFKKEGPTAMVGDGLNDAPALAAADIG  607

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG++ILM+NDI +I +AI+L R+  RKV+ NIV +I TKAAI+ LAI
Sbjct  608   ISMGISGSALASETGNIILMSNDIMKIPEAIKLARKASRKVVENIVFSIMTKAAILDLAI  667

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGG  2239
              GHPLVWAAV+ DVGTCL+VIFNS LLLR G
Sbjct  668   GGHPLVWAAVVADVGTCLLVIFNSMLLLRKG  698



>emb|CDY08717.1| BnaA06g25070D [Brassica napus]
Length=1559

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/694 (63%), Positives = 559/694 (81%), Gaps = 4/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVPLI+ ILK LDGV E SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  21    QKSYFDVLGICCSSEVPLIENILKSLDGVKEYSVIVPSRTVIVVHDNLLISPFQIAKALN  80

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A  EA++KV+G+TN   K  PSP+A+  GILLLLSFLK+VY PL+W+AVAA  AG +P+
Sbjct  81    QAKFEANVKVDGKTNFKNKW-PSPFALASGILLLLSFLKFVYPPLRWIAVAAVAAGIYPI  139

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    +DINIL+II+V  ++ + DY EAA +VFLFT  EWLE+RAS+KA A M
Sbjct  140   LAKAVASIGRKRVDINILVIITVAATLAMQDYMEAAAVVFLFTIAEWLETRASYKATAVM  199

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKV+TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  200   QSLMSLAPQKAIIAETGEEVEVDEVKVNTIVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  259

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             ++ VPKQ+DSTVWA TINLNGY+S+KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  260   AYPVPKQRDSTVWAGTINLNGYVSVKTTSLASDCVVAKMAKLVEEAQSSKTKSQRLIDKC  319

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ +S   A+  + +KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  320   SQYYTPAIILVSGGFAVVPAVMKVHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTK  379

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I+ + LL WVSS+
Sbjct  380   AATSGLLIKSADYLDTLSKIKITAFDKTGTITRGEFIVIEFRSLSRDISLHNLLYWVSSV  439

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA  IIDYA+S  VEP  E+VE +QNFPGEGIYG+IDG +IYIGN++I +RA 
Sbjct  440   ESKSSHPMAATIIDYAKSVDVEPRTEEVEDYQNFPGEGIYGKIDGNDIYIGNRRIGSRAK  499

Query  2871  CTSVPEFDVD-GREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
             C++VPE +VD  + GK++ YI+VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTG
Sbjct  500   CSTVPEIEVDTNKGGKTVGYIYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTG  559

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             D+  AA H QEQLG A+D  H ELLPE+K++II +F+K G T M+GDG+NDAPALATAD+
Sbjct  560   DNQDAAMHAQEQLGNAMDVVHGELLPEDKSRIILEFKKEGPTAMVGDGVNDAPALATADI  619

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LA +TGH+ILM+NDI RI +AI L RR  RKV+ N+ ++I  K  I+ LA
Sbjct  620   GISMGISGSALATQTGHIILMSNDIRRIPQAIRLARRSRRKVVENLFISITLKVGILVLA  679

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
               GHPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  680   FTGHPLIWAAVLADVGTCLLVILNSMLLLRDKDK  713


 Score =   349 bits (896),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 172/269 (64%), Positives = 215/269 (80%), Gaps = 1/269 (0%)
 Frame = -1

Query  3036  HPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVP  2857
             HPMA  IIDYA+S  VEP  E+VE +QNFPGEGIYG+IDG +IYIGN++I +RA C++VP
Sbjct  859   HPMAATIIDYAKSVDVEPRTEEVEDYQNFPGEGIYGKIDGNDIYIGNRRIGSRAKCSTVP  918

Query  2856  EFDVD-GREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAA  2680
             E +VD  + GK++ YI+VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTGD+  A
Sbjct  919   EIEVDTNKGGKTVGYIYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTGDNQDA  978

Query  2679  ARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMG  2500
             A H QEQLG A+D  H ELLPE+K++II +F+K G T M+GDG+NDAPALATAD+GISMG
Sbjct  979   AMHAQEQLGNAMDVVHGELLPEDKSRIILEFKKEGPTAMVGDGVNDAPALATADIGISMG  1038

Query  2499  ISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHP  2320
             ISGS LA +TGH+ILM+NDI RI +AI L RR  RKV+ N+ ++I  K  I+ LA AGHP
Sbjct  1039  ISGSALATQTGHIILMSNDIRRIPQAIRLARRARRKVVENLFISITLKVGILVLAFAGHP  1098

Query  2319  LVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             L+WAAVL DVGTCL+VI NS LLLR  DR
Sbjct  1099  LIWAAVLADVGTCLLVILNSMLLLRDKDR  1127



>ref|XP_007154730.1| hypothetical protein PHAVU_003G142700g [Phaseolus vulgaris]
 gb|ESW26724.1| hypothetical protein PHAVU_003G142700g [Phaseolus vulgaris]
Length=1187

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/693 (63%), Positives = 560/693 (81%), Gaps = 3/693 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK L+G+ EVSV+V ++TV+V+HD L I+Q QIV+ALN
Sbjct  8     QKSYFDVLGLCCSSEVPLIENILKPLEGIKEVSVIVPSRTVIVLHDTLAISQLQIVKALN  67

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+V+G+     K  P+PY++  G+LLL+S LK+VY P+K++A+ A  AG +P+
Sbjct  68    QARLEANIRVHGDEKH-KKRWPNPYSIASGVLLLVSLLKFVYHPMKYVALGAVAAGVYPI  126

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + +A+A++RN  +DI+ILMII+V+G+I + DY EA TIVFLF+  EWLESRAS+KA AAM
Sbjct  127   ILKAIASIRNRRIDISILMIIAVIGTIAMDDYLEAGTIVFLFSIAEWLESRASYKANAAM  186

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+N+  Q+AV+AETGE++DA++VKV+TILAVKAGEVIPIDG+V++G CEVDEKTLTGE
Sbjct  187   SSLMNITPQKAVIAETGEVVDADEVKVNTILAVKAGEVIPIDGVVLDGTCEVDEKTLTGE  246

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDC VA+M KLVEEAQ++K+  QR IDK 
Sbjct  247   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVVAKMTKLVEEAQNSKTTVQRLIDKF  306

Query  3405  AKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMFCALSR  3232
              K+YTPA+V I+  +A+  V V++R E+Y  H ALVVLVS CPCAL+LSTPVA FCA +R
Sbjct  307   VKFYTPAVVIIAILVAVIPVAVKSRKEKYWLHTALVVLVSGCPCALILSTPVATFCAYTR  366

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG  +LE LAK+KV+AFDKTGTIT+G+F V  F SL   I+ NTLL WVSS+
Sbjct  367   AATSGLLIKGGHHLETLAKIKVMAFDKTGTITKGDFVVTQFQSLSADIDLNTLLYWVSSV  426

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP+A AI+DY +S S+EP PEKV  F+NFPGEGI G+++   IYIGNKKI+ARAG
Sbjct  427   ESKSSHPLASAIVDYGRSLSIEPEPEKVTEFENFPGEGISGKMEDRVIYIGNKKIAARAG  486

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +VP    +   GK+  YI++G++  G+FSLSD CR G QEAI +LK++GIKT MLTGD
Sbjct  487   SETVPILQGEIARGKTTGYIYLGATQVGLFSLSDVCRLGVQEAIERLKLLGIKTAMLTGD  546

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S +AA   QEQLG +L+  HAELLPE+K +II +F+K G T MIGDG+NDAPALA+AD+G
Sbjct  547   SESAAMQAQEQLGHSLELVHAELLPEDKVKIISEFKKEGPTAMIGDGINDAPALASADIG  606

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG++ILM+NDI +I +AI+L RR   KV+ NI+++I TKAAI+ LA+
Sbjct  607   ISMGISGSALASETGNIILMSNDIRKIPEAIKLARRTRWKVLENIILSITTKAAIIGLAL  666

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
              G+P VWAAV+ DVGTCL+VI NS LLLR G +
Sbjct  667   GGYPFVWAAVVADVGTCLLVILNSMLLLRRGHK  699



>ref|XP_004297538.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Fragaria 
vesca subsp. vesca]
Length=835

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/694 (62%), Positives = 545/694 (79%), Gaps = 4/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEV L++ ILK L+GV EVSV++ TKTV+VVHD  LI+Q QI  A+N
Sbjct  25    QKSYFDVLGLCCSSEVALVENILKPLNGVKEVSVILPTKTVIVVHDSHLISQIQIDEAMN  84

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +ASLE+S+KV+ E  +  K  PSPYA+  G+LLLLS LKYVY+P +WLA+ A  AG FP+
Sbjct  85    QASLESSVKVHVE--NYKKKWPSPYAIASGVLLLLSLLKYVYSPFQWLALGAVAAGIFPI  142

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L + VA++RNL +DINIL+II+V+G+I + DY EA TIVFLFT  EWLESR+ HKA A M
Sbjct  143   LMKCVASIRNLKIDINILVIIAVIGTIAMSDYVEAGTIVFLFTIAEWLESRSRHKANAVM  202

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AVLA TG+++D + V+++TILAVKAGEVIPIDGIVV+GE EVDEKTLTGE
Sbjct  203   SSLMSMAPQKAVLAATGDVVDVDMVELNTILAVKAGEVIPIDGIVVDGEAEVDEKTLTGE  262

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ V K + STVWA T+NLNGYIS+KTTA+AEDC VA MAKLVEEAQ+ KS+ QR +DK 
Sbjct  263   SYPVAKLQGSTVWAGTVNLNGYISVKTTALAEDCVVAEMAKLVEEAQNRKSKTQRFVDKF  322

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AK+YTPA++ +S  +A+  +A+ V N S+ +HLALVVLVSACPCAL+LSTPV  FC L+ 
Sbjct  323   AKFYTPAVLFVSVSVAVIPAALHVPNWSQWFHLALVVLVSACPCALILSTPVVTFCTLTN  382

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YLEIL K+K + FDKTGTIT GEF V  F SL   I+ NTLL WV+SI
Sbjct  383   AATSGLLIKGGDYLEILGKIKTMCFDKTGTITSGEFFVMDFHSLRKDISLNTLLYWVASI  442

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E KSSHPMA A++D A+ HS+EP PE VE FQ+FPG+GI G IDG +IYIGN+KI+ R  
Sbjct  443   ERKSSHPMADALVDCARFHSIEPKPENVEDFQSFPGQGIRGRIDGQDIYIGNRKIALRTA  502

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +VP  +  G  GK++ YI+ G + AG+F+LSDACR GA EA+R+LK +GIKT +LTGD
Sbjct  503   SGTVPTIEESGNGGKTIGYIYCGGTPAGIFALSDACRLGAAEAVRELKEIGIKTALLTGD  562

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S+ AA H  EQL  A +  +AELLPEEKA+I+ +F+  G T M+GDG+NDAPALATAD+G
Sbjct  563   SHTAAIHTNEQLEQAFEVVYAELLPEEKARIVNEFKIEGYTAMVGDGINDAPALATADIG  622

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LAQETG+VILM+NDI  + KAI L +R  RKVI N+ +++  K A++ALA 
Sbjct  623   ISMGISGSALAQETGNVILMSNDIRNLPKAIRLAKRANRKVIENVTLSMAPKLAVLALAF  682

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             AGHPLVWAAVL D GTC++VI NS LLL+  + +
Sbjct  683   AGHPLVWAAVLADAGTCVLVILNSMLLLQASNNK  716



>ref|XP_003610069.1| Zn/Cd P(IB)-type ATPase [Medicago truncatula]
Length=1047

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/708 (62%), Positives = 556/708 (79%), Gaps = 18/708 (3%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK L GV EVSV+V ++TV+VVHD LLI+Q QIV+ALN
Sbjct  11    QKSYFDVVGLCCSSEVPLIENILKPLQGVKEVSVIVPSRTVIVVHDTLLISQLQIVKALN  70

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I++ G  N   K  PS Y+V  G+LLLLSFLK+VY P K++A+AA VAG +P+
Sbjct  71    QARLEANIRIYGNENH-KKKWPSIYSVASGLLLLLSFLKFVYTPFKYVALAAVVAGIYPI  129

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +A+ ++RNL +DINIL+II+V G+I ++DY EA TIVFLF+  +WLES ASHK+ A M
Sbjct  130   FLKAIVSIRNLRIDINILVIIAVAGTIAMNDYLEAGTIVFLFSISDWLESSASHKSNAVM  189

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             +SL+++  Q+AV+AETGE +D ++V+V+TILAVKAGE+IPIDGI+V+G+CEVDEKTLTGE
Sbjct  190   TSLMSIAPQKAVIAETGEDVDVDEVRVNTILAVKAGEIIPIDGIIVDGDCEVDEKTLTGE  249

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDC VA+M KLVE+AQ++K+  QR IDK 
Sbjct  250   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVVAKMTKLVEDAQNSKTSTQRLIDKF  309

Query  3405  AKYYTPA--------IVAISACLAISAV------KVENRSERY--HLALVVLVSACPCAL  3274
             AK+YTP         +V  SA + IS +       ++  +E+Y  H ALVVLVSACPCAL
Sbjct  310   AKFYTPVNFDGLIVLVVTFSAVIFISTLVAVVPVVLKVHNEKYWLHFALVVLVSACPCAL  369

Query  3273  VLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLD  3094
             +LSTPVA FCA ++AA  GLL KG   LE LAK+KV+AFDKTGTIT+GEF V +F SL D
Sbjct  370   ILSTPVATFCAYTKAATSGLLIKGGHALETLAKIKVMAFDKTGTITKGEFAVTNFQSLSD  429

Query  3093  GINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGM  2914
              I+ NTL+ WVS IESKSSHP+A AI+D+ +S S+ PNPEKV  F+NFPGEGI G+ID  
Sbjct  430   DIDLNTLIYWVSCIESKSSHPLAEAIVDHGRSLSIVPNPEKVTEFENFPGEGICGKIDER  489

Query  2913  EIYIGNKKISARAGC-TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIR  2737
              +YIGNKKI+ RAG  T VP  + +   GK++ YI+ G +  G+FSLSD CR+G QEAIR
Sbjct  490   VLYIGNKKIATRAGSETVVPTLEGEAHGGKTIGYIYSGPTPVGIFSLSDTCRSGVQEAIR  549

Query  2736  KLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIG  2557
             KLK++GIKT MLTGD  +AA   QEQLG AL+  HAELLPE K +II +F+K G T M+G
Sbjct  550   KLKLLGIKTAMLTGDCQSAAMQAQEQLGHALELVHAELLPEGKVKIITEFKKDGPTAMLG  609

Query  2556  DGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNI  2377
             DGLNDAPALA+AD+GISMGISGS LA ETG +ILM+ND+ +I +AI+L R+  RKVI NI
Sbjct  610   DGLNDAPALASADIGISMGISGSALASETGDIILMSNDLRKIPEAIKLARKARRKVIENI  669

Query  2376  VVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             V+++ TK AI+ALAIAGHP+VWAAVL DVGTCL+VI NS LLL  G +
Sbjct  670   VLSVITKVAILALAIAGHPIVWAAVLADVGTCLLVILNSMLLLPRGHK  717



>ref|XP_006303912.1| hypothetical protein CARUB_v10008389mg [Capsella rubella]
 gb|EOA36810.1| hypothetical protein CARUB_v10008389mg [Capsella rubella]
Length=754

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/695 (59%), Positives = 539/695 (78%), Gaps = 4/695 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ LDGV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSIVGDVLRPLDGVKEFSVIVPSRTVIVVHDNFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+LL LS  KY+Y+PL+W AV A +AG FP+
Sbjct  73    QARLEASVRPYGETSLKSQW-PSPFAIVSGVLLALSLFKYLYSPLEWFAVVAVMAGVFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + D+ EAATIVFLF+  +WLES A+ KA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATLCMQDFTEAATIVFLFSVADWLESSAAQKASTVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+AETG  +D  +V+++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPQKAVIAETGLEVDVGEVRINTVVSVKAGESIPIDGVVVDGRCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ++STV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ  +++ QR IDK 
Sbjct  252   SFPVSKQRESTVLAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKTQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ++AC A+  + +KV N S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVILAACFAVIPALLKVPNLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+++IAFDKTGTIT+ EFTV+ F SL   IN +TLL  VSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIEIIAFDKTGTITKAEFTVSDFRSLSHNINLHTLLYLVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKS+HPMA A+ID+A+S SVEP P+ VE+F+NFPGEG+YG IDG +IYIGNK I+ RAG
Sbjct  432   ESKSNHPMAAALIDHARSSSVEPKPDVVENFENFPGEGVYGRIDGQDIYIGNKTIAQRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP+ + D + GK++ YI++G+ LAG F L D CR G  +A+++LK++GIKT MLTGD
Sbjct  492   CLTVPDIEADMKRGKTIGYIYIGAKLAGSFCLLDGCRYGVAQALKELKILGIKTAMLTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA   QEQLG ALD  H+ELLP++KA+II +F+  G T M+GDGLNDAPALA AD+G
Sbjct  552   NQDAAMTTQEQLGNALDIVHSELLPQDKARIIDEFKSQGATMMVGDGLNDAPALAKADIG  611

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG +ILM+NDI +I K + L +R  +KVI N+V+++  K AIM L  
Sbjct  612   ISMGISGSALATETGDIILMSNDIRKIPKGMRLAKRSHKKVIENVVLSVSIKGAIMVLGF  671

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             AG+PLVWAAVL D GTCL+VI NS +LLR  +REA
Sbjct  672   AGYPLVWAAVLADAGTCLLVILNSMMLLR-DEREA  705



>gb|EPS72056.1| hypothetical protein M569_02696, partial [Genlisea aurea]
Length=700

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/697 (62%), Positives = 544/697 (78%), Gaps = 11/697 (2%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SE+P+I+++L  L+GV + SV++ TKT++VVHD  L+ Q QIV+ALN
Sbjct  2     DKSYFDVVGLCCSSEIPVIERVLNSLEGVKDFSVVLPTKTLIVVHDSSLLPQMQIVKALN  61

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +  LEAS++  G  N   +  PSPYA++ G LLLLS LK+VY PLKWL + A   G  PV
Sbjct  62    RVRLEASVRPKGVKNHKNR-FPSPYALLSGALLLLSLLKFVYHPLKWLTIGAIAVGIVPV  120

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +++AA+RNLT+++NIL++I+V GS+ L DYWEAATIVFLFTT EWLESRA H+A AAM
Sbjct  121   LLKSIAAIRNLTIEVNILVLIAVSGSVALGDYWEAATIVFLFTTAEWLESRAGHQATAAM  180

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL++VV QRAV+A+TGE ++A++VK++TILAVKAGE IPIDGIVV+G CEVDEK LTGE
Sbjct  181   SSLIDVVPQRAVIADTGEEVNADEVKLNTILAVKAGEAIPIDGIVVDGTCEVDEKLLTGE  240

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S  V K+KDSTVWA+TINLNGYI+++TT VA DC VARMAKLVEE+QS KS+ QR +DK 
Sbjct  241   SLPVSKEKDSTVWASTINLNGYITVRTTVVAGDCVVARMAKLVEESQSKKSKVQRFMDKC  300

Query  3405  AKYYTPAIVAISACLA----ISAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCAL  3238
             AKYYTP +V IS  LA    +S+  V ++   +HL+LVVLVS CPC L+LSTPVAMFCAL
Sbjct  301   AKYYTPIVVLISGVLALIPLLSSSHVHDKRGWFHLSLVVLVSGCPCPLLLSTPVAMFCAL  360

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLL---DGINHNTLLS  3067
             S AA LG+LFKGA+++E LAK+K I  DKTGTIT+GEF V+ F+SLL   +    +  L 
Sbjct  361   SEAARLGILFKGAQHIETLAKIKSIGLDKTGTITKGEFHVSDFTSLLHRDETTTVDEFLY  420

Query  3066  WVSSIESKSSHPMAPAIIDYAQSH-SVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKK  2890
             W+SS+ESKSSHPMA A++DYA+    VEP PE+V+ FQ+F GEGI G I    +YIGN+K
Sbjct  421   WISSVESKSSHPMAAALVDYARERCQVEPRPEEVDGFQSFSGEGIVGRIGDSVVYIGNRK  480

Query  2889  ISARAGCTSVPE-FDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIK  2713
             +++RAG +   E  +    EG S  Y+F+G SLAGVF L D+CRTGA+EA+R LK  GIK
Sbjct  481   LASRAGFSGGDEALERYAAEGMSTGYVFIGPSLAGVFHLQDSCRTGAREALRDLKSRGIK  540

Query  2712  TVMLTGDSYAAARHVQEQLGG-ALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAP  2536
             TVMLTGDS AAA   Q +LGG ALD  HAELLP +K +IIK+ QK G T M+GDG+NDAP
Sbjct  541   TVMLTGDSLAAANQAQRELGGEALDVVHAELLPADKEKIIKELQKEGPTAMVGDGVNDAP  600

Query  2535  ALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTK  2356
             AL+ ADVGISMG+SGS LA ETG V+LMTNDI RI KA  + ++  RK++ N+V++  TK
Sbjct  601   ALSAADVGISMGVSGSALATETGDVVLMTNDIQRIPKAYGIAKKTRRKIVENVVISFSTK  660

Query  2355  AAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             A I+ LAIAGHPLVWAAVL DVGTCL+VIFNS LLL+
Sbjct  661   AGILGLAIAGHPLVWAAVLADVGTCLLVIFNSMLLLK  697



>ref|XP_010110715.1| Cadmium/zinc-transporting ATPase 3 [Morus notabilis]
 gb|EXC27880.1| Cadmium/zinc-transporting ATPase 3 [Morus notabilis]
Length=948

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/694 (60%), Positives = 537/694 (77%), Gaps = 3/694 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYF+V+G+CC SEV L+++I++ ++GV E+SV++ TKT++VVHD LL++  QIV  LN
Sbjct  9     KKSYFEVLGLCCASEVALLERIMEQINGVKEISVILPTKTLIVVHDSLLLSDTQIVEVLN  68

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G+ N      P+P  + CG+LL LSFLK+V+ P +WLA+   V G+  +
Sbjct  69    KARLEASVQPKGDENFVRNKWPAPSVMACGVLLALSFLKFVWRPFQWLALGTVVIGAPSI  128

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               R+ A++RNLTL+INIL++++VVG++VL DYWEA T+VFLF+   WLE+RAS+KAMAAM
Sbjct  129   AIRSFASIRNLTLNINILVLLAVVGTLVLQDYWEAGTVVFLFSIAHWLETRASYKAMAAM  188

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             S+L ++  QRA +AETGE +D + VK+DTILAVKAGE IP+DG+VVEG+CEVDEK L+GE
Sbjct  189   SALTSMAPQRATIAETGEQVDVDSVKLDTILAVKAGEAIPMDGVVVEGKCEVDEKMLSGE  248

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K+  S VWA +INLNGYI+++TTA+A D  VARMAKLVE+A   KS+ +R IDK 
Sbjct  249   SFPVAKESGSIVWAGSINLNGYIAVRTTALARDSVVARMAKLVEDAHKKKSQTERFIDKC  308

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY P ++ ISA  AI  + ++  N +  +HLALVVLVS CPCALV+STPV +FCALSR
Sbjct  309   AKYYIPLVMIISASFAIIPAVLRFPNENYWFHLALVVLVSTCPCALVISTPVTIFCALSR  368

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YLE+LAKVK +AFDKTGT+TRGEF+V  F SL   I+ NTLL WVSSI
Sbjct  369   AATTGLLIKGGDYLELLAKVKTVAFDKTGTLTRGEFSVIDFRSLSHDISFNTLLYWVSSI  428

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++ + +S S+EPNPE VE FQNFPGEG+YG+IDG +IYIGN +I  RAG
Sbjct  429   ESKSSHPMADALVGHGRSQSIEPNPENVEGFQNFPGEGVYGKIDGKDIYIGNWRIGLRAG  488

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C      DV     ++  YI+ G++L G+F LSD CR+GA EAI +LK + I++ MLTGD
Sbjct  489   CEK-DSLDVQSMSRETNGYIYCGAALVGIFRLSDTCRSGAAEAIEELKELCIRSAMLTGD  547

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S AAA    +QL  ALD  HAELLPEEKAQ IK+F++ G   MIGDG+NDA ALATAD+G
Sbjct  548   SNAAAMIAYDQLDRALDTVHAELLPEEKAQFIKEFKRNGPVAMIGDGINDALALATADIG  607

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGH ILM+NDI +I KAI L +R +RK++ N+++++ TK+ I+ALA 
Sbjct  608   ISMGISGSALATETGHAILMSNDIRKIPKAIRLAKRAFRKLVENVIISVGTKSVILALAF  667

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             AG+PLVWAAVL DVGTCLVVI NS LLL+   ++
Sbjct  668   AGYPLVWAAVLTDVGTCLVVILNSMLLLKDTKKQ  701



>emb|CAD89012.1| putative cadmium/zinc-transporting ATPase 3 [Arabidopsis halleri 
subsp. halleri]
Length=757

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/695 (59%), Positives = 540/695 (78%), Gaps = 4/695 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ LDGV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCTSEVSIVGDVLRPLDGVKEFSVIVPSRTVIVVHDTFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A++ G+ L LSF KY Y+ L+WLAV A VAG FP+
Sbjct  73    QARLEASVRPYGETSLKSQW-PSPFAILSGVFLALSFFKYFYSLLEWLAVVAVVAGIFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L  I+V+ ++ + ++ EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRLDINALTFIAVIATLCMQNFTEAATIVFLFSVADWLESSAAHKASTVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+AETG  +D ++V+++TI++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIAETGHEVDVDEVRINTIVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ+DSTV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKQRDSTVLAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ++AC A+  V  K+++ S  +HLALVVLVS CPC L+LSTP+A FCAL++
Sbjct  312   SRYYTPAVVVLAACFAVIPVLLKLQDLSHWFHLALVVLVSGCPCGLILSTPIATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K++AFDKTGTIT+ EF V+ F SL   IN + LL WVSSI
Sbjct  372   AAMSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSHNINLHNLLYWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDYA+S SVEP P+ VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  432   ESKSSHPMAAALIDYARSVSVEPKPDLVENFQNFPGEGVYGRIDGQDIYIGNKRIAQRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP+ + + + GK++ YI++G+ L+G F+L D+CR G  +A+++LK +GIKT MLTGD
Sbjct  492   CLTVPDMEANMKRGKTIGYIYIGAKLSGSFNLIDSCRYGVAQALKELKSLGIKTAMLTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA   QEQL  ALD  H+ELLP++KA+II +F+  G T M+GDGLNDAPALA AD+G
Sbjct  552   NRDAALSTQEQLENALDIVHSELLPQDKARIIDEFKIQGPTMMVGDGLNDAPALAKADIG  611

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             +SMGISGS LA ETG +ILM+NDI +I K + L +R  +KVI N+V+++  K AIM LA 
Sbjct  612   LSMGISGSALATETGDIILMSNDIRKIPKGMRLAKRSHKKVIENVVLSVSIKGAIMVLAF  671

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
              G+PLVWAAVL D GTCL+VI NS +LLR  +REA
Sbjct  672   VGYPLVWAAVLADAGTCLLVILNSMMLLR-DEREA  705



>ref|XP_002867366.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43625.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=757

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/695 (58%), Positives = 538/695 (77%), Gaps = 4/695 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ LDGV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSIVGDVLRPLDGVKEFSVIVPSRTVIVVHDTFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  G+T+   +  PSP+A+V G+ L +SF KY Y  L+WLA+AA VAG FP+
Sbjct  73    QARLEASVRPYGDTSLKSQW-PSPFAIVSGVFLAVSFFKYFYNLLEWLAIAAVVAGIFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + D+ EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRLDINGLTLIAVIATLCMQDFTEAATIVFLFSVADWLESSAAHKASTVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+A+TG  +D ++V+++TI++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIADTGLEVDVDEVRINTIVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ++STV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKQRESTVLAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ++AC A+  + +KV+N S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVVLAACFAVIPALLKVQNLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K++AFDKTGTIT+ EF V+ F SL   IN + LL WVSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSHNINLHNLLYWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDYA+   VEP P+ VE+FQNFPGEG+YG IDG +IYIGNK+IS RAG
Sbjct  432   ESKSSHPMAAALIDYARLIFVEPKPDIVENFQNFPGEGVYGRIDGQDIYIGNKRISQRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VPE + + + GK++ YI++G+ L+G F+L D CR G  +A+++LK +GIKT MLTGD
Sbjct  492   CLTVPEMEANMKRGKTIGYIYIGAKLSGSFTLLDGCRYGVAQALKELKSLGIKTAMLTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA   QEQ+  ALD  H+ELLP++KA+II +F+  G T M+GDGLNDAPALA AD+G
Sbjct  552   NRDAAMSTQEQIENALDIVHSELLPQDKARIIDEFKIQGPTMMVGDGLNDAPALAKADIG  611

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG +ILM+NDI +I K + L +R  +KVI N+V+++  K AIM L  
Sbjct  612   ISMGISGSALATETGDIILMSNDIRKIPKGMRLAKRSHKKVIENVVLSVSIKGAIMVLGF  671

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
              G+PLVWAAVL D GTCL+VI NS +LLR  +REA
Sbjct  672   VGYPLVWAAVLADAGTCLLVILNSMMLLR-DEREA  705



>ref|XP_006431587.1| hypothetical protein CICLE_v10000354mg [Citrus clementina]
 gb|ESR44827.1| hypothetical protein CICLE_v10000354mg [Citrus clementina]
Length=774

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/694 (60%), Positives = 539/694 (78%), Gaps = 3/694 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+YF+V+G+CC SEVPL+++I+  LDGV E+SV+V TKTV+VVHD   I++ +IV ALN
Sbjct  6     KKNYFEVLGLCCSSEVPLVERIMNSLDGVEEISVIVPTKTVIVVHDTRRISETKIVEALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEA+++  G+     K  P+P  +  G+LL LSFL Y+Y PL+ LAVAA + G   +
Sbjct  66    KARLEATVRPEGKMKSQKKW-PAPSVMASGLLLALSFLGYIYYPLQSLAVAAVIFGVPAI  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L R+VA++++LTL+IN+L++++ VG++ L DY EA +IVFLF+  +WLES AS+KAMAAM
Sbjct  125   LVRSVASIKSLTLNINVLVLMAAVGTLALGDYVEAGSIVFLFSISQWLESVASYKAMAAM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++  Q+A+ AETG+ +D N VKV+TILAV+AGEVIPIDGIVVEG+CEVDEKTLTGE
Sbjct  185   SSLTSMAPQKAITAETGDQVDVNTVKVNTILAVRAGEVIPIDGIVVEGKCEVDEKTLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K++DS VWA TINL+GYISIKTTA+A+DC V+RMA LVEE+   KSRAQ  I+  
Sbjct  245   SFPVVKEQDSPVWAGTINLDGYISIKTTALAKDCVVSRMAALVEESHKKKSRAQTFIESF  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY PA++ IS   A+  +AV V N     +LA+VVLVS CPCAL+LSTPV +FCALS+
Sbjct  305   AKYYIPAVLLISVAFAVIPAAVGVPNVRHWLYLAIVVLVSTCPCALILSTPVVIFCALSK  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG  YLE LAKVK++AFDKTGT+TRGEFTV  F S+ D ++  TLL WVSSI
Sbjct  365   AATTGLLVKGGNYLETLAKVKMVAFDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSI  424

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DYA+S ++EP PE VE FQNFPGEGI+G+I G EIYIGN++I  R G
Sbjct  425   ESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNEIYIGNRRIGPRTG  484

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C+     +     GK+  Y+++G++  G FSLSD+CR+GA EAI+ LK +GIK+ +LTGD
Sbjct  485   CSKDSIVEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILTGD  544

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S+AAA + Q+QL  A D  +AELLP+ KA++++  +K G T M+GDG+NDAPALA AD+G
Sbjct  545   SHAAALYAQDQLDHAFDMVYAELLPQHKAELVELLKKDGTTAMVGDGINDAPALAAADIG  604

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+NDI +I KAI+L R+   K+I N+ +++  K A++ALAI
Sbjct  605   ISMGISGSALAMETGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLALAI  664

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             AG+PLVWAAVL DVGTCL+VI NS LLL+    E
Sbjct  665   AGYPLVWAAVLTDVGTCLIVILNSMLLLKNNPEE  698



>ref|XP_006492557.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like isoform 
X1 [Citrus sinensis]
Length=802

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/694 (60%), Positives = 538/694 (78%), Gaps = 3/694 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+YF+V+G+CC SEVPL+++IL  LDGV E+SV+V TKTV+VVHD   I++ +IV ALN
Sbjct  6     KKNYFEVLGLCCSSEVPLVERILNSLDGVEEISVIVPTKTVIVVHDTRRISETKIVEALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEA+++  G+     K  P+P  +  G+LL LSFL Y+Y PL+ LAVAA + G   +
Sbjct  66    KARLEATVRPEGKMKSQKKW-PAPSVMASGLLLALSFLGYIYYPLQSLAVAAVIFGVPAI  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L R+VA+++ LTL+IN+L++++ VG++ L DY EA +IVFLF+  +WLES AS+KAMAAM
Sbjct  125   LVRSVASIKRLTLNINVLVLMAAVGTLALGDYVEAGSIVFLFSISQWLESVASYKAMAAM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++  Q+A++AETGE +D N VKV+TILAV+AGEVIPIDGI+VEG+CEVDEKTLTGE
Sbjct  185   SSLTSMAPQKAIIAETGEQVDVNTVKVNTILAVRAGEVIPIDGIIVEGKCEVDEKTLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K++DS VWA TINL+GYISIKTTA+A+DC V+RMA LVEE+   KSRAQ  I+  
Sbjct  245   SFPVVKEQDSPVWAGTINLDGYISIKTTALAKDCVVSRMAALVEESHKKKSRAQTFIESF  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY PA++ +S   A+  +AV V N     +LA+VVLVS CPCAL+LSTPV +FCALS+
Sbjct  305   AKYYIPAVLLVSVAFAVIPAAVGVPNVRHWLYLAIVVLVSTCPCALILSTPVVIFCALSK  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG  YLE LAKVK++AFDKTGT+TRGEFTV  F S+ D ++  TLL WVSSI
Sbjct  365   AATTGLLVKGGNYLETLAKVKMVAFDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSI  424

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DYA+S ++EP PE VE FQNFPGEGI+G+I G EIYIGN +I  R G
Sbjct  425   ESKSSHPMAAALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNEIYIGNTRIGPRTG  484

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C+     +     GK+  Y+++G++  G FSLSD+CR+GA EAI+ LK +GIK+ +LTGD
Sbjct  485   CSKDSIVEAKCTGGKTRGYVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILTGD  544

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S+AAA + Q+QL  A D  +AELLP+ KA++++  +K G T M+GDG+NDAPALA AD+G
Sbjct  545   SHAAALYAQDQLDHAFDMVYAELLPQHKAELVELLKKDGTTAMVGDGINDAPALAAADIG  604

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+NDI +I KAI+L R+   K+I N+ +++  K A++ALAI
Sbjct  605   ISMGISGSALAVETGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLALAI  664

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             AG+PLVWAAVL DVGTCL+VI NS LLL+    E
Sbjct  665   AGYPLVWAAVLTDVGTCLIVILNSMLLLKNNPEE  698



>ref|NP_001289917.1| cadmium/zinc-transporting ATPase HMA3-like [Camelina sativa]
 gb|AII32284.1| heavy metal ATPase transporter 3b protein [Camelina sativa]
Length=761

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/700 (58%), Positives = 534/700 (76%), Gaps = 4/700 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
              N   + SYFDV+GICC SEV ++  +L+ LDGV E SV+V ++TV+VVHD  LI+Q QI
Sbjct  8     KNMNIQTSYFDVVGICCSSEVSIVGDVLRPLDGVIEFSVIVPSRTVIVVHDTFLISQLQI  67

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEAS++  G+T+   +  PSP+A+V G+LL+LSF KY Y PL+W A+ A VA
Sbjct  68    VKALNQARLEASVRPYGDTSLKSQW-PSPFAIVSGVLLVLSFFKYFYGPLEWFAIVAVVA  126

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G FP+L +AVA++    LDIN L +I+VV +  + D+ EAATIVFLF+  +WLES A+ K
Sbjct  127   GVFPILAKAVASVTRFRLDINALTLIAVVATQCMQDFTEAATIVFLFSVADWLESSAAQK  186

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A   MSSL+++  ++AV+AETG  +  ++V ++T+++VKAGE IPIDG+VV+G C+VDEK
Sbjct  187   ASTVMSSLMSLAPRKAVIAETGLEVGVDEVMINTVVSVKAGESIPIDGVVVDGSCDVDEK  246

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGESF V K ++STV AATINLNG+I +KTTA+A DC VA+M KLVEEAQ ++++ QR
Sbjct  247   TLTGESFPVSKHRESTVLAATINLNGFIKVKTTALAPDCVVAKMTKLVEEAQKSQTKTQR  306

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              IDK ++YYTP +V ++AC A+  + +KV N S  +HL+LVVLVS CPC L+LSTPVA F
Sbjct  307   FIDKCSRYYTPVVVILAACFAVIPALLKVHNLSHWFHLSLVVLVSGCPCGLILSTPVATF  366

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  G L K  + LE LAK+K++AFDKTGTIT+ EF V+ F SL   IN  +L+ 
Sbjct  367   CALTKAATSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSQNINMQSLIY  426

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSSIESKSSHPMA A+IDYA+S SVEP P+ VE+FQN PGEG+YG ID  +IYIGNK+I
Sbjct  427   WVSSIESKSSHPMAAALIDYARSVSVEPKPDVVENFQNIPGEGVYGRIDDQDIYIGNKRI  486

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             + RAGC +VP+ + + + GK++ YI++G+ L G F+L D CR G  +A+ +LK +GIKT 
Sbjct  487   AQRAGCLTVPDIEANMKRGKTIGYIYIGAELVGSFNLLDGCRYGVAQALNELKSLGIKTA  546

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+  AA  +QEQLG ALD  H+ELLP++KA II +F+  G T M+GDGLNDAPALA
Sbjct  547   MLTGDNQDAAMSIQEQLGNALDIVHSELLPQDKASIIDEFKSQGLTMMVGDGLNDAPALA  606

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
              AD+GISMGISGS LA ETG +ILM+NDI +I K + L +R  +KVI N+V+++  K AI
Sbjct  607   KADIGISMGISGSALATETGDIILMSNDIRKISKGMRLAKRSHKKVIENVVLSVSIKGAI  666

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             M L  AG+PLVWAAVL D GTCL+VI NS +LLR  +REA
Sbjct  667   MVLGFAGYPLVWAAVLADAGTCLLVIINSMMLLR-DEREA  705



>ref|NP_001289919.1| cadmium/zinc-transporting ATPase HMA3 [Camelina sativa]
 gb|AFS33099.1| heavy metal ATPase transporter 3 [Camelina sativa]
Length=761

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/695 (58%), Positives = 534/695 (77%), Gaps = 4/695 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ LDGV E SV+V ++TV+VVHD  LI+Q QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSIVGDVLRPLDGVIEFSVIVPSRTVIVVHDTFLISQLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  G+T+       SP+A+V G+LL LSF KY Y PL+W A+ A VAG FP+
Sbjct  73    QARLEASVRPYGDTS-LKNQWTSPFAIVSGVLLALSFFKYFYGPLEWFAIVAVVAGVFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + D+ EAATIVFLF+  +WLES A+ KA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATLCMQDFTEAATIVFLFSVADWLESSAAQKASTVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+A+TG  ++ ++V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIADTGLEVNVDEVMINTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K ++STV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKHRESTVLAATINLNGYIKVKTTALARDCIVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTP++V ++AC A+  + +KV N S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPSVVILAACFAVIPALLKVHNLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K +AFDKTGTIT+ EF V+ F SL   IN ++LL WVSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIKTVAFDKTGTITKAEFMVSDFRSLSHNINLHSLLYWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDYA+S SVEP P+ VE+FQNFPGEG+YG ID  +IYIGNK+I+ RAG
Sbjct  432   ESKSSHPMAAALIDYARSVSVEPKPDVVENFQNFPGEGVYGRIDAQDIYIGNKRIAQRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP+ + + + GK++ YI++G+ L G F+L D CR G  +A+++LK +GIKT MLTGD
Sbjct  492   CLTVPDIEANMKRGKTIGYIYIGAELVGSFNLLDGCRYGVAQALKELKALGIKTAMLTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA  +QEQLG  LD  H+ELLP+EKA+II  F+  G T M+GDGLNDAPALA AD+G
Sbjct  552   NQDAAISIQEQLGNGLDIVHSELLPQEKARIIDDFKSQGPTMMVGDGLNDAPALAKADIG  611

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG +ILM+NDI +I K + L +R  +KVI N+V+++  K AIM L  
Sbjct  612   ISMGISGSALATETGDIILMSNDIRKIPKGMRLAKRSHKKVIENVVLSVSIKGAIMVLGF  671

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             AG+PLVWAAVL D GTCL+VI NS +LLR  +REA
Sbjct  672   AGYPLVWAAVLADAGTCLLVIINSMMLLR-DEREA  705



>ref|XP_009137892.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3 [Brassica rapa]
Length=764

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/697 (61%), Positives = 541/697 (78%), Gaps = 4/697 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV L+ +IL+ LDGV E SV+V ++TV+VVHD LLI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSLVGEILRPLDGVKEFSVIVPSRTVIVVHDILLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  GET+   +  PSP+AVV G+LL LSFLKY Y+PL+W AV A VAG FP+
Sbjct  73    KARLEASVRPYGETSLTSQW-PSPFAVVSGVLLALSFLKYFYSPLEWFAVVAVVAGVFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    +DIN L +I+V+ ++ + DY EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRVDINALTLIAVIATVCMEDYTEAATIVFLFSVADWLESSAAHKASTVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+AETG+ +D + V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIAETGQEVDVDDVGINTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ+DSTV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKQRDSTVLAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ++AC A+  V  KV+N S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVVVAACFAVIPVLLKVQNLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+++ AFDKTGTIT+ EFTV+ F SL   IN  TLL WVSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIRISAFDKTGTITKAEFTVSDFKSLSPNINLKTLLYWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDYA+S SVEP P++VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  432   ESKSSHPMAAALIDYARSVSVEPTPDRVENFQNFPGEGVYGRIDGQDIYIGNKRIAQRAG  491

Query  2871  CTS-VPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
             C S VP  + + + GK++ YI++G  L G F+L D CR GA +A+++LK + IKT MLTG
Sbjct  492   CLSTVPGIEANMKRGKTIGYIYIGEELTGSFNLLDGCRHGAAQALQELKSLNIKTAMLTG  551

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             D+  AA  +QEQLG ALD  HAELLP++KA+II +F+  G T M+GDGLNDAPALA AD+
Sbjct  552   DNRDAAMSIQEQLGDALDIVHAELLPQDKARIIDEFKSQGPTMMVGDGLNDAPALAKADI  611

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LA ETG +ILM+NDI +I K + L RR  RKVI N+V+++  K AIM L 
Sbjct  612   GISMGISGSALATETGDIILMSNDINKIPKGMRLARRSHRKVIENVVLSVGIKGAIMVLG  671

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREAP  2224
             + G+PL+WAAVL D GTCL+VI NS +LLR     AP
Sbjct  672   LVGYPLIWAAVLADAGTCLLVILNSMMLLRDEREAAP  708



>sp|P0CW78.1|HMA3B_ARATH RecName: Full=Cadmium/zinc-transporting ATPase HMA3; AltName: 
Full=Cadmium/zinc-transporting ATPase 4; AltName: Full=Protein 
HEAVY METAL ATPASE 3 [Arabidopsis thaliana]
 gb|AAL16382.1| putative heavy metal transporter HMA3 [Arabidopsis thaliana]
 gb|AAR10768.1| potential Zn/Cd heavy metal transporter [Arabidopsis thaliana]
Length=760

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/697 (58%), Positives = 536/697 (77%), Gaps = 6/697 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ +DGV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSIVGNVLRQVDGVKEFSVIVPSRTVIVVHDTFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+LL+LSF KY Y+PL+WLA+ A VAG FP+
Sbjct  73    QARLEASVRPYGETSLKSQW-PSPFAIVSGVLLVLSFFKYFYSPLEWLAIVAVVAGVFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + D+ EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATLCMQDFTEAATIVFLFSVADWLESSAAHKASIVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+A+TG  +D ++V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIADTGLEVDVDEVGINTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ++STV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKQRESTVMAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V  +AC A+  V  KV++ S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVVSAACFAVIPVLLKVQDLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K++AFDKTGTIT+ EF V+ F SL   IN + LL+WVSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSPSINLHKLLNWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E KSSHPMA A+IDYA S SVEP P+ VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  432   ECKSSHPMAAALIDYAISVSVEPKPDIVENFQNFPGEGVYGRIDGQDIYIGNKRIAQRAG  491

Query  2871  CTS--VPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             C +  VP+ +   + GK++ YI++G+ L G F+L D CR G  +A+++LK +GI+T MLT
Sbjct  492   CLTDNVPDIEATMKRGKTIGYIYMGAKLTGSFNLLDGCRYGVAQALKELKSLGIQTAMLT  551

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATAD  2518
             GD+  AA   QEQL  ALD  H+ELLP++KA+II  F+  G T M+GDGLNDAPALA AD
Sbjct  552   GDNQDAAMSTQEQLENALDIVHSELLPQDKARIIDDFKIQGPTMMVGDGLNDAPALAKAD  611

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             +GISMGISGS LA ETG +ILM+NDI +I K + L +R  +KVI N+V+++  K AIM L
Sbjct  612   IGISMGISGSALATETGDIILMSNDIRKIPKGMRLAKRSHKKVIENVVLSVSIKGAIMVL  671

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
                G+PLVWAAVL D GTCL+VI NS +LLR  +REA
Sbjct  672   GFVGYPLVWAAVLADAGTCLLVILNSMILLR-DEREA  707



>gb|KFK29565.1| hypothetical protein AALP_AA7G151300 [Arabis alpina]
Length=763

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/696 (58%), Positives = 533/696 (77%), Gaps = 4/696 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ L+GV++ SV+V ++TV+VVHD LLI+  QI +ALN
Sbjct  4     QTSYFDVVGICCSSEVSIVGDVLRPLNGVNDFSVIVPSRTVIVVHDNLLISPLQIAKALN  63

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+ L LSFLKY+Y+  ++LA+ A VAG FP+
Sbjct  64    QARLEASVRPYGETSLKSQW-PSPFALVSGVFLALSFLKYLYSLFEFLAIVAVVAGVFPI  122

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + DY E+ATIVFLF+  +WLE+ A+HKA   M
Sbjct  123   LAKAVASITRFRLDINALTLIAVIATVCMQDYTESATIVFLFSVADWLETSAAHKASTVM  182

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+AETG  +D ++V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  183   SSLMSLAPRKAVIAETGLEVDVDEVGINTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  242

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ+DS V AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  243   SFPVSKQRDSNVLAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  302

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ++AC A+  V  KV N S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  303   SRYYTPAVVVLAACFAVIPVLLKVHNLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  362

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K+ AFDKTGTIT+ EF V+ F SL   I+ + LL WVSSI
Sbjct  363   AATSGFLIKTGDCLETLAKIKIAAFDKTGTITKAEFMVSDFKSLSHNISLHNLLYWVSSI  422

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ES SSHPMA A+IDYA+S SVEP  + VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  423   ESMSSHPMAAALIDYARSSSVEPKSDMVENFQNFPGEGVYGRIDGQDIYIGNKRIARRAG  482

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP+ + + + GK++ YI++G  L G FSL D CR G  +A+++LK +GI+T MLTGD
Sbjct  483   CLTVPDIEANMKRGKTIGYIYIGEELTGSFSLLDGCRYGVVQALKELKSLGIQTAMLTGD  542

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA   QEQLG ALD  H ELLP++KA II +F+  G T M+GDGLNDAPALA AD+G
Sbjct  543   NRDAAMFTQEQLGNALDIVHTELLPQDKATIIDEFKSQGPTMMVGDGLNDAPALAKADIG  602

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG +ILM+NDI +I K + L RR  RKVI N+V+++  K AIM L  
Sbjct  603   ISMGISGSALATETGDIILMSNDIRKIPKGMRLARRSHRKVIENVVLSVSIKGAIMVLGF  662

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREAP  2224
             AG+PLVWAAVL D GTCL+VI NS +LLR  + EAP
Sbjct  663   AGYPLVWAAVLADAGTCLLVILNSMMLLR-DEHEAP  697



>ref|XP_010927214.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Elaeis guineensis]
Length=957

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/689 (61%), Positives = 533/689 (77%), Gaps = 5/689 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+KILK LDG+ +VSV+V +KTV+VVHD LLI+  QIV+ALN
Sbjct  51    QKSYFDVLGLCCSSEVPLIEKILKPLDGIQKVSVIVPSKTVIVVHDSLLISPLQIVKALN  110

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+  G T+   K  PSPY + CG+LLL+S  K  + PL+W A+AA   G+ P+
Sbjct  111   QARLEATIRAYG-TDGIIKKWPSPYILACGVLLLISLFKRFFHPLRWFALAAVAVGAPPI  169

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R++AA+R  TLDINILM+I+V G++ L DY EA  IVFLFT  EWLE+RAS KA A M
Sbjct  170   IFRSIAAIRRYTLDINILMLIAVGGAVALSDYSEAGFIVFLFTVAEWLEARASRKATAGM  229

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             S L+N+  Q+AVLAETG+++DA  VK+DTILAVKAGEVIPIDG+VV+G  EVDE++LTGE
Sbjct  230   SLLMNMAPQKAVLAETGQVIDARDVKIDTILAVKAGEVIPIDGVVVDGRSEVDERSLTGE  289

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ  S VWA T+N++GYIS++TTA+AE  AVA+MA+LVEEAQ+++S+ QR ID  
Sbjct  290   SFPVAKQAQSLVWAGTVNIDGYISVRTTALAEHSAVAKMARLVEEAQNSRSKTQRMIDSC  349

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V  +A  A+  +  +  N    + LALV+LVSACPCALVLSTPVA FCAL +
Sbjct  350   AKYYTPAVVIAAAGFAVIPLIQRAHNPKHWFQLALVLLVSACPCALVLSTPVATFCALLK  409

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG + LE LA++KV+AFDKTGTITRGEF V  F S+ + +  + LL WV+SI
Sbjct  410   AARTGLLIKGGDVLEALARIKVVAFDKTGTITRGEFAVVEFCSINNEVTLHELLYWVASI  469

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DYA+S+S+EP P+ V  F  +PGEGI GEI G  IYIG K+I+ARA 
Sbjct  470   ESKSSHPMASALVDYARSNSIEPKPDCVREFHIYPGEGICGEIHGKTIYIGKKRIAARAS  529

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP+ + D +EG +M Y+F G+   GVF+LSD CRTG+ EAI++LK++GIKT MLTGD
Sbjct  530   CETVPQLE-DMKEGVTMGYVFSGNVPVGVFTLSDTCRTGSAEAIKELKLLGIKTAMLTGD  588

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPALATADV  2515
             S AAA H Q QLG A++E HAELLPE+K +II + +   G   M+GDG+NDAPALA ADV
Sbjct  589   STAAAMHAQNQLGHAIEELHAELLPEDKVRIINELKSSEGYIAMVGDGMNDAPALAMADV  648

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS +A ET H+ LM+NDI +I KAI L R+   K+I NI  +I TK AI+ALA
Sbjct  649   GISMGISGSAVAMETSHITLMSNDIKKIPKAIRLARKTHFKIIGNIFFSIITKIAILALA  708

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
              AGHPL+WAAVL DVGTCL+VI NS +LL
Sbjct  709   FAGHPLLWAAVLADVGTCLLVILNSMMLL  737



>ref|XP_006412748.1| hypothetical protein EUTSA_v10026996mg, partial [Eutrema salsugineum]
 gb|ESQ54201.1| hypothetical protein EUTSA_v10026996mg, partial [Eutrema salsugineum]
Length=756

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/700 (59%), Positives = 537/700 (77%), Gaps = 5/700 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N    + SYFDV+GICC SEV L+  +L+ LDGV E SV+V ++TV+VVHD L I+  QI
Sbjct  8     NKKNLQTSYFDVVGICCSSEVSLVGDVLRPLDGVKEFSVIVPSRTVIVVHDTL-ISPLQI  66

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEAS++  GET+   +  PSP+AV+ G+LL LSFLKY Y+PL+WLAV A VA
Sbjct  67    VKALNQARLEASVRPYGETSLKSQW-PSPFAVISGVLLALSFLKYFYSPLEWLAVVAVVA  125

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G FP+L +AVA++    LDIN L +I+V+ ++ + DY EAATIVFLF+  +WLES A+ K
Sbjct  126   GIFPILAKAVASVTRFRLDINTLTLIAVIATLCMQDYTEAATIVFLFSVADWLESSAAQK  185

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A   MSSL+++  ++AV+AETG  +D ++V ++T+++VKAGE IPIDG+VV+G C+VDEK
Sbjct  186   ASTVMSSLMSLAPRKAVIAETGLEVDVDEVWINTVVSVKAGESIPIDGVVVDGSCDVDEK  245

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGESF V KQ+DS V AATINLNGYI ++TTA+A DC VA+M KLVEEAQ ++++ QR
Sbjct  246   TLTGESFPVSKQRDSNVLAATINLNGYIKVRTTALARDCVVAKMTKLVEEAQKSQTKTQR  305

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              IDK ++YYTPA+V ++AC A+  + ++V N S  +HLALVVLVS CPC L+LSTPVA F
Sbjct  306   FIDKCSRYYTPAVVVVAACFAVIPALLEVHNLSHWFHLALVVLVSGCPCGLILSTPVATF  365

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CAL++AA  G L K  + LE LAK+K+ AFDKTGTIT+ EFTV  F SL   IN   LL 
Sbjct  366   CALTKAATSGFLIKTGDCLETLAKIKIAAFDKTGTITKAEFTVEDFRSLSHNINLKNLLY  425

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSSIESKSSHPMA A+IDYA+S SVEP P+ VE+F NFPGEG+YG IDG +IYIGNK+I
Sbjct  426   WVSSIESKSSHPMAAALIDYARSISVEPKPDMVENFHNFPGEGVYGRIDGQDIYIGNKRI  485

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             + RAGC +VP+ +V+ + GK++ YI++G  L G F+L D CR G  +A+++LK +GI T 
Sbjct  486   AKRAGCLTVPDIEVNMKWGKTIGYIYIGEKLTGSFNLLDGCRHGVAQALKELKSLGITTA  545

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+  AA   QEQLG ALD  H+ELLP++KA+II +F+  G   M+GDGLNDAPALA
Sbjct  546   MLTGDNRDAAMSTQEQLGNALDIVHSELLPQDKARIIDEFKSQGPIMMVGDGLNDAPALA  605

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
              AD+GISMGISGS LA ETG +ILM+NDIG+I + + L RR  +KVI N+V+++  K AI
Sbjct  606   KADIGISMGISGSALATETGDIILMSNDIGKIPRGMRLARRSHKKVIENVVLSVSIKGAI  665

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             M L  AG+PL+WAAVL D GTCL+VI NS LLLR  +REA
Sbjct  666   MVLGFAGYPLIWAAVLADAGTCLLVILNSMLLLR-DEREA  704



>ref|XP_008798128.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Phoenix dactylifera]
 ref|XP_008798129.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Phoenix dactylifera]
Length=922

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/690 (61%), Positives = 538/690 (78%), Gaps = 5/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+KILK LDG+ +VSV+V +KTV+VVHD LLI+  QIV+ALN
Sbjct  16    QKSYFDVLGLCCSSEVPLIEKILKPLDGIQKVSVIVPSKTVIVVHDSLLISPLQIVKALN  75

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+  G T++  K  PSPY + CG+LLL+S  K  + PL+W A+AA V G  P+
Sbjct  76    QARLEATIRAYG-TDNIIKKWPSPYILACGVLLLVSLFKRFFHPLQWFALAAVVVGMPPI  134

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R++AA+R  TLDINILM+I+V G++ L DY EA  IVFLFT  EWLE+RAS KA A M
Sbjct  135   IFRSIAAVRRYTLDINILMLIAVGGAVALGDYSEAGFIVFLFTVAEWLEARASGKATAGM  194

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             S L+N+  Q+AVLAETG+++DA  VKV+TI+AVKAGEVIPIDG+VV+G  EVDE++LTGE
Sbjct  195   SLLMNMAPQKAVLAETGQVVDARDVKVNTIVAVKAGEVIPIDGVVVDGRSEVDERSLTGE  254

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ  S VWA T+N++GYIS++TTA+AE  AVA+MA+LVEEAQ+++S+ QR ID  
Sbjct  255   SFPVAKQAQSLVWAGTLNIDGYISVRTTALAEHSAVAKMARLVEEAQNSRSQTQRLIDSC  314

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V  +A  A+  S ++V N    + LALV+LVSACPCALVLSTPVA FCAL +
Sbjct  315   AKYYTPAVVIAAAGFAVIPSIMRVHNPKHWFQLALVLLVSACPCALVLSTPVATFCALLK  374

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +GLL KG + LE LA+++V+AFDKTGTITRGEF V  F S+   I  + LL WV+SI
Sbjct  375   AARVGLLIKGGDVLEALARIEVVAFDKTGTITRGEFAVVEFCSIDSEIALHELLYWVASI  434

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++D A+ +S+EP P+ V+ F  +PGEGI GEIDG  IYIGNK+I+ARA 
Sbjct  435   ESKSSHPMASALVDCARLNSIEPKPDCVKEFHIYPGEGICGEIDGKTIYIGNKRIAARAS  494

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VPE  VD +EG ++ ++F G+   GVF+LSD CRTG+ EAI++LK++GIKT MLTGD
Sbjct  495   CETVPEL-VDMKEGVTVGHVFSGTVPVGVFTLSDTCRTGSAEAIKELKLLGIKTAMLTGD  553

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATADV  2515
             S AAA H Q QLG A+++ HAELLPE+K +II   + + G   MIGDG+NDAPALA ADV
Sbjct  554   STAAAMHAQNQLGHAIEDLHAELLPEDKVRIINDLKTREGSIAMIGDGMNDAPALAMADV  613

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS +A ET H+ LM+NDI +I KAI L R+   K+I NI  +I TK AI+ALA
Sbjct  614   GISMGISGSAVAMETSHITLMSNDIRKIPKAIRLARKTHFKIIGNIFFSIITKIAILALA  673

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
              AGHPL+WAAVL DVGTCL+VI NS +LLR
Sbjct  674   FAGHPLLWAAVLADVGTCLLVILNSMMLLR  703



>ref|XP_008453702.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like, partial 
[Cucumis melo]
Length=1177

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/638 (64%), Positives = 512/638 (80%), Gaps = 3/638 (0%)
 Frame = -1

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A  EA+++  G+  D  K  PSPYAV  G+LLLLS LKYV    +W+A+AA  A
Sbjct  6     VKALNQARFEANVRAYGDQKDHRKKWPSPYAVASGLLLLLSLLKYVNPIFRWVALAAVAA  65

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G  P++ ++ AA+R+L +DINIL +I+V+G+IVL DY EAATIVFLFT  EWLESRA+HK
Sbjct  66    GILPIVLKSFAAVRHLRIDINILALIAVIGTIVLKDYLEAATIVFLFTIAEWLESRAAHK  125

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A MSSL+++  Q+AVLA+TGE++ A++VK+ T+LAVKAGE IPIDGIVVEG+CEVDEK
Sbjct  126   ANAVMSSLLSIAPQKAVLADTGEVVGADEVKLGTLLAVKAGEDIPIDGIVVEGKCEVDEK  185

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGESF VPKQK+STVWA TINLNGY+++KTTA+AEDC VA+MAKLVEEAQ+NKSR QR
Sbjct  186   TLTGESFPVPKQKNSTVWAGTINLNGYVTVKTTALAEDCVVAKMAKLVEEAQNNKSRTQR  245

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              IDK AK+YTPA++ IS C+ +   A+++ NRS  +HLALVVLVSACPCAL+LSTPVA F
Sbjct  246   FIDKCAKFYTPAVIIISTCIVVIPVALRLPNRSHWFHLALVVLVSACPCALILSTPVASF  305

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSL-LDGINHNTLL  3070
             CAL++AA  GLL KG +YLE L K+K++AFDKTGTITRGEF V  F  L  D I+ +TLL
Sbjct  306   CALTKAATSGLLIKGGDYLETLGKIKIMAFDKTGTITRGEFMVTEFQVLDKDNISLDTLL  365

Query  3069  SWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKK  2890
              WVSSIESKSSHPMA A++D+ +S S++P PE V+ FQNFPGEG++G IDG +IYIGN+K
Sbjct  366   YWVSSIESKSSHPMAAALVDHGRSLSIDPKPENVDDFQNFPGEGVHGRIDGKDIYIGNRK  425

Query  2889  ISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKT  2710
             I+ RA C +VPE   + ++G+++ YIF G+  AGVFSLSD+CRTGA+EA+ +L+ +GIKT
Sbjct  426   IATRANCATVPEIKDEAKDGRTVGYIFCGTIAAGVFSLSDSCRTGAKEAMDELRSLGIKT  485

Query  2709  VMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPAL  2530
              MLTGDS AAA   Q++LG AL   HAELLP++K ++I  F+K G T MIGDGLNDAPAL
Sbjct  486   AMLTGDSSAAALQAQKELGKALQTVHAELLPQDKTRLINDFKKEGPTAMIGDGLNDAPAL  545

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             ATAD+GISMGISGS LA ETG VILMTNDI ++ KAI L RR   KVI N+++++  + A
Sbjct  546   ATADIGISMGISGSALAIETGDVILMTNDIRKVPKAIRLARRANNKVIENVILSVAPRIA  605

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             I+ LA  GHPLVWAAVL DVG C++VI NS LLLRG D
Sbjct  606   ILGLAFGGHPLVWAAVLADVGACVLVILNSMLLLRGTD  643



>ref|XP_008354231.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Malus 
domestica]
Length=680

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/679 (62%), Positives = 521/679 (77%), Gaps = 23/679 (3%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK L+GV  VSV+V ++TV+VVHD LLI+Q QIV+ALN
Sbjct  16    QKSYFDVLGLCCASEVPLIENILKPLEGVKXVSVIVPSRTVIVVHDSLLISQLQIVKALN  75

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++V G  +   K  PSPYA+  G+LL+LSFLKY Y PL WLA+ A   G FPV
Sbjct  76    QARLEANVRVYGAGDIYKKTWPSPYAIGSGVLLVLSFLKYAYRPLGWLALGAVAVGIFPV  135

Query  3945  LRRAVAALRNLTL-DINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
               +  AA+RN    DINIL+II+V+G+I L             T   W       KA A 
Sbjct  136   ALKCFAAIRNFRFHDINILVIIAVIGTIALX------------TIQSW-------KAKAV  176

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSL+++  Q+AVLAE+GE++  ++VK++TILAVKAGE IPIDGIVVEG+ EVDEKTLTG
Sbjct  177   MSSLMSMAPQKAVLAESGEVVXVDEVKLNTILAVKAGEXIPIDGIVVEGKAEVDEKTLTG  236

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ES  V K+KDSTVWA TINLNGYIS+KTT++AEDCAVA+MAKL EEAQ++K R QR IDK
Sbjct  237   ESXPVAKEKDSTVWAGTINLNGYISVKTTSLAEDCAVAKMAKLXEEAQNSKXRTQRFIDK  296

Query  3408  IAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              A +YTPA++ IS  +A+  +A+ V N  + +HLALVVLVS CPC L+LSTPV  FC L+
Sbjct  297   CAMFYTPAVLVISVSIAVIPAALHVHNWXKWFHLALVVLVSXCPCXLILSTPVVTFCTLT  356

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  GLL KG +Y+EILAKVK++AFDKTGTITRGEF V  F SL D I+ NTLL WVSS
Sbjct  357   KAATSGLLIKGGDYIEILAKVKIMAFDKTGTITRGEFVVMDFQSLRDDISLNTLLYWVSS  416

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IE KSSHPMA A++DY +  SVEPNPE VE FQNFPGEGI+G+IDG +IYIGN+KI+ RA
Sbjct  417   IERKSSHPMADALVDYGRLFSVEPNPENVEEFQNFPGEGIHGKIDGQDIYIGNRKIALRA  476

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C  VP  +   + GK++ YI+ G + AGVF++SDACR+GA EA ++LK +GIKT MLTG
Sbjct  477   ACEIVPTIE-GSKGGKTIGYIYSGGAPAGVFTISDACRSGAAEAXKELKKLGIKTAMLTG  535

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             DS AAA H  EQL  AL+   AELLPE+KA+IIK+F+  G T M+GDG+NDA ALATADV
Sbjct  536   DSNAAALHTNEQLKQALEVVQAELLPEDKARIIKEFKMEGNTAMVGDGINDAAALATADV  595

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LAQETG++IL++NDI ++ KA++L RR  RKVI N+ ++I TKA+I+AL 
Sbjct  596   GISMGISGSALAQETGNIILLSNDIRKLPKAVQLARRAKRKVIENVALSITTKASILALG  655

Query  2334  IAGHPLVWAAVLVDVGTCL  2278
              AGHPLVWAAVL DVG  L
Sbjct  656   FAGHPLVWAAVLADVGVRL  674



>gb|KHN45233.1| Cadmium/zinc-transporting ATPase 3 [Glycine soja]
Length=885

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/689 (60%), Positives = 529/689 (77%), Gaps = 3/689 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV +VSV+V T+TV VVHD LLI++ QI  ALN
Sbjct  6     KRSSFEVLGMCCATEEALVERILKPLRGVKDVSVIVPTRTVTVVHDVLLISESQIADALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS+++ GET D  K  P    +VCG+LL LSFLKY Y PL WLA+ + V G   V
Sbjct  66    AARLEASLRLQGET-DNEKKWPDLTTMVCGLLLALSFLKYAYQPLGWLALGSVVIGFPKV  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A+++ LTL+INIL++++V G+  L D+WEA  I+FLF+  +WLE+RA+HKAM AM
Sbjct  125   LLRAIASIKALTLNINILVLLAVCGTAALQDFWEAGIIIFLFSIAQWLETRATHKAMVAM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++  Q+AV+AETGE++D N VK++TILAVKAG+ IP+DGIVVEG+CEVDEK LTGE
Sbjct  185   SSLTSMAPQKAVIAETGELVDVNDVKINTILAVKAGDAIPLDGIVVEGKCEVDEKMLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S  V K+ DS VWA TIN+NGYIS+KTT +A+D  VARM+KLVEEA S KSR QR ID  
Sbjct  245   SLPVTKELDSVVWAGTINVNGYISVKTTVLAKDTVVARMSKLVEEASSRKSRTQRFIDHF  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY PA+V ISA +A+  +A+KV N    +HLA+VVL+SACPCAL+LSTPVA+FCAL++
Sbjct  305   AKYYIPAVVLISASIAVVPAALKVPNIKPWFHLAIVVLLSACPCALILSTPVAIFCALTK  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +Y+E L+ +K +AFDKTGTITRGEFTV  FS  +D I+  TLL WVSS+
Sbjct  365   AAISGLLLKGGDYIETLSGIKTVAFDKTGTITRGEFTVTDFSVSVDDISIETLLYWVSSV  424

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+++Y   +SV+P PE VE+FQNFPGEG+YG I+G +IYIGN++I ARAG
Sbjct  425   ESKSSHPMAAALVEYGMLNSVKPIPENVENFQNFPGEGVYGIINGKDIYIGNRRIGARAG  484

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
                V           S    + G +L GVF L+D CR+GA EAI +LK++G+++VMLTGD
Sbjct  485   SERVDCRTQCQSHEISTPKQYCGPTLVGVFRLADTCRSGALEAIEELKLLGVRSVMLTGD  544

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             S  AA + Q QL  ALD  HAELLP EKA II+ F+K G   MIGDG+NDAPALATAD+G
Sbjct  545   SSQAAMYAQSQLNHALDIVHAELLPAEKAVIIENFKKDGLIAMIGDGMNDAPALATADIG  604

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG+ ILM+NDI +I +AI L R+  RK+I N++++I  K+ I+ALAI
Sbjct  605   ISMGISGSALANETGNAILMSNDIRKIPEAIRLARKTTRKLIENVIISIGFKSVILALAI  664

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             AG+P+VW AVL DVGTCL+VI NS L+L+
Sbjct  665   AGYPIVWLAVLTDVGTCLLVILNSMLILQ  693



>ref|XP_009128077.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3 [Brassica rapa]
Length=758

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/695 (59%), Positives = 532/695 (77%), Gaps = 4/695 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC  EVPL+  +L+ L+GV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSMEVPLVGDVLRPLNGVKEFSVIVPSRTVIVVHDSFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+LL LSFLKY Y  L+W AV A VAG +P+
Sbjct  73    EARLEASVRPYGETSFKSQW-PSPFALVSGVLLALSFLKYFYGLLEWFAVVAVVAGVYPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + DY EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATVCMEDYTEAATIVFLFSVADWLESSAAHKASTVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+N+  ++AV+ ETG  +D ++V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMNLAPRKAVIVETGIEVDVDEVGLNTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ+DS V AATINLNGYI +KTT +A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKQRDSPVLAATINLNGYIKVKTTVLARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ++AC A+  V  K +N S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVVVAACFALIPVLLKAQNLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K+ AFDKTGTIT+ EFTV+ F SL   IN   L+ WVSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIKIAAFDKTGTITKAEFTVSDFQSLSHNINLQHLIYWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDYA+S SVEP P+ VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  432   ESKSSHPMAEALIDYARSVSVEPKPDMVENFQNFPGEGVYGRIDGQDIYIGNKRIAKRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP+ + D + GK++ YI++G  L G FSL D CR G  +A+++LK +GI T MLTGD
Sbjct  492   CLTVPDSEADMKGGKTIGYIYIGEELTGSFSLLDGCRHGVAQALKELKFLGITTAMLTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA  +Q+QLG ALD  H ELLP++KA+II +F+  G T M+GDGLNDAPALA AD+G
Sbjct  552   NRDAAMSIQQQLGNALDIAHTELLPQDKARIIDEFKSQGPTMMVGDGLNDAPALAKADIG  611

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG +ILM+ND+ +I K + L RR  +KVI N+V+++  K AIM L  
Sbjct  612   ISMGISGSALATETGDIILMSNDLRKIPKGMRLARRCHKKVIENVVLSVSIKGAIMVLGF  671

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             AG+PL+WAAVL D GTCL+VI NS +LLR  +REA
Sbjct  672   AGYPLIWAAVLADAGTCLLVILNSMMLLR-DEREA  705



>emb|CDX68627.1| BnaC01g08260D [Brassica napus]
Length=758

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/695 (59%), Positives = 535/695 (77%), Gaps = 4/695 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC  EVPL+  +L+ L+GV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    KTSYFDVVGICCSMEVPLVGDVLRPLNGVKEFSVIVPSRTVIVVHDTFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+L+ LSFLKY Y  L+W AV A VAG +P+
Sbjct  73    EARLEASVRPYGETSFKSQW-PSPFALVSGVLIALSFLKYFYGLLEWFAVVAVVAGVYPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + DY EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATVCMEDYTEAATIVFLFSVADWLESSAAHKASTVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+AETG  +D ++V+++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIAETGIEVDVDEVELNTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ+DSTV AATINLNGYI +KTT +A DC VA+M KLVEE Q ++++ QR IDK 
Sbjct  252   SFPVSKQRDSTVLAATINLNGYIKVKTTVLARDCVVAKMTKLVEEPQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAISA--VKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ++AC A+    +KV N S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVVVAACFALIPFLLKVHNLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K+ AFDKTGTIT+ EFTV+ F SL   IN   L+ WVSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIKIAAFDKTGTITKAEFTVSDFKSLSHSINLQNLIYWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDYA+S S+EP P+ VE+FQNFPGEG+YG+IDG +IYIGNK+I+ RAG
Sbjct  432   ESKSSHPMAEALIDYARSVSIEPKPDMVENFQNFPGEGVYGKIDGQDIYIGNKRIAQRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP+ + D + GK++ YI++G  L G FSL D CR G  +A+++LK +GI T MLTGD
Sbjct  492   CLTVPDSEADMKGGKTIGYIYIGEELTGSFSLLDGCRHGVAQALKELKSLGITTAMLTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA  +Q+QLG ALD  H ELLP++KA+II +F+  G T M+GDGLNDAPALA AD+G
Sbjct  552   NRDAAMSIQQQLGNALDIVHTELLPQDKARIIDEFKSQGPTMMVGDGLNDAPALAKADIG  611

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG +ILM+ND+ +I K + L +R  RKVI N+V+++  K AIM L  
Sbjct  612   ISMGISGSALATETGDIILMSNDLRKIPKGMRLAKRSHRKVIENVVLSVSIKGAIMGLGF  671

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             AG+PL+WAAVL D GTCL+VI NS +LLR  +REA
Sbjct  672   AGYPLIWAAVLADAGTCLLVILNSMMLLR-DEREA  705



>emb|CDY28160.1| BnaA01g06890D [Brassica napus]
Length=758

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/695 (59%), Positives = 533/695 (77%), Gaps = 4/695 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC  EVPL+  +L+ L+GV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSMEVPLVGDVLRPLNGVKEFSVIVPSRTVIVVHDSFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+LL LSFLKY Y  L+W AV A VAG +P+
Sbjct  73    EARLEASVRPYGETSFKSQW-PSPFALVSGVLLALSFLKYFYGLLEWFAVVAVVAGVYPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + DY EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATVCMEDYTEAATIVFLFSVADWLESSAAHKASTVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+AETG  +D ++V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIAETGIAVDVDEVGLNTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ+DS V AATINLNGYI +KTT +A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKQRDSHVLAATINLNGYIKVKTTVLARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ++AC A+  V  K +N S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVVVAACFALIPVLLKAQNLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K+ AFDKTGTIT+ EFTV+ F SL   IN   L+ WVSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIKIAAFDKTGTITKAEFTVSDFQSLSHNINLQHLIYWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+IDYA+S SVEP P+ VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  432   ESKSSHPMAEALIDYARSVSVEPKPDMVENFQNFPGEGVYGRIDGQDIYIGNKRIAKRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP+ + D + GK++ YI++G  L G FSL D CR G  +A+++LK +GI T MLTGD
Sbjct  492   CLTVPDSEADMKGGKTIGYIYIGEELTGSFSLLDGCRHGVAQALKELKFLGIATAMLTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA  +Q+QLG ALD  H ELLP++KA+II +F+  G T M+GDGLNDAPALA AD+G
Sbjct  552   NRDAAMSIQQQLGNALDIAHTELLPQDKARIIDEFKSQGPTMMVGDGLNDAPALAKADIG  611

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG +ILM+ND+ +I K + L RR  +KVI N+V+++  K AIM L  
Sbjct  612   ISMGISGSALATETGDIILMSNDLRKIPKGMRLARRCHKKVIENVVLSVSIKGAIMVLGF  671

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             AG+PL+WAAVL D GTCL+VI NS +LLR  +REA
Sbjct  672   AGYPLIWAAVLADAGTCLLVILNSMMLLR-DEREA  705



>ref|XP_008360509.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like [Malus 
domestica]
Length=1093

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/636 (63%), Positives = 507/636 (80%), Gaps = 4/636 (1%)
 Frame = -1

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+  LEA+++V G  +   K  PSPYA+  G+LL+LSFLKYVY PL WLA+ A   
Sbjct  115   VKALNQGRLEANVRVYGAGDSYKKTWPSPYAIGSGVLLVLSFLKYVYRPLGWLALGAVAV  174

Query  3960  GSFPVLRRAVAALRNLTL-DINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASH  3784
             G FP+  +   ++RN    DINIL+II+V+G+I L DY EAA+IVFLFT  EWL S A +
Sbjct  175   GIFPIASKGFVSIRNFRFHDINILLIIAVIGTIALKDYTEAASIVFLFTIAEWLRSSAGY  234

Query  3783  KAMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDE  3604
             +A A MSSL+++  Q+AVLAE+GE++  ++VK++TILAVKAGE+IPIDGIVVEG+ EVDE
Sbjct  235   RAKAVMSSLMSMAPQKAVLAESGEVVGVDEVKLNTILAVKAGEIIPIDGIVVEGKAEVDE  294

Query  3603  KTLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQ  3424
             KTLTGES+ V K+KDST+WA TINLNGYI +KTT++AEDCAVA+MAKLVEEAQ++K+R Q
Sbjct  295   KTLTGESYPVAKEKDSTIWAGTINLNGYIXVKTTSLAEDCAVAKMAKLVEEAQNSKTRTQ  354

Query  3423  RSIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAM  3250
               IDK A++YTPA++ IS  +A+  + + V N S  +HLALVVLVSACPC L+LSTPV  
Sbjct  355   SFIDKCARFYTPAVLVISVSIAVIPAVLHVHNWSNWFHLALVVLVSACPCGLILSTPVVT  414

Query  3249  FCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLL  3070
             FC L++AA  GLL KG +Y+EILAKVK +AFDKTGTITRGEF V  F SL D I+ NTLL
Sbjct  415   FCTLTKAATSGLLIKGGDYIEILAKVKTMAFDKTGTITRGEFVVMDFQSLRDDISLNTLL  474

Query  3069  SWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKK  2890
              WVSSIE KSSHPMA A++DY +S SVEP PE VE FQNFPGEGI+G+IDG +IYIGN+K
Sbjct  475   YWVSSIERKSSHPMADALVDYGRSLSVEPKPENVEEFQNFPGEGIHGKIDGQDIYIGNRK  534

Query  2889  ISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKT  2710
             I+ RA C  VP  +   + GK++ YI+ G + AGVF+++DACR+GA EA+++LK +GIKT
Sbjct  535   IALRAACEIVPTIE-GSKGGKTIGYIYSGGTPAGVFTIADACRSGAAEAVKELKKLGIKT  593

Query  2709  VMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPAL  2530
              MLTGDS AAA H  EQL  AL+  HAELLPE+KA+IIK+F+  G T M+GDG+NDAPAL
Sbjct  594   AMLTGDSNAAALHTNEQLKRALEVVHAELLPEDKARIIKEFKMEGNTAMVGDGINDAPAL  653

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             ATAD+GISMGISGS LAQETG++IL++NDI ++ KA++L RR  RKVI N+V++I TK +
Sbjct  654   ATADIGISMGISGSALAQETGNIILLSNDIRKLPKAVQLARRANRKVIENVVLSITTKVS  713

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             I+AL  AGHPLVWAAVL DVGTC++VIFNS LLL+G
Sbjct  714   ILALGFAGHPLVWAAVLADVGTCMLVIFNSMLLLQG  749



>ref|XP_003534884.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4 [Glycine 
max]
 gb|AET09960.1| heavy metal ATPase 3w, partial [Glycine max]
Length=885

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/697 (59%), Positives = 530/697 (76%), Gaps = 19/697 (3%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV +VSV+V T+TV VVHD LLI++ QI  ALN
Sbjct  6     KRSSFEVLGMCCATEEALVERILKPLRGVKDVSVIVPTRTVTVVHDVLLISESQIADALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS+++ GET D  K  P    +VCG+LL LSFLKY Y PL WLA+ + V G   V
Sbjct  66    AARLEASLRLQGET-DNEKKWPDLTTMVCGLLLALSFLKYAYQPLGWLALGSVVIGFPKV  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A+++ LTL+INIL++++V G+  L D+WEA  I+FLF+  +WLE+RA+HKAM AM
Sbjct  125   LLRAIASIKALTLNINILVLLAVCGTAALQDFWEAGIIIFLFSIAQWLETRATHKAMVAM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++  Q+AV+AETGE++D N VK++TILAVKAG+ IP+DGIVVEG+CEVDEK LTGE
Sbjct  185   SSLTSMAPQKAVIAETGELVDVNDVKINTILAVKAGDAIPLDGIVVEGKCEVDEKMLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S  V K+ DS VWA TIN+NGYIS+KTT +A+D  VARM+KLVEEA S KSR QR ID  
Sbjct  245   SLPVTKELDSVVWAGTINVNGYISVKTTVLAKDTVVARMSKLVEEASSRKSRTQRFIDHF  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY PA+V ISA +A+  +A+KV N    +HLA+VVL+SACPCAL+LSTPVA+FCAL++
Sbjct  305   AKYYIPAVVLISASIAVVPAALKVPNIKPWFHLAIVVLLSACPCALILSTPVAIFCALTK  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +Y+E L+ +K +AFDKTGTITRGEFTV  FS  +D I+  TLL WVSS+
Sbjct  365   AAISGLLLKGGDYIETLSGIKTVAFDKTGTITRGEFTVTDFSVSVDDISIETLLYWVSSV  424

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+++Y   +SV+P PE VE+FQNFPGEG+YG I+G +IYIGN++I ARAG
Sbjct  425   ESKSSHPMAAALVEYGMLNSVKPIPENVENFQNFPGEGVYGIINGKDIYIGNRRIGARAG  484

Query  2871  CTSV--------PEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGI  2716
                V        PE     +          G +L GVF L+D CR+GA EAI +LK++G+
Sbjct  485   SERVDCRTQCQSPEISTPNQ--------CCGPTLVGVFRLADTCRSGALEAIEELKLLGV  536

Query  2715  KTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAP  2536
             ++VMLTGDS  AA + Q QL  ALD  HAELLP EKA II+ F+K G   MIGDG+NDAP
Sbjct  537   RSVMLTGDSSQAAMYAQSQLNHALDIVHAELLPAEKAVIIENFKKDGLIAMIGDGMNDAP  596

Query  2535  ALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTK  2356
             ALATAD+GISMGISGS LA ETG+ ILM+NDI +I +AI L R+  RK+I N++++I  K
Sbjct  597   ALATADIGISMGISGSALANETGNAILMSNDIRKIPEAIRLARKTTRKLIENVIISIGFK  656

Query  2355  AAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             + I+ALAIAG+P+VW AVL DVGTCL+VI NS L+L+
Sbjct  657   SVILALAIAGYPIVWLAVLTDVGTCLLVILNSMLILQ  693



>gb|AJF37114.1| heavy metal ATPase [Sedum alfredii]
Length=777

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/702 (59%), Positives = 542/702 (77%), Gaps = 6/702 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N    +KSYFDV+G+CC SEV LI+K+LK LDGV  + V+V T+T++VVHD L I+Q QI
Sbjct  17    NEERMKKSYFDVLGVCCSSEVVLIEKVLKNLDGVQTIRVIVPTRTLIVVHDELQISQSQI  76

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             ++ LN A +EA+++ N +  +  K  PSPY +VCGILL++SF  Y Y+PLKW+AVA+ V 
Sbjct  77    LKVLNLARMEANVRSN-QGENFTKKWPSPYTMVCGILLIVSFGVYFYSPLKWVAVASVVV  135

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+LR++  +++NL LDIN+L I++V+G+I+L DY EAATIVFLF+  EWLESRAS +
Sbjct  136   GIYPILRKSFVSVKNLVLDINVLAIMAVIGTILLKDYLEAATIVFLFSIAEWLESRASQE  195

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A  AMS L+N+  ++AV+AETGE ++   V + T+LAVKAGEVIPIDG V+EGE EVDEK
Sbjct  196   ATVAMSELLNMEPEKAVIAETGETVNVADVTLSTVLAVKAGEVIPIDGTVIEGEAEVDEK  255

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
              LTGESF V KQK +TV A T+NLNGYI++KTTAVA+DC V++MA+LVEEAQ++KS+ Q+
Sbjct  256   LLTGESFPVFKQKGATVLAGTMNLNGYIAVKTTAVADDCVVSKMARLVEEAQTSKSKTQQ  315

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              IDKIAKYYTPA++ +S  L +  +A+K  +R   YH+ALVVLVSACPC L+LSTPVA F
Sbjct  316   LIDKIAKYYTPAVMILSIGLVVIPAALKFNDRDWWYHIALVVLVSACPCGLILSTPVATF  375

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CALS+AA  G+L KG ++LE LAKVK +AFDKTGTIT GEF V  F +L   +N  TLL 
Sbjct  376   CALSKAAKSGVLLKGGDHLETLAKVKTVAFDKTGTITTGEFLVTEFRTLRADLNLKTLLY  435

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WV+SIESKSSHPMA A+IDYAQ +S++P+PE V  F N+PGEGI+G++D  +IYIGN++I
Sbjct  436   WVASIESKSSHPMAKAVIDYAQLYSIKPHPEAVMEFHNYPGEGIHGKLDSQDIYIGNRRI  495

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             + RA   ++PE + +   GK+  Y++   +LAG FSLSDACR+G  +A+ +LK M I TV
Sbjct  496   AHRAHSETIPEIEDNASGGKTRGYVYCNGTLAGWFSLSDACRSGTFQAVNELKSMNILTV  555

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGDS+AAA   Q QL  A++   AELLPE+KA+IIK F       MIGDG+NDAPALA
Sbjct  556   MLTGDSHAAAAQAQNQLQQAIEIVRAELLPEDKARIIKDFN--APFAMIGDGINDAPALA  613

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMG++GS LA ETG++ILM+NDI ++ + I+L R+ + KVI N+V++I  K  +
Sbjct  614   TADIGISMGLAGSALATETGNIILMSNDIRKVPEVIKLARKAYNKVIQNLVLSITIKGGV  673

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR-GGDREAP  2224
             +ALA AG+ LVWAAVL DVGTCL+VIFNS LLLR  G+  +P
Sbjct  674   LALAFAGYALVWAAVLADVGTCLLVIFNSMLLLRSNGNGRSP  715



>gb|AET09961.1| heavy metal atpase 3a, partial [Glycine max]
 dbj|BAL46410.1| P-type ATPase [Glycine max]
Length=885

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/697 (59%), Positives = 529/697 (76%), Gaps = 19/697 (3%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV +VSV+V T+TV VVHD LLI++ QI  ALN
Sbjct  6     KRSSFEVLGMCCATEEALVERILKPLRGVKDVSVIVPTRTVTVVHDVLLISESQIADALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS+++ GET D  K  P    +VCG+LL LSFLKY Y PL WLA+ + V G   V
Sbjct  66    AARLEASLRLQGET-DNEKKWPDLTTMVCGLLLALSFLKYAYQPLGWLALGSVVIGFPKV  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A+++ LTL+INIL++++V G+  L D+WEA  I+FLF+  +WLE+RA+HKAM AM
Sbjct  125   LLRAIASIKALTLNINILVLLAVCGTAALQDFWEAGIIIFLFSIAQWLETRATHKAMVAM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++  Q+AV+AETGE++D N VK++TILAVKAG+ IP+DGIVVEG+CEVDEK LTGE
Sbjct  185   SSLTSMAPQKAVIAETGELVDVNDVKINTILAVKAGDAIPLDGIVVEGKCEVDEKMLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S  V K+ DS VWA TIN+NGYIS+KTT +A+D  VARM+KLVEEA S KSR QR ID  
Sbjct  245   SLPVTKELDSVVWAGTINVNGYISVKTTVLAKDTVVARMSKLVEEASSRKSRTQRFIDHF  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY PA+V ISA +A+  +A+KV N    +HLA+VVL+SACPCAL+LSTPVA+FCAL++
Sbjct  305   AKYYIPAVVLISASIAVVPAALKVPNIKPWFHLAIVVLLSACPCALILSTPVAIFCALTK  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +Y+E L+ +K +AFDKTGTITRGEFTV  FS  +D I+  TLL WVSS+
Sbjct  365   AAISGLLLKGGDYIETLSGIKTVAFDKTGTITRGEFTVTDFSVSVDDISIETLLYWVSSV  424

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+++Y   +SV+P PE VE+FQNFPGEG+YG I+G +IYIGN++I ARAG
Sbjct  425   ESKSSHPMAAALVEYGMLNSVKPIPENVENFQNFPGEGVYGIINGKDIYIGNRRIGARAG  484

Query  2871  CTSV--------PEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGI  2716
                V        PE     +          G +L GVF L+D CR+GA EAI +LK++G+
Sbjct  485   SERVDCRTQCQSPEISTPNQ--------CCGPTLVGVFRLADTCRSGALEAIEELKLLGV  536

Query  2715  KTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAP  2536
             ++VMLTGDS  AA + Q QL  ALD  HAELLP EKA II+ F+K G   MIGDG+NDAP
Sbjct  537   RSVMLTGDSSQAAMYAQSQLNHALDIVHAELLPAEKAVIIENFKKDGLIAMIGDGMNDAP  596

Query  2535  ALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTK  2356
             ALATAD+GISM ISGS LA ETG+ ILM+NDI +I +AI L R+  RK+I N++++I  K
Sbjct  597   ALATADIGISMEISGSALANETGNAILMSNDIRKIPEAIRLARKTTRKLIENVIISIGFK  656

Query  2355  AAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             + I+ALAIAG+P+VW AVL DVGTCL+VI NS L+L+
Sbjct  657   SVILALAIAGYPIVWLAVLTDVGTCLLVILNSMLILQ  693



>ref|XP_009803734.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2 isoform X4 [Nicotiana 
sylvestris]
Length=580

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/550 (72%), Positives = 468/550 (85%), Gaps = 3/550 (1%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICC SEV L++KILK L+GV EVSV+VTTKTV+V+HD LLI+  QIV+ALN+
Sbjct  15    KSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDSLLISPQQIVKALNQ  74

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A LEASI+V GE N   K  PSP+A+  GILL LSFLKY +AP +WLA+AA   G  P++
Sbjct  75    ARLEASIRVKGEKNYQKKW-PSPFAIGSGILLGLSFLKYFFAPFQWLALAAVAVGIPPII  133

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              R VAA+RNLTLDINIL++I+V GSIVLHDYWEA TIVFLF   EWLESRASHKA AAMS
Sbjct  134   FRGVAAVRNLTLDINILVLIAVAGSIVLHDYWEAGTIVFLFAIAEWLESRASHKATAAMS  193

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
             SLVN+V   AVLAE+GE+++ ++VKV++ILAVKAGE IPIDG+VVEGEC+VDEKTLTGES
Sbjct  194   SLVNIVPPTAVLAESGEVVNVDEVKVNSILAVKAGETIPIDGVVVEGECDVDEKTLTGES  253

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
             F V KQ+DSTVWA T NLNGYIS+KTTA+AEDCAVARMA+LVE+AQ+ KS+ QR IDK A
Sbjct  254   FPVSKQRDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQNKKSKTQRYIDKCA  313

Query  3402  KYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPAIVAISA LAI  +A++V NR+E Y LALV LVSACPCALVLSTPVAM CALS+A
Sbjct  314   KYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVLSTPVAMCCALSKA  373

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIE  3049
             A  GLLFKGAEYLE LAK+K++AFDKTGTIT+GEF V  F SL+DG + NTLL WVSSIE
Sbjct  374   ATSGLLFKGAEYLETLAKIKIMAFDKTGTITKGEFMVTEFKSLIDGFSLNTLLYWVSSIE  433

Query  3048  SKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGC  2869
             SKS HPMA A++DYAQS+SVEP P++VE FQNFPGEGI+G IDGMEIY+GN+KIS+RAGC
Sbjct  434   SKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEIYVGNRKISSRAGC  493

Query  2868  TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDS  2689
             T+VPE + D  +GKS+ YIF+GSS AG+FSLSD CR G +EA+R+LK MGIKT MLTGD 
Sbjct  494   TTVPEIEGDSFKGKSVGYIFLGSSPAGIFSLSDVCRIGVKEAMRELKQMGIKTAMLTGDC  553

Query  2688  YAAARHVQEQ  2659
             YAAA HVQ+Q
Sbjct  554   YAAANHVQDQ  563



>ref|XP_010050934.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like [Eucalyptus 
grandis]
Length=991

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/678 (60%), Positives = 518/678 (76%), Gaps = 15/678 (2%)
 Frame = -1

Query  4266  SEVPLIDKILKGLDGVHE-------vsvmvttktvvvVHDPLLITQHQIVRALNKASLEA  4108
             SEV L++KIL+ LDG+++        +V++ TKTV+V+HDPL+++Q  +V ALNKA LEA
Sbjct  56    SEVALVEKILRQLDGINDISIIIPTKTVIIPTKTVIVLHDPLIVSQSTLVEALNKARLEA  115

Query  4107  SIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLRRAVA  3928
             SIK  G+ +   K  PSP  +VCG+L  LSFL+YVY PLKWLA+AA V G   +  R+ A
Sbjct  116   SIKHRGKIDSATKW-PSPALIVCGLLFGLSFLQYVYQPLKWLALAAVVIGLPSIAWRSYA  174

Query  3927  ALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNV  3748
             ++++LTL+I +L++ISV+G++ L DYWEAA+IVFLF+  +WLE RASHKAMA MSSL ++
Sbjct  175   SIKHLTLNIYVLILISVIGTLALQDYWEAASIVFLFSIAQWLELRASHKAMATMSSLASM  234

Query  3747  VSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPK  3568
               ++AV+AETGE +D N VK+ T+L+VKAGE +PIDGIVVEG+C+VDEK LTGES+ V K
Sbjct  235   TPEKAVIAETGESVDVNDVKMSTVLSVKAGEAVPIDGIVVEGKCDVDEKMLTGESYPVAK  294

Query  3567  QKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTP  3388
               DSTVWA +INLNGYIS++TTA+A D  VARMA LVEEA   K+  Q  ID  AKYY P
Sbjct  295   SIDSTVWAGSINLNGYISVRTTALATDSVVARMATLVEEAHKEKTHTQGLIDNCAKYYIP  354

Query  3387  AIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGL  3214
              I  +SAC+A   +A+K++N    +HLA+VVL+ +CPCAL+LSTP+  FCALSRAA  GL
Sbjct  355   GIALVSACIAAVPAALKLKNEHHWFHLAIVVLIGSCPCALILSTPITFFCALSRAAKDGL  414

Query  3213  LFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSH  3034
             LFKG  +LEILAKVK +AFDKTGT+TRGEF V +F S  + I+ N LL WVSSIESKSSH
Sbjct  415   LFKGGGFLEILAKVKTVAFDKTGTVTRGEFVVTNFQSDCNNIDLNALLYWVSSIESKSSH  474

Query  3033  PMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPE  2854
             PM+ AIIDYA S S+EP PE+VE+FQNFPGEGIYG+I+G  IYIGN++I  RAGC +   
Sbjct  475   PMSTAIIDYANSFSIEPKPEEVEYFQNFPGEGIYGQINGKSIYIGNRRIGLRAGCET---  531

Query  2853  FDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAAR  2674
                 G E  +  +I++G S  G FSLSDACRTG+ EAI  +K +GIKT MLTGDS AAAR
Sbjct  532   --ASGIETDTNGFIYIGQSPVGKFSLSDACRTGSMEAINDVKSLGIKTAMLTGDSQAAAR  589

Query  2673  HVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGIS  2494
               Q QL  ALD   AELLPE K +II+ F+K G T MIGDG+NDAPALATADVGISMGIS
Sbjct  590   STQNQLNNALDIVCAELLPENKVRIIEDFKKDGPTAMIGDGVNDAPALATADVGISMGIS  649

Query  2493  GSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLV  2314
             GS LA ET  VILM+NDI +I +AI+L R  +RK++ NI++++  K A++ LA AG+PLV
Sbjct  650   GSALAMETADVILMSNDIRKIPEAIKLARWTFRKLVENILISVSLKCAVLGLAFAGYPLV  709

Query  2313  WAAVLVDVGTCLVVIFNS  2260
             WAAVL DVGTCL+VI NS
Sbjct  710   WAAVLTDVGTCLIVILNS  727



>gb|AJF37113.1| heavy metal ATPase [Sedum alfredii]
Length=805

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/694 (59%), Positives = 534/694 (77%), Gaps = 5/694 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     KSYFDV+G+CC SEV LI+K+LK LDGV  V V+V T+T++VVHD L ITQ QI
Sbjct  17    NEERVRKSYFDVLGVCCSSEVALIEKVLKNLDGVQTVRVIVPTRTLIVVHDELQITQSQI  76

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ LN A +EA+++ N + ++  K  PSPY +VCGILL++S   Y Y+PLKW+AVA+ V 
Sbjct  77    VKVLNLARMEANVRSN-QGDNFMKKWPSPYTMVCGILLIVSLGLYFYSPLKWVAVASVVV  135

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G +P+LR++  + +NL LDIN+L I++V+G++ L DY EAATIVFLF+  EWLESRAS +
Sbjct  136   GIYPILRKSFVSFKNLVLDINVLAIMAVIGTMFLKDYLEAATIVFLFSIAEWLESRASLE  195

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A  AMS L+N+  ++AV+AETGE ++   V++ T+LAVKAGEVIPIDGIVVEGE E+DEK
Sbjct  196   ATVAMSELLNMEPEKAVIAETGETVNVADVRLSTVLAVKAGEVIPIDGIVVEGEAEIDEK  255

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
              LTGESF V KQK +TV A T+NLNGYI++KTTAVA+DC V++MA+LVEEAQ++KSR Q+
Sbjct  256   LLTGESFPVFKQKGATVLAGTMNLNGYIAVKTTAVADDCVVSKMARLVEEAQTSKSRTQQ  315

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              IDKIAKYYTPA++ +S CL +  +A+K ++R   YHLALVVLVSACPC L+LSTPVA F
Sbjct  316   LIDKIAKYYTPAVIILSICLVVVPAALKFDDRDWWYHLALVVLVSACPCGLILSTPVATF  375

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CALS+AA  G+L KG ++LE LAKVK +AFDKTGTIT GEF V  F +L   ++  TLL 
Sbjct  376   CALSKAAKSGVLLKGGDHLETLAKVKTVAFDKTGTITTGEFVVNEFRTLHADLSLKTLLY  435

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WV+SIESKSSHPMA A++DYAQ +S++P PE V  F N+PGEGI+G+++  +IYIGN++I
Sbjct  436   WVASIESKSSHPMAKAVVDYAQLYSIKPQPEAVMEFHNYPGEGIHGKLESQDIYIGNRRI  495

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             + RA   ++PE +     GK+  Y++   +LAG FSLSDACR+G  +A+ +LK M I TV
Sbjct  496   ALRARSETMPEIESGASGGKTRGYVYCNGTLAGWFSLSDACRSGTFQAVNELKSMNILTV  555

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGDS+AAA   Q QL  A++   AELLPE+KA+IIK+ +      MIGDG+NDAPALA
Sbjct  556   MLTGDSHAAAAQAQNQLQEAIEIVRAELLPEDKARIIKELE--APVAMIGDGINDAPALA  613

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
             TAD+GISMG+ GS LA ETG++ILM+NDI ++ + I+L R  + KVI N+V++   K  +
Sbjct  614   TADIGISMGLDGSALATETGNIILMSNDIRKVPEVIKLARAAYNKVIQNLVLSSTIKGGV  673

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             + LA AG+ LVWAAVL DVGTCL+VIFNS LLLR
Sbjct  674   LVLAFAGYALVWAAVLADVGTCLLVIFNSMLLLR  707



>ref|XP_010227423.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Brachypodium distachyon]
Length=1039

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/693 (60%), Positives = 531/693 (77%), Gaps = 8/693 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EKSYFDV+GICCPSEVPL++K+L+ L GVH+V+V+V ++TV+VVHD   I+Q QIV+ALN
Sbjct  15    EKSYFDVLGICCPSEVPLVEKLLEPLAGVHKVTVVVPSRTVIVVHDAAAISQSQIVKALN  74

Query  4125  KASLEASIKVNGETNDGPKM---LPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGS  3955
             +A LEAS++  G      K+    PSPY +VCG LL++S  ++ + PLKW A+A A AG 
Sbjct  75    QARLEASVRAYGGGGGAEKISNKFPSPYVLVCGALLVVSLFEHFWPPLKWFALAGAAAGL  134

Query  3954  FPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAM  3775
              P++ R+VAA R LTLD+NILM+I+V G+I L DY EA  IVFLFTT EWLE+RAS KA 
Sbjct  135   PPIVLRSVAAARRLTLDVNILMLIAVAGAIALKDYSEAGFIVFLFTTAEWLETRASRKAT  194

Query  3774  AAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTL  3595
             A MSSL+++  Q AVLAETG+++    VKV+T++AVKAGEV+PIDG+VV+G  EVDE TL
Sbjct  195   AGMSSLMSMAPQNAVLAETGQVVATQDVKVNTVIAVKAGEVVPIDGVVVDGRSEVDESTL  254

Query  3594  TGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSI  3415
             TGESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR I
Sbjct  255   TGESFPVSKQADSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSNTQRLI  314

Query  3414  DKIAKYYTPAIVAISACLAISA--VKVENRSERYHLALVVLVSACPCALVLSTPVAMFCA  3241
             D  AKYYTPA+V +S  +A+    V+  N    + LALV+LVSACPCALVLSTPVA FCA
Sbjct  315   DTCAKYYTPAVVLMSGAVALIPVIVRAHNLKHWFQLALVLLVSACPCALVLSTPVATFCA  374

Query  3240  LSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWV  3061
             L RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F +  + +    LL WV
Sbjct  375   LLRAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFRTAGERVPKQKLLYWV  434

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             SSIES+SSHPMA A++D+AQS+SVEP  E V  FQ +PGEGIYGEIDG  +Y+GNK+I +
Sbjct  435   SSIESRSSHPMASALVDHAQSNSVEPKSENVTEFQIYPGEGIYGEIDGKGVYVGNKRILS  494

Query  2880  RAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
             RA C +VP  D+   +G ++ Y+     L GVF+LSD+CRTGA EAI++L+ +GIK+VML
Sbjct  495   RASCQTVP--DMKDMKGVTVGYVVCSKELIGVFTLSDSCRTGAAEAIKELRSLGIKSVML  552

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALAT  2524
             TGDS AAA + Q QLG  L E H+ELLPE+K +I+ + + K G T MIGDG+NDAPALA 
Sbjct  553   TGDSTAAATYAQNQLGNLLAEVHSELLPEDKVRIVDELKAKDGPTLMIGDGMNDAPALAK  612

Query  2523  ADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIM  2344
             ADVG+SMG+SGS +A ET H+ LM+NDI RI KAI+L RR  R +IVNIV ++ TK AI+
Sbjct  613   ADVGVSMGVSGSAVAMETSHITLMSNDIRRIPKAIKLARRTHRTIIVNIVFSVATKLAIV  672

Query  2343  ALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
              LA AGHPL+WAAVL DVGTCL+VI  S LLLR
Sbjct  673   GLAFAGHPLIWAAVLADVGTCLLVIMYSMLLLR  705



>ref|XP_010541195.1| PREDICTED: LOW QUALITY PROTEIN: putative inactive cadmium/zinc-transporting 
ATPase HMA3 [Tarenaya hassleriana]
Length=791

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/703 (57%), Positives = 531/703 (76%), Gaps = 8/703 (1%)
 Frame = -1

Query  4317  NNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIV  4138
              N  + +YFDV+GICC SEVPL+  +L+ LDGV E SV+  ++TV+VVHD LLI+  +I 
Sbjct  14    RNTLQTTYFDVVGICCSSEVPLVGDVLRPLDGVKEFSVIXPSRTVIVVHDSLLISPAEIA  73

Query  4137  RALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             +ALN+A LEA+++  GE        PSP+AV  G LL LSFLKY Y P++ LAVAAA AG
Sbjct  74    KALNQARLEATVRPYGEAV-FKNQWPSPFAVASGSLLALSFLKYFYGPVELLAVAAAAAG  132

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
              FP+  +A+A+L+   LDIN LM+I+VV ++ + ++ EAATIVFLF+  EWLES A+ KA
Sbjct  133   IFPIAAKALASLKMFRLDINALMLIAVVATMCMREFTEAATIVFLFSIAEWLESSAACKA  192

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
              AAMSSL++V  Q+AV+AETG+++  ++V+++T++AVKAGE +PIDG+VV+G C+VDEKT
Sbjct  193   GAAMSSLMSVAPQKAVIAETGQVVGVDEVQINTVVAVKAGESVPIDGVVVDGSCDVDEKT  252

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
              TGESF V KQKDSTVWA TINLNGYIS++TTA+A DC VA+M KLVEEAQ +++R QR 
Sbjct  253   RTGESFPVSKQKDSTVWAGTINLNGYISVRTTALARDCVVAKMVKLVEEAQKSQTRTQRF  312

Query  3417  IDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSA--CPCALVLSTPVAM  3250
             ID+ ++YYTPA+V ISAC AI  + ++ +N S   HLALVVLVSA  CPC L+LSTPVA 
Sbjct  313   IDRCSQYYTPAVVVISACFAIIPTVLRFDNLSNWLHLALVVLVSACSCPCGLILSTPVAT  372

Query  3249  FCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLL  3070
             FCAL++AA  G L K  + LE L+K++V AFDKTGTIT+ EF V  F  L   ++H+ L+
Sbjct  373   FCALTKAAMSGFLVKNGDSLETLSKIRVAAFDKTGTITKAEFLVTDFRVLSHDVSHHNLI  432

Query  3069  SWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKK  2890
              W++SIE KSSHPMA A+++YA+S SV+P P+ VE FQN PGEG+YG IDG +IYIGNK+
Sbjct  433   YWIASIEDKSSHPMAAALVNYARSVSVQPKPDNVEGFQNSPGEGVYGRIDGQDIYIGNKR  492

Query  2889  ISARAGCT--SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGI  2716
             I+ RAG +  SVP  +     GK++ Y++VG  LAG F+L D CR G  +A+++LK +GI
Sbjct  493   IALRAGSSTDSVPNPEAAMNRGKTIGYVYVGQRLAGSFNLLDGCRYGVAQALKELKSLGI  552

Query  2715  KTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAP  2536
             KT ML+GD+ AAA   QEQLG  LD  H ELLPE+KA+II +F+  G T M+GDGLN+AP
Sbjct  553   KTAMLSGDNRAAAMDAQEQLGNELDAVHPELLPEDKARIIDEFKSHGPTAMVGDGLNEAP  612

Query  2535  ALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTK  2356
             A+A AD+GI+MGISGS LA ETGH +LM+ND+ +I KAI L RR  RKV+ N+++++  K
Sbjct  613   AIAKADIGIAMGISGSALATETGHAVLMSNDVRKIPKAIRLARRCQRKVMENVILSVSIK  672

Query  2355  AAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
               I+ L  AG+PLVW AVL D GTCLVVI NS LLLR  +REA
Sbjct  673   GGILVLGFAGYPLVWLAVLADAGTCLVVILNSMLLLR-DEREA  714



>ref|XP_006600491.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4-like 
isoform X2 [Glycine max]
Length=748

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/636 (63%), Positives = 504/636 (79%), Gaps = 3/636 (0%)
 Frame = -1

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A LEA+I+V G+     K  PSPY++  G+LLLLS LK+V+ PLK+LA+ A   
Sbjct  3     VKALNEARLEANIRVYGDEKH-QKRWPSPYSIASGVLLLLSLLKFVFHPLKYLALGAVAV  61

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
               +P++ +A+ ++RNL LDINILM+I+V+G+I ++ Y EA TIVFLF+  +WLESRASHK
Sbjct  62    AVYPLILKAIVSIRNLRLDINILMLIAVIGTISMNHYLEAGTIVFLFSIAQWLESRASHK  121

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A MSSL+N+  Q+AV+AETGE++DA++VK++T+L VKAGEVIPIDG+V++G CEVDEK
Sbjct  122   ATAVMSSLMNIAPQKAVIAETGEVVDADEVKINTVLEVKAGEVIPIDGVVIDGICEVDEK  181

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
              LTGESF V KQKDSTVWA TINLNGYIS+KTTA+AEDC +A+MAKLVEEAQ++K+  QR
Sbjct  182   KLTGESFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCVMAKMAKLVEEAQNSKTNIQR  241

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              IDK A++YTP +V ISA +A+   A+K  N       +LVVLVSACPCAL+LSTPVA F
Sbjct  242   LIDKFAQFYTPGVVIISALVAVIPLALKQHNHKLWLQFSLVVLVSACPCALILSTPVATF  301

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CA ++AA  GLL KG ++LE LAK+KV+AFDKTGTIT+GEF V HF SL D I+ NTL  
Sbjct  302   CAYTKAATSGLLIKGGDHLETLAKIKVMAFDKTGTITKGEFVVTHFQSLSDDIDFNTLAY  361

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSSIESKSSHP A AI+DY +S SVEP PEKV  F+ FPGEGI G+I+G  IYIGNK+I
Sbjct  362   WVSSIESKSSHPSAAAIVDYGRSLSVEPEPEKVTEFEIFPGEGICGKIEGRVIYIGNKRI  421

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             +ARAG  +VP    +   GK+  YI++G+   G FSLSDACR   QEAI +LK +GIKT 
Sbjct  422   AARAGFETVPILQGEVERGKTTGYIYLGAIPIGFFSLSDACRLRVQEAIGQLKSLGIKTA  481

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALA  2527
             MLTGD+ +AA  VQ++LG +L+  HAELLPE+K +II +F+K G T M+GDGLNDAPALA
Sbjct  482   MLTGDNQSAAMQVQDELGHSLELVHAELLPEDKVKIISEFKKEGPTAMVGDGLNDAPALA  541

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
              AD+GISMGISGS LA ETG++ILM+NDI +I +AI+L R+  RKV+ NIV +I TKAAI
Sbjct  542   AADIGISMGISGSALASETGNIILMSNDIMKIPEAIKLARKASRKVVENIVFSIMTKAAI  601

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGG  2239
             + LAI GHPLVWAAV+ DVGTCL+VIFNS LLLR G
Sbjct  602   LDLAIGGHPLVWAAVVADVGTCLLVIFNSMLLLRKG  637



>ref|XP_009150707.1| PREDICTED: cadmium/zinc-transporting ATPase HMA3-like [Brassica 
rapa]
Length=1190

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/694 (61%), Positives = 547/694 (79%), Gaps = 10/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVPLI+ ILK LDGV E SV V ++TV+VVHD LLI+  QI +ALN
Sbjct  21    QKSYFDVLGICCSSEVPLIENILKSLDGVKEYSVNVPSRTVIVVHDNLLISPFQIAKALN  80

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A  EA++KV+G+TN   K  PSP+A   GILLLLSFLK+VY PL+W+AVAA  AG +P+
Sbjct  81    QAKFEANVKVDGKTNFKNKW-PSPFAPASGILLLLSFLKFVYPPLRWIAVAAVAAGIYPI  139

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    +DINIL+II+V  ++ + DY EAA +VFLFT  EWLE+RAS+KA A M
Sbjct  140   LAKAVASIGRKRVDINILVIITVAATLAMQDYMEAAAVVFLFTIAEWLETRASYKATAVM  199

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+A++AETGE ++ ++VKV+TI+AVKAGE IPIDGIVV+G CEVDEKTLTGE
Sbjct  200   QSLMSLAPQKAIIAETGEEVEVDEVKVNTIVAVKAGETIPIDGIVVDGNCEVDEKTLTGE  259

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             ++ VPKQ+DSTVWA TINLNGY+S+KTT++A DC VA+MAKLVEEAQS+K+++QR IDK 
Sbjct  260   AYPVPKQRDSTVWAGTINLNGYVSVKTTSLASDCVVAKMAKLVEEAQSSKTKSQRLIDKC  319

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPAI+ +S   A+  + +K+ N +  +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  320   SQYYTPAIILVSGGFAVVPAVMKLHNLNHWFHLALVVLVSACPCGLILSTPVATFCALTK  379

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL     H+T    +   
Sbjct  380   AATSGLLIKSADYLDTLSKIKITAFDKTGTITRGEFIVIEFRSL-----HST-KPGLLPE  433

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ES  S     +++DYA+S +VEP  E+VE +QNFPGEGIYG+IDG +IYIGNK+I +RA 
Sbjct  434   ESSLSLSSDHSLVDYAKSVNVEPRTEEVEGYQNFPGEGIYGKIDGNDIYIGNKRIGSRAK  493

Query  2871  CTSVPEFDVD-GREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              ++VPE +VD  + GK++ YI+VG  LAGVF+LSDACR+G  +A+++LK +GIKT MLTG
Sbjct  494   ISTVPEIEVDTNKGGKTVGYIYVGERLAGVFNLSDACRSGVAQAMKELKDLGIKTAMLTG  553

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             D+  AA H QEQLG A+D  H ELLPE+K++II +F+K G T M+GDG+NDAPALATAD+
Sbjct  554   DNQDAAMHAQEQLGNAMDVVHGELLPEDKSRIILEFKKEGPTAMVGDGVNDAPALATADI  613

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LA +TGH+ILM+NDI RI +AI L RR  RKV+ N+ ++I  K  I+ LA
Sbjct  614   GISMGISGSALATQTGHIILMSNDIRRIPQAIRLARRARRKVVENLFISITLKVGILVLA  673

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
              AGHPL+WAAVL DVGTCL+VI NS LLLR  D+
Sbjct  674   FAGHPLIWAAVLADVGTCLLVILNSMLLLRDKDK  707



>ref|XP_007138820.1| hypothetical protein PHAVU_009G240000g [Phaseolus vulgaris]
 gb|ESW10814.1| hypothetical protein PHAVU_009G240000g [Phaseolus vulgaris]
Length=892

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/696 (59%), Positives = 527/696 (76%), Gaps = 6/696 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV  VSV+V T+TV VVHD L I++ QI  ALN
Sbjct  6     KRSSFEVLGLCCATEATLVERILKPLHGVKHVSVIVPTRTVTVVHDVLFISESQIADALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS+++ GET D  K  P    +VCG+LL LSFLKYVY PL+WLA+ + V G   V
Sbjct  66    AARLEASLRLQGET-DNEKKWPDLTTMVCGLLLALSFLKYVYQPLEWLALGSVVIGFPKV  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A+++ LTL+INIL++++V G+  L D+WEA  I+FLF+  +WLE+RA+HKA  AM
Sbjct  125   LLRAIASIKALTLNINILVLLAVCGTAALRDFWEAGVIIFLFSIAQWLETRATHKAKVAM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++  Q+AV+AETGE +D N VK+DTILAV+ G+ IP+DGIVVEG+CEVDEK LTGE
Sbjct  185   SSLTSMAPQKAVIAETGERVDVNDVKIDTILAVRPGDAIPLDGIVVEGKCEVDEKMLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S  V K+ DS VWA TIN+NGYIS+KTT +A+D  VARM+KLVEEA S KSR QR ID  
Sbjct  245   SLPVIKEFDSVVWAGTINVNGYISVKTTVLAKDTVVARMSKLVEEASSRKSRTQRFIDNF  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY PA+V ISA +A+  +A++V +     HLA+VVL+SACPCAL+LSTPVA+FCAL++
Sbjct  305   AKYYIPAVVLISASIAVVPAAIEVPDIKPWLHLAIVVLLSACPCALILSTPVAIFCALTK  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +Y+E L+ +K +AFDKTGTITRGEFTV  F S +D I+  TLL WVSSI
Sbjct  365   AATSGLLLKGGDYVETLSGIKTVAFDKTGTITRGEFTVTDF-SFVDDISIETLLYWVSSI  423

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA ++++Y  SHSV P PE VE+F+NF GEG++G IDG +IYIGN++I ARA 
Sbjct  424   ESKSSHPMAASLVEYGMSHSVRPIPENVENFENFAGEGVFGTIDGKDIYIGNRRIGARAD  483

Query  2871  CTSVP-EFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
                V     +   E  S      G +L GVFSL D CR+GA EAI +LK++G+++VMLTG
Sbjct  484   SARVDCHLQLQSHE-ISTPKEHCGPTLVGVFSLVDTCRSGALEAIEELKLLGVRSVMLTG  542

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADV  2515
             DS  AA +VQ QL   LD  HAELLP EKA II+  +K G   MIGDG+NDAPALATAD+
Sbjct  543   DSSQAAMYVQSQLNHGLDLVHAELLPAEKAVIIENLKKDGLIAMIGDGINDAPALATADI  602

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS LA ETG+ ILM+NDI +I +AI L R+  RK+I N+++++  K+AI+ALA
Sbjct  603   GISMGISGSALANETGNAILMSNDIQKIPEAIRLARKTTRKLIENVIISVGFKSAILALA  662

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             IAG+P+VW AVL DVGTCL+VIFNS L+L+   + A
Sbjct  663   IAGYPIVWLAVLTDVGTCLLVIFNSMLILQETPKSA  698



>ref|XP_010677583.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Beta vulgaris subsp. vulgaris]
Length=832

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/693 (59%), Positives = 537/693 (77%), Gaps = 6/693 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EKSYF+++G+CC SEVPLI+ ILK L GVHE+SV+V TKT++VVHD   I+  QIV+ALN
Sbjct  32    EKSYFEIMGLCCSSEVPLIEGILKPLKGVHEISVVVPTKTLMVVHDIETISTSQIVQALN  91

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  GE N   K  P  + + CG+LLLLSFLK+VY P++WLAV     G   +
Sbjct  92    KARLEASVRPRGEGNYTKKW-PGKWDIACGLLLLLSFLKFVYHPMQWLAVVVVFIGVPNI  150

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R++A++RNLTL++N++++++V G++ L DY +AA IVFL+   +WLESRAS+KAM+ M
Sbjct  151   IWRSIASIRNLTLNVNVIVLVAVGGTLALQDYTDAAIIVFLYNIAQWLESRASYKAMSVM  210

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++   +A LAETG+ +D   V + TI+AVKAGEVIPIDG+VVEG+CEVDEK LTGE
Sbjct  211   SSLTSMTPLKATLAETGKQVDVTSVNLGTIIAVKAGEVIPIDGVVVEGKCEVDEKALTGE  270

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF   K+  STVWA TINLNGYIS++TT +AE+C VARM  LVEEAQS K++ Q  I+ +
Sbjct  271   SFPGIKEFGSTVWAGTINLNGYISVRTTMLAENCLVARMVNLVEEAQSRKAKIQTFIENV  330

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AK+Y P +V ISA +A+   A+++ +++  +HLALVVLVSACPCALV+STPV +FCALS+
Sbjct  331   AKWYIPVVVLISAGVAVIPIALQIGDKTRWFHLALVVLVSACPCALVISTPVTIFCALSK  390

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLLFKG +YLE+LAKVK +AFDKTGTIT GEF V HF SL + I+  TLL WVSSI
Sbjct  391   AATTGLLFKGGDYLELLAKVKTVAFDKTGTITTGEFVVTHFHSLHETISIETLLFWVSSI  450

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+I+YA S S+EP PE+VE FQN+PGEGIYG+I+G  IYIGN +IS RAG
Sbjct  451   ESKSSHPMAAALINYAASFSIEPMPEEVEEFQNYPGEGIYGKIEGAHIYIGNYRISLRAG  510

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +    ++   E K+  +I++G++L G F LSD CR+GA EA+++LK  GI+TVMLTGD
Sbjct  511   SHA---NELHKMEEKASGFIYMGATLVGTFGLSDNCRSGAMEAMKELKKSGIRTVMLTGD  567

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             ++ AA+ VQ QL  ALD  HA+LLPE+KA+II++ +  G   M+GDG+NDA ALAT D+G
Sbjct  568   NHIAAQQVQHQLEEALDIVHAQLLPEDKARIIEELKNDGVVAMVGDGINDALALATTDIG  627

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETGHVILM+NDI +I +AI++ ++  RK+I N+V++  TK  ++ALAI
Sbjct  628   ISMGISGSALAMETGHVILMSNDIRKIPQAIQISKKASRKIIENVVISFFTKGIVLALAI  687

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             AG+ ++  AV+ DVGTCL+VI NS LLL+G + 
Sbjct  688   AGYSMLLVAVVTDVGTCLLVILNSMLLLQGTEE  720



>gb|EAZ38178.1| hypothetical protein OsJ_22530 [Oryza sativa Japonica Group]
 dbj|BAM36049.1| heavy metal ATPase 2, partial [Oryza sativa Japonica Group]
 dbj|BAN45659.1| heavy metal transporting ATPase [Oryza sativa Japonica Group]
Length=1067

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/694 (60%), Positives = 537/694 (77%), Gaps = 6/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICCPSEVPL++K+L+ L+GV +V+V+V ++TV+VVHD   I+Q QIV+ALN
Sbjct  9     QKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIVPSRTVIVVHDVDAISQSQIVKALN  68

Query  4125  KASLEASIKVNGETNDG-PKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFP  3949
             +A LEAS++  G  ++      PSPY ++CG+LL++S  ++ + PLKW A+ AA AG  P
Sbjct  69    QARLEASVRAYGNGSEKITNKWPSPYVLLCGLLLVVSLFEHFWHPLKWFALVAAAAGLPP  128

Query  3948  VLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
             ++ R++AA+R LTLD+NILM+I+V G+I L DY EA  IVFLFTT EWLE+RASHKA A 
Sbjct  129   IVLRSIAAIRRLTLDVNILMLIAVAGAIALKDYSEAGFIVFLFTTAEWLETRASHKATAG  188

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MS+L+++  Q+A+LAETGE++ A  VKV+T++AVKAGEVIPIDG+VV+G  EVDE TLTG
Sbjct  189   MSALMSMAPQKAILAETGEVVAARDVKVNTVIAVKAGEVIPIDGVVVDGRSEVDESTLTG  248

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID 
Sbjct  249   ESFPVSKQPDSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSSTQRLIDT  308

Query  3408  IAKYYTPAIVAISACL-AISAV-KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYYTPA+V ++  + AI A+ K  N    + LALV+LVSACPCALVLSTP+A FCAL 
Sbjct  309   CAKYYTPAVVVMAGSVAAIPAIAKAHNLKHWFQLALVLLVSACPCALVLSTPIATFCALL  368

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F  + + ++   LL WVSS
Sbjct  369   RAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQPVGERVSLQQLLYWVSS  428

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             +ES+SSHPMA  ++DYAQS SVEP  E V  FQ +PGEGIYGEIDG  IYIGNK+I +RA
Sbjct  429   VESRSSHPMASVLVDYAQSKSVEPKSENVSEFQIYPGEGIYGEIDGAGIYIGNKRILSRA  488

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VP  D+   +G ++ Y+   + L GVF+LSDACRTG+ EAI++L+ +GIK+VMLTG
Sbjct  489   SCETVP--DMKDMKGVTIGYVACNNELIGVFTLSDACRTGSAEAIKELRSLGIKSVMLTG  546

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKF-QKGGRTGMIGDGLNDAPALATAD  2518
             DS AAA + Q QLG  L E HAELLPE+K +I+ +  +K G T M+GDG+NDAPALA AD
Sbjct  547   DSSAAATYAQNQLGNILAEVHAELLPEDKVRIVGELKEKDGPTLMVGDGMNDAPALAKAD  606

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMG+SGS +A ET HV LM+NDI RI KA+ L RR  R +IVNI+ ++ TK AI+ L
Sbjct  607   VGVSMGVSGSAVAMETSHVALMSNDIRRIPKAVRLARRTHRTIIVNIIFSVITKLAIVGL  666

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             A AGHPL+WAAVL DVGTCL+VI  S LLLR  D
Sbjct  667   AFAGHPLIWAAVLADVGTCLLVIMYSMLLLREKD  700



>gb|ADL59568.1| P1B-ATPase 2 [Triticum aestivum]
Length=1003

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/692 (60%), Positives = 533/692 (77%), Gaps = 6/692 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EKSYFDV+GICCPSEVPL++K+L+ L GVH+V+V+V ++TV+V+HD   I+Q QIVRALN
Sbjct  14    EKSYFDVLGICCPSEVPLVEKLLEPLAGVHKVTVVVPSRTVIVLHDAAAISQAQIVRALN  73

Query  4125  KASLEASIKVNGETNDGP--KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
              A LEAS++  G           PSPY +VCG+LL++S  ++ + PL+W AVA A AG  
Sbjct  74    GARLEASVRAYGGAGQSKVSNKWPSPYVLVCGVLLVVSLFEHFWRPLRWFAVAGAAAGLP  133

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ R+VAALR  T+D+NILM+I+V G+I L DY EA  IVFLFT  EWLE+RA  KA A
Sbjct  134   PIVLRSVAALRRRTMDVNILMLIAVAGAIALKDYPEAGFIVFLFTIAEWLETRACGKATA  193

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q AVLAETG+++    VK++T++AVKAGEV+PIDG+VV+G  EVDE TLT
Sbjct  194   GMSSLMSMAPQNAVLAETGQVVATQDVKINTVIAVKAGEVVPIDGVVVDGRSEVDESTLT  253

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID
Sbjct  254   GESFPVSKQTDSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSSTQRLID  313

Query  3411  KIAKYYTPAIVAISACLAISAVKVENRSER--YHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYTPA++ +SA +A+  V V+ R+ R  + LALV+LVSACPCALVLSTPVA FCAL
Sbjct  314   TCAKYYTPAVIFMSAAVAVIPVCVKARNLRHWFELALVLLVSACPCALVLSTPVATFCAL  373

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
              RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F ++ + ++   L+ WVS
Sbjct  374   LRAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQTVGERVSKQQLIYWVS  433

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIES+SSHPMA A++ YAQS+SVEP  E V  FQ +PGEGIYGEIDG  +Y+GNK+I AR
Sbjct  434   SIESRSSHPMASALVGYAQSNSVEPKSENVAEFQIYPGEGIYGEIDGEGVYVGNKRILAR  493

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             A C +VP+  V+  +G ++ Y+     L GVFSLSD+CRTG+ EAI++L+ +GIK+VMLT
Sbjct  494   ASCQTVPDI-VEHMKGVTIGYVACNKELIGVFSLSDSCRTGSAEAIKELRSLGIKSVMLT  552

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS AAA H Q QLG  L E HAELLPE+K +I+ + + + G T MIGDG+NDAPALA A
Sbjct  553   GDSTAAATHAQNQLGNILAEVHAELLPEDKVRIVDELKARDGPTLMIGDGMNDAPALAKA  612

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS +A ET H+ LM+NDI RI KAI+L RR  R ++VNIV ++ TK AI+ 
Sbjct  613   DVGVSMGVSGSAVAMETSHITLMSNDIRRIPKAIKLARRTHRTIVVNIVFSVTTKLAIVG  672

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             LA AGHPL+WAAVL DVGTCL+VI  S LLLR
Sbjct  673   LAFAGHPLIWAAVLADVGTCLLVIMYSMLLLR  704



>gb|AIA57685.1| heavy metal transporting P1B-ATPase 2 [Triticum aestivum]
Length=1003

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/692 (60%), Positives = 533/692 (77%), Gaps = 6/692 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EKSYFDV+GICCPSEVPL++K+L+ L GVH+V+V+V ++TV+V+HD   I+Q QIVRALN
Sbjct  14    EKSYFDVLGICCPSEVPLVEKLLEPLAGVHKVTVVVPSRTVIVLHDAAAISQAQIVRALN  73

Query  4125  KASLEASIKVNGETNDGP--KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
              A LEAS++  G           PSPY +VCG+LL++S  ++ + PL+W AVA A AG  
Sbjct  74    GARLEASVRAYGGAGQSKVSNKWPSPYVLVCGVLLVVSLFEHFWRPLRWFAVAGAAAGLP  133

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ R+VAALR  T+D+NILM+I+V G+I L DY EA  IVFLFT  EWLE+RA  KA A
Sbjct  134   PIVLRSVAALRRRTMDVNILMLIAVAGAIALKDYPEAGFIVFLFTIAEWLETRACGKATA  193

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q AVLAETG+++    VK++T++AVKAGEV+PIDG+VV+G  EVDE TLT
Sbjct  194   GMSSLMSMAPQNAVLAETGQVVATQDVKINTVIAVKAGEVVPIDGVVVDGRSEVDESTLT  253

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID
Sbjct  254   GESFPVSKQADSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSSTQRLID  313

Query  3411  KIAKYYTPAIVAISACLAISAVKVENRSER--YHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYTPA++ +SA +A+  V V+ R+ R  + LALV+LVSACPCALVLSTPVA FCAL
Sbjct  314   TCAKYYTPAVIFMSAAVAVIPVCVKARNLRHWFELALVLLVSACPCALVLSTPVATFCAL  373

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
              RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F ++ + ++   L+ WVS
Sbjct  374   LRAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQTVGERVSKQQLIYWVS  433

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIES+SSHPMA A++ YAQS+SVEP  E V  FQ +PGEGIYGEIDG  +Y+GNK+I AR
Sbjct  434   SIESRSSHPMASALVGYAQSNSVEPKSENVAEFQIYPGEGIYGEIDGEGVYVGNKRILAR  493

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             A C +VP+  V+  +G ++ Y+     L GVFSLSD+CRTG+ EAI++L+ +GIK+VMLT
Sbjct  494   ASCQTVPDI-VEHMKGVTIGYVACNKELIGVFSLSDSCRTGSAEAIKELRSLGIKSVMLT  552

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS AAA H Q QLG  L E HAELLPE+K +I+ + + + G T MIGDG+NDAPALA A
Sbjct  553   GDSTAAATHAQNQLGNILAEVHAELLPEDKVRIVDELKARDGPTLMIGDGMNDAPALAKA  612

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS +A ET H+ LM+NDI RI KAI+L RR  R ++VNIV ++ TK AI+ 
Sbjct  613   DVGVSMGVSGSAVAMETSHITLMSNDIRRIPKAIKLARRTHRTIVVNIVFSVTTKLAIVG  672

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             LA AGHPL+WAAVL DVGTCL+VI  S LLLR
Sbjct  673   LAFAGHPLIWAAVLADVGTCLLVIMYSMLLLR  704



>ref|XP_009401554.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Musa acuminata subsp. malaccensis]
Length=910

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/694 (58%), Positives = 524/694 (76%), Gaps = 6/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYF+V+G+CCPSEVPLI+ IL  LDG+ +VSV+V +K V+V+HD L+I+Q QIV+ALN
Sbjct  29    QKSYFEVLGLCCPSEVPLIENILSSLDGIQKVSVIVPSKMVIVIHDSLIISQLQIVKALN  88

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++  G T+   K  PSPY +  G+LL  S  K+ + PLKWLA+AA VAG  P+
Sbjct  89    QARLEATVRAYG-TDAIVKKWPSPYILASGLLLSASMFKHFFHPLKWLAIAAVVAGLPPI  147

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R++AA+R  TLD NIL++++V G++ L DY EA  IV LF   EWLES +S KA A M
Sbjct  148   VLRSIAAIRTCTLDTNILLLVAVGGAVALEDYTEAGFIVLLFAVAEWLESISSLKATAGM  207

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             S+L+ +  Q A+LAETGE++DA  VK++TILAVKAGEVIPIDG+VVEG+ EVDE +LTGE
Sbjct  208   STLMRMAPQNAILAETGEVVDAQDVKINTILAVKAGEVIPIDGVVVEGQSEVDESSLTGE  267

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ  S VWA T+N++GYIS++TTA+AE  AVARMA+LVEEAQ+ +S+ Q  ID  
Sbjct  268   SFPVVKQPQSPVWAGTLNIDGYISVRTTALAEQSAVARMARLVEEAQNRRSKTQTLIDSC  327

Query  3405  AKYYTPAIVAISACLAISA--VKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V I+A +A+    ++V +    + LALV+LVSACPCALVLSTPVA FCAL R
Sbjct  328   AKYYTPAVVTIAAGVAVVPMLMRVNDTKRWFRLALVLLVSACPCALVLSTPVATFCALLR  387

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GL  KG + LE LA + V+AFDKTGT+T+GEFTV  F S+   ++ +TLL WVSSI
Sbjct  388   AARAGLFIKGGDVLENLAGITVVAFDKTGTLTKGEFTVMDFRSISSNVSLHTLLYWVSSI  447

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DYA+S+S++P PE V  F  +PGEGI+GEIDG  IYIGNK+I++RA 
Sbjct  448   ESKSSHPMASALVDYAKSNSIKPKPENVREFHIYPGEGIHGEIDGKNIYIGNKRIASRAA  507

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP  +V+G EG +  YIF+     G+F+LSD CR GA +A++ LK +GIK  M+TGD
Sbjct  508   CKTVP--NVEGMEGINYGYIFLDMIPIGIFTLSDTCRAGAAQALKALKSLGIKCAMITGD  565

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPALATADV  2515
             S  AA H Q QLG A++  HAELLPE+K +II   + G G   MIGDG+NDAP+LA ADV
Sbjct  566   SNEAAIHAQNQLGHAIEIIHAELLPEDKVRIIGDLKAGEGSIAMIGDGMNDAPSLAMADV  625

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMGISGS +A+ET H+ LM+NDI ++ KAI L R+ +  +I NI  ++ TK  ++A A
Sbjct  626   GISMGISGSAVAKETSHITLMSNDISKVPKAIRLARKTYFTIIQNIFFSVITKVVVLAFA  685

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
              AGHPL+WAAVL DVGTCL+VI NS +LL+  D+
Sbjct  686   FAGHPLLWAAVLADVGTCLLVILNSMMLLQSKDK  719



>gb|EEC81261.1| hypothetical protein OsI_24354 [Oryza sativa Indica Group]
Length=1069

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/694 (60%), Positives = 536/694 (77%), Gaps = 6/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICCPSEVPL++K+L+ L+GV +V+V+V ++TV+VVHD   I+Q QIV+ALN
Sbjct  9     QKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIVPSRTVIVVHDVDAISQSQIVKALN  68

Query  4125  KASLEASIKVNGETNDG-PKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFP  3949
             +A LEAS++  G  ++      PSPY ++CG+LL++S  ++ + PLKW A+ AA AG  P
Sbjct  69    QARLEASVRAYGNGSEKITNKWPSPYVLLCGLLLVVSLFEHFWHPLKWFALVAAAAGLPP  128

Query  3948  VLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
             ++ R++AA+R LTLD+NILM+I+V G+I L DY EA  IVFLFTT EWLE+RASHKA A 
Sbjct  129   IVLRSIAAIRRLTLDVNILMLIAVAGAIALKDYSEAGFIVFLFTTAEWLETRASHKATAG  188

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MS+L+++  Q+A+LAETGE++ A  VKV+T++AVKAGEVIPIDG+VV+G  EVDE TLTG
Sbjct  189   MSALMSMAPQKAILAETGEVVAARDVKVNTVIAVKAGEVIPIDGVVVDGRSEVDESTLTG  248

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID 
Sbjct  249   ESFPVSKQPDSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSSTQRLIDT  308

Query  3408  IAKYYTPAIVAISACL-AISAV-KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYYTPA+V ++  + AI A+ K  N    + LALV+LVSACPCALVLSTP+A FCAL 
Sbjct  309   CAKYYTPAVVVMAGSVAAIPAIAKAHNLKHWFQLALVLLVSACPCALVLSTPIATFCALL  368

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F  + + ++   LL WVSS
Sbjct  369   RAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQPVGEHVSLQQLLYWVSS  428

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IES+SSHPMA  ++DYAQS SVEP  E    FQ +PGEGIYGEIDG  IYIGNK+I +RA
Sbjct  429   IESRSSHPMASVLVDYAQSKSVEPKSENASEFQIYPGEGIYGEIDGAGIYIGNKRILSRA  488

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VP  D+   +G ++ Y+   + L GVF+LSDACRTG+ EAI++L+ +GIK+VMLTG
Sbjct  489   SCETVP--DMKDMKGVTIGYVACNNELIGVFTLSDACRTGSAEAIKELRSLGIKSVMLTG  546

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKF-QKGGRTGMIGDGLNDAPALATAD  2518
             DS AAA + Q QLG  L E HAELLPE+K +I+ +  +K G T M+GDG+NDAPALA AD
Sbjct  547   DSTAAATYAQNQLGNILAEVHAELLPEDKVRIVGELKEKDGPTLMVGDGMNDAPALAKAD  606

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMG+SGS +A ET H+ LM+NDI RI KA+ L RR  R +IVNI+ ++ TK AI+ L
Sbjct  607   VGVSMGVSGSAVAMETSHITLMSNDIRRIPKAVRLARRTHRTIIVNIIFSVITKLAIVGL  666

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             A AGHPL+WAAVL DVGTCL+VI  S LLLR  D
Sbjct  667   AFAGHPLIWAAVLADVGTCLLVIMYSMLLLREKD  700



>ref|XP_002438953.1| hypothetical protein SORBIDRAFT_10g028920 [Sorghum bicolor]
 gb|EER90320.1| hypothetical protein SORBIDRAFT_10g028920 [Sorghum bicolor]
Length=1069

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/699 (59%), Positives = 534/699 (76%), Gaps = 8/699 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICCPSEVPL++K+L+ L GVH V+V+V ++TV+V+HD    +  QIV+ALN
Sbjct  12    QKSYFDVLGICCPSEVPLVEKLLRPLPGVHTVTVIVPSRTVIVLHDAAATSPAQIVKALN  71

Query  4125  KASLEASIKVNGETNDGP--KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
             +A LEAS++  G  ++       PSPY + CG+ L++S  ++ + PLKW A+ AA AG  
Sbjct  72    QARLEASVRAYGSGSEEKVANKWPSPYVLFCGVFLVVSLFEHFWPPLKWFALVAAAAGLP  131

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ R+ AA R LTLD+NILM+I+V G+I L DY EA  IVFLFTT EWLE+RASHKA A
Sbjct  132   PIVLRSFAAARRLTLDVNILMLIAVSGAIALKDYSEAGFIVFLFTTAEWLETRASHKATA  191

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q+AVLAETGE++ A  VKV+T++AVKAGEV+PIDG+VV+G  EVDE TLT
Sbjct  192   GMSSLMSMTPQKAVLAETGEVVSAQDVKVNTVIAVKAGEVVPIDGVVVDGRSEVDESTLT  251

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S+ QR ID
Sbjct  252   GESFPVAKQPDSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSKTQRLID  311

Query  3411  KIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYTPA+V ++A +A+   A++  +    + LALV+LVSACPCALVLSTPVA FCAL
Sbjct  312   TCAKYYTPAVVVMAAGVAVIPVAIRAHHLKHWFQLALVLLVSACPCALVLSTPVATFCAL  371

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
               AA  GLL KG + LE LA++K+ AFDKTGTITRGEF V  F ++ + I    LL WVS
Sbjct  372   LTAARTGLLIKGGDVLETLARIKIAAFDKTGTITRGEFCVEEFQAVGERIPMQQLLYWVS  431

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIES+SSHPMA  ++DYA S SVEP  + V  FQ +PGEGIYGEIDG  +YIGNK+I +R
Sbjct  432   SIESRSSHPMASVLVDYALSKSVEPKSDNVTEFQIYPGEGIYGEIDGEGVYIGNKRILSR  491

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             A C +VP  D+   +G ++ Y+     L GVF+LSD+CRTG+ EAIR+L+ +GIK+VMLT
Sbjct  492   ASCETVP--DMKDMKGVTIGYVACKGQLIGVFTLSDSCRTGSAEAIRELRSLGIKSVMLT  549

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS AAA + Q QLG  LDE H ELLPE+K +I+ + + K G T MIGDG+NDAPALA A
Sbjct  550   GDSSAAASYAQNQLGNILDEVHPELLPEDKVRIVDELKAKHGPTLMIGDGMNDAPALAKA  609

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS +A ET H+ LM+NDI RI KAI+L RR  R +IVNI+ ++ TK AI+ 
Sbjct  610   DVGVSMGVSGSAVAMETSHITLMSNDIRRIPKAIQLARRTHRTIIVNIIFSVITKLAIVG  669

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRG-GDREA  2227
             LA++GHPL+WAAVL DVGTC++VI  S LLLR  G R+A
Sbjct  670   LALSGHPLIWAAVLADVGTCMLVIMYSMLLLRSKGGRKA  708



>gb|AIA57684.1| heavy metal transporting P1B-ATPase 2 [Triticum aestivum]
Length=1023

 Score =   798 bits (2060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/692 (60%), Positives = 533/692 (77%), Gaps = 6/692 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EKSYFDV+GICCPSEVPL++K+L+ L GVH+V+V+V ++TV+V+HD   I+  QIVRALN
Sbjct  12    EKSYFDVLGICCPSEVPLVEKLLEPLAGVHKVTVVVPSRTVIVLHDAAAISTAQIVRALN  71

Query  4125  KASLEASIKVNGETNDGP--KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
              A LEAS++  G           PSPY +VCG+LL++S  ++ + PLKW AVA A AG  
Sbjct  72    GARLEASVRAYGGAGQSKVSNKWPSPYVLVCGVLLVVSLFEHFWRPLKWFAVAGAAAGLP  131

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ R+VAALR  T+D+NILM+I+V G+I L DY EA  IVFLFT  EWLE+RA  KA A
Sbjct  132   PIVLRSVAALRRRTMDVNILMLIAVAGAIALKDYSEAGFIVFLFTIAEWLETRACGKATA  191

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q AVLAETG+++    VK++T++AVKAGEV+PIDG+VV+G  EVDE TLT
Sbjct  192   GMSSLMSMAPQNAVLAETGQVVATQDVKINTVIAVKAGEVVPIDGVVVDGRSEVDESTLT  251

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF V KQ DS VWA T+N++GYIS++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID
Sbjct  252   GESFPVSKQTDSQVWAGTLNIDGYISVRTTAMADNSAVAKMARLVEEAQNSRSSTQRLID  311

Query  3411  KIAKYYTPAIVAISACLAISAVKVENRSER--YHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYTPA++ +SA +A+  V V+ R+ R  + LALV+LVSACPCALVLSTPVA FCAL
Sbjct  312   TCAKYYTPAVIFMSAAVAVIPVCVKARNLRHWFELALVLLVSACPCALVLSTPVATFCAL  371

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
              RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F ++ + ++   L+ WVS
Sbjct  372   LRAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQTVGERVSKQQLVYWVS  431

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIES+SSHPMA A++ YAQS+SVEP  E V  FQ +PGEGIYGEIDG  +Y+GNK+I AR
Sbjct  432   SIESRSSHPMASALVGYAQSNSVEPKSENVAEFQIYPGEGIYGEIDGEGVYVGNKRILAR  491

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             A C +VP+  V+  +G ++ Y+     L GVFSLSD+CRTGA EAI++L+ +GIK+VMLT
Sbjct  492   ASCQTVPDI-VEHMKGVTIGYVACNKELIGVFSLSDSCRTGAAEAIKELRSLGIKSVMLT  550

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPALATA  2521
             GDS AAA + Q QLG  L E H+ELLPE+K +I+ + + G G T MIGDG+NDAPALA A
Sbjct  551   GDSTAAATYAQNQLGNILAEVHSELLPEDKVRIVDELKAGDGPTLMIGDGMNDAPALAKA  610

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS +A ET H+ LM+NDI RI KAI+L RR  R ++VNIV ++ TK AI+A
Sbjct  611   DVGVSMGVSGSAVAMETSHITLMSNDIRRIPKAIKLARRTHRTIVVNIVFSVTTKLAIVA  670

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             LA AGHPL+WAAVL DVGTCL+VI  S LLLR
Sbjct  671   LAFAGHPLIWAAVLADVGTCLLVIMYSMLLLR  702



>gb|ADU53143.1| P1B-ATPase heavy-metal transporter [Oryza sativa Japonica Group]
Length=1067

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/694 (60%), Positives = 536/694 (77%), Gaps = 6/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICCPSEVPL++K+L+ L+GV +V+V+V ++TV+VVHD   I+Q QIV+ALN
Sbjct  9     QKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIVPSRTVIVVHDVDAISQSQIVKALN  68

Query  4125  KASLEASIKVNGETNDG-PKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFP  3949
             +  LEAS++  G  ++      PSPY ++CG+LL++S  ++ + PLKW A+ AA AG  P
Sbjct  69    QTRLEASVRAYGNGSEKITNKWPSPYVLLCGLLLVVSLFEHFWHPLKWFALVAAAAGLPP  128

Query  3948  VLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
             ++ R++AA+R LTLD+NILM+I+V G+I L DY EA  IVFLFTT EWLE+RASHKA A 
Sbjct  129   IVLRSIAAIRRLTLDVNILMLIAVAGAIALKDYSEAGFIVFLFTTAEWLETRASHKATAG  188

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MS+L+++  Q+A+LAETGE++ A  VKV+T++AVKAGEVIPIDG+VV+G  EVDE TLTG
Sbjct  189   MSALMSMAPQKAILAETGEVVAARDVKVNTVIAVKAGEVIPIDGVVVDGRSEVDESTLTG  248

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID 
Sbjct  249   ESFPVSKQPDSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSSTQRLIDT  308

Query  3408  IAKYYTPAIVAISACL-AISAV-KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYYTPA+V ++  + AI A+ K  N    + LALV+LVSACPCALVLSTP+A FCAL 
Sbjct  309   CAKYYTPAVVVMAGSVAAIPAIAKAHNLKHWFQLALVLLVSACPCALVLSTPIATFCALL  368

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F  + + ++   LL WVSS
Sbjct  369   RAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQPVGERVSLQQLLYWVSS  428

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             +ES+SSHPMA  ++DYAQS SVEP  E V  FQ +PGEGIYGEIDG  IYIGNK+I +RA
Sbjct  429   VESRSSHPMASVLVDYAQSKSVEPKSENVSEFQIYPGEGIYGEIDGAGIYIGNKRILSRA  488

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VP  D+   +G ++ Y+   + L GVF+LSDACRTG+ EAI++L+ +GIK+VMLTG
Sbjct  489   SCETVP--DMKDMKGVTIGYVACNNELIGVFTLSDACRTGSAEAIKELRSLGIKSVMLTG  546

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKF-QKGGRTGMIGDGLNDAPALATAD  2518
             DS AAA + Q QLG  L E HAELLPE+K +I+ +  +K G T M+GDG+NDAPALA AD
Sbjct  547   DSSAAATYAQNQLGNILAEVHAELLPEDKVRIVGELKEKDGPTLMVGDGMNDAPALAKAD  606

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMG+SGS +A ET HV LM+NDI RI KA+ L RR  R +IVNI+ ++ TK AI+ L
Sbjct  607   VGVSMGVSGSAVAMETSHVALMSNDIRRIPKAVRLARRTHRTIIVNIIFSVITKLAIVGL  666

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             A AGHPL+WAAVL DVGTCL+VI  S LLLR  D
Sbjct  667   AFAGHPLIWAAVLADVGTCLLVIMYSMLLLREKD  700



>gb|AIA57683.1| heavy metal transporting P1B-ATPase 2 [Triticum aestivum]
Length=985

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/692 (60%), Positives = 530/692 (77%), Gaps = 6/692 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EKSYFDV+GICCPSEVPL++K+L+ L GVH+V+V+V ++TV+V+HD   I+  QIVR LN
Sbjct  15    EKSYFDVLGICCPSEVPLVEKLLEPLAGVHKVTVVVPSRTVIVLHDAAAISTAQIVRELN  74

Query  4125  KASLEASIKVNGETNDGP--KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
                LEAS++  G           PSPY +VCG+LL++S  ++ + PLKW AVA A AG  
Sbjct  75    GVRLEASVRAYGGAGQSKVSNKWPSPYVLVCGVLLVVSLFEHFWRPLKWFAVAGAAAGLP  134

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ R+VAALR  T+D+NILM+I+V G+I L DY EA  IVFLFT  EWLE+RA  KA A
Sbjct  135   PIVLRSVAALRRRTMDVNILMLIAVAGAIALKDYSEAGFIVFLFTIAEWLETRACGKATA  194

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q AVLAETG+++    VK++T++AVKAGEV+PIDG+VV+G  EVDE TLT
Sbjct  195   GMSSLMSMAPQNAVLAETGQVVATQDVKINTVIAVKAGEVVPIDGVVVDGRSEVDESTLT  254

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID
Sbjct  255   GESFPVSKQADSQVWAGTLNIDGYIAMRTTAMADNSAVAKMARLVEEAQNSRSSTQRLID  314

Query  3411  KIAKYYTPAIVAISACLAISAVKVENRSER--YHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYTPA++ +SA +A+  V V  R+ R  + LALV+LVSACPCALVLSTPVA FCAL
Sbjct  315   TCAKYYTPAVIFMSAAVAVIPVCVRARNLRHWFELALVLLVSACPCALVLSTPVATFCAL  374

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
              RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F ++ + ++   L+ WVS
Sbjct  375   LRAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQTVGERVSKQQLIYWVS  434

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIES+SSHPMA A++ YAQS+SVEP  E V  FQ +PGEGIYGEIDG  +Y+GNK+I AR
Sbjct  435   SIESRSSHPMASALVGYAQSNSVEPKSENVAEFQIYPGEGIYGEIDGEGVYVGNKRILAR  494

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             A C +VP+  V+  +G ++ Y+     L GVFSLSD+CRTG+ EAI++L+ +GIK+VMLT
Sbjct  495   ASCQTVPDI-VEHMKGVTIGYVACNKELIGVFSLSDSCRTGSAEAIKELRSLGIKSVMLT  553

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS AAA H Q QLG  L E HAELLPE+K +I+ + + + G T MIGDG+NDAPALA A
Sbjct  554   GDSTAAATHAQNQLGNILAEVHAELLPEDKVRILDELKARDGPTLMIGDGMNDAPALAKA  613

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS +A ET H+ LM+NDI RI KAI+L RR  R ++VNIV ++ TK AI+A
Sbjct  614   DVGVSMGVSGSAVAMETSHITLMSNDIRRIPKAIKLARRTHRTIVVNIVFSVTTKLAIVA  673

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             LA AGHPL+WAAVL DVGTCL+VI  S LLLR
Sbjct  674   LAFAGHPLIWAAVLADVGTCLLVIMYSMLLLR  705



>gb|ABF55693.1| putative ATPase-like zinc transporter [Triticum aestivum]
Length=1023

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/692 (60%), Positives = 533/692 (77%), Gaps = 6/692 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EKSYFDV+GICCPSEVPL++K+L+ L GVH+V+V+V ++TV+V+HD   I+  QIVRALN
Sbjct  12    EKSYFDVLGICCPSEVPLVEKLLEPLAGVHKVTVVVPSRTVIVLHDAAAISTAQIVRALN  71

Query  4125  KASLEASIKVNGETNDGP--KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
              A LEAS++  G           PSPY +VCG+LL++S  ++ + PLKW AVA A AG  
Sbjct  72    GARLEASVRAYGGAGQSKVSNKWPSPYVLVCGVLLVVSLFEHFWRPLKWFAVAGAAAGLP  131

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ R+VAALR  T+D+NILM+I+V G+I L DY EA  IVFLFT  EWLE+RA  KA A
Sbjct  132   PIVLRSVAALRRRTMDVNILMLIAVAGAIALKDYSEAGFIVFLFTIAEWLETRACGKATA  191

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q AVLAETG+++    VK++T++AVKAGEV+PIDG+VV+G  EVDE TLT
Sbjct  192   GMSSLMSMAPQNAVLAETGQVVATQDVKINTVIAVKAGEVVPIDGVVVDGRSEVDESTLT  251

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             G+SF V KQ DS VWA T+N++GYIS++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID
Sbjct  252   GKSFPVSKQTDSQVWAGTLNIDGYISVRTTAMADNSAVAKMARLVEEAQNSRSSTQRLID  311

Query  3411  KIAKYYTPAIVAISACLAISAVKVENRSER--YHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYTPA++ +SA +A+  V V+ R+ R  + LALV+LVSACPCALVLSTPVA FCAL
Sbjct  312   TCAKYYTPAVIFMSAAVAVIPVCVKARNLRHWFELALVLLVSACPCALVLSTPVATFCAL  371

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
              RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F ++ + ++   L+ WVS
Sbjct  372   LRAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQTVGERVSKQQLVYWVS  431

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIES+SSHPMA A++ YAQS+SVEP  E V  FQ +PGEGIYGEIDG  +Y+GNK+I AR
Sbjct  432   SIESRSSHPMASALVGYAQSNSVEPKSENVAEFQIYPGEGIYGEIDGEGVYVGNKRILAR  491

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             A C +VP+  V+  +G ++ Y+     L GVFSLSD+CRTGA EAI++L+ +GIK+VMLT
Sbjct  492   ASCQTVPDI-VEHMKGVTIGYVACNKELIGVFSLSDSCRTGAAEAIKELRSLGIKSVMLT  550

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS AAA + Q QLG  L E H+ELLPE+K +I+ + + + G T MIGDG+NDAPALA A
Sbjct  551   GDSTAAATYAQNQLGNILAEVHSELLPEDKVRIVDELKARDGPTLMIGDGMNDAPALAKA  610

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS +A ET H+ LM+NDI RI KAI+L RR  R ++VNIV ++ TK AI+A
Sbjct  611   DVGVSMGVSGSAVAMETSHITLMSNDIHRIPKAIKLARRTHRTIVVNIVFSVTTKLAIVA  670

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             LA AGHPL+WAAVL DVGTCL+VI  S LLLR
Sbjct  671   LAFAGHPLIWAAVLADVGTCLLVIMYSMLLLR  702



>ref|XP_003594931.1| Zn/Cd P(IB)-type ATPase [Medicago truncatula]
 gb|AES65182.1| heavy metal ATPase transporter [Medicago truncatula]
Length=829

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/697 (57%), Positives = 522/697 (75%), Gaps = 20/697 (3%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV  VSV+V  +TV VVHD LLI++ +I  ALN
Sbjct  6     KRSNFEVLGMCCATEATLVERILKPLHGVKAVSVIVPARTVTVVHDVLLISESKIADALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS +  GETN+  K  P    + CG+LL LSFLKY+Y PL WLA+ +   G   V
Sbjct  66    TARLEASFRPQGETNN-EKKCPDILTMACGLLLALSFLKYIYPPLGWLALGSVAIGFPKV  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A++R LTL+INIL++++V G+  L D+ +   I+FLF+  +WLE+RA+HKA+ AM
Sbjct  125   LFRAIASIRALTLNINILVLLAVCGTAALQDFTDGGVIIFLFSIAQWLETRATHKALVAM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL N+  Q A++AETGE +D N VK++TILAVKAG+ IP+DGIVVEG+CEVDEK LTGE
Sbjct  185   SSLTNMAPQMAIVAETGERVDVNDVKMNTILAVKAGDAIPLDGIVVEGKCEVDEKMLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K+ DS VWA TIN+NGYIS++TT +A+D  VARM++LVEEA S KS AQR ID  
Sbjct  245   SFPVTKESDSLVWAGTINMNGYISVRTTVLAKDTVVARMSRLVEEASSRKSLAQRFIDNF  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY P +V ISA +A+  +A+ V +    +HLALVVL+S CPCAL+LSTPVA+FCAL++
Sbjct  305   AKYYIPVVVLISASIAVVPAALSVPDMEPWFHLALVVLLSGCPCALILSTPVAIFCALTK  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YLE L+++K +AFDKTGTITRGEF+V  FS+  D IN+ TLL W+SSI
Sbjct  365   AAISGLLLKGGDYLETLSRIKTVAFDKTGTITRGEFSVTDFSA-GDDINNETLLYWISSI  423

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP+A A++DYA+ HS++P PE VE+FQNFPGEGI+G IDG +IYIGNK++  RA 
Sbjct  424   ESKSSHPVAGALVDYARLHSIKPVPENVENFQNFPGEGIFGTIDGRDIYIGNKRVGVRAI  483

Query  2871  CT--------SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGI  2716
             C           PE        +         +L GVFSL DACR+GA EA+ +LK++G+
Sbjct  484   CKRDNCEVQFQRPEISTKKNNCE--------ETLVGVFSLVDACRSGALEAMEELKLLGV  535

Query  2715  KTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAP  2536
             ++VMLTGDS   A +VQ QL  A+D  HAELLP EKA++I+ F+K G   MIGDG+NDAP
Sbjct  536   RSVMLTGDSSQVAMYVQSQLKNAIDIVHAELLPHEKAKLIENFKKEGPIAMIGDGINDAP  595

Query  2535  ALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTK  2356
             ALATAD+GISMGISGS LA ET + ILM+NDI ++ +AI L R+  RK++ N+++++  K
Sbjct  596   ALATADIGISMGISGSALANETSNAILMSNDIRKVPEAIRLARKTTRKLVENVIISVGFK  655

Query  2355  AAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
              AI+ALAIAG+PLVW AVL DVGTCL+VI NS L+L+
Sbjct  656   CAILALAIAGYPLVWLAVLTDVGTCLLVILNSMLILQ  692



>ref|XP_009415522.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Musa acuminata subsp. malaccensis]
 ref|XP_009415523.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Musa acuminata subsp. malaccensis]
 ref|XP_009415524.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Musa acuminata subsp. malaccensis]
 ref|XP_009415526.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Musa acuminata subsp. malaccensis]
Length=891

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/690 (58%), Positives = 532/690 (77%), Gaps = 5/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+KILK L GV +VSV+V +KTV+VVHD LLI+QH+I++ALN
Sbjct  16    QKSYFDVLGLCCSSEVPLIEKILKPLSGVQKVSVIVPSKTVIVVHDSLLISQHEILKALN  75

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+++  G + +  K  PSPY + CG+LL++S  K  + PL+W A+AA + G  P+
Sbjct  76    QARLEATVRAYG-SAEITKKWPSPYILACGVLLVVSLFKRFFHPLRWFAIAAVLVGINPI  134

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R +AA+R LTLDINIL++I+V G++ L DY EAA +VFLFT  EWLESRASHKA   M
Sbjct  135   ILRGIAAIRRLTLDINILLLIAVGGAVALRDYSEAAFVVFLFTIAEWLESRASHKATVGM  194

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AVLAETG+++D   V+++TI+ VKAGEVIPIDGIVV+G+ EVDE++LTGE
Sbjct  195   SSLMSMAPQKAVLAETGQVVDIEDVEINTIIEVKAGEVIPIDGIVVDGQSEVDERSLTGE  254

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S  V KQ +S VWA T+N++GYIS++TTA++E+ AVA+M +LVEEAQ+ +S  QR ID  
Sbjct  255   SLPVTKQVNSLVWAGTLNIDGYISLRTTALSENSAVAKMKRLVEEAQNRRSNTQRLIDSC  314

Query  3405  AKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
              KYYTPA+V ++A +A+    ++V N    + LALV+LVSACPCALVLSTPVA FCAL +
Sbjct  315   TKYYTPAVVIVAAGVALVPLVMRVNNPRIWFQLALVLLVSACPCALVLSTPVATFCALLK  374

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +GLL KG + LE LAK++V+AFDKTGTIT+GEF V  F S+   ++   LL WVSSI
Sbjct  375   AARIGLLIKGGDVLEALAKIRVVAFDKTGTITKGEFKVVEFQSISSKVSLEMLLYWVSSI  434

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++++A+SHS+EP P+ V+ F  +PGEGIYGE+DG +I+IGNK+I+AR  
Sbjct  435   ESKSSHPMAAALVEHARSHSIEPKPDCVKEFHIYPGEGIYGEVDGRDIHIGNKRIAARVL  494

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP  + D +EG +  Y+F+     G ++LSD CR GA EAI++LK +GIKT MLTGD
Sbjct  495   CETVPNME-DMKEGVTYGYVFLDMVPVGTYALSDTCRIGAAEAIKELKSLGIKTAMLTGD  553

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATADV  2515
             S  A+ H Q QL   ++E HAELLPE+K Q+I K + + G T M+GDG+NDAPALA ADV
Sbjct  554   SMEASLHAQRQLNHVMEEVHAELLPEDKVQLIGKLKSREGSTAMVGDGMNDAPALAMADV  613

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMG+SGS +A ET H+ LM+NDI +I +AI L R+  R +I+NI+ +  TK AI+A+A
Sbjct  614   GISMGVSGSAVAMETSHITLMSNDICKIPRAIRLARKTRRMIIMNIIFSGVTKIAILAIA  673

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
              AG PL+WAAVL DVGTCL+VI NS  LL+
Sbjct  674   FAGRPLLWAAVLADVGTCLLVILNSMTLLQ  703



>ref|XP_004488108.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4-like 
isoform X2 [Cicer arietinum]
Length=832

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/697 (56%), Positives = 527/697 (76%), Gaps = 9/697 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV +VSV+V  +TV V+HD L I++ QI  ALN
Sbjct  7     KRSNFEVLGMCCATEASLVERILKPLHGVKDVSVIVPARTVTVIHDFLFISESQIADALN  66

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              ASLEAS + +GE+N+  K  P    + CG+LL+LSFLKY+Y PL WLA+ +   G   V
Sbjct  67    AASLEASYRPHGESNNNEKKWPDFPTMACGLLLVLSFLKYIYPPLGWLALGSVAIGFPKV  126

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A+++ LTL+INIL++++V G++ + D+ +   I+FLF+  +WLE+RA+HKAM AM
Sbjct  127   LFRAIASIKALTLNINILVVLAVCGTVAIQDFTDGGVIIFLFSIAQWLETRATHKAMVAM  186

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL N+  Q A++AETGE +D N+VK++TILAVKAGE IP+DG+VV+G+CEVDEK LTGE
Sbjct  187   SSLTNMAPQMAIVAETGERVDVNEVKINTILAVKAGEAIPLDGVVVDGKCEVDEKMLTGE  246

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K+ DS VWA TIN+NGYIS++T  +A+D  VA+M++LVEEA S KS+AQR ID  
Sbjct  247   SFPVTKESDSLVWAGTINMNGYISVRTIVLAKDTVVAKMSRLVEEASSRKSQAQRFIDNF  306

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY P +V ISA +A+  +A+ V +    +HL+LVVL+S CPCAL+LSTPVA+FCAL++
Sbjct  307   AKYYIPVVVLISASIAVIPAAISVPDIEPWFHLSLVVLLSGCPCALILSTPVAIFCALTK  366

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YLE L+++K +AFDKTGTITRGEF+V  F S+ D I++ TLL W+SSI
Sbjct  367   AAISGLLLKGGDYLETLSRIKTVAFDKTGTITRGEFSVTDF-SVSDDIDNETLLYWISSI  425

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP+A A+++Y   HS++P PE VE+FQNFPGEGI G IDG +IYIGN++I  RA 
Sbjct  426   ESKSSHPVAAALVEYGMLHSIKPVPENVENFQNFPGEGIVGTIDGRDIYIGNRRIGIRAE  485

Query  2871  CTSVP---EFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
                V    +F  +    K       G +L GVFSL DACR+GA EAI +LK++G+++VML
Sbjct  486   SERVDCQLQFQSNEISAKKQ---HCGQTLVGVFSLVDACRSGALEAIEELKLLGVRSVML  542

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATA  2521
             TGDS   A +VQ QL  A+D  HAELLP EKA II+  +K G T M+GDG+NDAPALATA
Sbjct  543   TGDSSQVAMYVQSQLNHAIDIVHAELLPHEKATIIENLKKQGPTAMVGDGINDAPALATA  602

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             D+GISMGISGS LA ET + ILM+NDI ++ +AI L R+  RK+I N+++++  K AI+A
Sbjct  603   DIGISMGISGSALANETSNAILMSNDIRKVPEAIRLARKTTRKLIENVIISVGFKCAILA  662

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             LAIAG+PLVW AVL DVGTCL+VI NS L+L+   ++
Sbjct  663   LAIAGYPLVWLAVLTDVGTCLLVILNSMLILQENKKD  699



>ref|XP_004487939.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like isoform 
X1 [Cicer arietinum]
Length=834

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/697 (57%), Positives = 526/697 (75%), Gaps = 9/697 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV +VSV+V T+TV VVHD L I+Q QI  ALN
Sbjct  7     KRSNFEVLGMCCATEASLVERILKPLHGVKDVSVIVPTRTVTVVHDVLFISQSQIADALN  66

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              ASLEAS + +GE+N+  K  P    + CG+LL+LSFLKY+Y  L+WLA+ +   G   V
Sbjct  67    NASLEASYRPHGESNNIEKKWPDFPTMACGLLLVLSFLKYLYPSLEWLALGSVAIGFPKV  126

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A+++ LTL+INIL++ +V G+I + D+ +   I+FLF+  +WLE+RA+HKAM AM
Sbjct  127   LFRAIASIKALTLNINILVVFAVCGTIAIQDFTDGGVIIFLFSIAQWLETRATHKAMVAM  186

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL N+  Q A+ AETGE +D N+VK++TILAVKAGE IP+DG+VV+G+CEVDEK LTGE
Sbjct  187   SSLTNMAPQMAIAAETGERVDVNEVKINTILAVKAGEAIPLDGVVVDGKCEVDEKMLTGE  246

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K+ DS VWA TIN+NGYIS++T  +A+D  VA+M++LVEEA S KS+AQR ID  
Sbjct  247   SFPVTKESDSLVWAGTINMNGYISVRTIVLAKDTVVAKMSRLVEEASSRKSQAQRFIDNF  306

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY P +V ISA +A+  +A+ V +    +HL+LVVL+S CPCAL+LSTPVA+FCAL++
Sbjct  307   AKYYIPVVVLISASIAVVPAAISVPDIEPWFHLSLVVLLSGCPCALILSTPVAIFCALTK  366

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YLE L+++K +AFDKTGTITRGEF+V  FS   D I++ T+L W+SSI
Sbjct  367   AAISGLLLKGGDYLETLSRIKTVAFDKTGTITRGEFSVTDFSG-TDDIDNETILYWISSI  425

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHP+A A+++Y   HS++P PE VE+FQNFPGEGI+G IDG +IYIGN++I  RA 
Sbjct  426   ESKSSHPVAAALVEYGMLHSIKPVPENVENFQNFPGEGIFGTIDGRDIYIGNRRIGIRAQ  485

Query  2871  CTSVP---EFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
                V    +F  +    K     + G +L GVFSL DACR+GA EAI +LK++G+++VML
Sbjct  486   SERVDCQLQFQSNEISAKKQ---YCGQTLVGVFSLVDACRSGALEAIEELKLLGVRSVML  542

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATA  2521
             TGDS   A +VQ QL  A+D  HAELLP EKA II+  +K G T MIGDG+NDAPALATA
Sbjct  543   TGDSSQVAMYVQSQLNHAIDIVHAELLPHEKATIIENLKKQGPTAMIGDGINDAPALATA  602

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             D+GISMGISGS LA ET + ILM+NDI ++ +AI L R+  RK+I N+++++  K AI+A
Sbjct  603   DIGISMGISGSALANETSNAILMSNDIRKVPEAIRLARKTTRKLIENVIISVGFKCAILA  662

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             LAIAG+PLVW AVL DVGTCL VI NS L+L+   ++
Sbjct  663   LAIAGYPLVWLAVLTDVGTCLFVILNSMLILQENKKD  699



>gb|AFJ94191.1| P1B-ATPase 2 [Triticum aestivum]
Length=1003

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/692 (60%), Positives = 531/692 (77%), Gaps = 6/692 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK YFDV+GICCPSEVPL++K+L+ L GVH+V+V+V ++TV+V+HD   I+Q QIVRALN
Sbjct  14    EKGYFDVLGICCPSEVPLVEKLLEPLAGVHKVTVVVPSRTVIVLHDAAAISQAQIVRALN  73

Query  4125  KASLEASIKVNGETNDGP--KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
              A LEAS++  G           PSPY +VCG+LL++S  ++ + PL+W AVA A AG  
Sbjct  74    GARLEASVRAYGGAGQSKVSNKWPSPYVLVCGVLLVVSLFEHFWRPLRWFAVAGAAAGLP  133

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ R+VAALR  T+D+NILM+I+V G+I L DY EA  IVFLFT  EWLE+RA  KA A
Sbjct  134   PIVLRSVAALRRRTMDVNILMLIAVAGAIALKDYPEAGFIVFLFTIAEWLETRACGKATA  193

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q AVLAETG+++    VK++T++AVKAGEV+PIDG+VV+G  EVDE TLT
Sbjct  194   GMSSLMSMAPQNAVLAETGQVVATQDVKINTVIAVKAGEVVPIDGVVVDGRSEVDESTLT  253

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID
Sbjct  254   GESFPVSKQADSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSSTQRLID  313

Query  3411  KIAKYYTPAIVAISACLAISAVKVENRSER--YHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYTPA++ +SA +A+  V V+ R+ R  + LALV+LVSACPCALVLSTPVA FCAL
Sbjct  314   TCAKYYTPAVIFMSAAVAVIPVCVKARNLRHWFELALVLLVSACPCALVLSTPVATFCAL  373

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
              RAA  GLL KG + LE LA +KV AFDKTGTITRGE +V  F ++ + ++   L+ WVS
Sbjct  374   LRAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGESSVEEFQTVGERVSKQQLIYWVS  433

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIES+SSHPMA A++ YAQS+SVEP  E V  FQ +PGEGIYGEIDG  +Y+GNK+I AR
Sbjct  434   SIESRSSHPMASALVGYAQSNSVEPKSENVAEFQIYPGEGIYGEIDGEGVYVGNKRILAR  493

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             A C +VP+  V+  +G ++ Y+     L GVFSLSD+CRTG+ EAI++L+ +GIK+VMLT
Sbjct  494   ASCQTVPDI-VEHMKGVTIGYVACNKELIGVFSLSDSCRTGSAEAIKELRSLGIKSVMLT  552

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS AAA H Q QLG  L E HAELLPE+K +I+ + + + G T MIGDG+NDAPALA A
Sbjct  553   GDSTAAATHAQNQLGNILAEVHAELLPEDKVRIVDELKARDGPTLMIGDGMNDAPALAKA  612

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS +A ET H+ LM+NDI RI KAI+L RR  R ++VNIV ++ TK AI+ 
Sbjct  613   DVGVSMGVSGSAVAMETSHITLMSNDIRRIPKAIKLARRTHRTIVVNIVFSVTTKLAIVG  672

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             LA AGHPL+WAAVL DVGTCL+VI  S LLLR
Sbjct  673   LAFAGHPLIWAAVLADVGTCLLVIMYSMLLLR  704



>ref|XP_009402027.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Musa acuminata subsp. malaccensis]
Length=817

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/690 (58%), Positives = 528/690 (77%), Gaps = 5/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+KILK LDGV +VSV+V +KTV+V+HD LLI+QH+I +ALN
Sbjct  16    QKSYFDVLGLCCSSEVPLIEKILKPLDGVQKVSVIVPSKTVIVIHDSLLISQHEIAKALN  75

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  G T    K  PS Y + CG+LLL+S  K  + PL+W A+AA + G  P+
Sbjct  76    QARLEASVRAYG-TAKSTKKWPSLYILACGVLLLVSLFKKFFHPLQWFAIAAVLVGIPPI  134

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R++AA+R LTLDINIL++I+V G++   DY EAA IV LFT  EWLES+AS KA A M
Sbjct  135   MLRSIAAIRKLTLDINILLLIAVGGAVAFRDYSEAAFIVLLFTVAEWLESKASSKATAGM  194

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AVLAETG+++D   V+++T++AVKAGEVIPIDGIV++G  EVDE++LTGE
Sbjct  195   SSLMSMAPQQAVLAETGQVVDVEDVEINTLIAVKAGEVIPIDGIVIDGWSEVDERSLTGE  254

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ +S VWA T++++GY+S++TT+++E+ AVA+M  LVEEAQS++SR QR ID  
Sbjct  255   SFPVAKQANSLVWAGTLSIDGYVSVRTTSLSENSAVAKMTSLVEEAQSSRSRTQRLIDSC  314

Query  3405  AKYYTPAIVAISACLAISA--VKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
              KYYTPA+V ++A +A+    ++  N    + LALV+ VSACPCALVLSTPVA FCAL +
Sbjct  315   TKYYTPAVVIVAAGVALIPFLMRASNPRSWFQLALVLCVSACPCALVLSTPVATFCALLK  374

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG + LE LAK++V+AFDKTGTIT+GEFTV  F S+   +N +TLL WVSSI
Sbjct  375   AARTGLLIKGGDVLEALAKIRVVAFDKTGTITKGEFTVVEFESMSGKVNLHTLLYWVSSI  434

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++D+A+S+S+EP PE V+ F+ +PGEGIYGEI+G  IYIGNK+I+ARA 
Sbjct  435   ESKSSHPMAYALVDHARSYSIEPKPESVKEFRIYPGEGIYGEIEGRNIYIGNKRIAARAS  494

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               +VP    D + G +  Y+F+     G F+LSD CRTGA EA ++LK++GIKT MLTGD
Sbjct  495   SETVPNM-ADMKGGVTYGYVFLDMIQVGTFALSDTCRTGAAEANKELKLLGIKTAMLTGD  553

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPALATADV  2515
             S  AA H   Q+   ++  HAELLPE+K  +I   +K  G T M+GDG+NDAPALA A +
Sbjct  554   STEAAMHAHGQIEHGMEIIHAELLPEDKVHLIDSLKKREGPTAMVGDGVNDAPALAMASI  613

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GISMG+SGS +A ET H+ LM+ND+ +I KAI L R+   K++ NIV ++ TK AI+A+A
Sbjct  614   GISMGVSGSAVAVETSHITLMSNDLRKIPKAIRLARKTRFKIVANIVFSLATKIAILAMA  673

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             +AGHPL+WAAVL DVGTCL+VIFNS  LL+
Sbjct  674   VAGHPLLWAAVLADVGTCLLVIFNSMTLLQ  703



>ref|XP_006656442.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Oryza 
brachyantha]
Length=1044

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/694 (60%), Positives = 535/694 (77%), Gaps = 6/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICCPSEVPL++K+L+ L+GV +V+V+V ++TV+VVHD   ++Q QIV+ALN
Sbjct  11    QKSYFDVLGICCPSEVPLVEKLLQPLEGVQKVTVIVPSRTVIVVHDAAAVSQAQIVKALN  70

Query  4125  KASLEASIKVNGETNDG-PKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFP  3949
             +A LEAS++  G  ++      PSPY ++CG+LL++S  ++ + PLKW A+ AA AG  P
Sbjct  71    QARLEASVRAYGTGSEKITNKWPSPYVLLCGVLLVVSLFEHFWHPLKWFALGAAAAGLPP  130

Query  3948  VLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
             +L R+ AA+R LTLD+NILM+I+V G+I L DY EA  IVFLFTT EWLE+RASHKA A 
Sbjct  131   ILLRSFAAIRRLTLDVNILMLIAVAGAIALKDYSEAGFIVFLFTTAEWLETRASHKATAG  190

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MS+L+++  Q+AVLAETGE++ A  VKV+TI+AVKAGEVIPIDG+VV+G  EVDE TLTG
Sbjct  191   MSALMSMTPQKAVLAETGEVVAARDVKVNTIIAVKAGEVIPIDGVVVDGRSEVDESTLTG  250

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID 
Sbjct  251   ESFPVSKQPDSEVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSNTQRVIDT  310

Query  3408  IAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYYTPA+V +S  +A   + VKV N    + LALV+LVSACPCALVLSTP+A FCAL 
Sbjct  311   CAKYYTPAVVVMSGSVAAIPAIVKVHNLKHWFQLALVLLVSACPCALVLSTPIATFCALL  370

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F  + + +    LL WVSS
Sbjct  371   RAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQVVGEHVTMQQLLYWVSS  430

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IES+SSHPMA  ++DY+QS SVEP  + V  FQ +PGEGIYGEIDG  +YIGNK+I +RA
Sbjct  431   IESRSSHPMAAVLVDYSQSKSVEPKSDNVTEFQIYPGEGIYGEIDGSGVYIGNKRILSRA  490

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VP  D+   +G ++ Y+   + L GVF+LSD+CRTG+ EAI++L+ +GIK+VMLTG
Sbjct  491   SCETVP--DMKDMKGVTVGYVVCNNELIGVFTLSDSCRTGSAEAIKELRSLGIKSVMLTG  548

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKF-QKGGRTGMIGDGLNDAPALATAD  2518
             DS AAA + Q QLG  L E HAELLPE+K +++ +  +K G T MIGDG+NDAPALA AD
Sbjct  549   DSTAAATYAQNQLGNILSEVHAELLPEDKVRLVGELKEKDGPTLMIGDGMNDAPALAKAD  608

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMG+SGS +A ET H+ LM+NDI RI KA+ L RR  R +IVNIV ++ TK AI+ L
Sbjct  609   VGVSMGVSGSAVAMETSHITLMSNDIRRIPKAVRLARRTHRTIIVNIVFSVITKLAIVGL  668

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGD  2236
             A AGHPL+WAAVL DVGTCL+VI  S LLLR  D
Sbjct  669   AFAGHPLIWAAVLADVGTCLLVIMYSMLLLREKD  702



>ref|XP_004488107.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4-like 
isoform X1 [Cicer arietinum]
Length=847

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/712 (55%), Positives = 527/712 (74%), Gaps = 24/712 (3%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV +VSV+V  +TV V+HD L I++ QI  ALN
Sbjct  7     KRSNFEVLGMCCATEASLVERILKPLHGVKDVSVIVPARTVTVIHDFLFISESQIADALN  66

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              ASLEAS + +GE+N+  K  P    + CG+LL+LSFLKY+Y PL WLA+ +   G   V
Sbjct  67    AASLEASYRPHGESNNNEKKWPDFPTMACGLLLVLSFLKYIYPPLGWLALGSVAIGFPKV  126

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A+++ LTL+INIL++++V G++ + D+ +   I+FLF+  +WLE+RA+HKAM AM
Sbjct  127   LFRAIASIKALTLNINILVVLAVCGTVAIQDFTDGGVIIFLFSIAQWLETRATHKAMVAM  186

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL N+  Q A++AETGE +D N+VK++TILAVKAGE IP+DG+VV+G+CEVDEK LTGE
Sbjct  187   SSLTNMAPQMAIVAETGERVDVNEVKINTILAVKAGEAIPLDGVVVDGKCEVDEKMLTGE  246

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K+ DS VWA TIN+NGYIS++T  +A+D  VA+M++LVEEA S KS+AQR ID  
Sbjct  247   SFPVTKESDSLVWAGTINMNGYISVRTIVLAKDTVVAKMSRLVEEASSRKSQAQRFIDNF  306

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY P +V ISA +A+  +A+ V +    +HL+LVVL+S CPCAL+LSTPVA+FCAL++
Sbjct  307   AKYYIPVVVLISASIAVIPAAISVPDIEPWFHLSLVVLLSGCPCALILSTPVAIFCALTK  366

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW----  3064
             AA  GLL KG +YLE L+++K +AFDKTGTITRGEF+V  F S+ D I++ TLL W    
Sbjct  367   AAISGLLLKGGDYLETLSRIKTVAFDKTGTITRGEFSVTDF-SVSDDIDNETLLYWYVFY  425

Query  3063  -----------VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDG  2917
                        +SSIESKSSHP+A A+++Y   HS++P PE VE+FQNFPGEGI G IDG
Sbjct  426   ALNMYTIFFSLISSIESKSSHPVAAALVEYGMLHSIKPVPENVENFQNFPGEGIVGTIDG  485

Query  2916  MEIYIGNKKISARAGCTSVP---EFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQE  2746
              +IYIGN++I  RA    V    +F  +    K       G +L GVFSL DACR+GA E
Sbjct  486   RDIYIGNRRIGIRAESERVDCQLQFQSNEISAKKQH---CGQTLVGVFSLVDACRSGALE  542

Query  2745  AIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTG  2566
             AI +LK++G+++VMLTGDS   A +VQ QL  A+D  HAELLP EKA II+  +K G T 
Sbjct  543   AIEELKLLGVRSVMLTGDSSQVAMYVQSQLNHAIDIVHAELLPHEKATIIENLKKQGPTA  602

Query  2565  MIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVI  2386
             M+GDG+NDAPALATAD+GISMGISGS LA ET + ILM+NDI ++ +AI L R+  RK+I
Sbjct  603   MVGDGINDAPALATADIGISMGISGSALANETSNAILMSNDIRKVPEAIRLARKTTRKLI  662

Query  2385  VNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
              N+++++  K AI+ALAIAG+PLVW AVL DVGTCL+VI NS L+L+   ++
Sbjct  663   ENVIISVGFKCAILALAIAGYPLVWLAVLTDVGTCLLVILNSMLILQENKKD  714



>ref|XP_004966112.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Setaria 
italica]
Length=1095

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/699 (58%), Positives = 526/699 (75%), Gaps = 7/699 (1%)
 Frame = -1

Query  4308  AEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRAL  4129
             A+KSYFDV+GICCPSEVPL++++L+ L GV +V+V+V ++TV+V+HD    +   IV+ L
Sbjct  13    AQKSYFDVLGICCPSEVPLVERLLEPLPGVRKVTVIVPSRTVIVLHDADATSPAHIVKVL  72

Query  4128  NKASLEASIKVNGE-TNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
             N+A L+AS++  G  T       PSPY ++CG+ LL+S  ++ + PLKW A+ A  AG  
Sbjct  73    NQAKLDASVRAYGSGTEKITNKWPSPYVLLCGVCLLVSLFEHFWRPLKWFALGAVAAGIL  132

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P+L R+ AA R LTLD+NILM+I+V G+I L DY EA  IVFLFTT EWLE+RASHKA A
Sbjct  133   PILMRSFAAARRLTLDVNILMLIAVSGAIALKDYSEAGFIVFLFTTAEWLETRASHKATA  192

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q+AVLAETG+++ A  VKV+TI+AVKAGE+IPIDGIVV+G  EVDE TLT
Sbjct  193   GMSSLMSMAPQKAVLAETGQVVAAQDVKVNTIIAVKAGEIIPIDGIVVDGRSEVDESTLT  252

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF V KQ +S VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID
Sbjct  253   GESFPVAKQPESQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNSRSNTQRLID  312

Query  3411  KIAKYYT--PAIVAISACLAISAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYT    ++A +  +    ++  N    + LALV+LVSACPCALVLSTP+A FCAL
Sbjct  313   TCAKYYTPAVVVMAAAVAVIPVVIRAHNLKHMFQLALVLLVSACPCALVLSTPIATFCAL  372

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
               AA  GLL KG + LE LAK+K+ AFDKTGTITRGEF V  F  +   ++   LL WVS
Sbjct  373   LTAARTGLLIKGGDVLESLAKIKIAAFDKTGTITRGEFCVEEFKVVGGRVSIQQLLYWVS  432

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIES+SSHPMA  ++DYAQS SVEP  + V  FQ +PGEGIYGEIDG  +YIGNK+I +R
Sbjct  433   SIESRSSHPMASVLVDYAQSKSVEPKSDTVTEFQIYPGEGIYGEIDGEGVYIGNKRILSR  492

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             A C +VP  D++  +G ++ Y+     L GVF+LSD+CRTG+ EAI++L+ +GIK+VMLT
Sbjct  493   ASCETVP--DIEDMKGVTVGYVACKRELIGVFTLSDSCRTGSAEAIKELRSLGIKSVMLT  550

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS AAA + QEQLG  LDE  +ELLPE+K +I+ + + K G T MIGDG+NDAPALA A
Sbjct  551   GDSAAAAAYAQEQLGNILDEVRSELLPEDKVRIVDELKAKHGPTLMIGDGMNDAPALAKA  610

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS +A ET H+ LM+NDI RI KA++L RR  R +IVNI+ ++ TK AI+ 
Sbjct  611   DVGVSMGVSGSAVAMETSHITLMSNDIRRIPKAVQLARRTHRTIIVNIIFSVITKLAIVG  670

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRG-GDREA  2227
             LAI GHPL+WAAVL DVGTCL+VI  S LLLR   DR+A
Sbjct  671   LAIGGHPLIWAAVLADVGTCLLVIMYSMLLLRSKSDRKA  709



>ref|XP_003636710.1| Zn/Cd P(IB)-type ATPase [Medicago truncatula]
Length=845

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/713 (56%), Positives = 521/713 (73%), Gaps = 36/713 (5%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV  VSV+V  +TV VVHD LLI++ +I  ALN
Sbjct  6     KRSNFEVLGMCCATEATLVERILKPLHGVKAVSVIVPARTVTVVHDVLLISESKIADALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS +  GETN+  K  P    + CG+LL LSFLKY+Y PL WLA+ +   G   V
Sbjct  66    TARLEASFRPQGETNN-EKKCPDILTMACGLLLALSFLKYIYPPLGWLALGSVAIGFPKV  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A++R LTL+INIL++++V G+  L D+ +   I+FLF+  +WLE+RA+HKA+ AM
Sbjct  125   LFRAIASIRALTLNINILVLLAVCGTAALQDFTDGGVIIFLFSIAQWLETRATHKALVAM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL N+  Q A++AETGE +D N VK++TILAVKAG+ IP+DGIVVEG+CEVDEK LTGE
Sbjct  185   SSLTNMAPQMAIVAETGERVDVNDVKMNTILAVKAGDAIPLDGIVVEGKCEVDEKMLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V K+ DS VWA TIN+NGYIS++TT +A+D  VARM++LVEEA S KS AQR ID  
Sbjct  245   SFPVTKESDSLVWAGTINMNGYISVRTTVLAKDTVVARMSRLVEEASSRKSLAQRFIDNF  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY P +V ISA +A+  +A+ V +    +HLALVVL+S CPCAL+LSTPVA+FCAL++
Sbjct  305   AKYYIPVVVLISASIAVVPAALSVPDMEPWFHLALVVLLSGCPCALILSTPVAIFCALTK  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTL-------  3073
             AA  GLL KG +YLE L+++K +AFDKTGTITRGEF+V  FS+  D IN+ T        
Sbjct  365   AAISGLLLKGGDYLETLSRIKTVAFDKTGTITRGEFSVTDFSA-GDDINNETYCTGRFHL  423

Query  3072  ---------LSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEID  2920
                      L+ +SSIESKSSHP+A A++DYA+ HS++P PE VE+FQNFPGEGI+G ID
Sbjct  424   SIERNNVRSLALISSIESKSSHPVAGALVDYARLHSIKPVPENVENFQNFPGEGIFGTID  483

Query  2919  GMEIYIGNKKISARAGCT--------SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDAC  2764
             G +IYIGNK++  RA C           PE        +         +L GVFSL DAC
Sbjct  484   GRDIYIGNKRVGVRAICKRDNCEVQFQRPEISTKKNNCE--------ETLVGVFSLVDAC  535

Query  2763  RTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ  2584
             R+GA EA+ +LK++G+++VMLTGDS   A +VQ QL  A+D  HAELLP EKA++I+ F+
Sbjct  536   RSGALEAMEELKLLGVRSVMLTGDSSQVAMYVQSQLKNAIDIVHAELLPHEKAKLIENFK  595

Query  2583  KGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRR  2404
             K G   MIGDG+NDAPALATAD+GISMGISGS LA ET + ILM+NDI ++ +AI L R+
Sbjct  596   KEGPIAMIGDGINDAPALATADIGISMGISGSALANETSNAILMSNDIRKVPEAIRLARK  655

Query  2403  VWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
               RK++ N+++++  K AI+ALAIAG+PLVW AVL DVGTCL+VI NS L+L+
Sbjct  656   TTRKLVENVIISVGFKCAILALAIAGYPLVWLAVLTDVGTCLLVILNSMLILQ  708



>gb|ADG56570.1| heavy metal transporter [Hordeum vulgare]
 dbj|BAJ94569.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1009

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/692 (60%), Positives = 529/692 (76%), Gaps = 6/692 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EKSYFDV+GICCPSEVPL++K+L+ L GVH+V+V+V ++TV+V+HD   I+Q QIVRALN
Sbjct  13    EKSYFDVLGICCPSEVPLVEKLLEPLAGVHKVTVVVPSRTVIVLHDAAAISQAQIVRALN  72

Query  4125  KASLEASIKVNGETNDGP--KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
              A LEAS++  G           PSPY +VCG+LL++S  ++ + PLKW AVA A AG  
Sbjct  73    GARLEASVRAYGGAGQSKVTNKWPSPYVLVCGVLLVVSLFEHFWRPLKWFAVAGAAAGLP  132

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++ R+VAALR  T+D+NILM+I+V G+I L DY EA  IVFLFT  EWLE+RA  KA A
Sbjct  133   PIILRSVAALRRRTMDVNILMLIAVAGAIALKDYSEAGFIVFLFTIAEWLETRACGKATA  192

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+++  Q AVLAETG+++    VK++T++AVKAGE++PIDG+VV+G  EVDE TLT
Sbjct  193   GMSSLMSMAPQNAVLAETGQVVATQDVKINTVIAVKAGEIVPIDGVVVDGRSEVDESTLT  252

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF V KQ DS VWA T+N++GYI+++TTA+A++ AVA+MA+LVEEAQ+N+S  QR ID
Sbjct  253   GESFPVSKQADSQVWAGTLNIDGYIAVRTTAMADNSAVAKMARLVEEAQNNRSSTQRLID  312

Query  3411  KIAKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYTPA++ +SA +A+  V  K  N    + LALV+LVSACPCALVLSTPVA FCAL
Sbjct  313   TCAKYYTPAVIFMSAAVAVIPVCLKARNLKHWFELALVLLVSACPCALVLSTPVATFCAL  372

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
              RAA  GLL KG + LE LA +KV AFDKTGTITRGEF+V  F ++ + ++   LL WVS
Sbjct  373   LRAARTGLLIKGGDVLESLASIKVAAFDKTGTITRGEFSVEEFQTVGERVSKQQLLYWVS  432

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIES+SSHPMA A++ YAQS+SVEP  E V  FQ +PGEGIYGEI G  +Y+GNK+I AR
Sbjct  433   SIESRSSHPMAAALVGYAQSNSVEPKSENVAEFQMYPGEGIYGEIGGEGVYVGNKRILAR  492

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             A C  VP+  V+  +G ++ Y+     L GVFSLSD+CRTG+ EAI++L+ +GIK+VMLT
Sbjct  493   ASCQIVPDI-VEHMKGVTIGYVACNKELIGVFSLSDSCRTGSAEAIKELRSLGIKSVMLT  551

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS AAA H Q QLG  L E HAELLPE+K +I+ + + + G T MIGDG+NDAPALA A
Sbjct  552   GDSTAAATHAQNQLGNILAEVHAELLPEDKVRIVDELKARDGPTLMIGDGMNDAPALAKA  611

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS +A ET H+ LM+NDI RI KAI+L RR  R ++VNIV ++ TK AI+A
Sbjct  612   DVGVSMGVSGSAVAMETSHITLMSNDIRRIPKAIKLARRTHRTIVVNIVFSVTTKLAIVA  671

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             LA AGHPL+WAAVL DVGTCL+VI  S LLLR
Sbjct  672   LAFAGHPLIWAAVLADVGTCLLVIMYSMLLLR  703



>gb|EMS48900.1| Cadmium/zinc-transporting ATPase 3 [Triticum urartu]
Length=968

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/688 (59%), Positives = 531/688 (77%), Gaps = 6/688 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EKSYFDV+GICCPSEVPL++K+L+ L GVH+V+V+V ++TV+VVHD   I+Q QIV+ALN
Sbjct  6     EKSYFDVLGICCPSEVPLVEKLLEPLAGVHKVTVVVPSRTVIVVHDAAAISQAQIVKALN  65

Query  4125  KASLEASIKVNGETNDGP-KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFP  3949
             +A LEAS++  G          PSPY +VCG+LL++S  ++ + PL+WLA+ A  AG  P
Sbjct  66    QARLEASVRAYGGAGQNKINKWPSPYVLVCGVLLVVSLFEHFWRPLRWLALVATAAGLPP  125

Query  3948  VLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
             ++ R+VAA R LTLD+NILM+I+V G+I L DY EA  IVFLFTT EWLE+RAS KA A 
Sbjct  126   IVLRSVAAARRLTLDVNILMLIAVAGAIALKDYSEAGFIVFLFTTAEWLETRASCKATAG  185

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             M+SL+++  Q AVLAETG+++ A  VKV+T++AVKAGEV+PIDG+VV+G  EVDE+TLTG
Sbjct  186   MASLMSMAPQNAVLAETGQVVAAQDVKVNTVIAVKAGEVVPIDGVVVDGRSEVDEQTLTG  245

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF V KQ DS VWA T+N++GYIS++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID 
Sbjct  246   ESFPVAKQTDSEVWAGTLNIDGYISVRTTAMADNSAVAKMARLVEEAQNSRSETQRLIDT  305

Query  3408  IAKYYTPAIVAISACLAISAVKVENRSER--YHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYYTPA++ ++A +A++ V V  R+ R  + LALV+LVSACPCALVLSTPVA FCAL 
Sbjct  306   CAKYYTPAVIVMAAAVAVTPVIVRARNLRHWFQLALVLLVSACPCALVLSTPVATFCALL  365

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  GLL KG + LE LA +KV AFDKTGTIT GEF+VA F ++ + +    LL WVSS
Sbjct  366   KAARTGLLIKGGDVLESLAGIKVAAFDKTGTITSGEFSVAEFRAVGERVTKQQLLYWVSS  425

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             +E +SSHPMA A++DYA+S+SVEP  E V  FQ +PGEGIYGEIDG  +Y+GN++I +RA
Sbjct  426   VEGRSSHPMAAALVDYARSNSVEPKSENVVEFQIYPGEGIYGEIDGQGVYVGNRRILSRA  485

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VPE  V+  +G ++ Y+     L G+F LSD CRTG+ EAIR+L+ MGIK+VMLTG
Sbjct  486   SCETVPE--VNDIKGVTVGYVACNKELVGLFGLSDVCRTGSAEAIRELRSMGIKSVMLTG  543

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS AAA + Q QLG  L E H+ELLPE+K +I+ + + + G T M+GDG+NDAPALA AD
Sbjct  544   DSTAAATYAQNQLGNVLAEVHSELLPEDKVRIVDELKARDGPTLMVGDGMNDAPALARAD  603

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMG+SGS +A ET HV LM+ND+ RI KAI L RR  R ++ NIV ++ TK AI+ L
Sbjct  604   VGVSMGVSGSAVAMETSHVTLMSNDVRRIPKAIRLARRTRRTIVTNIVFSVATKLAIVGL  663

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTL  2254
             A+AGHPLVWAAVL DVGTCL+VI  S +
Sbjct  664   ALAGHPLVWAAVLADVGTCLLVIMYSMM  691



>emb|CAB81005.1| cadmium-transporting ATPase-like protein [Arabidopsis thaliana]
Length=711

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/695 (56%), Positives = 504/695 (73%), Gaps = 51/695 (7%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ +DGV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSIVGNVLRQVDGVKEFSVIVPSRTVIVVHDTFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+LL+LSF KY Y+PL+WLA+ A VAG FP+
Sbjct  73    QARLEASVRPYGETSLKSQW-PSPFAIVSGVLLVLSFFKYFYSPLEWLAIVAVVAGVFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + D+ EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATLCMQDFTEAATIVFLFSVADWLESSAAHKASIVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+A+TG  +D ++V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIADTGLEVDVDEVGINTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ++STV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKQRESTVMAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V  +AC A+  V  KV++ S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVVSAACFAVIPVLLKVQDLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K++AFDKTGTIT+ EF V+ F SL   IN + LL WVSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSPSINLHKLLYWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E KSSHPMA A+IDYA+S SVEP P+ VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  432   ECKSSHPMAAALIDYARSVSVEPKPDIVENFQNFPGEGVYGRIDGQDIYIGNKRIAQRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +                                               GI+T MLTGD
Sbjct  492   CLT-----------------------------------------------GIQTAMLTGD  504

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA   QEQL  ALD  H+ELLP++KA+II  F+  G T M+GDGLNDAPALA AD+G
Sbjct  505   NQDAAMSTQEQLENALDIVHSELLPQDKARIIDDFKIQGPTMMVGDGLNDAPALAKADIG  564

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG +ILM+NDI +I K + L +R  +KVI N+V+++  K AIM L  
Sbjct  565   ISMGISGSALATETGDIILMSNDIRKIPKGMRLAKRSHKKVIENVVLSVSIKGAIMVLGF  624

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
              G+PLVWAAVL D GTCL+VI NS +LLR  +REA
Sbjct  625   VGYPLVWAAVLADAGTCLLVILNSMMLLR-DEREA  658



>ref|XP_006492558.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like isoform 
X2 [Citrus sinensis]
Length=724

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/616 (60%), Positives = 478/616 (78%), Gaps = 2/616 (0%)
 Frame = -1

Query  4071  KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLRRAVAALRNLTLDINIL  3892
             K  P+P  +  G+LL LSFL Y+Y PL+ LAVAA + G   +L R+VA+++ LTL+IN+L
Sbjct  5     KKWPAPSVMASGLLLALSFLGYIYYPLQSLAVAAVIFGVPAILVRSVASIKRLTLNINVL  64

Query  3891  MIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGE  3712
             ++++ VG++ L DY EA +IVFLF+  +WLES AS+KAMAAMSSL ++  Q+A++AETGE
Sbjct  65    VLMAAVGTLALGDYVEAGSIVFLFSISQWLESVASYKAMAAMSSLTSMAPQKAIIAETGE  124

Query  3711  ILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATIN  3532
              +D N VKV+TILAV+AGEVIPIDGI+VEG+CEVDEKTLTGESF V K++DS VWA TIN
Sbjct  125   QVDVNTVKVNTILAVRAGEVIPIDGIIVEGKCEVDEKTLTGESFPVVKEQDSPVWAGTIN  184

Query  3531  LNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAI-  3355
             L+GYISIKTTA+A+DC V+RMA LVEE+   KSRAQ  I+  AKYY PA++ +S   A+ 
Sbjct  185   LDGYISIKTTALAKDCVVSRMAALVEESHKKKSRAQTFIESFAKYYIPAVLLVSVAFAVI  244

Query  3354  -SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILA  3178
              +AV V N     +LA+VVLVS CPCAL+LSTPV +FCALS+AA  GLL KG  YLE LA
Sbjct  245   PAAVGVPNVRHWLYLAIVVLVSTCPCALILSTPVVIFCALSKAATTGLLVKGGNYLETLA  304

Query  3177  KVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQS  2998
             KVK++AFDKTGT+TRGEFTV  F S+ D ++  TLL WVSSIESKSSHPMA A++DYA+S
Sbjct  305   KVKMVAFDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARS  364

Query  2997  HSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMS  2818
              ++EP PE VE FQNFPGEGI+G+I G EIYIGN +I  R GC+     +     GK+  
Sbjct  365   LAIEPVPENVEDFQNFPGEGIFGKIHGNEIYIGNTRIGPRTGCSKDSIVEAKCTGGKTRG  424

Query  2817  YIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDE  2638
             Y+++G++  G FSLSD+CR+GA EAI+ LK +GIK+ +LTGDS+AAA + Q+QL  A D 
Sbjct  425   YVYLGATPVGTFSLSDSCRSGALEAIKDLKSLGIKSFILTGDSHAAALYAQDQLDHAFDM  484

Query  2637  FHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVI  2458
              +AELLP+ KA++++  +K G T M+GDG+NDAPALA AD+GISMGISGS LA ETGHVI
Sbjct  485   VYAELLPQHKAELVELLKKDGTTAMVGDGINDAPALAAADIGISMGISGSALAVETGHVI  544

Query  2457  LMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCL  2278
             LM+NDI +I KAI+L R+   K+I N+ +++  K A++ALAIAG+PLVWAAVL DVGTCL
Sbjct  545   LMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKGAVLALAIAGYPLVWAAVLTDVGTCL  604

Query  2277  VVIFNSTLLLRGGDRE  2230
             +VI NS LLL+    E
Sbjct  605   IVILNSMLLLKNNPEE  620



>emb|CDY69511.1| BnaAnng30640D [Brassica napus]
Length=716

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/541 (66%), Positives = 447/541 (83%), Gaps = 2/541 (0%)
 Frame = -1

Query  3861  LHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVD  3682
             + DY EAA +VFLFT  EWL+SRAS+KA A M SL+++  Q+AV+AETGE ++ +++K++
Sbjct  1     MRDYTEAAAVVFLFTIAEWLQSRASYKASAVMQSLMSLAPQKAVIAETGEEVEVDELKIN  60

Query  3681  TILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATINLNGYISIKTT  3502
             T++AVKAGE I IDG+VV+G CEVDEKTLTGE+F VPK +DSTVWA TINLNGYI++KTT
Sbjct  61    TVIAVKAGETISIDGVVVDGNCEVDEKTLTGEAFPVPKLRDSTVWAGTINLNGYITVKTT  120

Query  3501  AVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAI--SAVKVENRS  3328
             A+AEDC VA+MAKLVEEAQ++K+  QR ID+ +KYYTPAI+ IS C  +   A+KV N  
Sbjct  121   ALAEDCVVAKMAKLVEEAQNSKTETQRFIDECSKYYTPAIILISLCFVVIPFALKVHNMK  180

Query  3327  ERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKT  3148
                HLALVVLVSACPC L+LSTPVA FCAL++AA  GLL KGA+YLE LAK+K +AFDKT
Sbjct  181   HWLHLALVVLVSACPCGLILSTPVATFCALTKAATSGLLIKGADYLETLAKIKTVAFDKT  240

Query  3147  GTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKV  2968
             GTITRGEF V  F SL   I+ ++LL WVSS+ESKSSHPMA A++DYA+S SVEP PE V
Sbjct  241   GTITRGEFIVMDFKSLSRDISLHSLLYWVSSVESKSSHPMAAALVDYAKSISVEPKPEAV  300

Query  2967  EHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAG  2788
             E +QNFPGEGI+G+IDG E+YIGNK+I++RAGC+SVP+ DVD + GK++ Y+++G +LAG
Sbjct  301   EDYQNFPGEGIHGKIDGKEVYIGNKRIASRAGCSSVPDIDVDTKGGKTVGYVYLGETLAG  360

Query  2787  VFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEK  2608
             VF+LSDACR+G  +A+++LK MGIKT MLTGD+ A+A H QEQLG  +D  HAELLPE K
Sbjct  361   VFNLSDACRSGVAQAMKELKSMGIKTAMLTGDNQASAMHAQEQLGNVMDVVHAELLPEGK  420

Query  2607  AQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIG  2428
             +QIIK+F++ G T M+GDGLNDAPALATAD+GISMG+SGS LA ETGH+ILM+NDI RI 
Sbjct  421   SQIIKEFKREGPTAMVGDGLNDAPALATADIGISMGVSGSALATETGHIILMSNDIRRIP  480

Query  2427  KAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             +AI L RR  RKV+ N+V++I  K AI+ALA AGHPL+WAAVL DVGTCL+VI NS LLL
Sbjct  481   QAIRLARRGKRKVVENVVLSITMKGAILALAFAGHPLIWAAVLADVGTCLLVILNSMLLL  540

Query  2247  R  2245
             R
Sbjct  541   R  541



>ref|XP_008644205.1| PREDICTED: uncharacterized protein LOC100501494 isoform X1 [Zea 
mays]
 gb|AFW69331.1| hypothetical protein ZEAMMB73_904472 [Zea mays]
Length=1099

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/694 (59%), Positives = 526/694 (76%), Gaps = 10/694 (1%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             KSYFDV+GICCPSEVPL++K+L+ L GV  V+V+V ++TV+V+HD    +  QIV+ALN+
Sbjct  12    KSYFDVLGICCPSEVPLVEKLLRPLPGVRTVTVIVPSRTVIVLHDAAATSPAQIVKALNQ  71

Query  4122  ASLEASIKVNGETNDG-----PKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             A LEAS++  G  +DG      K  PSPY ++CG+LL++S  + ++ PLKW A+AAA AG
Sbjct  72    ARLEASVRAYGGGSDGRQAAGSKRWPSPYVLLCGLLLVVSLFERLWPPLKWCALAAAAAG  131

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
               P+  R+ AA R LTLD+NILM+I+V G+I L DY EA  IVFLFTT EWLE+RASHKA
Sbjct  132   LPPIALRSFAAARRLTLDVNILMLIAVSGAIALKDYSEAGFIVFLFTTAEWLETRASHKA  191

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
              A MSSL+++  Q+AV+AETGE++ A  VKV T+LAVKAGEV+PIDG+VV+G  EVDE T
Sbjct  192   TAGMSSLMSMAPQKAVVAETGEVVAAQDVKVGTVLAVKAGEVVPIDGVVVDGRSEVDEST  251

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             LTGESF V KQ +S VWA T+N++GYI+++TTA+A++ AVA+MA++VEEAQ+++SR QR 
Sbjct  252   LTGESFPVAKQPESQVWAGTLNIDGYIAVRTTAMADNSAVAKMARMVEEAQNSRSRTQRL  311

Query  3417  IDKIAKYYTP--AIVAISACLAISAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             ID  AKYYTP   ++A    +    V+  N    + LALV+LVSACPCALVLSTPVA FC
Sbjct  312   IDTCAKYYTPAVVVMAAGVAVVPVVVRAHNLKHWFQLALVLLVSACPCALVLSTPVATFC  371

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL  AA  GLL KG + LE LA++K+ AFDKTGTITRGEF+V  F ++ + +    LL W
Sbjct  372   ALLTAARTGLLIKGGDVLETLARIKIAAFDKTGTITRGEFSVEEFQAVGERVTTPQLLYW  431

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSSIES+SSHPMA  ++DYAQS SV P  + V  FQ FPGEGIYGEIDG  +YIGNK+I 
Sbjct  432   VSSIESRSSHPMASVLVDYAQSKSVGPKSDNVAEFQIFPGEGIYGEIDGEGVYIGNKRIL  491

Query  2883  ARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVM  2704
             +RA C +VP  D+   +G ++ Y+     L GVF+LSD+CRTG+ EAIR+L+ +GIK+VM
Sbjct  492   SRASCETVP--DMKDMKGVTVGYVACKGQLIGVFTLSDSCRTGSDEAIRELRSLGIKSVM  549

Query  2703  LTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALA  2527
             LTGDS AAA + Q QLG  LDE H+ELLPE+K +I+ + + K G T MIGDG+NDAPALA
Sbjct  550   LTGDSSAAASYAQNQLGNILDEVHSELLPEDKVRIVDELKAKHGPTLMIGDGMNDAPALA  609

Query  2526  TADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAI  2347
              ADVG+SMG+SGS +A ET H+ LM+NDI RI  A++L RR  R ++VNIV ++ TK AI
Sbjct  610   KADVGVSMGVSGSAVAMETSHITLMSNDIRRIPMAVQLARRTHRTIVVNIVFSVITKLAI  669

Query  2346  MALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             + LA+AGHPL+WAAVL DVGTC++VI  S LLLR
Sbjct  670   VGLALAGHPLIWAAVLADVGTCMLVIMYSMLLLR  703



>emb|CDX68625.1| BnaC01g08280D [Brassica napus]
Length=730

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/541 (66%), Positives = 446/541 (82%), Gaps = 2/541 (0%)
 Frame = -1

Query  3861  LHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVD  3682
             + DY EAA +VFLFT  EWL+SRAS++A A M SL+++  Q+AV+AETGE ++ +++K++
Sbjct  1     MRDYTEAAAVVFLFTIAEWLQSRASYRASAVMQSLMSLAPQKAVIAETGEEVEVDELKIN  60

Query  3681  TILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATINLNGYISIKTT  3502
             T++AVKAGE IPIDG+VV+G CEVDEKTLTGE+F VPK +DSTVWA TINLNGYI++KTT
Sbjct  61    TVIAVKAGETIPIDGVVVDGNCEVDEKTLTGEAFPVPKLRDSTVWAGTINLNGYITVKTT  120

Query  3501  AVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAI--SAVKVENRS  3328
             A+AEDC VA+MAKLVEE+Q++K+  QR ID+ +KYYTPAI+ IS C  +   A+KV N  
Sbjct  121   ALAEDCVVAKMAKLVEESQNSKTETQRFIDECSKYYTPAIILISLCFVVIPFALKVHNMK  180

Query  3327  ERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKT  3148
                HLALVVLVSACPC L+LSTPVA FCAL++AA  GLL K A+YLE LAK+K +AFDKT
Sbjct  181   HWLHLALVVLVSACPCGLILSTPVASFCALTKAATSGLLIKEADYLETLAKIKTVAFDKT  240

Query  3147  GTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKV  2968
             GTITRGEF V  F SL   I+ + LL WVSS+ESKSSHPMA A++DYA+S SVEP PE V
Sbjct  241   GTITRGEFIVMDFKSLSRDISLHRLLYWVSSVESKSSHPMAAALLDYAKSVSVEPKPESV  300

Query  2967  EHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAG  2788
             E +QNFPGEGI+G+IDG E+YIGNK+I++RAGC+SVP+ DVD + GK++ Y+++G +LAG
Sbjct  301   EDYQNFPGEGIFGKIDGKEVYIGNKRIASRAGCSSVPDIDVDTKGGKTVGYVYLGETLAG  360

Query  2787  VFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEK  2608
             VF+LSDACR+G  +A+++LK MGIKT MLTGD+ A+A H QEQLG  +D  HAELLPE K
Sbjct  361   VFNLSDACRSGVAQAMKELKSMGIKTAMLTGDNQASAMHAQEQLGNVMDVVHAELLPEGK  420

Query  2607  AQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIG  2428
             +QIIK+F++ G T M+GDGLNDAPALATAD+GISMG+SGS LA ETGH+ILM+NDI RI 
Sbjct  421   SQIIKEFKREGPTAMVGDGLNDAPALATADIGISMGVSGSALATETGHIILMSNDIRRIP  480

Query  2427  KAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             +AI L RR  RKV+ N+V++I  K AI+ALA AGHPL+WAAVL DVGTCL+VI NS LLL
Sbjct  481   QAIRLARRGKRKVVENVVLSITMKGAILALAFAGHPLIWAAVLADVGTCLLVILNSMLLL  540

Query  2247  R  2245
             R
Sbjct  541   R  541



>ref|XP_010438219.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like isoform 
X2 [Camelina sativa]
Length=794

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/541 (66%), Positives = 448/541 (83%), Gaps = 3/541 (1%)
 Frame = -1

Query  3861  LHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVD  3682
             + DY EAA +VFLFT  EWL+SRAS+KA A M SL+++  Q+AV+AETGE ++ +++K++
Sbjct  1     MRDYTEAAVVVFLFTIAEWLQSRASYKASAVMQSLMSLAPQKAVIAETGEEVEVDELKIN  60

Query  3681  TILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATINLNGYISIKTT  3502
             T++AVKAGE IPIDG+VV+G CEVDEKTLTGE+F VPK +DSTVWA T NLNGYI++KTT
Sbjct  61    TVIAVKAGETIPIDGVVVDGNCEVDEKTLTGEAFPVPKLRDSTVWAGTFNLNGYITVKTT  120

Query  3501  AVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAI--SAVKVENRS  3328
             A+AEDC VA+MAKLVEEAQ++K+  QR ID+ +KYYTPAI+ IS   A+   A+KV N  
Sbjct  121   ALAEDCVVAKMAKLVEEAQNSKTETQRFIDECSKYYTPAIMVISIFFAVIPLALKVHNPK  180

Query  3327  ERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKT  3148
               +HLALVVLVSACPC L+LSTPVA FCAL++AA  GLL KGA+YLE LAK+K++AFDKT
Sbjct  181   HWFHLALVVLVSACPCGLILSTPVATFCALTKAATSGLLIKGADYLETLAKIKIVAFDKT  240

Query  3147  GTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKV  2968
             GTITRGEF V  F SL   I+ N LL WVSS ESKSSHPMA A++DYA+S SVEP PE V
Sbjct  241   GTITRGEFIVMDFKSLSSDISLNNLLYWVSSAESKSSHPMAAALVDYAKSVSVEPKPEAV  300

Query  2967  EHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAG  2788
             E +QNFPGEGIYG+IDG ++YIGNK+I++RAGC+SVP+ DVD + GK++ Y++VG +LAG
Sbjct  301   EDYQNFPGEGIYGKIDGKQVYIGNKRIASRAGCSSVPDIDVDTKGGKTVGYVYVGETLAG  360

Query  2787  VFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEK  2608
             VF+LSDACR+G  +A+++LK +GIKT MLTGD+ AAA H QEQLG A+D   AELLPE K
Sbjct  361   VFNLSDACRSGVAQAMKELKSLGIKTAMLTGDNEAAAMHAQEQLGNAMDIVRAELLPEGK  420

Query  2607  AQIIKKFQK-GGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRI  2431
             ++IIK+F++  G TGM+GDGLNDAPALATAD+GISMG+SGS LA ETG++ILM+NDI RI
Sbjct  421   SEIIKEFKREEGPTGMVGDGLNDAPALATADIGISMGVSGSALATETGNIILMSNDIRRI  480

Query  2430  GKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLL  2251
              +AI+L RR  RKV+ N++++I  K AI+ALA AGHPL+WAAVL DVGTCL+VI NS LL
Sbjct  481   PQAIKLARRAKRKVVENVIISITMKVAILALAFAGHPLIWAAVLADVGTCLLVILNSMLL  540

Query  2250  L  2248
             L
Sbjct  541   L  541



>ref|XP_006850918.1| hypothetical protein AMTR_s00025p00176690 [Amborella trichopoda]
 gb|ERN12499.1| hypothetical protein AMTR_s00025p00176690 [Amborella trichopoda]
Length=1012

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/694 (55%), Positives = 516/694 (74%), Gaps = 11/694 (2%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KS+F+V+G+CCP+EVPLI++ILK L GVH+V V V +K+V+V+HDP+ ITQ QIV ALN
Sbjct  11    QKSHFNVLGLCCPAEVPLIERILKPLQGVHKVCVNVPSKSVMVLHDPISITQVQIVAALN  70

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A L+ASI+  GE  + PK  PS + +V G LL+LSF K+ + P+ WLA+ A   G  P+
Sbjct  71    SARLDASIREIGEAIN-PKKWPSRFTLVSGFLLILSFTKFWFEPMHWLALGAVAVGIPPI  129

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               ++   LR   LDIN L+II+V G+I L DY EA  IV LFT+ EW+ES  S+KA AAM
Sbjct  130   FMKSFVTLRRWILDINTLVIIAVAGTIALGDYIEAGFIVVLFTSAEWIESLTSYKAHAAM  189

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+++  Q+AVLA++G  +D   VK++T+LAVKAG++IPIDGIVVEG  EVDEKTLTGE
Sbjct  190   QSLMSMAPQKAVLAQSGATVDTKDVKLNTLLAVKAGDMIPIDGIVVEGRSEVDEKTLTGE  249

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
              + V K   S VWA T+NLNGY+SIKT A+AED AVARMAKLVEEAQ N S+ QR ++  
Sbjct  250   PYPVTKDPQSQVWAGTLNLNGYMSIKTVALAEDSAVARMAKLVEEAQQNTSKTQRIVEVF  309

Query  3405  AKYYTPAIVAISACLAISAVKVENRSERYH----LALVVLVSACPCALVLSTPVAMFCAL  3238
             AKYYTP I+ ++  LAI  + +  RSE +H    L+LVVL+ ACPCALVLSTP+ M CAL
Sbjct  310   AKYYTPVILVLAVGLAI--IPLSLRSENWHHYLYLSLVVLMCACPCALVLSTPIVMACAL  367

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLL---DGINHNTLLS  3067
             SR +++G+L KG +YLE LAK+K++AFDKTGTITRG+F+V+   SL    + +  + +L 
Sbjct  368   SRMSSIGVLVKGGDYLEKLAKIKIMAFDKTGTITRGKFSVSEMISLSKDEEDVGLDKMLY  427

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WV+S+ESKSSHPMA A++DY +S  +EP  EKV+ FQNFPGEGI G IDG  I+IGN+K+
Sbjct  428   WVTSLESKSSHPMAAALVDYCRSKGIEPATEKVKDFQNFPGEGISGIIDGKCIFIGNQKM  487

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             S+RAGC SVP+   + + G ++ Y+ +G  + G F+LSD  R GA   IR+LK MGIK  
Sbjct  488   SSRAGCKSVPDITSEHKGGGTVGYVLIGEKVVGYFTLSDDVRFGALGVIRELKNMGIKVA  547

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPAL  2530
             MLTGD+ AAA  V  +L  A+   HAELLP+EKA++I   +K  G+  MIGDG+NDAPAL
Sbjct  548   MLTGDTNAAALRVNNKLEKAIGIMHAELLPDEKAKLIVDLKKSEGQIAMIGDGINDAPAL  607

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             A++DVGI+MG +GS +A ET H+ LM++D+ R+   +++ R+  +K++ N+ +++ TK  
Sbjct  608   ASSDVGIAMGATGSAIASETSHITLMSDDLKRLPDIVKISRKTCQKIMENVFLSMITKLG  667

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             ++ALA++GHPL+WAA+L DVGTCLVVIFNSTLLL
Sbjct  668   VVALALSGHPLIWAAMLADVGTCLVVIFNSTLLL  701



>emb|CDY69827.1| BnaAnng31630D, partial [Brassica napus]
Length=630

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/545 (65%), Positives = 442/545 (81%), Gaps = 2/545 (0%)
 Frame = -1

Query  3861  LHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVD  3682
             + D+ EAA +VFLFT  EWLE+RAS+KA A M SL+++  Q+A++AETGE ++ + VKV+
Sbjct  1     MQDFMEAAAVVFLFTIAEWLETRASYKANAVMQSLMSLAPQKAIIAETGEEVEVDDVKVN  60

Query  3681  TILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATINLNGYISIKTT  3502
             TI+AVKAGE IPIDG VV+G CEVDEKTLTGE+F VPKQKDSTVWA TINLNGYIS+KT 
Sbjct  61    TIVAVKAGETIPIDGTVVDGNCEVDEKTLTGEAFPVPKQKDSTVWAGTINLNGYISVKTI  120

Query  3501  AVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAI--SAVKVENRS  3328
             A+A DC V +MAKLVEEAQS+K+++QR IDK ++YYTPAI+ IS C+A   + +KV N +
Sbjct  121   ALASDCVVTKMAKLVEEAQSSKTKSQRLIDKCSQYYTPAIIFISGCIAAVPAIMKVHNLN  180

Query  3327  ERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKT  3148
               +HLALVVLVSACPC L+LSTPVA FCAL++AA  GLL K A+YL+ L+K+K+ AFDKT
Sbjct  181   HWFHLALVVLVSACPCGLILSTPVATFCALTKAATSGLLIKSADYLDTLSKIKITAFDKT  240

Query  3147  GTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKV  2968
             GTITRGEF V  F SL   I+  TLL WVSS+ESKSSHPMA  I+DYA+S  VEP  E+V
Sbjct  241   GTITRGEFIVVDFKSLHRDISLRTLLYWVSSVESKSSHPMAATIVDYAKSVDVEPRTEEV  300

Query  2967  EHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAG  2788
             E +Q FPGEGIYG+IDG +IYIGNK+I++RA C++VPE +VD + GK++ YI+VG  LAG
Sbjct  301   EDYQLFPGEGIYGKIDGNDIYIGNKRIASRAKCSTVPEIEVDTKGGKTIGYIYVGERLAG  360

Query  2787  VFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEK  2608
             VF+LSDACR+G  +A+++LK +GIKT MLTGD+  AA H QEQLG ALD  H ELLPE+K
Sbjct  361   VFNLSDACRSGVIQAMKELKDLGIKTAMLTGDNQDAAMHAQEQLGNALDVVHGELLPEDK  420

Query  2607  AQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIG  2428
             ++II++F+K G T M+GDG+NDAPALATAD+GISMGISGS LA +TG +ILM+NDI RI 
Sbjct  421   SRIIQEFKKEGPTAMVGDGVNDAPALATADIGISMGISGSALATQTGDIILMSNDIRRIP  480

Query  2427  KAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             +AI++ RR  RKV+ N+ ++I  K  I+ LAI GHPL+WAAVLVDVGTCL+VI NS LLL
Sbjct  481   QAIKIARRARRKVVQNVFISIIFKVGILILAICGHPLIWAAVLVDVGTCLLVILNSMLLL  540

Query  2247  RGGDR  2233
             R  D+
Sbjct  541   REKDK  545



>pir||T00532 probable cadmium-transporting ATPase (EC 3.6.1.-) - Arabidopsis 
thaliana
Length=1001

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/541 (65%), Positives = 449/541 (83%), Gaps = 2/541 (0%)
 Frame = -1

Query  3861  LHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVD  3682
             + D+ EAA +VFLFT  +WLE+RAS+KA + M SL+++  Q+A++AETGE ++ ++VKVD
Sbjct  1     MQDFMEAAAVVFLFTISDWLETRASYKATSVMQSLMSLAPQKAIIAETGEEVEVDEVKVD  60

Query  3681  TILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATINLNGYISIKTT  3502
             T++AVKAGE IPIDGIVV+G CEVDEKTLTGE+F VPKQ+DSTVWA TINLNGYI +KTT
Sbjct  61    TVVAVKAGETIPIDGIVVDGNCEVDEKTLTGEAFPVPKQRDSTVWAGTINLNGYICVKTT  120

Query  3501  AVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAISAV--KVENRS  3328
             ++A DC VA+MAKLVEEAQS+K+++QR IDK ++YYTPAI+ +SAC+AI  V  KV N  
Sbjct  121   SLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKCSQYYTPAIILVSACVAIVPVIMKVHNLK  180

Query  3327  ERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKT  3148
               +HLALVVLVS CPC L+LSTPVA FCAL++AA  GLL K A+YL+ L+K+K++AFDKT
Sbjct  181   HWFHLALVVLVSGCPCGLILSTPVATFCALTKAATSGLLIKSADYLDTLSKIKIVAFDKT  240

Query  3147  GTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKV  2968
             GTITRGEF V  F SL   IN  +LL WVSS+ESKSSHPMA  I+DYA+S SVEP PE+V
Sbjct  241   GTITRGEFIVIDFKSLSRDINLRSLLYWVSSVESKSSHPMAATIVDYAKSVSVEPRPEEV  300

Query  2967  EHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAG  2788
             E +QNFPGEGIYG+IDG +I+IGNKKI++RAGC++VPE +VD + GK++ Y++VG  LAG
Sbjct  301   EDYQNFPGEGIYGKIDGNDIFIGNKKIASRAGCSTVPEIEVDTKGGKTVGYVYVGERLAG  360

Query  2787  VFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEK  2608
              F+LSDACR+G  +A+ +LK +GIKT MLTGD+ AAA H QEQLG  LD  H +LLPE+K
Sbjct  361   FFNLSDACRSGVSQAMAELKSLGIKTAMLTGDNQAAAMHAQEQLGNVLDVVHGDLLPEDK  420

Query  2607  AQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIG  2428
             ++II++F+K G T M+GDG+NDAPALATAD+GISMGISGS LA +TG++ILM+NDI RI 
Sbjct  421   SRIIQEFKKEGPTAMVGDGVNDAPALATADIGISMGISGSALATQTGNIILMSNDIRRIP  480

Query  2427  KAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             +A++L RR  RKV+ N+ ++I  KA I+ALA AGHPL+WAAVLVDVGTCL+VIFNS LLL
Sbjct  481   QAVKLARRARRKVVENVCLSIILKAGILALAFAGHPLIWAAVLVDVGTCLLVIFNSMLLL  540

Query  2247  R  2245
             R
Sbjct  541   R  541



>ref|XP_010415068.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4 [Camelina 
sativa]
Length=1151

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/547 (65%), Positives = 451/547 (82%), Gaps = 2/547 (0%)
 Frame = -1

Query  3879  VVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGEILDA  3700
             ++ ++ + D+ EAA +VFLFT  +WLE+RAS+KA + M SL+++  Q+A++AETGE ++ 
Sbjct  1     MIATLAMQDFMEAAAVVFLFTIADWLETRASYKASSVMQSLMSLAPQKAIIAETGEEVEV  60

Query  3699  NQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATINLNGY  3520
             ++VKV T++AVKAGE IPIDGIVV+G CEVDEKTLTGE+F VPKQ+DS VWA TINLNGY
Sbjct  61    DEVKVSTVVAVKAGETIPIDGIVVDGNCEVDEKTLTGEAFPVPKQRDSMVWAGTINLNGY  120

Query  3519  ISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAISAV--  3346
             +++KTT++A DC VA+MAKLVEEAQS+K+++QR IDK ++YYTPAI+ ISAC AI  +  
Sbjct  121   VTVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKCSQYYTPAIIIISACFAIVPIIM  180

Query  3345  KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKV  3166
             KV N +  +HLALVVLVSACPC L+LSTPVA FCAL++AA  GLL K A+YL+ L+K+K+
Sbjct  181   KVHNLTHWFHLALVVLVSACPCGLILSTPVATFCALTKAATSGLLIKSADYLDTLSKIKI  240

Query  3165  IAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVE  2986
              AFDKTGTITRGEF V  F SL   I   +LL WVSS+ESKSSHPMA  I+D+A+S SVE
Sbjct  241   AAFDKTGTITRGEFIVIDFKSLSRDITLRSLLYWVSSVESKSSHPMAATIVDHAKSVSVE  300

Query  2985  PNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFV  2806
             P PE+VE +QNFPGEGIYG+IDG +IYIGNK+I++RAGC++VPE +VD + GK++ Y++V
Sbjct  301   PRPEEVEDYQNFPGEGIYGKIDGNDIYIGNKRIASRAGCSTVPEIEVDTKGGKTVGYVYV  360

Query  2805  GSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAE  2626
             G  LAGVFSLSDACR+G  +A+ +LK MGIKT MLTGDS A+A H QEQLG  LD  H E
Sbjct  361   GERLAGVFSLSDACRSGVSQAMTELKSMGIKTAMLTGDSQASAMHAQEQLGNVLDVVHGE  420

Query  2625  LLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTN  2446
             LLPE+K++II++F+K G T M+GDG+NDAPALATAD+GISMGISGS LA +TGH+ILM+N
Sbjct  421   LLPEDKSKIIQEFKKEGPTAMVGDGVNDAPALATADIGISMGISGSALATQTGHIILMSN  480

Query  2445  DIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIF  2266
             DI RI +AI+L RR  RKV+ N+ ++I  KA I+A A AGHPL+WAAVLVDVGTCL+VIF
Sbjct  481   DIRRIPQAIKLARRARRKVVQNVFLSITFKAGILAFAFAGHPLIWAAVLVDVGTCLLVIF  540

Query  2265  NSTLLLR  2245
             NS LLLR
Sbjct  541   NSMLLLR  547



>ref|XP_008382648.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like isoform 
X2 [Malus domestica]
Length=955

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/585 (64%), Positives = 464/585 (79%), Gaps = 11/585 (2%)
 Frame = -1

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
             S  V  R V  + ++ L I+ L I  VVG+I L DY EAA+IVFLF   EWL+S A ++A
Sbjct  48    SVIVPSRTVIVVHDILL-ISQLQI--VVGTIALKDYTEAASIVFLFIIAEWLQSCAGYRA  104

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
              A MSSL+++  Q+AVLAE+GE++D ++VK+ TILAVKAGEVIPIDGIVVEG+ EVDE+T
Sbjct  105   KAVMSSLMSMAPQKAVLAESGEVVDVDEVKLYTILAVKAGEVIPIDGIVVEGKGEVDEQT  164

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             LTGES+ V K+KDSTVWA TINLNGYIS+KTTA+AEDCAVA+MAKLVEEAQS+K+R QR 
Sbjct  165   LTGESYPVAKEKDSTVWAGTINLNGYISVKTTALAEDCAVAKMAKLVEEAQSSKTRTQRF  224

Query  3417  IDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             IDK A +YTPA++ IS  +A+  +A+ V N S+ +HLALVVLVSACPC L+LSTP+  FC
Sbjct  225   IDKCAMFYTPAVLVISVSIAVIPAALHVHNWSKWFHLALVVLVSACPCGLILSTPIVTFC  284

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
              L++AA  GLL KG +Y+EILAKVK++AFDKTGTITRGEF V  F SL D I+ NTLL W
Sbjct  285   TLTKAATSGLLIKGGDYIEILAKVKIMAFDKTGTITRGEFVVMDFQSLRDDISLNTLLYW  344

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             V+SIE KSSHPMA A++DY +S S+EP PE VE FQNFPGEGI+G+IDG +IYIGN+KI+
Sbjct  345   VASIERKSSHPMADALVDYGRSLSIEPKPENVEEFQNFPGEGIHGKIDGQDIYIGNRKIA  404

Query  2883  ARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVM  2704
              RA C  VP  +     GK++ YI+   + AGVF++SDACR+GA EAIR+LK +GIKT M
Sbjct  405   LRAACEIVPTTE-GSNGGKTIGYIYSRGTPAGVFTISDACRSGAAEAIRELKKLGIKTAM  463

Query  2703  LTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALAT  2524
             LTGDS AAA H  EQL  AL+  HAELLPE+KA+I+K+F+  G T M+GDG+NDAPALAT
Sbjct  464   LTGDSNAAALHTNEQLKQALEVVHAELLPEDKARIVKEFKTEGNTAMVGDGINDAPALAT  523

Query  2523  ADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIM  2344
             AD+GISMGISGS LAQETG++IL++NDI ++ KA++L RR  RKV+ N+V++I TK  I+
Sbjct  524   ADIGISMGISGSALAQETGNIILLSNDIRKLPKAVQLARRANRKVVENVVLSITTKVGIL  583

Query  2343  ALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR-----GGDREAP  2224
             AL  AGHPLVWAAVL DVGTC++VIFNS LLL+     GG+  AP
Sbjct  584   ALGFAGHPLVWAAVLADVGTCMLVIFNSMLLLQGTQKHGGNTSAP  628


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIV  4138
             +KSYFDV+G+CC SEVPLI+ ILK L+GV EVSV+V ++TV+VVHD LLI+Q QIV
Sbjct  16    QKSYFDVLGLCCSSEVPLIENILKPLEGVKEVSVIVPSRTVIVVHDILLISQLQIV  71



>gb|KEH37413.1| heavy metal ATPase transporter [Medicago truncatula]
Length=739

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/609 (59%), Positives = 463/609 (76%), Gaps = 19/609 (3%)
 Frame = -1

Query  4041  CGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLRRAVAALRNLTLDINILMIISVVGSIV  3862
             CG+LL LSFLKY+Y PL WLA+ +   G   VL RA+A++R LTL+INIL++++V G+  
Sbjct  3     CGLLLALSFLKYIYPPLGWLALGSVAIGFPKVLFRAIASIRALTLNINILVLLAVCGTAA  62

Query  3861  LHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVD  3682
             L D+ +   I+FLF+  +WLE+RA+HKA+ AMSSL N+  Q A++AETGE +D N VK++
Sbjct  63    LQDFTDGGVIIFLFSIAQWLETRATHKALVAMSSLTNMAPQMAIVAETGERVDVNDVKMN  122

Query  3681  TILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATINLNGYISIKTT  3502
             TILAVKAG+ IP+DGIVVEG+CEVDEK LTGESF V K+ DS VWA TIN+NGYIS++TT
Sbjct  123   TILAVKAGDAIPLDGIVVEGKCEVDEKMLTGESFPVTKESDSLVWAGTINMNGYISVRTT  182

Query  3501  AVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAI--SAVKVENRS  3328
              +A+D  VARM++LVEEA S KS AQR ID  AKYY P +V ISA +A+  +A+ V +  
Sbjct  183   VLAKDTVVARMSRLVEEASSRKSLAQRFIDNFAKYYIPVVVLISASIAVVPAALSVPDME  242

Query  3327  ERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKT  3148
               +HLALVVL+S CPCAL+LSTPVA+FCAL++AA  GLL KG +YLE L+++K +AFDKT
Sbjct  243   PWFHLALVVLLSGCPCALILSTPVAIFCALTKAAISGLLLKGGDYLETLSRIKTVAFDKT  302

Query  3147  GTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKV  2968
             GTITRGEF+V  FS+  D IN+ TLL W+SSIESKSSHP+A A++DYA+ HS++P PE V
Sbjct  303   GTITRGEFSVTDFSA-GDDINNETLLYWISSIESKSSHPVAGALVDYARLHSIKPVPENV  361

Query  2967  EHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT--------SVPEFDVDGREGKSMSYI  2812
             E+FQNFPGEGI+G IDG +IYIGNK++  RA C           PE        +     
Sbjct  362   ENFQNFPGEGIFGTIDGRDIYIGNKRVGVRAICKRDNCEVQFQRPEISTKKNNCE-----  416

Query  2811  FVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFH  2632
                 +L GVFSL DACR+GA EA+ +LK++G+++VMLTGDS   A +VQ QL  A+D  H
Sbjct  417   ---ETLVGVFSLVDACRSGALEAMEELKLLGVRSVMLTGDSSQVAMYVQSQLKNAIDIVH  473

Query  2631  AELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILM  2452
             AELLP EKA++I+ F+K G   MIGDG+NDAPALATAD+GISMGISGS LA ET + ILM
Sbjct  474   AELLPHEKAKLIENFKKEGPIAMIGDGINDAPALATADIGISMGISGSALANETSNAILM  533

Query  2451  TNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVV  2272
             +NDI ++ +AI L R+  RK++ N+++++  K AI+ALAIAG+PLVW AVL DVGTCL+V
Sbjct  534   SNDIRKVPEAIRLARKTTRKLVENVIISVGFKCAILALAIAGYPLVWLAVLTDVGTCLLV  593

Query  2271  IFNSTLLLR  2245
             I NS L+L+
Sbjct  594   ILNSMLILQ  602



>ref|XP_010415060.1| PREDICTED: putative cadmium/zinc-transporting ATPase HMA4 isoform 
X2 [Camelina sativa]
Length=1145

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/541 (66%), Positives = 447/541 (83%), Gaps = 2/541 (0%)
 Frame = -1

Query  3861  LHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVD  3682
             + D+ EAA +VFLFT  +WLE+RAS+KA + M SL+++  Q+A++AETGE ++ ++VKV 
Sbjct  1     MQDFMEAAAVVFLFTIADWLETRASYKASSVMQSLMSLAPQKAIIAETGEEVEVDEVKVS  60

Query  3681  TILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATINLNGYISIKTT  3502
             T++AVKAGE IPIDGIVV+G CEVDEKTLTGE+F VPKQ+DS VWA TINLNGY+++KTT
Sbjct  61    TVVAVKAGETIPIDGIVVDGNCEVDEKTLTGEAFPVPKQRDSMVWAGTINLNGYVTVKTT  120

Query  3501  AVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAISAV--KVENRS  3328
             ++A DC VA+MAKLVEEAQS+K+++QR IDK ++YYTPAI+ ISAC AI  +  KV N +
Sbjct  121   SLAGDCVVAKMAKLVEEAQSSKTKSQRLIDKCSQYYTPAIIIISACFAIVPIIMKVHNLT  180

Query  3327  ERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKT  3148
               +HLALVVLVSACPC L+LSTPVA FCAL++AA  GLL K A+YL+ L+K+K+ AFDKT
Sbjct  181   HWFHLALVVLVSACPCGLILSTPVATFCALTKAATSGLLIKSADYLDTLSKIKIAAFDKT  240

Query  3147  GTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKV  2968
             GTITRGEF V  F SL   I   +LL WVSS+ESKSSHPMA  I+D+A+S SVEP PE+V
Sbjct  241   GTITRGEFIVIDFKSLSRDITLRSLLYWVSSVESKSSHPMAATIVDHAKSVSVEPRPEEV  300

Query  2967  EHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAG  2788
             E +QNFPGEGIYG+IDG +IYIGNK+I++RAGC++VPE +VD + GK++ Y++VG  LAG
Sbjct  301   EDYQNFPGEGIYGKIDGNDIYIGNKRIASRAGCSTVPEIEVDTKGGKTVGYVYVGERLAG  360

Query  2787  VFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEK  2608
             VFSLSDACR+G  +A+ +LK MGIKT MLTGDS A+A H QEQLG  LD  H ELLPE+K
Sbjct  361   VFSLSDACRSGVSQAMTELKSMGIKTAMLTGDSQASAMHAQEQLGNVLDVVHGELLPEDK  420

Query  2607  AQIIKKFQKGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIG  2428
             ++II++F+K G T M+GDG+NDAPALATAD+GISMGISGS LA +TGH+ILM+NDI RI 
Sbjct  421   SKIIQEFKKEGPTAMVGDGVNDAPALATADIGISMGISGSALATQTGHIILMSNDIRRIP  480

Query  2427  KAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             +AI+L RR  RKV+ N+ ++I  KA I+A A AGHPL+WAAVLVDVGTCL+VIFNS LLL
Sbjct  481   QAIKLARRARRKVVQNVFLSITFKAGILAFAFAGHPLIWAAVLVDVGTCLLVIFNSMLLL  540

Query  2247  R  2245
             R
Sbjct  541   R  541



>gb|AIA57681.1| heavy metal transporting P1B-ATPase 3 [Triticum aestivum]
Length=829

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/698 (56%), Positives = 521/698 (75%), Gaps = 9/698 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++L  LDGV  VSV+V ++TVVV HDP  ++Q +IV+ LN
Sbjct  27    EKTYLDVLGVCCSAEVALVERLLAPLDGVRAVSVVVPSRTVVVEHDPAAVSQSRIVKVLN  86

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS++  G +    +  PSPY V CG+LLL S  +++  PL+WLA+AAA AG+ P+
Sbjct  87    GAGLEASVRAYGSSGVIGRW-PSPYIVACGVLLLASSFRWLLPPLQWLALAAACAGAPPM  145

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L R +AA   LTLDINILM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  146   LLRGIAAASRLTLDINILMLIAVAGAVALKDYTEAGVIVFLFTTAEWLETLACTKASAGM  205

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL++++  +AVLAETGE+++   + V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  206   SSLMSMIPPKAVLAETGEVVNVRDIGVGAVIAVRAGEMVPVDGMVVDGQSEVDERSLTGE  265

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ VPKQ  S VWA T+NL+GYI+++T A+AE+  VA+M +LVEEAQ +KSR QR ID  
Sbjct  266   SYPVPKQPHSEVWAGTLNLDGYIAVRTMALAENSTVAKMERLVEEAQQSKSRTQRLIDSC  325

Query  3405  AKYYTPAIVAISACLAISAVKVENR-SER-YHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V + A +A+    +  R +ER + LALV+LVSACPCALVLSTPVA FCAL  
Sbjct  326   AKYYTPAVVVLGAGVALLPPLLGARDAERWFRLALVLLVSACPCALVLSTPVATFCALLT  385

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +G+L KG + LE L ++K +AFDKTGTITRGEFTV  F  +   +  + LL W+SSI
Sbjct  386   AARMGVLVKGGDVLESLGEIKAVAFDKTGTITRGEFTVDMFDVVGHKVQMSHLLYWISSI  445

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR-A  2875
             ESKSSHPMA A++++AQS S+EP PE V  F+  PGEGIYGEIDGM IY+GNK++ AR +
Sbjct  446   ESKSSHPMAAALVEHAQSKSIEPKPECVAEFRVLPGEGIYGEIDGMRIYVGNKRVLARGS  505

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VPE  ++G +G SM Y+     L GVFSLSD CRTGA EAIR+L  MGI +V+LTG
Sbjct  506   SCQTVPE-RMNGLKGVSMGYVICDGDLVGVFSLSDDCRTGAAEAIRELASMGISSVLLTG  564

Query  2694  DSYAAARHVQEQLGGA-LDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             D   AA H QEQLGGA L+E H+EL PE+K +++   + + G T M+GDG+NDAPALATA
Sbjct  565   DIAEAAMHAQEQLGGALLEEVHSELFPEDKVRLVGALKARAGPTMMVGDGMNDAPALATA  624

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMGISGS  A ET H  LM++DI R+ +A+ LGRR  R + VN+  ++  KAA++A
Sbjct  625   DVGVSMGISGSAAAMETSHATLMSSDILRVPEAVRLGRRARRTIAVNMASSVAAKAAVLA  684

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL--RGGDR  2233
             LA+A  P++WAAVL DVGTCL+V+ NS LLL  R G R
Sbjct  685   LAVAWRPVLWAAVLADVGTCLLVVLNSMLLLGERRGRR  722



>emb|CAB43847.1| cadmium-transporting ATPase-like protein [Arabidopsis thaliana]
Length=689

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/695 (54%), Positives = 485/695 (70%), Gaps = 73/695 (11%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ +DGV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSIVGNVLRQVDGVKEFSVIVPSRTVIVVHDTFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+LL+LSF KY Y+PL+WLA+ A VAG FP+
Sbjct  73    QARLEASVRPYGETSLKSQW-PSPFAIVSGVLLVLSFFKYFYSPLEWLAIVAVVAGVFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + D+ EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATLCMQDFTEAATIVFLFSVADWLESSAAHKASIVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+A+TG  +D ++V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIADTGLEVDVDEVGINTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ++STV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKQRESTVMAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V  +AC A+  V  KV++ S  +HLALVVL                      
Sbjct  312   SRYYTPAVVVSAACFAVIPVLLKVQDLSHWFHLALVVL----------------------  349

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K++AFDKTGTIT+ EF V+ F SL   IN + LL WVSSI
Sbjct  350   AATSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSPSINLHKLLYWVSSI  409

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E KSSHPMA A+IDYA+S SVEP P+ VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  410   ECKSSHPMAAALIDYARSVSVEPKPDIVENFQNFPGEGVYGRIDGQDIYIGNKRIAQRAG  469

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +                                               GI+T MLTGD
Sbjct  470   CLT-----------------------------------------------GIQTAMLTGD  482

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVG  2512
             +  AA   QEQL  ALD  H+ELLP++KA+II  F+  G T M+GDGLNDAPALA AD+G
Sbjct  483   NQDAAMSTQEQLENALDIVHSELLPQDKARIIDDFKIQGPTMMVGDGLNDAPALAKADIG  542

Query  2511  ISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAI  2332
             ISMGISGS LA ETG +ILM+NDI +I K + L +R  +KVI N+V+++  K AIM L  
Sbjct  543   ISMGISGSALATETGDIILMSNDIRKIPKGMRLAKRSHKKVIENVVLSVSIKGAIMVLGF  602

Query  2331  AGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
              G+PLVWAAVL D GTCL+VI NS +LLR  +REA
Sbjct  603   VGYPLVWAAVLADAGTCLLVILNSMMLLR-DEREA  636



>gb|AIA57678.1| heavy metal transporting P1B-ATPase 3 [Triticum turgidum subsp. 
durum]
 gb|AIA57679.1| heavy metal transporting P1B-ATPase 3 [Triticum turgidum subsp. 
durum]
Length=829

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/698 (56%), Positives = 521/698 (75%), Gaps = 9/698 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++L  LDGV  VSV+V ++TVVV HDP  ++Q +IV+ LN
Sbjct  27    EKTYLDVLGVCCSAEVALVERLLAPLDGVRAVSVVVPSRTVVVEHDPAAVSQSRIVKVLN  86

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS++  G +    +  PSPY V CG+LLL S  +++  PL+WLA+AAA AG+ P+
Sbjct  87    GAGLEASVRAYGSSGVIGRW-PSPYIVACGVLLLASSFRWLLPPLQWLALAAACAGAPPM  145

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L R +AA   LTLDINILM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  146   LLRGIAAASRLTLDINILMLIAVAGAVALKDYTEAGVIVFLFTTAEWLETLACTKASAGM  205

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL++++  +AVLAETG++++   + V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  206   SSLMSMIPPKAVLAETGDVVNVRDIGVGAVIAVRAGEMVPVDGMVVDGQSEVDERSLTGE  265

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ VPKQ  S VWA T+NL+GYI+++T A+AE+  VA+M +LVEEAQ +KSR QR ID  
Sbjct  266   SYPVPKQPHSEVWAGTLNLDGYIAVRTMALAENSTVAKMERLVEEAQQSKSRTQRLIDSC  325

Query  3405  AKYYTPAIVAISACLAISAVKVENR-SER-YHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V + A +A+    +  R +ER + LALV+LVSACPCALVLSTPVA FCAL  
Sbjct  326   AKYYTPAVVVLGAGVALLPPLLGARDAERWFRLALVLLVSACPCALVLSTPVATFCALLT  385

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +G+L KG + LE L ++K +AFDKTGTITRGEFTV  F  +   +  + LL W+SSI
Sbjct  386   AARMGVLVKGGDVLESLGEIKAVAFDKTGTITRGEFTVDMFDVVGHKVQMSHLLYWISSI  445

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR-A  2875
             ESKSSHPMA A++++A+S S+EP PE V  F+  PGEGIYGEIDGM IY+GNK++ AR +
Sbjct  446   ESKSSHPMAAALVEHARSKSIEPKPECVAEFRVLPGEGIYGEIDGMRIYVGNKRVLARGS  505

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VPE  ++G +G SM Y+     L GVFSLSD CRTGA EAIR+L  MGI +V+LTG
Sbjct  506   SCQTVPE-RMNGLKGVSMGYVICDGDLVGVFSLSDDCRTGAAEAIRELASMGISSVLLTG  564

Query  2694  DSYAAARHVQEQLGGA-LDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             D   AA H QEQLGGA L+E H+EL PE+K +++   + + G T M+GDG+NDAPALATA
Sbjct  565   DIAEAAMHAQEQLGGALLEEVHSELFPEDKVRLVGALKARAGPTMMVGDGMNDAPALATA  624

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMGISGS  A ET H  LM++DI R+ +A+ LGRR  R + VN+  ++  KAA++A
Sbjct  625   DVGVSMGISGSAAAMETSHATLMSSDILRVPEAVRLGRRARRTIAVNMASSVAAKAAVLA  684

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL--RGGDR  2233
             LA+A  P++WAAVL DVGTCL+V+ NS LLL  R G R
Sbjct  685   LAVAWRPVLWAAVLADVGTCLLVVLNSMLLLGERRGRR  722



>gb|AIA57682.1| heavy metal transporting P1B-ATPase 3 [Triticum aestivum]
Length=853

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/702 (56%), Positives = 520/702 (74%), Gaps = 11/702 (2%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++L  LDGV  VSV+V ++TVVV HDP  ++Q +IV+ LN
Sbjct  27    EKTYLDVLGVCCSAEVALVERLLAPLDGVRAVSVVVPSRTVVVEHDPAAVSQSRIVKVLN  86

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS++  G +    +  PSPY V CG LLL S  +++  PL+WLA+ AA AG+ P+
Sbjct  87    GAGLEASVRAYGSSGVIGRW-PSPYIVACGALLLASSFRWLLPPLQWLALGAACAGAPPM  145

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L R +AA   LTLDINILM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  146   LLRGLAAASRLTLDINILMLIAVAGAVALKDYAEAGVIVFLFTTAEWLETLACTKASAGM  205

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL++++  +AVLAETGE+++   + V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  206   SSLMSMIPPKAVLAETGEVVNVRDIGVGAVIAVRAGEMVPVDGVVVDGQSEVDERSLTGE  265

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ VPKQ  S VWA T+NL+GYI+++T A+AE+  VA+M +LVEEAQ +KS+ QR ID  
Sbjct  266   SYPVPKQPQSEVWAGTLNLDGYIAVRTMALAENSTVAKMERLVEEAQQSKSKTQRLIDSC  325

Query  3405  AKYYTPAIVAISACLAISAVKVENR-SER-YHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTPA+V + A +A+    +  R +ER + LALV+LVSACPCALVLSTPVA FCAL  
Sbjct  326   ARYYTPAVVVLGAGVALLPPLLGARDAERWFRLALVLLVSACPCALVLSTPVATFCALLT  385

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +G+L KG + LE L +++ +AFDKTGTITRGEF+V  F  +   +  + LL W+SSI
Sbjct  386   AARMGVLVKGGDVLESLGEIRAVAFDKTGTITRGEFSVDMFDVVGHKVQMSYLLYWISSI  445

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR-A  2875
             ESKSSHPMA A+++YAQS S+EP PE V  F+  PGEGIYGEIDG  IY+GNK++ AR +
Sbjct  446   ESKSSHPMAAALVEYAQSKSIEPKPECVAQFRILPGEGIYGEIDGKRIYVGNKRVLARGS  505

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VPE  ++G +G S+ Y+     L GVFS SD CRTGA EAIR+L  MGI +V+LTG
Sbjct  506   SCQTVPE-RMNGLKGVSIGYVICDGDLVGVFSFSDDCRTGAAEAIRELASMGISSVLLTG  564

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS  AA H Q+QLGGAL+E H+EL PE+K +++   + + G T M+GDG+NDAPALATAD
Sbjct  565   DSAEAAVHAQQQLGGALEELHSELFPEDKVRLVGALKARAGPTMMVGDGMNDAPALATAD  624

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMGISGS  A ET H  LM++DI R+ +A+ LGRR  R + VN+V +I  KAA++AL
Sbjct  625   VGVSMGISGSAAAMETSHATLMSSDILRVPEAVRLGRRARRTIAVNMVSSIAAKAAVLAL  684

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLL-----RGGDREA  2227
             A+A  P++WAAVL DVGTCL+V+ NS LLL     R G  EA
Sbjct  685   AVAWRPVLWAAVLADVGTCLLVVLNSMLLLGEGRGRRGKEEA  726



>ref|XP_008451420.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like isoform 
X3 [Cucumis melo]
Length=592

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/561 (61%), Positives = 444/561 (79%), Gaps = 8/561 (1%)
 Frame = -1

Query  4317  NNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIV  4138
             N   E+S+FDV+GICC SE+PLI+ ILK L+G+ +++V+V T+T++VVHD LLI+Q QIV
Sbjct  18    NKKFERSHFDVLGICCSSEIPLIENILKPLEGIKQITVIVPTRTLIVVHDSLLISQLQIV  77

Query  4137  RALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             +ALN+A LEA+I++ G+     K  PSPYA+  G+LL  SFLKYVY PL+WLAVAA  AG
Sbjct  78    KALNEARLEANIQLKGK-GIMKKKWPSPYAIASGLLLTASFLKYVYHPLRWLAVAAVAAG  136

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
              FP+L +A++A+R+L +D+NIL II+VVG+I + DY EA +IVFLF+  EWLESRAS KA
Sbjct  137   IFPILLKAISAIRHLRIDVNILAIIAVVGTIAMEDYMEAGSIVFLFSIAEWLESRASQKA  196

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
               AMSSL+ +  Q+A +AE+GE++D   VK+ ++L+VKAGEVIPIDGIVVEG CEVDEKT
Sbjct  197   NGAMSSLMRLAPQKATIAESGEVVDVRDVKLKSVLSVKAGEVIPIDGIVVEGNCEVDEKT  256

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             L+GE+F V KQKDS VWA TINLNGY+S++TT VAEDC VA+MA+LVEEAQ NKS+ Q  
Sbjct  257   LSGETFPVTKQKDSLVWAGTINLNGYVSVQTTVVAEDCVVAKMAELVEEAQKNKSKTQTF  316

Query  3417  IDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFC  3244
             ID+ AKYYTPA++ ISACLA   +A++V N S   HLALVVLVSACPCAL+LSTPVA FC
Sbjct  317   IDECAKYYTPAVIIISACLAAIPAALRVHNLSHWLHLALVVLVSACPCALILSTPVAAFC  376

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL++AA  G+L KG  +LE+LAK+KV+AFDKTGTITRGEF V HF +L D I+ NTLL W
Sbjct  377   ALTKAAMAGVLIKGGNHLEVLAKIKVMAFDKTGTITRGEFVVTHFQALRDDISFNTLLQW  436

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSSIESKSSHPMA A+++Y + HS++  PE VE F+NFPGEG+ G+IDG +IYIG+KKI+
Sbjct  437   VSSIESKSSHPMATALVNYGKLHSIDLKPENVEEFENFPGEGVRGKIDGNDIYIGSKKIA  496

Query  2883  ARAG-----CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMG  2719
             ARAG      + +  FD + R+ +++ Y+F G ++ G F L D+CR+G +EAI ++K  G
Sbjct  497   ARAGYDIPVSSELNNFDDETRQEQTLGYVFCGGTIIGSFGLLDSCRSGVKEAIEEIKSFG  556

Query  2718  IKTVMLTGDSYAAARHVQEQL  2656
             IKT MLTGD  AAA HVQEQ+
Sbjct  557   IKTAMLTGDCRAAAMHVQEQV  577



>ref|XP_006853047.1| hypothetical protein AMTR_s00038p00036580 [Amborella trichopoda]
 gb|ERN14514.1| hypothetical protein AMTR_s00038p00036580 [Amborella trichopoda]
Length=878

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/691 (54%), Positives = 496/691 (72%), Gaps = 7/691 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KS+ DV+GICC SE  LI++IL    GVH VSV V +K+V+V HDP +I++ QIV  LN
Sbjct  109   QKSHLDVLGICCISEAALIERILMSPKGVHNVSVHVPSKSVIVTHDPAMISEAQIVAILN  168

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS++  G T    +  PSP+ VV G+LLLLS  K+ + P+ WLA+ A V G   V
Sbjct  169   SAKLEASVRELG-TVKNRRTWPSPFTVVSGVLLLLSLTKFWFKPMHWLALGAVVTGLPQV  227

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R+ A ++   LDIN LM+I+V G+I L DY EA  IVFLF   EWLES  S KA   M
Sbjct  228   VVRSFATIQQKILDINSLMLIAVAGTIALKDYEEAGCIVFLFALAEWLESMTSQKAQITM  287

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             S+L+N+  Q+A+LAETGEI+D  +V ++TILAVKAGE++PIDGIVVEG  EVDEK+LTGE
Sbjct  288   SALMNMAPQKAMLAETGEIVDTREVPLNTILAVKAGEMVPIDGIVVEGRSEVDEKSLTGE  347

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
                V K+  S VWA T+NLNGY++IKT A+AED  VARM +LVE AQ + SR QR ++  
Sbjct  348   PLPVTKEPQSAVWAGTLNLNGYMTIKTVALAEDSTVARMVRLVEAAQHSTSRTQRIVEVF  407

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTP+++ I+A +AI  + ++ EN     +++LVVL+ ACPCALVLSTP+A  CALSR
Sbjct  408   ARYYTPSVLIIAAGMAIIPTIMRKENWHSHLYMSLVVLICACPCALVLSTPIATACALSR  467

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLL--DGINHNTLLSWVS  3058
              A+ G+L KG ++LE LA+V+++AFDKTGTIT G+F+VA    L+  D I+ + LL WVS
Sbjct  468   TASEGVLVKGGDFLETLARVRIVAFDKTGTITSGKFSVAEMVCLIEEDDISLDMLLYWVS  527

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             S+ESKS+HPMA A +DY +S  VEP PEKVE FQNFPGEG+YG +DG  IYIGNKK++ R
Sbjct  528   SVESKSNHPMAAAFVDYGRSRQVEPAPEKVEDFQNFPGEGVYGIVDGAAIYIGNKKMALR  587

Query  2877  AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             AGC SVP  + +  +G +++Y+F+G  + G+FSL D  R  A   IR+LK +GIK V+LT
Sbjct  588   AGCNSVPNIN-EQEQGATLAYVFLGRKVVGMFSLYDEVRHSALGVIRELKKLGIKIVLLT  646

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPALATA  2521
             GD +AAA  V +QL   +D  H+ELLP+EKAQ I   +K  G T M+GDG+NDAPALA A
Sbjct  647   GDGHAAATRVNDQLEKEIDVIHSELLPDEKAQKIVDMKKSHGLTAMVGDGINDAPALAAA  706

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG++MG SGS +A E  HV LM++D+ +  + I  GRR   K+  NI +++  K  I+ 
Sbjct  707   DVGVAMGASGSAIASEASHVTLMSDDLRQFHETILTGRRTRWKIAENISLSVVPKVTIVV  766

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             LA+ GHP +WAAVLVD+G CL+VI NS LLL
Sbjct  767   LALCGHPYMWAAVLVDMGACLLVIMNSMLLL  797



>ref|XP_002459579.1| hypothetical protein SORBIDRAFT_02g006950 [Sorghum bicolor]
 gb|EER96100.1| hypothetical protein SORBIDRAFT_02g006950 [Sorghum bicolor]
Length=933

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/693 (56%), Positives = 501/693 (72%), Gaps = 6/693 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+GICC +EV L++++L  + GV  V+V+V ++TV+V HD  +++Q  IV+ LN
Sbjct  41    EKTYLDVLGICCTAEVALVERLLSPIHGVRAVTVVVPSRTVIVDHDTAVVSQFHIVKVLN  100

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEASI+  G +       PSP+ + CG+LL  S    +  PL+WLAV AAV GS P+
Sbjct  101   KAGLEASIRAYGSSAGASWRWPSPFIIACGVLLAASLFAPLLPPLQWLAVVAAVVGSQPM  160

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA AA   LTLDINILM+I+VVGS+ L  Y EA  IVFLFT  EWLE+ A  KA A M
Sbjct  161   LLRAFAAAGKLTLDINILMLIAVVGSVALGSYTEAGAIVFLFTVAEWLETLACTKASAGM  220

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL++ V +  VLAETG+++    V V T++AV+AG+V+P+DG+VV+G  EVDE +LTGE
Sbjct  221   MSLMSTVPKTVVLAETGQVVGMGDVAVGTVVAVRAGDVVPVDGVVVDGHSEVDESSLTGE  280

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  S VWA TINL+GYIS++TTA+AE+  VA+M +LVE+AQ++ SR QR ID  
Sbjct  281   SFPVPKQPQSEVWAGTINLDGYISVRTTALAENSTVAKMERLVEDAQNSASRTQRLIDSC  340

Query  3405  AKYYTPAIVAISACLAISAVKVENR--SERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AK+YTPA+V I+A + +    + +R     + L+LV+LVSACPCALVLSTPVA FCAL R
Sbjct  341   AKHYTPAVVVIAATVVVVPALLGSRDLEHWFRLSLVLLVSACPCALVLSTPVATFCALLR  400

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +GLL KG   LE L +V V AFDKTGTITRGEF++  F  + D +  N LL WVSSI
Sbjct  401   AARMGLLIKGGNVLESLGEVSVAAFDKTGTITRGEFSIKDFLVVGDKVEMNKLLYWVSSI  460

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DYAQS S++  P+ V     + GEGIYGEI+G +IYIGN++I AR+ 
Sbjct  461   ESKSSHPMAAALVDYAQSKSIQARPDDVTETCIYHGEGIYGEINGKKIYIGNERIMARSS  520

Query  2871  C--TSVPEFDVDG-REGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
             C   +    + DG  +G SM  +     L G FSLSD CRTGA EAI +LK MGIK+VML
Sbjct  521   CHQHAAAHQETDGLMKGVSMGLVICDGDLVGKFSLSDTCRTGAAEAILQLKSMGIKSVML  580

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALAT  2524
             TGDS AAA+H QEQLGG L+E HA LLPE+K ++I++ Q + G T M+GDG+NDAPALA 
Sbjct  581   TGDSAAAAKHAQEQLGGVLEELHAGLLPEDKVRLIRELQTRHGATMMVGDGMNDAPALAA  640

Query  2523  ADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIM  2344
             ADVGISMG+SGS  A ET H  LM+ DI R+ KA+ LGRR  R + +N+  ++ TKAA+M
Sbjct  641   ADVGISMGLSGSAAAIETSHATLMSGDILRVPKAVRLGRRTRRTIALNVASSVATKAAVM  700

Query  2343  ALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             ALA+A  P++W AVL DVGTCL+V+ +S LLLR
Sbjct  701   ALAVAWRPVLWVAVLADVGTCLLVVLHSMLLLR  733



>ref|XP_002894071.1| hypothetical protein ARALYDRAFT_473917 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70330.1| hypothetical protein ARALYDRAFT_473917 [Arabidopsis lyrata subsp. 
lyrata]
Length=982

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/515 (65%), Positives = 424/515 (82%), Gaps = 2/515 (0%)
 Frame = -1

Query  3783  KAMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDE  3604
             +A A M SL+++  Q+A++AETGE ++ ++VK+ T++AVKAGE IPIDGIVV+G CEVDE
Sbjct  2     QATAVMQSLMSLAPQKAIIAETGEEVEVDEVKISTVVAVKAGETIPIDGIVVDGNCEVDE  61

Query  3603  KTLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQ  3424
             KTLTGE+F VPKQ+DSTVWA TINLNGYIS+KTT++A DC VA+MAKLVEEAQS+K+++Q
Sbjct  62    KTLTGEAFPVPKQRDSTVWAGTINLNGYISVKTTSLAGDCVVAKMAKLVEEAQSSKTKSQ  121

Query  3423  RSIDKIAKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAM  3250
             R IDK ++YYTPAI+ +SAC+AI  V  KV N    +HLALVVLVS CPC L+LSTPVA 
Sbjct  122   RLIDKCSQYYTPAIIVVSACVAIVPVIMKVHNLKHWFHLALVVLVSGCPCGLILSTPVAT  181

Query  3249  FCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLL  3070
             FCAL++AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V  F SL   I   +LL
Sbjct  182   FCALTKAATSGLLIKSADYLDTLSKMKIAAFDKTGTITRGEFIVIDFKSLSRDITLRSLL  241

Query  3069  SWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKK  2890
              WVSS+ESKSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEGIYG+I+G +IYIGNK+
Sbjct  242   YWVSSVESKSSHPMAATIVDYAKSVSVEPRPEEVEDYQNFPGEGIYGKIEGNDIYIGNKR  301

Query  2889  ISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKT  2710
             I++RAGC++VPE +VD + G ++ Y++VG  LAGVF+LSDACR+G  +A+ +LK +GIKT
Sbjct  302   IASRAGCSTVPEIEVDTKGGNTVGYVYVGERLAGVFNLSDACRSGVSQAMTELKSLGIKT  361

Query  2709  VMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPAL  2530
              MLTGDS AAA H QEQLG  LD  H ELLPE+K++II++F+K G T M+GDG+NDAPAL
Sbjct  362   AMLTGDSQAAAMHAQEQLGNVLDVVHGELLPEDKSKIIQEFKKEGPTAMVGDGVNDAPAL  421

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             A AD+GISMGISGS LA +TGH+ILM+NDI RI +A++L RR  RKV+ N+ ++I  KA 
Sbjct  422   AIADIGISMGISGSALATQTGHIILMSNDIRRIPQAVKLARRARRKVVENVFLSIILKAG  481

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             I+ALA AGHPL+WAAVLVDVGTCL+VI NS LLLR
Sbjct  482   ILALAFAGHPLIWAAVLVDVGTCLLVILNSMLLLR  516



>dbj|BAK00726.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=838

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/687 (56%), Positives = 512/687 (75%), Gaps = 7/687 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++L  LDGV  VSV+V ++TVVV HDP  ++Q +IV+ LN
Sbjct  29    EKTYLDVLGVCCSAEVALVERLLAPLDGVRAVSVVVPSRTVVVEHDPSAVSQSRIVKVLN  88

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS++  G +    +  PSPY V CG LLL S  +++  PL+WLA+ AA AG+ P+
Sbjct  89    GAGLEASVRAYGSSGVIGRW-PSPYIVACGALLLASSFRWLLPPLQWLALGAACAGAPPM  147

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R  AA   L LDINILM+I+VVG++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  148   VLRGFAAASRLALDINILMLIAVVGAVALKDYTEAGVIVFLFTTAEWLETLACTKASAGM  207

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL++++  +AVLAETGE+++   + V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  208   SSLMSMIPPKAVLAETGEVVNVRDIDVGAVIAVRAGEMVPVDGVVVDGQSEVDERSLTGE  267

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ VPKQ  S VWA T+NL+GYI+++T+A+AE+  VA+M +LVEEAQ +KS+ QR ID  
Sbjct  268   SYPVPKQPLSEVWAGTLNLDGYIAVRTSALAENSTVAKMERLVEEAQQSKSKTQRLIDSC  327

Query  3405  AKYYTPAIVAISACLAISAVKVENR-SER-YHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V + A +A+    V  R +ER + LALV+LVSACPCALVLSTPVA FCAL  
Sbjct  328   AKYYTPAVVFLGAGVALLPPLVGARDAERWFRLALVLLVSACPCALVLSTPVATFCALLT  387

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +GLL KG + LE L ++K +AFDKTGTITRGEFTV  F  +   +  + LL W+SSI
Sbjct  388   AARMGLLVKGGDVLESLGEIKAVAFDKTGTITRGEFTVDIFDVVGHKVQMSQLLYWISSI  447

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+++YAQS S+EP PE V  F+  PGEGIYGEIDG  IY+GNK++ ARA 
Sbjct  448   ESKSSHPMAAALVEYAQSKSIEPKPECVAEFRILPGEGIYGEIDGKRIYVGNKRVLARAS  507

Query  2871  C--TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
                T+VPE  ++G +G S+ Y+     L GVFSLSD CRTGA EAIR+L  MGI +V+LT
Sbjct  508   SCQTAVPE-RMNGLKGVSIGYVICDGDLVGVFSLSDDCRTGAAEAIRELASMGISSVLLT  566

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS  AA H QE+LGGAL+E H+EL PE+K +++   + + G T M+GDG+NDAPALA A
Sbjct  567   GDSAEAAVHAQERLGGALEELHSELFPEDKVRLVSAVKARVGPTMMVGDGMNDAPALAMA  626

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMGISGS  A ET H  LM++DI R+ +A+ LGRR  R + VN+V ++  K A++A
Sbjct  627   DVGVSMGISGSAAAMETSHATLMSSDILRVPEAVRLGRRARRTIAVNMVSSVAAKVAVLA  686

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNS  2260
             LA+A  P++WAAVL DVGTCL+V+ NS
Sbjct  687   LALAWRPVLWAAVLADVGTCLLVVLNS  713



>gb|AFP87422.1| putative cadmium/zinc-transporting ATPase [Triticum turgidum 
subsp. durum]
Length=815

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/696 (55%), Positives = 518/696 (74%), Gaps = 6/696 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++L  LDGV  V+V+V ++TVVV HDP  ++Q +IV+ LN
Sbjct  26    EKTYLDVLGVCCSAEVALVERLLAPLDGVRAVAVVVPSRTVVVEHDPAAVSQSRIVKVLN  85

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS++  G +    +  PSPY V CG LLL S  +++  PL+WLA+ AA AG+ P+
Sbjct  86    GAGLEASVRAYGSSGFIGRR-PSPYIVACGALLLASSFRWLLLPLQWLALGAACAGAPPM  144

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R +AA   L LDINILM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  145   VLRGLAAASRLALDINILMLIAVAGAVALKDYTEAGVIVFLFTTAEWLETLACTKASAGM  204

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL++++  +AVLAETGE+++   + V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  205   SSLMSMIPPKAVLAETGEVVNVRDIGVGVVIAVRAGEMVPVDGVVVDGQSEVDERSLTGE  264

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ VPKQ  S VWA T+NL+GYI+++T A+AE+  VA+M +LVEEAQ +KS+ QR ID  
Sbjct  265   SYPVPKQPQSEVWAGTLNLDGYIAVRTMALAENSTVAKMERLVEEAQQSKSKTQRLIDSC  324

Query  3405  AKYYTPAIVAISACLAISAVKVENR-SER-YHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V + A +A+    +  R +ER + LALV+LVSACPCALVLSTPVA FCAL  
Sbjct  325   AKYYTPAVVVLGAGVALLPPLLGARDAERWFRLALVLLVSACPCALVLSTPVATFCALLT  384

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +G+L KG + LE L +++ +AFDKTGTITRGEFTV  F  +   +  + LL W+SSI
Sbjct  385   AARMGVLVKGGDVLESLGEIRAVAFDKTGTITRGEFTVDMFDVVEQKVQMSHLLYWISSI  444

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR-A  2875
             ESKSSHPMA A++++AQS S++P PE V  F+  PGEG+YGEIDG  IY+GNK++ AR +
Sbjct  445   ESKSSHPMAAALVEHAQSKSIQPKPECVAEFRILPGEGVYGEIDGKRIYVGNKRVLARGS  504

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VPE  ++G +G S+ Y+     L GVFSLSD CRTGA EAIR+L  MGI +V+LTG
Sbjct  505   SCQTVPE-RMNGLKGVSIGYVICDGDLVGVFSLSDDCRTGAAEAIRELASMGISSVLLTG  563

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS  AA H QE+LGGAL+E H+EL PE+K +++   + + G T M+GDG+NDAPALATAD
Sbjct  564   DSAEAAVHAQERLGGALEELHSELFPEDKVRLVGALKARAGPTMMVGDGMNDAPALATAD  623

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMGISGS  A ET H  LM++DI R+ +A+ LGRR  R + VN+V ++  KAA++AL
Sbjct  624   VGVSMGISGSAAAMETSHATLMSSDILRVPEAVRLGRRARRTIAVNMVSSVAAKAAVLAL  683

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             A+A  P++WAAVL DVGTCL+V+ NS LLL  G R 
Sbjct  684   AVAWRPVLWAAVLADVGTCLLVVLNSMLLLGEGRRR  719



>gb|AIA57675.1| heavy metal transporting P1B-ATPase 3 [Triticum turgidum subsp. 
durum]
 gb|AIA57676.1| heavy metal transporting P1B-ATPase 3 [Triticum turgidum subsp. 
durum]
 gb|AIA57677.1| heavy metal transporting P1B-ATPase 3 [Triticum turgidum subsp. 
durum]
 gb|AIA57680.1| heavy metal transporting P1B-ATPase 3 [Triticum aestivum]
Length=816

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/696 (55%), Positives = 518/696 (74%), Gaps = 6/696 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++L  LDGV  V+V+V ++TVVV HDP  ++Q +IV+ LN
Sbjct  27    EKTYLDVLGVCCSAEVALVERLLAPLDGVRAVAVVVPSRTVVVEHDPAAVSQSRIVKVLN  86

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS++  G +    +  PSPY V CG LLL S  +++  PL+WLA+ AA AG+ P+
Sbjct  87    GAGLEASVRAYGSSGFIGRR-PSPYIVACGALLLASSFRWLLLPLQWLALGAACAGAPPM  145

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R +AA   L LDINILM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  146   VLRGLAAASRLALDINILMLIAVAGAVALKDYTEAGVIVFLFTTAEWLETLACTKASAGM  205

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL++++  +AVLAETGE+++   + V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  206   SSLMSMIPPKAVLAETGEVVNVRDIGVGVVIAVRAGEMVPVDGVVVDGQSEVDERSLTGE  265

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ VPKQ  S VWA T+NL+GYI+++T A+AE+  VA+M +LVEEAQ +KS+ QR ID  
Sbjct  266   SYPVPKQPQSEVWAGTLNLDGYIAVRTMALAENSTVAKMERLVEEAQQSKSKTQRLIDSC  325

Query  3405  AKYYTPAIVAISACLAISAVKVENR-SER-YHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V + A +A+    +  R +ER + LALV+LVSACPCALVLSTPVA FCAL  
Sbjct  326   AKYYTPAVVVLGAGVALLPPLLGARDAERWFRLALVLLVSACPCALVLSTPVATFCALLT  385

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +G+L KG + LE L +++ +AFDKTGTITRGEFTV  F  +   +  + LL W+SSI
Sbjct  386   AARMGVLVKGGDVLESLGEIRAVAFDKTGTITRGEFTVDMFDVVEQKVQMSHLLYWISSI  445

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR-A  2875
             ESKSSHPMA A++++AQS S++P PE V  F+  PGEG+YGEIDG  IY+GNK++ AR +
Sbjct  446   ESKSSHPMAAALVEHAQSKSIQPKPECVAEFRILPGEGVYGEIDGKRIYVGNKRVLARGS  505

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VPE  ++G +G S+ Y+     L GVFSLSD CRTGA EAIR+L  MGI +V+LTG
Sbjct  506   SCQTVPE-RMNGLKGVSIGYVICDGDLVGVFSLSDDCRTGAAEAIRELASMGISSVLLTG  564

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS  AA H QE+LGGAL+E H+EL PE+K +++   + + G T M+GDG+NDAPALATAD
Sbjct  565   DSAEAAVHAQERLGGALEELHSELFPEDKVRLVGALKARAGPTMMVGDGMNDAPALATAD  624

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMGISGS  A ET H  LM++DI R+ +A+ LGRR  R + VN+V ++  KAA++AL
Sbjct  625   VGVSMGISGSAAAMETSHATLMSSDILRVPEAVRLGRRARRTIAVNMVSSVAAKAAVLAL  684

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             A+A  P++WAAVL DVGTCL+V+ NS LLL  G R 
Sbjct  685   AVAWRPVLWAAVLADVGTCLLVVLNSMLLLGEGRRR  720



>ref|XP_008801401.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Phoenix dactylifera]
Length=602

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/568 (61%), Positives = 440/568 (77%), Gaps = 4/568 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+KIL  LDG+H+VSV+V +KTV+VVHD LLI+Q QIVRALN
Sbjct  17    QKSYFDVLGLCCSSEVPLIEKILMPLDGIHKVSVIVPSKTVIVVHDSLLISQLQIVRALN  76

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA+I+  G T+   K  PSPY + CG LLL+S  K  + PL+W A+AAA  G+ P+
Sbjct  77    QARLEATIRAYG-TDSIIKKWPSPYVLACGALLLVSLFKKFFHPLQWFALAAAAVGAPPI  135

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R++AALR  TLDINILM+I+V G++ L DY EA  IVFLFT  +WLESRAS+KA A M
Sbjct  136   IFRSIAALRRFTLDINILMLIAVCGAVALGDYSEAGFIVFLFTVAQWLESRASYKAAAGM  195

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+ +  Q+AVLAETG+++DA  VK+ TILAVKAGEVIPIDG+VV+G  E DE++LTGE
Sbjct  196   SSLMKMAPQKAVLAETGQVVDARDVKIGTILAVKAGEVIPIDGVVVDGRSEADERSLTGE  255

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ  S+VWA T+N++GYIS++TTA+AE  AVA+MA+LVEEAQ+++S+ QR ID  
Sbjct  256   SFPVAKQAQSSVWAGTLNMDGYISVRTTALAEHSAVAKMARLVEEAQNSRSKTQRLIDSC  315

Query  3405  AKYYTPAIVAISACLAISA--VKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             A+YYTPA+V  +A  A+    ++V N      LALV+LVSACPCALVLSTPVA FCAL +
Sbjct  316   ARYYTPAVVMAAAGFAVIPLIIRVHNPKHWIELALVLLVSACPCALVLSTPVAAFCALLK  375

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG + LE LA++KV+AFDKTGTITRGEF V  F S+ + +N + LL WVSSI
Sbjct  376   AARTGLLVKGGDVLEALARIKVVAFDKTGTITRGEFAVVEFRSINNEVNLHALLYWVSSI  435

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A++DYA+S+S+EP P+ V  F  +PGEGIYGEIDG  IYIGNK+I+ARA 
Sbjct  436   ESKSSHPMASALVDYARSNSIEPKPDCVREFHIYPGEGIYGEIDGKNIYIGNKRIAARAS  495

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VPE D D +EG ++ YIF G+   GVF+LSD CRTGA EAI++LK++GIKT MLTGD
Sbjct  496   CETVPELD-DIKEGVTLGYIFSGTVAIGVFTLSDTCRTGATEAIKELKLLGIKTAMLTGD  554

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEK  2608
             S AAA H Q Q+G A+ EF      + K
Sbjct  555   SAAAAMHAQNQIGHAIQEFMQNFYRKTK  582



>ref|XP_003561282.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Brachypodium distachyon]
Length=819

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/694 (54%), Positives = 504/694 (73%), Gaps = 9/694 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+Y DV+G+CC +EV L++++L  L GV  VSV+V ++TVVV HDP  ++Q  IV+ LN
Sbjct  24    DKTYLDVLGVCCSAEVALVERLLSPLAGVRTVSVVVPSRTVVVQHDPAAVSQSHIVKVLN  83

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAP----LKWLAVAAAVAG  3958
              A LEAS++  G +    +  PSPY +  G+LLL S L ++       L+WLA+AAA  G
Sbjct  84    GAGLEASVRAYGSSGIISRW-PSPYILASGVLLLASSLSWLLPDPLHHLQWLALAAAFVG  142

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
             + P+L R  AA   LTLDIN+LM+I+V G+  L DY EA  IVFLFTT EWLE+ A  KA
Sbjct  143   APPMLLRGFAAASRLTLDINVLMLIAVAGAAALGDYTEAGAIVFLFTTAEWLETLACTKA  202

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
              A MSSL++++  +AVLAETG++++ + + V  ++AV+AGEV+P+DG+VV+G+ EVDE++
Sbjct  203   SAGMSSLMSMIPPKAVLAETGQVVNVSDIGVGAVVAVRAGEVVPVDGVVVDGQSEVDERS  262

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             LTGES+ VPKQ  S VWA T+NL+GYI+++T+A+AE+  VARM KLVEEAQ+++S+ QR 
Sbjct  263   LTGESYPVPKQPQSEVWAGTLNLDGYIAVRTSALAENSTVARMEKLVEEAQNSRSKTQRL  322

Query  3417  IDKIAKYYTPAIVAISACLAISAVKV-ENRSER-YHLALVVLVSACPCALVLSTPVAMFC  3244
             ID  AKYYTPA+V + A +A+  + +     ER + L+LV+LVSACPCALVLSTPVA FC
Sbjct  323   IDSCAKYYTPAVVVMGAGVALPPLLLGAGDPERWFRLSLVLLVSACPCALVLSTPVATFC  382

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AL  AA +G+L KG + LE L ++  +AFDKTGTITRGEF++A F  + D +    LL W
Sbjct  383   ALLTAARMGVLIKGGDVLESLGEITAVAFDKTGTITRGEFSIAAFHVVADKVQITHLLYW  442

Query  3063  VSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKIS  2884
             VSSIESKSSHPMA A+++YA+S S++P PE V  F+  PGEG+YGEI G  IYIGNK+ +
Sbjct  443   VSSIESKSSHPMAAALVEYARSKSIQPKPENVAEFRVIPGEGVYGEIHGRHIYIGNKRAA  502

Query  2883  -ARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
              AR  C +VPE      +G S+ Y+     L G FSLSD CRTGA EAI++L  MGIK+V
Sbjct  503   LARGSCHTVPEKKDGDLKGVSVGYVICDGDLVGAFSLSDDCRTGAAEAIQELTAMGIKSV  562

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPAL  2530
             MLTGDS  AA H QEQLGGAL+E H +L PE+K +++   + + G T M+GDG+NDAPAL
Sbjct  563   MLTGDSAEAAAHAQEQLGGALEELHWDLFPEDKVRLVAALKARAGPTMMVGDGMNDAPAL  622

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             A ADVG+SMG+SGS  A ET H  LM++D+ R+ +A+ LGRR  R + VN+V ++  KAA
Sbjct  623   AMADVGVSMGVSGSAAAMETSHATLMSSDVLRVPEAVRLGRRARRTIAVNLVASVGIKAA  682

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             ++ LA+A  P +WAAVL DVGTCL+V+ NS  LL
Sbjct  683   VLVLAVAWTPALWAAVLADVGTCLLVVLNSMRLL  716



>ref|XP_008670003.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Zea mays]
Length=893

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/686 (55%), Positives = 494/686 (72%), Gaps = 4/686 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+GICC +EV L++++L  ++GV  V+V+V ++TV+V HD   ++Q  IV+ LN
Sbjct  24    EKTYLDVLGICCTAEVALVERLLAPINGVRAVTVVVPSRTVIVDHDTAAVSQFHIVKVLN  83

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G +   P   PSP+ V CG+LL  S    +  PL+WLAVAAA  GS P+
Sbjct  84    KAGLEASVRAYGSSAGAPGRWPSPFIVACGVLLAASLFAPLLPPLRWLAVAAACVGSQPM  143

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA AA   LTLDINILM+I+V G++ L  Y EA  IVFLFT  EWLE+ A  KA A M
Sbjct  144   LLRAFAAAGKLTLDINILMLIAVAGAVALGSYTEAGAIVFLFTVAEWLETLACTKASAGM  203

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL++ V +  VLAETG+++    V V T++AV+AG+V+P+DG+VV G+ EVDE +LTGE
Sbjct  204   LSLMSSVPKTVVLAETGQVVGMGDVAVGTVVAVRAGDVVPVDGVVVGGQSEVDESSLTGE  263

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  S VWA TINL+GYIS++TTA+AE+  VA+M +LVEEAQ+++SR QR ID  
Sbjct  264   SFPVPKQAQSEVWAGTINLDGYISVRTTALAENSTVAKMERLVEEAQNSRSRTQRLIDSC  323

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AK+YTPA+V ++A + +  V     +    + L+LV+LVSACPCALVLSTPVA FCAL R
Sbjct  324   AKHYTPAVVVLAAGVVLVPVLLGAPDLEHWFRLSLVLLVSACPCALVLSTPVATFCALLR  383

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +GLL KG   LE L +V+V AFDKTGTITRGEF++  F  + D +  + LL WVSSI
Sbjct  384   AARMGLLVKGGNVLESLGEVRVAAFDKTGTITRGEFSIKDFLVVRDKVQMSQLLYWVSSI  443

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+++YAQS S++P PE V     + GEGIYG I+G  IYIGN++I AR+ 
Sbjct  444   ESKSSHPMAAALVEYAQSKSIQPKPEDVTETCIYHGEGIYGAINGKHIYIGNERIMARSS  503

Query  2871  C-TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
             C       + DG +G S+  +     L G FSLSD CRTGA EAI +L+ MGIK+VMLTG
Sbjct  504   CRQQAGHRETDGLKGVSVGLVICDGDLVGKFSLSDTCRTGAAEAILQLRSMGIKSVMLTG  563

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS AAA+H QEQLGG L+E H+ LLPE+K ++I+  Q + G T M+GDG+NDAPALA AD
Sbjct  564   DSEAAAKHAQEQLGGVLEELHSGLLPEDKVRLIRGLQARHGATLMVGDGMNDAPALAAAD  623

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMG+SGS  A ET H  LM+ D+ R+ KA+ LGRR  R + VN+  ++  KAA++AL
Sbjct  624   VGVSMGLSGSAAAIETSHATLMSGDVLRVPKAVRLGRRTRRTIAVNVASSVGAKAAVLAL  683

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNS  2260
             A+A  P++W AVL DVGTCL+V+ +S
Sbjct  684   AVAWRPVLWVAVLADVGTCLLVVLHS  709



>tpg|DAA39458.1| TPA: hypothetical protein ZEAMMB73_904745 [Zea mays]
Length=927

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/687 (55%), Positives = 494/687 (72%), Gaps = 5/687 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+GICC +EV L++++L  ++GV  V+V+V ++TV+V HD   ++Q  IV+ LN
Sbjct  57    EKTYLDVLGICCTAEVALVERLLAPINGVRAVTVVVPSRTVIVDHDTAAVSQFHIVKVLN  116

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G +   P   PSP+ V CG+LL  S    +  PL+WLAVAAA  GS P+
Sbjct  117   KAGLEASVRAYGSSAGAPGRWPSPFIVACGVLLAASLFAPLLPPLRWLAVAAACVGSQPM  176

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA AA   LTLDINILM+I+V G++ L  Y EA  IVFLFT  EWLE+ A  KA A M
Sbjct  177   LLRAFAAAGKLTLDINILMLIAVAGAVALGSYTEAGAIVFLFTVAEWLETLACTKASAGM  236

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL++ V +  VLAETG+++    V V T++AV+AG+V+P+DG+VV G+ EVDE +LTGE
Sbjct  237   LSLMSSVPKTVVLAETGQVVGMGDVAVGTVVAVRAGDVVPVDGVVVGGQSEVDESSLTGE  296

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  S VWA TINL+GYIS++TTA+AE+  VA+M +LVEEAQ+++SR QR ID  
Sbjct  297   SFPVPKQAQSEVWAGTINLDGYISVRTTALAENSTVAKMERLVEEAQNSRSRTQRLIDSC  356

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AK+YTPA+V ++A + +  V     +    + L+LV+LVSACPCALVLSTPVA FCAL R
Sbjct  357   AKHYTPAVVVLAAGVVLVPVLLGAPDLEHWFRLSLVLLVSACPCALVLSTPVATFCALLR  416

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +GLL KG   LE L +V+V AFDKTGTITRGEF++  F  + D +  + LL WVSSI
Sbjct  417   AARMGLLVKGGNVLESLGEVRVAAFDKTGTITRGEFSIKDFLVVRDKVQMSQLLYWVSSI  476

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+++YAQS S++P PE V     + GEGIYG I+G  IYIGN++I AR+ 
Sbjct  477   ESKSSHPMAAALVEYAQSKSIQPKPEDVTETCIYHGEGIYGAINGKHIYIGNERIMARSS  536

Query  2871  CTS--VPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
             C        + DG +G S+  +     L G FSLSD CRTGA EAI +L+ MGIK+VMLT
Sbjct  537   CRQQEAGHRETDGLKGVSVGLVICDGDLVGKFSLSDTCRTGAAEAILQLRSMGIKSVMLT  596

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATA  2521
             GDS AAA+H QEQLGG L+E H+ LLPE+K ++I+  Q + G T M+GDG+NDAPALA A
Sbjct  597   GDSEAAAKHAQEQLGGVLEELHSGLLPEDKVRLIRGLQARHGATLMVGDGMNDAPALAAA  656

Query  2520  DVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMA  2341
             DVG+SMG+SGS  A ET H  LM+ D+ R+ KA+ LGRR  R + VN+  ++  KAA++A
Sbjct  657   DVGVSMGLSGSAAAIETSHATLMSGDVLRVPKAVRLGRRTRRTIAVNVASSVGAKAAVLA  716

Query  2340  LAIAGHPLVWAAVLVDVGTCLVVIFNS  2260
             LA+A  P++W AVL DVGTCL+V+ +S
Sbjct  717   LAVAWRPVLWVAVLADVGTCLLVVLHS  743



>ref|XP_008650804.1| PREDICTED: uncharacterized protein LOC100191729 isoform X3 [Zea 
mays]
 tpg|DAA60088.1| TPA: hypothetical protein ZEAMMB73_622637 [Zea mays]
Length=883

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/702 (55%), Positives = 500/702 (71%), Gaps = 8/702 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+GICC +EV L++++L  + GV  V+V+V ++TV+V HD   ++Q  IV+ LN
Sbjct  29    EKTYLDVLGICCTAEVALVERLLTPIQGVRAVTVVVPSRTVIVDHDTAAVSQFHIVKVLN  88

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G +       PSP+ V CG LL LS L  +  PL+WLAVAAA  GS P+
Sbjct  89    KAGLEASVRAYGSSAGAGGRWPSPFTVACGALLALSLLAPLLPPLRWLAVAAACVGSQPM  148

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA AA   LTLDINILM+I+V GS+ L  + EA  IVFLFT  EWLE+ A  KA A M
Sbjct  149   LLRAFAAAGKLTLDINILMLIAVAGSVALGSFTEAGAIVFLFTVAEWLETLACSKASAGM  208

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL++ V +  VLAETG+++    V V T++AV+AG+V+P+DG+VV G  EVDE +LTGE
Sbjct  209   LSLMSTVPKTVVLAETGQVVGMGDVAVGTVVAVRAGDVVPVDGVVVGGHSEVDESSLTGE  268

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  S VWA TINL+GYIS++TTA+AE+  VA+M +LVEEAQ+++SR QR ID  
Sbjct  269   SFPVPKQPQSEVWAGTINLDGYISVRTTALAENSTVAKMERLVEEAQNSRSRTQRLIDSC  328

Query  3405  AKYYTPAIVAISACLAISAVKVENR----SERYHLALVVLVSACPCALVLSTPVAMFCAL  3238
             AK+YTPA+V ++A + +    +  R       + L+LV+LVSACPCALVLSTPVA FCAL
Sbjct  329   AKHYTPAVVVLAAGVVLVPALLGARDLELEHWFRLSLVLLVSACPCALVLSTPVATFCAL  388

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVS  3058
              RAA +GLL KG   LE L +V+V AFDKTGTITRGEF++  F  + D +  N LL WVS
Sbjct  389   LRAARMGLLVKGGNVLESLGEVRVAAFDKTGTITRGEFSIKDFHVVGDKVEMNQLLYWVS  448

Query  3057  SIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR  2878
             SIESKSSHPMA A+++YAQS SV+P PE V     + GEGIYG +DG +IYIGN++I AR
Sbjct  449   SIESKSSHPMAAALVEYAQSKSVQPKPENVTETCIYHGEGIYGVMDGKQIYIGNERIIAR  508

Query  2877  AGC---TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             + C         + DG +G S+ ++     L G FSLSD CRTGA EAI +L+ MGIK+V
Sbjct  509   SSCRHHQHAGHQETDGLKGVSIGHVICDGDLVGKFSLSDTCRTGAAEAILQLRSMGIKSV  568

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPAL  2530
             MLTGDS AAA+H QEQLGG L+E HA LLPE+K ++++  Q + G T M+GDG+NDAPAL
Sbjct  569   MLTGDSAAAAKHAQEQLGGVLEELHAGLLPEDKVRLVRGLQARHGATLMVGDGMNDAPAL  628

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             A ADVG+SMG+SGS  A ET H  LM+ DI R+ KA+ LGRR  R + VN+  ++  KAA
Sbjct  629   AAADVGVSMGLSGSAAAIETSHAALMSGDILRVPKAVRLGRRARRTIAVNVASSVGAKAA  688

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREAP  2224
             ++ALA+A  P++W AVL DVGTCL+V+ +S LLLR G    P
Sbjct  689   VLALAVAWRPVLWVAVLADVGTCLLVVLHSMLLLRDGAARRP  730



>ref|XP_004487940.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like isoform 
X2 [Cicer arietinum]
Length=747

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/572 (57%), Positives = 430/572 (75%), Gaps = 12/572 (2%)
 Frame = -1

Query  3921  RNLTLDINILMIIS---VVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVN  3751
             R +T+  ++L I     V G+I + D+ +   I+FLF+  +WLE+RA+HKAM AMSSL N
Sbjct  45    RTVTVVHDVLFISQSQIVCGTIAIQDFTDGGVIIFLFSIAQWLETRATHKAMVAMSSLTN  104

Query  3750  VVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVP  3571
             +  Q A+ AETGE +D N+VK++TILAVKAGE IP+DG+VV+G+CEVDEK LTGESF V 
Sbjct  105   MAPQMAIAAETGERVDVNEVKINTILAVKAGEAIPLDGVVVDGKCEVDEKMLTGESFPVT  164

Query  3570  KQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYT  3391
             K+ DS VWA TIN+NGYIS++T  +A+D  VA+M++LVEEA S KS+AQR ID  AKYY 
Sbjct  165   KESDSLVWAGTINMNGYISVRTIVLAKDTVVAKMSRLVEEASSRKSQAQRFIDNFAKYYI  224

Query  3390  PAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALG  3217
             P +V ISA +A+  +A+ V +    +HL+LVVL+S CPCAL+LSTPVA+FCAL++AA  G
Sbjct  225   PVVVLISASIAVVPAAISVPDIEPWFHLSLVVLLSGCPCALILSTPVAIFCALTKAAISG  284

Query  3216  LLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSS  3037
             LL KG +YLE L+++K +AFDKTGTITRGEF+V  FS   D I++ T+L W+SSIESKSS
Sbjct  285   LLLKGGDYLETLSRIKTVAFDKTGTITRGEFSVTDFSGT-DDIDNETILYWISSIESKSS  343

Query  3036  HPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVP  2857
             HP+A A+++Y   HS++P PE VE+FQNFPGEGI+G IDG +IYIGN++I  RA    V 
Sbjct  344   HPVAAALVEYGMLHSIKPVPENVENFQNFPGEGIFGTIDGRDIYIGNRRIGIRAQSERVD  403

Query  2856  ---EFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
                +F  +    K     + G +L GVFSL DACR+GA EAI +LK++G+++VMLTGDS 
Sbjct  404   CQLQFQSNEISAKKQ---YCGQTLVGVFSLVDACRSGALEAIEELKLLGVRSVMLTGDSS  460

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATADVGIS  2506
               A +VQ QL  A+D  HAELLP EKA II+  +K G T MIGDG+NDAPALATAD+GIS
Sbjct  461   QVAMYVQSQLNHAIDIVHAELLPHEKATIIENLKKQGPTAMIGDGINDAPALATADIGIS  520

Query  2505  MGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAG  2326
             MGISGS LA ET + ILM+NDI ++ +AI L R+  RK+I N+++++  K AI+ALAIAG
Sbjct  521   MGISGSALANETSNAILMSNDIRKVPEAIRLARKTTRKLIENVIISVGFKCAILALAIAG  580

Query  2325  HPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             +PLVW AVL DVGTCL VI NS L+L+   ++
Sbjct  581   YPLVWLAVLTDVGTCLFVILNSMLILQENKKD  612



>ref|XP_006303913.1| hypothetical protein CARUB_v10008389mg [Capsella rubella]
 gb|EOA36811.1| hypothetical protein CARUB_v10008389mg [Capsella rubella]
Length=565

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/552 (58%), Positives = 428/552 (78%), Gaps = 3/552 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ LDGV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSIVGDVLRPLDGVKEFSVIVPSRTVIVVHDNFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+LL LS  KY+Y+PL+W AV A +AG FP+
Sbjct  73    QARLEASVRPYGETSLKSQW-PSPFAIVSGVLLALSLFKYLYSPLEWFAVVAVMAGVFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + D+ EAATIVFLF+  +WLES A+ KA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATLCMQDFTEAATIVFLFSVADWLESSAAQKASTVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+AV+AETG  +D  +V+++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPQKAVIAETGLEVDVGEVRINTVVSVKAGESIPIDGVVVDGRCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ++STV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ  +++ QR IDK 
Sbjct  252   SFPVSKQRESTVLAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKTQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V ++AC A+  + +KV N S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVILAACFAVIPALLKVPNLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+++IAFDKTGTIT+ EFTV+ F SL   IN +TLL  VSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIEIIAFDKTGTITKAEFTVSDFRSLSHNINLHTLLYLVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKS+HPMA A+ID+A+S SVEP P+ VE+F+NFPGEG+YG IDG +IYIGNK I+ RAG
Sbjct  432   ESKSNHPMAAALIDHARSSSVEPKPDVVENFENFPGEGVYGRIDGQDIYIGNKTIAQRAG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VP+ + D + GK++ YI++G+ LAG F L D CR G  +A+++LK++GIKT MLTGD
Sbjct  492   CLTVPDIEADMKRGKTIGYIYIGAKLAGSFCLLDGCRYGVAQALKELKILGIKTAMLTGD  551

Query  2691  SYAAARHVQEQL  2656
             +  AA   QEQ+
Sbjct  552   NQDAAMTTQEQV  563



>ref|XP_004959104.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Setaria 
italica]
Length=877

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/690 (54%), Positives = 507/690 (73%), Gaps = 5/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++L  +DG+  V+V+V ++TV+V HDP  ++   IV+ALN
Sbjct  45    EKTYLDVLGVCCSAEVALVERLLAPIDGIRGVTVVVPSRTVIVEHDPAAVSLSHIVKALN  104

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A  EAS +  G +       PSPY +  G LLL S L  +  PL+WLA+AAA AG+ PV
Sbjct  105   RAGQEASERAYGSSGGVVGRWPSPYILASGGLLLASSLAPLLPPLRWLALAAACAGAPPV  164

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A+   L LDIN+LM+ +  G+  L D+ EA  IVFLFTT EWLE+ A  KA A M
Sbjct  165   LLRALASATRLALDINVLMLAAAAGAAALGDFAEAGAIVFLFTTAEWLETLACTKATAGM  224

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL++++  R VLA+TGE++    VKV  ++AV+AGEV+PIDG+VV+G+ EVDE +LTGE
Sbjct  225   SSLMSMIPPRVVLADTGEVVSLRDVKVGAVVAVRAGEVVPIDGVVVDGQSEVDESSLTGE  284

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  S VWA T+NL+GYI+++TTA+AE+  VA+M +LVE AQ+++S+ QR ID  
Sbjct  285   SFPVPKQPPSEVWAGTMNLDGYIAVRTTALAENSTVAKMERLVEAAQNSRSKTQRLIDSC  344

Query  3405  AKYYTPAIVAISACLAISA--VKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             +KYYTPA+VA++A + +    ++ ++    + LALV+LVSACPCALVLSTPVA FCAL R
Sbjct  345   SKYYTPAVVALAASVVLVPLLLRAQDMRRWFRLALVLLVSACPCALVLSTPVATFCALLR  404

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +G+L KG + LE L  ++V AFDKTGTIT+GEF++  F  + D +  + LL WVSSI
Sbjct  405   AARMGVLIKGGDILETLGGIRVAAFDKTGTITKGEFSIDGFHVVGDKVELSQLLYWVSSI  464

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+++YAQS S++P PE    F+ +PGEGIYGEI G  +YIGN++I AR+ 
Sbjct  465   ESKSSHPMATALVEYAQSKSIQPKPENATEFRIYPGEGIYGEISGRHVYIGNRRIMARSS  524

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
             C +VPE   D R+G S+ Y+     L G FSLSD CRTGA EAIR+L+ MGIK+VMLTGD
Sbjct  525   CYTVPEM--DDRKGASIGYVICDGDLVGAFSLSDDCRTGAAEAIRELRSMGIKSVMLTGD  582

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATADV  2515
             S +AA   QEQL GA+DE H ELLP +K +++ + + + G T M+GDG+NDAPALA ADV
Sbjct  583   SRSAAMRAQEQLRGAMDELHPELLPADKVRLVGELKARDGPTMMVGDGMNDAPALAMADV  642

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             G+SMG+SGS  A ET H  LM++DI R+  A+ LGRR  R + VN+VV++  KAA++ALA
Sbjct  643   GVSMGLSGSAAAMETSHATLMSSDILRVPAAVGLGRRARRTIAVNVVVSVAAKAAVVALA  702

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             +A  P++WAAVL DVGTCLVV+ +S  LLR
Sbjct  703   VAWRPVLWAAVLADVGTCLVVVLHSMTLLR  732



>ref|XP_006431594.1| hypothetical protein CICLE_v10003938mg, partial [Citrus clementina]
 gb|ESR44834.1| hypothetical protein CICLE_v10003938mg, partial [Citrus clementina]
Length=625

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/521 (62%), Positives = 408/521 (78%), Gaps = 4/521 (1%)
 Frame = -1

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A+AAMSSL ++  Q+A++AETGE +D N VKV+TILAV+AGEVIPIDGIVVEG+CEVDEK
Sbjct  1     AIAAMSSLTSMAPQKAIIAETGEQVDVNTVKVNTILAVRAGEVIPIDGIVVEGKCEVDEK  60

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             TLTGESF V K++DS VWA TINL+GYISIKTTA+A+DC V+RMA LVEE+   KSRAQ 
Sbjct  61    TLTGESFPVVKEQDSPVWAGTINLDGYISIKTTALAKDCVVSRMAALVEESHKKKSRAQT  120

Query  3420  SIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMF  3247
              I+  AKYY PA++ IS   A+  +AV V N     +LA+VVLVS CPCAL+LSTPV +F
Sbjct  121   FIESFAKYYIPAVLLISVAFAVIPAAVGVPNVRHWLYLAIVVLVSTCPCALILSTPVVIF  180

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             CALS+AA  GLL KG  YLEIL KVK++AFDKTGT+TRGEFTV  F S+ D ++  TLL 
Sbjct  181   CALSKAATTGLLVKGGNYLEILLKVKMVAFDKTGTVTRGEFTVTDFQSICDDVSLGTLLY  240

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             WVSSI+SKSSHPMA A++DYA+S ++EP PE VE FQNFPGEGI+G+I G EIYIGN++I
Sbjct  241   WVSSIQSKSSHPMASALVDYARSLAIEPVPENVEDFQNFPGEGIFGKIHGNEIYIGNRRI  300

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMG--IK  2713
               R GC+     +     GK+  Y+++G++  G FSLS++CR+GA EAI+ LK +G  IK
Sbjct  301   GPRTGCSKDSIVEAKCTGGKTRGYVYLGATPVGTFSLSESCRSGAPEAIKDLKSLGIKIK  360

Query  2712  TVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPA  2533
             +V+LTGDS+AAA ++Q+QL  A D  +AELLP+ KA++++  +K G T M+GDG+NDAPA
Sbjct  361   SVILTGDSHAAALYLQDQLDHAFDMVYAELLPQHKAELVELLKKDGTTAMVGDGINDAPA  420

Query  2532  LATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKA  2353
             LA A++GISMGISGS LA ETGHVILM+NDI +I KAI+L R+   K+I N+ +++  K 
Sbjct  421   LAAANIGISMGISGSALAMETGHVILMSNDIRKIPKAIKLARKASTKLIQNVTLSVTVKG  480

Query  2352  AIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             A++ LA+AG+PLVWAAVL DVGTCLVVI NS LLL+    E
Sbjct  481   AVLVLAVAGYPLVWAAVLTDVGTCLVVILNSMLLLKNNPEE  521



>ref|XP_006658417.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Oryza 
brachyantha]
Length=881

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/688 (53%), Positives = 499/688 (73%), Gaps = 5/688 (1%)
 Frame = -1

Query  4299  SYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKA  4120
             +Y DV+G+CC +EV L++++L  LDGV  VSV+V ++TVVV HDP   ++  IV ALNKA
Sbjct  40    TYLDVLGVCCSAEVALVERLLAPLDGVRVVSVVVASRTVVVEHDPAAASESAIVNALNKA  99

Query  4119  SLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLR  3940
              LEAS++  G +    +  PSPY V  G+LLL SF  +++ PL+ LA AA  AG+ P+LR
Sbjct  100   GLEASMRAYGSSGVVSRW-PSPYIVASGVLLLASFFNWLFPPLQLLAFAAVCAGAPPMLR  158

Query  3939  RAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSS  3760
             R  AA  +L+LDIN+LM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A MSS
Sbjct  159   RGWAAACSLSLDINVLMLIAVAGALALGDYTEAGGIVFLFTTAEWLETLACTKASAGMSS  218

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+  +  +AVL   GE++    V+V  ++AV+AGE++P+DG+VV+G+ EVDE +LTGESF
Sbjct  219   LMGTLPAKAVLV-NGEVVRVRDVRVGDVVAVRAGEIVPVDGVVVDGQSEVDESSLTGESF  277

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              VPKQ  S VWA T+N++GYI+++TTAVA++  VARM +LVE AQ+++S+ QR ID  AK
Sbjct  278   PVPKQPHSDVWAGTMNMDGYIAVRTTAVADNSTVARMDRLVEAAQNSRSKTQRLIDICAK  337

Query  3399  YYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPA+V  +A + +  + +  ++  + ++LALV+LVSACPCALVLSTPVA FCA+ RAA
Sbjct  338   YYTPAVVVAAAGVPMIPALLGADSLRQWWNLALVLLVSACPCALVLSTPVATFCAMLRAA  397

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
              +G+  KG + LE L +++ +AFDKTGTITRGEF++  F  + + +  + LL WV+SIES
Sbjct  398   RMGIFIKGGDVLESLGEIRAVAFDKTGTITRGEFSIDSFHLVENKLEIDHLLHWVASIES  457

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             KSSHPMA A+++YAQS S++PNPE V  F+ +PGEGIYGEI G  IYIGN++  ARA   
Sbjct  458   KSSHPMAAALVEYAQSKSIQPNPENVGDFRIYPGEGIYGEIHGKHIYIGNRRALARASSP  517

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
                +      +G S+ Y+     LAGVFSLSD CRTGA EA+R+L  +GIK+VMLTGDS 
Sbjct  518   QQVQETSGMIKGVSVGYVICDGELAGVFSLSDDCRTGAAEAVRELGSLGIKSVMLTGDST  577

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATADVGI  2509
              AA H Q QLGG ++E H+ELLPE+K +++   + + G T M+GDG+NDA ALA ADVG+
Sbjct  578   RAAMHAQGQLGGVMEELHSELLPEDKVRLVGGLKARFGPTMMVGDGMNDAAALAAADVGV  637

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMGISGS  A ET H  LM++D+ R+ +AI LGRR  R + VN+  ++  KAA++ LA +
Sbjct  638   SMGISGSAAAMETSHATLMSSDVLRVPEAIRLGRRARRIIAVNVAASLAVKAAVLVLAAS  697

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
               P++WAAVL DVGTCL+V+ NS  LLR
Sbjct  698   WRPVLWAAVLADVGTCLLVVLNSMTLLR  725



>gb|AFW69330.1| hypothetical protein ZEAMMB73_904472 [Zea mays]
Length=1003

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/546 (60%), Positives = 417/546 (76%), Gaps = 5/546 (1%)
 Frame = -1

Query  3873  GSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGEILDANQ  3694
             G+I L DY EA  IVFLFTT EWLE+RASHKA A MSSL+++  Q+AV+AETGE++ A  
Sbjct  64    GAIALKDYSEAGFIVFLFTTAEWLETRASHKATAGMSSLMSMAPQKAVVAETGEVVAAQD  123

Query  3693  VKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATINLNGYIS  3514
             VKV T+LAVKAGEV+PIDG+VV+G  EVDE TLTGESF V KQ +S VWA T+N++GYI+
Sbjct  124   VKVGTVLAVKAGEVVPIDGVVVDGRSEVDESTLTGESFPVAKQPESQVWAGTLNIDGYIA  183

Query  3513  IKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTP--AIVAISACLAISAVKV  3340
             ++TTA+A++ AVA+MA++VEEAQ+++SR QR ID  AKYYTP   ++A    +    V+ 
Sbjct  184   VRTTAMADNSAVAKMARMVEEAQNSRSRTQRLIDTCAKYYTPAVVVMAAGVAVVPVVVRA  243

Query  3339  ENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIA  3160
              N    + LALV+LVSACPCALVLSTPVA FCAL  AA  GLL KG + LE LA++K+ A
Sbjct  244   HNLKHWFQLALVLLVSACPCALVLSTPVATFCALLTAARTGLLIKGGDVLETLARIKIAA  303

Query  3159  FDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPN  2980
             FDKTGTITRGEF+V  F ++ + +    LL WVSSIES+SSHPMA  ++DYAQS SV P 
Sbjct  304   FDKTGTITRGEFSVEEFQAVGERVTTPQLLYWVSSIESRSSHPMASVLVDYAQSKSVGPK  363

Query  2979  PEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFVGS  2800
              + V  FQ FPGEGIYGEIDG  +YIGNK+I +RA C +VP  D+   +G ++ Y+    
Sbjct  364   SDNVAEFQIFPGEGIYGEIDGEGVYIGNKRILSRASCETVP--DMKDMKGVTVGYVACKG  421

Query  2799  SLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELL  2620
              L GVF+LSD+CRTG+ EAIR+L+ +GIK+VMLTGDS AAA + Q QLG  LDE H+ELL
Sbjct  422   QLIGVFTLSDSCRTGSDEAIRELRSLGIKSVMLTGDSSAAASYAQNQLGNILDEVHSELL  481

Query  2619  PEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTND  2443
             PE+K +I+ + + K G T MIGDG+NDAPALA ADVG+SMG+SGS +A ET H+ LM+ND
Sbjct  482   PEDKVRIVDELKAKHGPTLMIGDGMNDAPALAKADVGVSMGVSGSAVAMETSHITLMSND  541

Query  2442  IGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFN  2263
             I RI  A++L RR  R ++VNIV ++ TK AI+ LA+AGHPL+WAAVL DVGTC++VI  
Sbjct  542   IRRIPMAVQLARRTHRTIVVNIVFSVITKLAIVGLALAGHPLIWAAVLADVGTCMLVIMY  601

Query  2262  STLLLR  2245
             S LLLR
Sbjct  602   SMLLLR  607



>gb|EAZ03300.1| hypothetical protein OsI_25443 [Oryza sativa Indica Group]
 dbj|BAJ25743.1| heavy metal transporter 3 [Oryza sativa Indica Group]
Length=1004

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/700 (53%), Positives = 513/700 (73%), Gaps = 9/700 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+Y DV+G+CC +EV L++++L  LDGV  VSV+V ++TVVV HDP    +  IV+ALN
Sbjct  42    KKTYLDVLGVCCSAEVALVERLLAPLDGVRVVSVVVASRTVVVEHDPAAAPESAIVKALN  101

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G +    +  PSPY V  G+LL  SF ++++ PL+ LAVAA VAG+ P+
Sbjct  102   KAGLEASVRAYGSSGVVSRW-PSPYIVASGVLLTASFFEWLFPPLQCLAVAAVVAGAPPM  160

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             +RR  AA   L+LDIN+LM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  161   VRRGFAAASRLSLDINVLMLIAVAGALCLGDYTEAGAIVFLFTTAEWLETLACTKASAGM  220

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+ ++  +AV+A TGE++    V+V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  221   SSLMGMLPVKAVIATTGEVVSVRDVRVGDVVAVRAGEIVPVDGVVVDGQSEVDERSLTGE  280

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  S VWA T+NL+GYI+++TTA+AE+  VA+M +LVE AQ+++S+ QR ID  
Sbjct  281   SFPVPKQPHSEVWAGTMNLDGYIAVRTTALAENSTVAKMERLVEAAQNSRSKTQRLIDSC  340

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V ++A +A+  + +  +   + + LALV+LVSACPCALVLSTPVA FCA+ R
Sbjct  341   AKYYTPAVVVVAAGVALIPALLGADGLEQWWKLALVMLVSACPCALVLSTPVASFCAMLR  400

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLD-GINHNTLLSWVSS  3055
             AA +G+  KG + LE L +++ +AFDKTGTITRGEF++  F  + D  +  + LL W++S
Sbjct  401   AARMGIFIKGGDVLESLGEIRAVAFDKTGTITRGEFSIDSFHLVGDHKVEMDHLLYWIAS  460

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IESKSSHPMA A+++YAQS S++PNPE V  F+ +PGEGIYGEI G  IYIGN++  ARA
Sbjct  461   IESKSSHPMAAALVEYAQSKSIQPNPENVGDFRIYPGEGIYGEIHGKHIYIGNRRTLARA  520

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
                   +   +  +G S+ Y+     LAG+FSLSD CRTGA EAIR+L  +GIK+VMLTG
Sbjct  521   SSPQSTQEMGEMIKGVSIGYVICDGELAGIFSLSDDCRTGAAEAIRELGSLGIKSVMLTG  580

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS AAA H Q QLGG ++E H+ELLPE+K +++   + + G T M+GDG+NDA ALA AD
Sbjct  581   DSSAAATHAQGQLGGVMEELHSELLPEDKVRLVGGLKARFGPTMMVGDGMNDAAALAAAD  640

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMGISGS  A ET H  LM++D+ R+ +A+ LGRR  R + VN+  ++  KAA++AL
Sbjct  641   VGVSMGISGSAAAMETSHATLMSSDVLRVPEAVRLGRRARRTIAVNVAGSVAVKAAVLAL  700

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR----GGDRE  2230
             A A  P++WAAVL DVGTCL+V+ NS  LLR    GG +E
Sbjct  701   AAAWRPVLWAAVLADVGTCLLVVLNSMTLLREEWKGGAKE  740



>dbj|BAL46411.1| P-type ATPase [Glycine max]
Length=559

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/560 (58%), Positives = 421/560 (75%), Gaps = 19/560 (3%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             ++S F+V+G+CC +E  L+++ILK L GV +VSV+V T+TV VVHD LLI++ QI  ALN
Sbjct  6     KRSSFEVLGMCCATEEALVERILKPLRGVKDVSVIVPTRTVTVVHDVLLISESQIADALN  65

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A LEAS+++ GET D  K  P    +VCG+LL LSFLKY Y PL WLA+ + V G   V
Sbjct  66    AARLEASLRLQGET-DNEKKWPDLTTMVCGLLLALSFLKYAYQPLGWLALGSVVIGFPKV  124

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L RA+A+++ LTL+INIL++++V G+  L D+WEA  I+FLF+  +WLE+RA+HKAM AM
Sbjct  125   LLRAIASIKALTLNINILVLLAVCGTAALQDFWEAGIIIFLFSIAQWLETRATHKAMVAM  184

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL ++  Q+AV+AETGE++D N VK++TILAVKAG+ IP+DGIVVEG+CEVDEK LTGE
Sbjct  185   SSLTSMAPQKAVIAETGELVDVNDVKINTILAVKAGDAIPLDGIVVEGKCEVDEKMLTGE  244

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S  V K+ DS VWA TIN+NGYIS+KTT +A+D  VARM+KLVEEA S KSR QR ID  
Sbjct  245   SLPVTKELDSVVWAGTINVNGYISVKTTVLAKDTVVARMSKLVEEASSRKSRTQRFIDHF  304

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYY PA+V ISA +A+  +A+KV N    +HLA+VVL+SACPCAL+LSTPVA+FCAL++
Sbjct  305   AKYYIPAVVLISASIAVVPAALKVPNIKPWFHLAIVVLLSACPCALILSTPVAIFCALTK  364

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +Y+E L+ +K +AFDKTGTITRGEFTV  FS  +D I+  TLL WVSS+
Sbjct  365   AAISGLLLKGGDYIETLSGIKTVAFDKTGTITRGEFTVTDFSVSVDDISIETLLYWVSSV  424

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ESKSSHPMA A+++Y   +SV+P PE VE+FQNFPGEG+YG I+G +IYIGN++I ARAG
Sbjct  425   ESKSSHPMAAALVEYGMLNSVKPIPENVENFQNFPGEGVYGIINGKDIYIGNRRIGARAG  484

Query  2871  CTSV--------PEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGI  2716
                V        PE     +          G +L GVF L+D CR+GA EAI +LK++G+
Sbjct  485   SERVDCRTQCQSPEISTPNQ--------CCGPTLVGVFRLADTCRSGALEAIEELKLLGV  536

Query  2715  KTVMLTGDSYAAARHVQEQL  2656
             ++VMLTGDS  AA + Q Q+
Sbjct  537   RSVMLTGDSSQAAMYAQSQV  556



>ref|NP_001059240.2| Os07g0232900 [Oryza sativa Japonica Group]
 dbj|BAC21509.1| putative potential cadmium/zinc-transporting ATPase 4 [Oryza 
sativa Japonica Group]
 dbj|BAF21154.2| Os07g0232900 [Oryza sativa Japonica Group]
 dbj|BAJ23048.1| cadmium selective transporter for low entry to shoot 1 from Nipponbare 
[Oryza sativa Japonica Group]
 dbj|BAJ25742.1| heavy metal transporter 3 [Oryza sativa Japonica Group]
Length=1004

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/700 (53%), Positives = 511/700 (73%), Gaps = 9/700 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+Y DV+G+CC +EV L++++L  LDGV  VSV+V ++TVVV HDP    +  IV+ALN
Sbjct  42    KKTYLDVLGVCCSAEVALVERLLAPLDGVRVVSVVVASRTVVVEHDPAAAPESAIVKALN  101

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G +    +  PSPY V  G+LL  SF ++++ PL+ LAVAA VAG+ P+
Sbjct  102   KAGLEASVRAYGSSGVVSR-WPSPYIVASGVLLTASFFEWLFPPLQCLAVAAVVAGAPPM  160

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             +RR  AA   L+LDIN+LM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  161   VRRGFAAASRLSLDINVLMLIAVAGALCLGDYTEAGAIVFLFTTAEWLETLACTKASAGM  220

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+ ++  +AV+A TGE++    V+V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  221   SSLMGMLPVKAVIATTGEVVSVRDVRVGDVVAVRAGEIVPVDGVVVDGQSEVDERSLTGE  280

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  S VWA T+N +GYI+++TTA+AE+  VA+M +LVE AQ+++S+ QR ID  
Sbjct  281   SFPVPKQPHSEVWAGTMNFDGYIAVRTTALAENSTVAKMERLVEAAQNSRSKTQRLIDSC  340

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V ++A +A+  + +  +   + + LALV+LVSACPCALVLSTPVA FCA+ R
Sbjct  341   AKYYTPAVVVVAAGVALIPALLGADGLEQWWKLALVMLVSACPCALVLSTPVASFCAMLR  400

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLD-GINHNTLLSWVSS  3055
             AA +G+  KG + LE L +++ +AFDKTGTITRGEF++  F  + D  +  + LL W++S
Sbjct  401   AARMGIFIKGGDVLESLGEIRAVAFDKTGTITRGEFSIDSFHLVGDHKVEMDHLLYWIAS  460

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IESKSSHPMA A+++YAQS S++PNPE V  F+ +PGEGIYGEI G  IYIGN++  ARA
Sbjct  461   IESKSSHPMAAALVEYAQSKSIQPNPENVGDFRIYPGEGIYGEIHGKHIYIGNRRTLARA  520

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
                   +   +  +G S+ Y+     LAGVFSLSD CRTGA EAIR+L  +GIK+VMLTG
Sbjct  521   SSPQSTQEMGEMIKGVSIGYVICDGELAGVFSLSDDCRTGAAEAIRELGSLGIKSVMLTG  580

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS AAA H Q QLGG ++E H+ELLPE+K +++   + + G T M+GDG+NDA ALA AD
Sbjct  581   DSSAAATHAQGQLGGVMEELHSELLPEDKVRLVSGLKARFGPTMMVGDGMNDAAALAAAD  640

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMGISGS  A ET H  LM++D+ R+ +A+ LGR   R + VN+  ++  KAA++AL
Sbjct  641   VGVSMGISGSAAAMETSHATLMSSDVLRVPEAVRLGRCARRTIAVNVAGSVAVKAAVLAL  700

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR----GGDRE  2230
             A A  P++WAAVL DVGTCL+V+ NS  LLR    GG +E
Sbjct  701   AAAWRPVLWAAVLADVGTCLLVVLNSMTLLREEWKGGAKE  740



>dbj|BAJ25745.1| heavy metal transporter 3 [Oryza sativa Japonica Group]
Length=1004

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/700 (53%), Positives = 510/700 (73%), Gaps = 9/700 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+Y DV+G+CC +EV L++++L  LDGV  VSV+V ++TVVV HDP    +  IV+ALN
Sbjct  42    KKTYLDVLGVCCSAEVALVERLLAPLDGVRVVSVVVASRTVVVEHDPAAAPESAIVKALN  101

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G +    +  PSPY V  G+LL  SF ++++ PL+ LAVAA VAG+ P+
Sbjct  102   KAGLEASVRAYGSSGVVSR-WPSPYIVASGVLLTASFFEWLFPPLQCLAVAAVVAGAPPM  160

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             +RR  AA   L+LDIN+LM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  161   VRRGFAAASRLSLDINVLMLIAVAGALCLGDYTEAGAIVFLFTTAEWLETLACTKASAGM  220

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+ ++  +AV+A TGE++    V+V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  221   SSLMGMLPVKAVIATTGEVVSVRDVRVGDVVAVRAGEIVPVDGVVVDGQSEVDERSLTGE  280

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  S VWA T+N +GYI+++TTA+AE+  VA+M +LVE AQ+++S+ QR ID  
Sbjct  281   SFPVPKQPHSEVWAGTMNFDGYIAVRTTALAENSTVAKMERLVEAAQNSRSKTQRLIDSC  340

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V ++A +A+  + +  +   + + LALV+LVSACPCALVLSTPVA FCA+ R
Sbjct  341   AKYYTPAVVVVAAGVALIPALLGADGLEQWWKLALVMLVSACPCALVLSTPVASFCAMLR  400

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLD-GINHNTLLSWVSS  3055
             AA +G+  KG + LE L +++ +AFDKTGTITRGEF++  F  + D  +  + LL W++S
Sbjct  401   AARMGIFIKGGDVLESLGEIRAVAFDKTGTITRGEFSIDSFHLVGDHKVEMDHLLYWIAS  460

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IESKSSHPMA A+++YAQS S++PNPE V  F+ +PGEGIYGEI G  IYIGN++  ARA
Sbjct  461   IESKSSHPMAAALVEYAQSKSIQPNPENVGDFRIYPGEGIYGEIHGKHIYIGNRRTLARA  520

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
                   +   +  +G S+ Y+     LAGVFSLSD CRTGA EAIR+L  +GIK+VMLTG
Sbjct  521   SSPQSTQEMGEMIKGVSIGYVICDGELAGVFSLSDDCRTGAAEAIRELGSLGIKSVMLTG  580

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS AAA H Q QLGG ++E H+ELLPE+K +++   + + G T M+GDG+NDA ALA AD
Sbjct  581   DSSAAATHAQGQLGGVMEELHSELLPEDKVRLVSGLKARFGPTMMVGDGMNDAAALAAAD  640

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMGISGS  A ET H  LM++D+ R+ +A+ LGR   R + VN+  ++  KAA++AL
Sbjct  641   VGVSMGISGSAAAMETSHATLMSSDVLRVPEAVRLGRCARRTIAVNVAGSVAVKAAVLAL  700

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR----GGDRE  2230
             A A  P++WAAV  DVGTCL+V+ NS  LLR    GG +E
Sbjct  701   AAAWRPVLWAAVFADVGTCLLVVLNSMTLLREEWKGGAKE  740



>dbj|BAJ23049.1| cadmium selective transporter for low entry to shoot 1 from Anjana 
Dhan [Oryza sativa Indica Group]
 dbj|BAJ25741.1| heavy metal transporter 3 [Oryza sativa Indica Group]
 dbj|BAJ25744.1| heavy metal transporter 3 [Oryza sativa Indica Group]
Length=951

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/700 (54%), Positives = 510/700 (73%), Gaps = 9/700 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+Y DV+G+CC +EV L++++L  LDGV  VSV+V + TVVV HDP    +  IV+ALN
Sbjct  42    KKTYLDVLGVCCSAEVALVERLLAPLDGVRVVSVVVASHTVVVEHDPAAAPESVIVKALN  101

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G +    +  PSPY V  G+LL  SF ++++ PL+ LAVAA VAG+ P+
Sbjct  102   KAGLEASVRAYGSSGVVSRW-PSPYIVASGVLLTASFFEWLFPPLQCLAVAAVVAGAPPM  160

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             +RR  AA   L+LDIN+LM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  161   VRRGFAAASRLSLDINVLMLIAVSGALCLGDYTEAGAIVFLFTTAEWLETLACTKASAGM  220

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+ ++  +AV+A TGE++    V+V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  221   SSLMGMLPVKAVIATTGEVVSVRDVRVGDVVAVRAGEIVPVDGVVVDGQSEVDERSLTGE  280

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  S VWA T+NL+GYI+++TTA+AE+  VA+M +LVE AQ+++S+ QR ID  
Sbjct  281   SFPVPKQPHSEVWAGTMNLDGYIAVRTTALAENSTVAKMERLVEAAQNSRSKMQRLIDSC  340

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V ++A +A+  + +  +   + + LALV+LVS CPCALVLSTPVA FCA+ R
Sbjct  341   AKYYTPAVVVVAAGVALIPALLGADGLEQWWKLALVMLVSVCPCALVLSTPVASFCAMLR  400

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLD-GINHNTLLSWVSS  3055
             AA +G+  KG + LE L +++ +AFDKTGTITRGEF++  F  + D  +  + LL W++S
Sbjct  401   AARMGIFIKGGDVLESLGEIRAVAFDKTGTITRGEFSIDSFHLVGDHKVEMDHLLYWIAS  460

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IESKSSHPMA A+++YAQS S++PNPE V  FQ +PGEGIYGEI G  IYIGN++  ARA
Sbjct  461   IESKSSHPMAAALVEYAQSKSIQPNPENVADFQIYPGEGIYGEIHGKHIYIGNRRTLARA  520

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
                   +   +  +G S+ Y+     LAGVFSLSD CRTGA EAIR+L  +GIKTVMLTG
Sbjct  521   SSPQTIQEMGEMIKGVSIGYVICDGELAGVFSLSDDCRTGAAEAIRELGSLGIKTVMLTG  580

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS AAA H Q QLG  ++E H+ELLPE+K +++   + + G T M+GDG+NDA ALA AD
Sbjct  581   DSSAAATHAQGQLGAVMEELHSELLPEDKVRLVDGLKARFGPTMMVGDGMNDAAALAVAD  640

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMGISGS  A ET H  LM++D+ R+ +A+ LGRR  R + VN+  ++  KAA++AL
Sbjct  641   VGVSMGISGSAAAMETSHATLMSSDVLRVPEAVRLGRRARRTIAVNVAGSVAVKAAVLAL  700

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR----GGDRE  2230
             A A  P++WAAVL DVGTCL+V+ NS  LLR    GG +E
Sbjct  701   AAAWRPVLWAAVLADVGTCLLVVLNSMTLLREKWKGGAKE  740



>gb|KEH37412.1| heavy metal ATPase transporter [Medicago truncatula]
Length=677

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/523 (60%), Positives = 399/523 (76%), Gaps = 19/523 (4%)
 Frame = -1

Query  3783  KAMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDE  3604
             KA+ AMSSL N+  Q A++AETGE +D N VK++TILAVKAG+ IP+DGIVVEG+CEVDE
Sbjct  27    KALVAMSSLTNMAPQMAIVAETGERVDVNDVKMNTILAVKAGDAIPLDGIVVEGKCEVDE  86

Query  3603  KTLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQ  3424
             K LTGESF V K+ DS VWA TIN+NGYIS++TT +A+D  VARM++LVEEA S KS AQ
Sbjct  87    KMLTGESFPVTKESDSLVWAGTINMNGYISVRTTVLAKDTVVARMSRLVEEASSRKSLAQ  146

Query  3423  RSIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAM  3250
             R ID  AKYY P +V ISA +A+  +A+ V +    +HLALVVL+S CPCAL+LSTPVA+
Sbjct  147   RFIDNFAKYYIPVVVLISASIAVVPAALSVPDMEPWFHLALVVLLSGCPCALILSTPVAI  206

Query  3249  FCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLL  3070
             FCAL++AA  GLL KG +YLE L+++K +AFDKTGTITRGEF+V  FS+  D IN+ TLL
Sbjct  207   FCALTKAAISGLLLKGGDYLETLSRIKTVAFDKTGTITRGEFSVTDFSAG-DDINNETLL  265

Query  3069  SWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKK  2890
              W+SSIESKSSHP+A A++DYA+ HS++P PE VE+FQNFPGEGI+G IDG +IYIGNK+
Sbjct  266   YWISSIESKSSHPVAGALVDYARLHSIKPVPENVENFQNFPGEGIFGTIDGRDIYIGNKR  325

Query  2889  ISARAGCT--------SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRK  2734
             +  RA C           PE        +         +L GVFSL DACR+GA EA+ +
Sbjct  326   VGVRAICKRDNCEVQFQRPEISTKKNNCEE--------TLVGVFSLVDACRSGALEAMEE  377

Query  2733  LKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGD  2554
             LK++G+++VMLTGDS   A +VQ QL  A+D  HAELLP EKA++I+ F+K G   MIGD
Sbjct  378   LKLLGVRSVMLTGDSSQVAMYVQSQLKNAIDIVHAELLPHEKAKLIENFKKEGPIAMIGD  437

Query  2553  GLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIV  2374
             G+NDAPALATAD+GISMGISGS LA ET + ILM+NDI ++ +AI L R+  RK++ N++
Sbjct  438   GINDAPALATADIGISMGISGSALANETSNAILMSNDIRKVPEAIRLARKTTRKLVENVI  497

Query  2373  VAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             +++  K AI+ALAIAG+PLVW AVL DVGTCL+VI NS L+L+
Sbjct  498   ISVGFKCAILALAIAGYPLVWLAVLTDVGTCLLVILNSMLILQ  540



>ref|NP_194741.2| putative inactive cadmium/zinc-transporting ATPase HMA3 [Arabidopsis 
thaliana]
 sp|P0CW77.1|HMA3A_ARATH RecName: Full=Putative inactive cadmium/zinc-transporting ATPase 
HMA3; AltName: Full=Putative inactive cadmium/zinc-transporting 
ATPase 4; AltName: Full=Putative inactive protein HEAVY 
METAL ATPASE 3 [Arabidopsis thaliana]
 gb|ABE66104.1| ATPase E1-E2 type family protein/heavy-metal-associated domain-containing 
protein [Arabidopsis thaliana]
 gb|AEE85723.1| heavy metal atpase 3 [Arabidopsis thaliana]
Length=542

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/530 (58%), Positives = 411/530 (78%), Gaps = 5/530 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ +DGV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSIVGNVLRQVDGVKEFSVIVPSRTVIVVHDTFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+LL+LSF KY Y+PL+WLA+ A VAG FP+
Sbjct  73    QARLEASVRPYGETSLKSQW-PSPFAIVSGVLLVLSFFKYFYSPLEWLAIVAVVAGVFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + D+ EAATIVFLF+  +WLES A+HKA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATLCMQDFTEAATIVFLFSVADWLESSAAHKASIVM  191

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+A+TG  +D ++V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  192   SSLMSLAPRKAVIADTGLEVDVDEVGINTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  251

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ++STV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  252   SFPVSKQRESTVMAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  311

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V  +AC A+  V  KV++ S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  312   SRYYTPAVVVSAACFAVIPVLLKVQDLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  371

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K++AFDKTGTIT+ EF V+ F SL   IN + LL WVSSI
Sbjct  372   AATSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSPSINLHKLLYWVSSI  431

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E KSSHPMA A+IDYA+S SVEP P+ VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  432   ECKSSHPMAAALIDYARSVSVEPKPDIVENFQNFPGEGVYGRIDGQDIYIGNKRIAQRAG  491

Query  2871  CTS--VPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLK  2728
             C +  VP+ +   + GK++ YI++G+ L G F+L D CR G  +A+++LK
Sbjct  492   CLTDNVPDIEATMKRGKTIGYIYMGAKLTGSFNLLDGCRYGVAQALKELK  541



>ref|XP_002983485.1| hypothetical protein SELMODRAFT_118425 [Selaginella moellendorffii]
 gb|EFJ15386.1| hypothetical protein SELMODRAFT_118425 [Selaginella moellendorffii]
Length=831

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/700 (48%), Positives = 482/700 (69%), Gaps = 9/700 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     ++  +V+GICCPSEVPL+ KIL+ L GV EVSV  T++ V V+HD LL  + ++
Sbjct  39    NFQQVARTVLNVMGICCPSEVPLVRKILEPLPGVKEVSVNYTSRIVTVLHDRLLTPEGRL  98

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A L+AS+   GE        PSP+ + CGILLL+SF K+ + PLKW A+ A   
Sbjct  99    VKALNEARLDASLHHRGELKRSSNW-PSPWTICCGILLLVSFFKHFWNPLKWFAIGAVAV  157

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G  P+  R++A+LR   LDINILM+I+V G+I L DY EA +IVFLFT  EWLE R+S +
Sbjct  158   GIPPIFMRSIASLRRWILDINILMLIAVGGAIALTDYIEAGSIVFLFTLAEWLEGRSSEQ  217

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A +A++S ++V  + A+LAETG ++  ++VK+ + +AVKAGE+IP+DGI++ GEC +DE 
Sbjct  218   ARSALASGLDV-PRNAILAETGAMVPVDEVKLGSSIAVKAGEMIPVDGIIMSGECSLDES  276

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             +LTGES  V K   S VWA T+NL GYI+++TTA+AED AV+RM KLVEEAQ+ +S  ++
Sbjct  277   SLTGESKPVEKACGSEVWAGTVNLAGYITVQTTALAEDSAVSRMIKLVEEAQAKRSHFEQ  336

Query  3420  SIDKIAKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMF  3247
              ++K AK+YTPA+VA +  LA+  +      E++  +LAL++LV ACPCALVLSTPVA+ 
Sbjct  337   LVEKFAKFYTPALVATALGLALIPLIAHTHHEKHWLYLALILLVVACPCALVLSTPVAVA  396

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             C +  AA LG++ KG  YLEILAK+K +A DKTGT+T G F V+    + +  +   +L 
Sbjct  397   CGIQHAARLGVVIKGGSYLEILAKIKCLAMDKTGTLTEGHFRVSEVVPVGETEDLQQILY  456

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             W++S+ES+SSHPMA A++ YA    V P+ + V  FQ   GEG+   +DG  + IGN ++
Sbjct  457   WLTSVESRSSHPMAAALVTYASLQDVVPS-KSVTDFQIIEGEGVSAVVDGHLVEIGNARL  515

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++R G +S     +  + G ++ ++     L  VFSL D  R  A EA+  LK M ++  
Sbjct  516   ASRLGWSSTAITKLKNQTG-TVGWLGKDHQLLAVFSLEDHVREEAAEAVSSLKRMKVQIH  574

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPAL  2530
             MLTGD++  A+ VQ +LGG     HA LLP++K +II++ ++  G TGMIGDG+NDAPAL
Sbjct  575   MLTGDNHETAQSVQRKLGGV--TVHAGLLPQDKVRIIQELKENHGVTGMIGDGINDAPAL  632

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             A ADVG +MG++GS +A ET  V LMT+D+ ++     LGRRV  KVI N+V+++  K A
Sbjct  633   AAADVGFAMGLAGSAVAMETSDVFLMTDDLRKLSMVASLGRRVRTKVIQNVVISVGLKVA  692

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             ++AL+ AG+  +W AVLVDVG CL+VI NSTLLLRG  ++
Sbjct  693   MLALSFAGYGYLWMAVLVDVGACLLVISNSTLLLRGTGKK  732



>gb|KEH37414.1| heavy metal ATPase transporter [Medicago truncatula]
Length=646

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/518 (60%), Positives = 395/518 (76%), Gaps = 19/518 (4%)
 Frame = -1

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSL N+  Q A++AETGE +D N VK++TILAVKAG+ IP+DGIVVEG+CEVDEK LTG
Sbjct  1     MSSLTNMAPQMAIVAETGERVDVNDVKMNTILAVKAGDAIPLDGIVVEGKCEVDEKMLTG  60

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF V K+ DS VWA TIN+NGYIS++TT +A+D  VARM++LVEEA S KS AQR ID 
Sbjct  61    ESFPVTKESDSLVWAGTINMNGYISVRTTVLAKDTVVARMSRLVEEASSRKSLAQRFIDN  120

Query  3408  IAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYY P +V ISA +A+  +A+ V +    +HLALVVL+S CPCAL+LSTPVA+FCAL+
Sbjct  121   FAKYYIPVVVLISASIAVVPAALSVPDMEPWFHLALVVLLSGCPCALILSTPVAIFCALT  180

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  GLL KG +YLE L+++K +AFDKTGTITRGEF+V  FS+  D IN+ TLL W+SS
Sbjct  181   KAAISGLLLKGGDYLETLSRIKTVAFDKTGTITRGEFSVTDFSAG-DDINNETLLYWISS  239

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IESKSSHP+A A++DYA+ HS++P PE VE+FQNFPGEGI+G IDG +IYIGNK++  RA
Sbjct  240   IESKSSHPVAGALVDYARLHSIKPVPENVENFQNFPGEGIFGTIDGRDIYIGNKRVGVRA  299

Query  2874  GCT--------SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMG  2719
              C           PE        +         +L GVFSL DACR+GA EA+ +LK++G
Sbjct  300   ICKRDNCEVQFQRPEISTKKNNCEE--------TLVGVFSLVDACRSGALEAMEELKLLG  351

Query  2718  IKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDA  2539
             +++VMLTGDS   A +VQ QL  A+D  HAELLP EKA++I+ F+K G   MIGDG+NDA
Sbjct  352   VRSVMLTGDSSQVAMYVQSQLKNAIDIVHAELLPHEKAKLIENFKKEGPIAMIGDGINDA  411

Query  2538  PALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICT  2359
             PALATAD+GISMGISGS LA ET + ILM+NDI ++ +AI L R+  RK++ N+++++  
Sbjct  412   PALATADIGISMGISGSALANETSNAILMSNDIRKVPEAIRLARKTTRKLVENVIISVGF  471

Query  2358  KAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             K AI+ALAIAG+PLVW AVL DVGTCL+VI NS L+L+
Sbjct  472   KCAILALAIAGYPLVWLAVLTDVGTCLLVILNSMLILQ  509



>ref|XP_002974006.1| hypothetical protein SELMODRAFT_149298 [Selaginella moellendorffii]
 gb|EFJ24961.1| hypothetical protein SELMODRAFT_149298 [Selaginella moellendorffii]
Length=781

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/688 (49%), Positives = 475/688 (69%), Gaps = 9/688 (1%)
 Frame = -1

Query  4284  IGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNKASLEAS  4105
             +GICCPSEVPL+ KIL+ L GV EVSV  T++ V V+HD LL  + ++V+ALN+A L+AS
Sbjct  1     MGICCPSEVPLVRKILEPLPGVKEVSVNYTSRIVTVLHDRLLTPEGRLVKALNEARLDAS  60

Query  4104  IKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLRRAVAA  3925
             +   GE        PSP+ + CGILLL+SF K+ + PLKW A+ A   G  P+  R++A+
Sbjct  61    LHHRGELKRSSNW-PSPWTICCGILLLVSFFKHFWNPLKWFAIGAVAVGIPPIFMRSIAS  119

Query  3924  LRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVV  3745
             LR   LDINILM+I+V G+I L DY EA +IVFLFT  EWLE R+S +A +A++S ++V 
Sbjct  120   LRRWILDINILMLIAVGGAIALTDYIEAGSIVFLFTLAEWLEGRSSEQARSALASGLDV-  178

Query  3744  SQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQ  3565
              + A+LAETG ++  ++VK+ + +AVKAGE+IP+DGI++ GEC +DE +LTGES  V K 
Sbjct  179   PRNAILAETGAMVPVDEVKLGSSIAVKAGEMIPVDGIIMSGECSLDESSLTGESKPVEKA  238

Query  3564  KDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPA  3385
               S VWA T+NL GYI+++TTA+AED AV+RM KLVEEAQ+ +S  ++ ++K AK+YTPA
Sbjct  239   CGSEVWAGTVNLAGYITVQTTALAEDSAVSRMIKLVEEAQAKRSHFEQLVEKFAKFYTPA  298

Query  3384  IVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMFCALSRAAALGLL  3211
             +VA +  LA+  +      E++  +LAL++LV ACPCALVLSTPVA+ C +  AA LG++
Sbjct  299   LVATALGLALIPLIAHTHHEKHWLYLALILLVVACPCALVLSTPVAVACGIQHAARLGVV  358

Query  3210  FKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHP  3031
              KG  YLEILAK+K +A DKTGT+T G F V+    + +      +L W++S+ES+SSHP
Sbjct  359   IKGGSYLEILAKIKCLAMDKTGTLTEGHFRVSEVVPVGETEGLQQILYWLTSVESRSSHP  418

Query  3030  MAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEF  2851
             MA A++ YA    V P+ + V  FQ   GEG+   +DG  + IGN ++++R G  +    
Sbjct  419   MAAALVTYASLQDVVPS-KSVTDFQIIEGEGVSAVVDGHLVEIGNARLASRLGWNNTAIT  477

Query  2850  DVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSYAAARH  2671
              +  + G ++ ++     L  VFSL D  R  A EA+  LK M ++  MLTGD++  A+ 
Sbjct  478   KLKNQTG-TVGWLGKDHQLLAVFSLEDHVREEAAEAVSSLKRMKVQIHMLTGDNHETAQS  536

Query  2670  VQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPALATADVGISMGIS  2494
             VQ +LGG     HA LLP++K +II++ ++  G TGMIGDG+NDAPALA ADVG +MG++
Sbjct  537   VQRKLGGV--TVHAGLLPQDKVRIIQELKENHGMTGMIGDGINDAPALAAADVGFAMGLA  594

Query  2493  GSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIAGHPLV  2314
             GS +A ET  V LMT+D+ ++     LGRRV  KVI N+V+++  K A++AL+ AG+  +
Sbjct  595   GSAVAMETSDVFLMTDDLRKLSMVASLGRRVRTKVIQNVVISVGLKVAMLALSFAGYGYL  654

Query  2313  WAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
             W AVLVDVG CL+VI NSTLLLRG  ++
Sbjct  655   WMAVLVDVGACLLVISNSTLLLRGTGKK  682



>gb|EAZ39201.1| hypothetical protein OsJ_23627 [Oryza sativa Japonica Group]
Length=1006

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/702 (52%), Positives = 500/702 (71%), Gaps = 11/702 (2%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHE--vsvmvttktvvvVHDPLLITQHQIVRA  4132
             +K+Y DV+G+CC +EV L++++L  LDGV        V  +            +H+ V+A
Sbjct  42    KKTYLDVLGVCCSAEVALVERLLAPLDGVPRGVRRRGVPHRRRRARPRRRPGVRHRAVKA  101

Query  4131  LNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSF  3952
             LNKA LEAS++  G +    +  PSPY V  G+LL  SF ++++ PL+ LAVAA VAG+ 
Sbjct  102   LNKAGLEASVRAYGSSGVVSR-WPSPYIVASGVLLTASFFEWLFPPLQCLAVAAVVAGAP  160

Query  3951  PVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMA  3772
             P++RR  AA   L+LDIN+LM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A
Sbjct  161   PMVRRGFAAASRLSLDINVLMLIAVAGALCLGDYTEAGAIVFLFTTAEWLETLACTKASA  220

Query  3771  AMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLT  3592
              MSSL+ ++  +AV+A TGE++    V+V  ++AV+AGE++P+DG+VV+G+ EVDE++LT
Sbjct  221   GMSSLMGMLPVKAVIATTGEVVSVRDVRVGDVVAVRAGEIVPVDGVVVDGQSEVDERSLT  280

Query  3591  GESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSID  3412
             GESF VPKQ  S VWA T+N +GYI+++TTA+AE+  VA+M +LVE AQ+++S+ QR ID
Sbjct  281   GESFPVPKQPHSEVWAGTMNFDGYIAVRTTALAENSTVAKMERLVEAAQNSRSKTQRLID  340

Query  3411  KIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCAL  3238
               AKYYTPA+V ++A +A+  + +  +   + + LALV+LVSACPCALVLSTPVA FCA+
Sbjct  341   SCAKYYTPAVVVVAAGVALIPALLGADGLEQWWKLALVMLVSACPCALVLSTPVASFCAM  400

Query  3237  SRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLD-GINHNTLLSWV  3061
              RAA +G+  KG + LE L +++ +AFDKTGTITRGEF++  F  + D  +  + LL W+
Sbjct  401   LRAARMGIFIKGGDVLESLGEIRAVAFDKTGTITRGEFSIDSFHLVGDHKVEMDHLLYWI  460

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             +SIESKSSHPMA A+++YAQS S++PNPE V  F+ +PGEGIYGEI G  IYIGN++  A
Sbjct  461   ASIESKSSHPMAAALVEYAQSKSIQPNPENVGDFRIYPGEGIYGEIHGKHIYIGNRRTLA  520

Query  2880  RAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
             RA      +   +  +G S+ Y+     LAGVFSLSD CRTGA EAIR+L  +GIK+VML
Sbjct  521   RASSPQSTQEMGEMIKGVSIGYVICDGELAGVFSLSDDCRTGAAEAIRELGSLGIKSVML  580

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALAT  2524
             TGDS AAA H Q QLGG ++E H+ELLPE+K +++   + + G T M+GDG+NDA ALA 
Sbjct  581   TGDSSAAATHAQGQLGGVMEELHSELLPEDKVRLVSGLKARFGPTMMVGDGMNDAAALAA  640

Query  2523  ADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIM  2344
             ADVG+SMGISGS  A ET H  LM++D+ R+ +A+ LGR   R + VN+  ++  KAA++
Sbjct  641   ADVGVSMGISGSAAAMETSHATLMSSDVLRVPEAVRLGRCARRTIAVNVAGSVAVKAAVL  700

Query  2343  ALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR----GGDRE  2230
             ALA A  P++WAAVL DVGTCL+V+ NS  LLR    GG +E
Sbjct  701   ALAAAWRPVLWAAVLADVGTCLLVVLNSMTLLREEWKGGAKE  742



>ref|XP_007138819.1| hypothetical protein PHAVU_009G240000g [Phaseolus vulgaris]
 gb|ESW10813.1| hypothetical protein PHAVU_009G240000g [Phaseolus vulgaris]
Length=709

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/517 (61%), Positives = 395/517 (76%), Gaps = 5/517 (1%)
 Frame = -1

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSL ++  Q+AV+AETGE +D N VK+DTILAV+ G+ IP+DGIVVEG+CEVDEK LTG
Sbjct  1     MSSLTSMAPQKAVIAETGERVDVNDVKIDTILAVRPGDAIPLDGIVVEGKCEVDEKMLTG  60

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ES  V K+ DS VWA TIN+NGYIS+KTT +A+D  VARM+KLVEEA S KSR QR ID 
Sbjct  61    ESLPVIKEFDSVVWAGTINVNGYISVKTTVLAKDTVVARMSKLVEEASSRKSRTQRFIDN  120

Query  3408  IAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYY PA+V ISA +A+  +A++V +     HLA+VVL+SACPCAL+LSTPVA+FCAL+
Sbjct  121   FAKYYIPAVVLISASIAVVPAAIEVPDIKPWLHLAIVVLLSACPCALILSTPVAIFCALT  180

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  GLL KG +Y+E L+ +K +AFDKTGTITRGEFTV  FS  +D I+  TLL WVSS
Sbjct  181   KAATSGLLLKGGDYVETLSGIKTVAFDKTGTITRGEFTVTDFS-FVDDISIETLLYWVSS  239

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             IESKSSHPMA ++++Y  SHSV P PE VE+F+NF GEG++G IDG +IYIGN++I ARA
Sbjct  240   IESKSSHPMAASLVEYGMSHSVRPIPENVENFENFAGEGVFGTIDGKDIYIGNRRIGARA  299

Query  2874  GCTSVP-EFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLT  2698
                 V     +   E  S      G +L GVFSL D CR+GA EAI +LK++G+++VMLT
Sbjct  300   DSARVDCHLQLQSHE-ISTPKEHCGPTLVGVFSLVDTCRSGALEAIEELKLLGVRSVMLT  358

Query  2697  GDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAPALATAD  2518
             GDS  AA +VQ QL   LD  HAELLP EKA II+  +K G   MIGDG+NDAPALATAD
Sbjct  359   GDSSQAAMYVQSQLNHGLDLVHAELLPAEKAVIIENLKKDGLIAMIGDGINDAPALATAD  418

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             +GISMGISGS LA ETG+ ILM+NDI +I +AI L R+  RK+I N+++++  K+AI+AL
Sbjct  419   IGISMGISGSALANETGNAILMSNDIQKIPEAIRLARKTTRKLIENVIISVGFKSAILAL  478

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             AIAG+P+VW AVL DVGTCL+VIFNS L+L+   + A
Sbjct  479   AIAGYPIVWLAVLTDVGTCLLVIFNSMLILQETPKSA  515



>ref|XP_002976118.1| hypothetical protein SELMODRAFT_104244 [Selaginella moellendorffii]
 gb|EFJ23023.1| hypothetical protein SELMODRAFT_104244 [Selaginella moellendorffii]
Length=818

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/696 (49%), Positives = 484/696 (70%), Gaps = 9/696 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     ++   V+G+CCPSEVPL+ KIL+ L GV EVSV  T ++V VVHD LL  + ++
Sbjct  40    NFQQVTRTVLSVMGLCCPSEVPLVRKILEPLPGVKEVSVNYTARSVTVVHDKLLTPEGRL  99

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A L+AS+   GE     K  PSP+ + CGILLL+SF K+ + PLKW+A+ A   
Sbjct  100   VKALNEARLDASLHRRGELKKANKW-PSPWTICCGILLLVSFFKHFWNPLKWMAIGAVAV  158

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G  P+L R++A+LR   LDINILM+I+V G+I L DY EA +IVFLFT  EWLE R+S +
Sbjct  159   GIPPILMRSIASLRRWILDINILMLIAVGGAIALADYIEAGSIVFLFTLAEWLEGRSSEQ  218

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A +A++S ++V  + A+LAETG ++  ++VK+ + +AVKAGE+IP+DG ++ G C +DE 
Sbjct  219   ARSALASGLDV-PRNAILAETGVMVSVDEVKLGSSIAVKAGEMIPVDGTILSGGCSLDES  277

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             +LTGES  V K   S VWA T+NL GYI+++TTA+AED AV+RM KLVEEAQ+ +S  ++
Sbjct  278   SLTGESKPVEKTCGSEVWAGTVNLAGYITVQTTALAEDSAVSRMIKLVEEAQAKRSHFEQ  337

Query  3420  SIDKIAKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMF  3247
              ++K AK+YTP +VA +  LA+  +    R+E++  +LALV+LV ACPCALVLSTPVA+ 
Sbjct  338   LVEKFAKFYTPVLVATALGLALIPLIAHVRNEKHWLYLALVLLVVACPCALVLSTPVAVA  397

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             C +  AA LG++ KG  YLEILAK+K +A DKTGT+T G F V+   ++ +  +   +L 
Sbjct  398   CGIQHAARLGVVIKGGSYLEILAKIKCLAMDKTGTLTEGHFRVSEVVAVGETEDLQQILY  457

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             W++S+ES+SSHPMA A++ YA    V P+ + V  FQ   GEG+   +DG  I IGN ++
Sbjct  458   WLASVESRSSHPMAAALVTYASLQDVVPS-KSVTDFQIIEGEGVSAVVDGHLIEIGNARL  516

Query  2886  SARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTV  2707
             ++R G ++     +   +  +M ++     L  VFSL D  R  A EA+R LK + ++  
Sbjct  517   ASRLGWSNTAITKL-ATQTATMGWVGKDHQLLAVFSLEDHVREEAAEAVRSLKRLNVQIH  575

Query  2706  MLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQK-GGRTGMIGDGLNDAPAL  2530
             MLTGD+   A+ VQ +LGG     HA LLP++K +II++ ++  G TGMIGDG+NDAPAL
Sbjct  576   MLTGDNNETAQDVQSKLGGV--TVHAGLLPQDKVRIIQELKENAGVTGMIGDGINDAPAL  633

Query  2529  ATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAA  2350
             A ADVG +MG++GS +A ET  V LMT+D+ ++G  + LGRRV  KVI N+V+++  KAA
Sbjct  634   AAADVGFAMGLAGSAVAMETSDVFLMTDDLRKLGLVVSLGRRVRTKVIQNVVISVGLKAA  693

Query  2349  IMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             ++AL+ AG+  +W AVLVDVG CL+VI NSTLLLRG
Sbjct  694   MLALSFAGYGYLWMAVLVDVGACLLVISNSTLLLRG  729



>ref|XP_002968260.1| hypothetical protein SELMODRAFT_89397 [Selaginella moellendorffii]
 gb|EFJ30514.1| hypothetical protein SELMODRAFT_89397 [Selaginella moellendorffii]
Length=819

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/697 (49%), Positives = 484/697 (69%), Gaps = 9/697 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
             N     ++   V+G+CCPSEVPL+ KIL+ L GV EVSV  T+++V VVHD LL  + ++
Sbjct  40    NFQQVTRTVLSVMGLCCPSEVPLVRKILEPLPGVKEVSVNYTSRSVTVVHDKLLTPEGRL  99

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN+A L+AS+   GE     K  PSP+ + CGILLL+SF K+ + PLKW+A+ A   
Sbjct  100   VKALNEARLDASLHRRGELKKANKW-PSPWTICCGILLLVSFFKHFWNPLKWMAIGAVAV  158

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G  P+L R++A+LR   LDINILM+I+V G+I L DY EA +IVFLFT  EWLE R+S +
Sbjct  159   GIPPILMRSIASLRRWILDINILMLIAVGGAIALADYIEAGSIVFLFTLAEWLEGRSSEQ  218

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A +A++S ++V  + A+LAETG ++  ++VK+ + +AVKAGE+IP+DG ++ G C +DE 
Sbjct  219   ARSALASGLDV-PRNAILAETGAMVSVDEVKLGSSIAVKAGEMIPVDGTILSGGCSLDES  277

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             +LTGES  V K   S VWA T+NL GYI+++TTA+AED AV+RM KLVEEAQ+ +S  ++
Sbjct  278   SLTGESKPVEKTCGSEVWAGTVNLAGYITVQTTALAEDSAVSRMIKLVEEAQAKRSHFEQ  337

Query  3420  SIDKIAKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMF  3247
              ++K AK+YTP +VA +  LA+  +    R+E++  +LALV+LV ACPCALVLSTPVA+ 
Sbjct  338   LVEKFAKFYTPVLVATALGLALIPLIAHVRNEKHWLYLALVLLVVACPCALVLSTPVAVA  397

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             C +  AA LG++ KG  YLEILAK+K +A DKTGT+T G F V+   ++ +  +   +L 
Sbjct  398   CGIQHAARLGVVIKGGSYLEILAKIKCLAMDKTGTLTEGHFRVSEVVAVGETEDLQQILY  457

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             W++S+ES+SSHPMA A++ YA    V P+ + V  FQ   GEG+   +DG  I IGN ++
Sbjct  458   WLASVESRSSHPMAAALVTYASLQDVVPS-KSVTDFQIIEGEGVSAVVDGHLIEIGNARL  516

Query  2886  SARAGCTSVPEFDVD-GREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKT  2710
             ++R G ++          +  ++ ++     L  VFSL D  R  A EA+R LK + ++ 
Sbjct  517   ASRLGWSNTGSIGSSFPTQTATIGWVGKDHQLLAVFSLEDHVREEAAEAVRSLKRLNVQI  576

Query  2709  VMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQK-GGRTGMIGDGLNDAPA  2533
              MLTGD+   A+ VQ +LGG     HA LLP++K +II++ ++  G TGMIGDG+NDAPA
Sbjct  577   HMLTGDNNETAQDVQSKLGGV--TVHAGLLPQDKVRIIQELKENAGVTGMIGDGINDAPA  634

Query  2532  LATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKA  2353
             LA ADVG +MG++GS +A ET  V LMT+D+ ++G  + LGRRV  KVI N+V+++  KA
Sbjct  635   LAAADVGFAMGLAGSAVAMETSDVFLMTDDLRKLGLVVSLGRRVRTKVIQNVVISVGLKA  694

Query  2352  AIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRG  2242
             A++AL+ AG+  +W AVLVDVG CL+VI NSTLLLRG
Sbjct  695   AMLALSFAGYGYLWMAVLVDVGACLLVISNSTLLLRG  731



>ref|XP_002459578.1| hypothetical protein SORBIDRAFT_02g006940 [Sorghum bicolor]
 gb|EER96099.1| hypothetical protein SORBIDRAFT_02g006940 [Sorghum bicolor]
Length=895

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/693 (54%), Positives = 504/693 (73%), Gaps = 10/693 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++LK +DGV  V+V+V ++TVVV HDP  ++Q  I     
Sbjct  45    EKTYLDVLGVCCSAEVALVERLLKPIDGVRSVTVVVPSRTVVVEHDPAAVSQSHI--GAQ  102

Query  4125  KASLEASIKVNGETNDGPKML---PSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGS  3955
             +  LEAS++  G T+ G  ++   PSPY V  G LLL S L  +  PL+WLA+AAA AG+
Sbjct  103   QGGLEASVRAYGSTSGGVGVVARWPSPYVVASGGLLLASLLAPLLPPLRWLALAAACAGA  162

Query  3954  FPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAM  3775
              P+L RA+A+   L LDIN LM+++V G+  L DY EA  IVFLFT  EWLE+ A  KA 
Sbjct  163   PPMLLRALASGLALALDINALMLVAVAGAAALGDYAEAGAIVFLFTAAEWLETLACTKAS  222

Query  3774  AAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTL  3595
             A MS+L+ +V  R VLA TGE++    V+V T++AV+AGEV+P+DG+VV+G+ EVDE +L
Sbjct  223   AGMSTLLTMVPPRVVLAGTGEVVSVRDVEVGTVVAVRAGEVVPVDGVVVDGQSEVDESSL  282

Query  3594  TGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSI  3415
             TGESF VPK   S VWA T+N++GYI+++TTA+A+D  VARM +LVE AQ+++S+ QR +
Sbjct  283   TGESFPVPKLPPSEVWAGTMNMDGYIAVRTTALADDSTVARMQRLVEAAQNSRSKTQRLV  342

Query  3414  DKIAKYYTPAIVAISACLAISAVKVENRS-ERY-HLALVVLVSACPCALVLSTPVAMFCA  3241
             D  AKYYTP +V ++A +A+  + +  +  +R+  LALV+LVSACPCALVLSTPVA FCA
Sbjct  343   DSCAKYYTPGVVVLAASVALVPLLLGAKDLKRWCQLALVLLVSACPCALVLSTPVATFCA  402

Query  3240  LSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWV  3061
             L RAA +G+L KG + LE L +++V AFDKTGTIT+G+F++  F  + D +  + LL WV
Sbjct  403   LLRAARMGVLIKGGDVLESLGEIRVAAFDKTGTITKGQFSIDGFHVVGDKVEMSQLLYWV  462

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             SSIESKSSHPMA A+++Y+QS S++P PE V  F+ FPGEGI G I+G +I+IGN++I A
Sbjct  463   SSIESKSSHPMAAALVEYSQSKSIQPKPENVTEFRIFPGEGISGVINGRQIFIGNRRIMA  522

Query  2880  RAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVML  2701
             R+ C + PE D D R G S+ Y+ V   L G FSLSD CRTGA EAI +L+ MGIK+VML
Sbjct  523   RSSCYTAPEMD-DHR-GASIGYVIVDGDLVGAFSLSDDCRTGAAEAIMELRSMGIKSVML  580

Query  2700  TGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALAT  2524
             TGDS AAA   Q+QLGG L+E H ELLP +K  ++   + + G T M+GDG+NDAPALA 
Sbjct  581   TGDSRAAATRAQQQLGGVLEELHWELLPADKVSLVGDLKARAGATLMVGDGMNDAPALAA  640

Query  2523  ADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIM  2344
             +DVG+SMG+SGS  A ET H  LM++DI R+  A+ LGR     +  N+VV++  KAA++
Sbjct  641   SDVGVSMGLSGSAAAMETSHATLMSSDILRVPAAVALGRCTRATIAANVVVSVGAKAAVL  700

Query  2343  ALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
             ALA+A  PL+WAAVL DVGTCL+V+ +S LLLR
Sbjct  701   ALAVAWRPLLWAAVLADVGTCLLVVLHSMLLLR  733



>ref|XP_001762170.1| predicted protein [Physcomitrella patens]
 gb|EDQ72962.1| predicted protein [Physcomitrella patens]
Length=810

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/697 (48%), Positives = 478/697 (69%), Gaps = 9/697 (1%)
 Frame = -1

Query  4320  NNNGAEKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI  4141
                G  K+  DV+GICCP+EVPLI K+L+ + GV EVSV VT+KTV V+HD L  +  ++
Sbjct  118   KTTGLSKTTIDVMGICCPNEVPLIKKLLEPIPGVEEVSVNVTSKTVTVLHDQLSASSSKL  177

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ALN AS+ AS+   GE     K  PSP+ +  GILL +SF +Y+Y PLKW+A+ +   
Sbjct  178   VKALNDASMVASVHQRGEWKAAQKW-PSPWTIASGILLGVSFFQYLYHPLKWVALGSVGV  236

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G  P++ R++AA+++  LDINILM+I+V G+I L DY EA +I FLFT  +WLESR+S K
Sbjct  237   GIPPLVLRSIAAMKSFILDINILMLIAVGGAIGLGDYLEAGSIAFLFTLADWLESRSSDK  296

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A AA++++V++  + A L  +G  +   +VKV T+L VKAGE++PIDG V  G+C VDE 
Sbjct  297   ARAAIAAVVDLAPRSATLLSSGMGVRVEEVKVGTLLTVKAGELVPIDGTVTSGKCNVDES  356

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             +LTGES  V K   S VWA T+N++G++++KTTA+AED AV+RM +LVEEAQ+ +SR + 
Sbjct  357   SLTGESLPVEKDVGSIVWAGTVNMSGHMTVKTTALAEDSAVSRMVRLVEEAQTQRSRTEL  416

Query  3420  SIDKIAKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMF  3247
              +++IAKYYTP IV  +  +A+    +   S+R+  +LALV+LV ACPCALV+STPV   
Sbjct  417   LVEQIAKYYTPGIVLAAIIIAVVPWALHVHSQRHWLYLALVLLVVACPCALVISTPVVTT  476

Query  3246  CALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLS  3067
             C +++AA LGLL KG  +LEIL K+KV+A DKTGT++ G F V     L  G N + +L 
Sbjct  477   CGIAQAARLGLLLKGGSHLEILGKLKVVALDKTGTLSEGHFRVTDIVGLDGGSNIHQILH  536

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
             W++S+E+K+SHPMA A++ +A  + V+P+ E V  F+   GEG+   ++G  I+IGN ++
Sbjct  537   WIASVENKASHPMATALVSFANQNGVKPS-EHVTDFEVIVGEGVKANVNGRIIHIGNARM  595

Query  2886  SARAG---CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGI  2716
             + R G     +     +   +G ++ +I V +   GV+ ++D  RT A EA+R LK +GI
Sbjct  596   ANRLGWDKAVAKEMIHLWSSQGATVGWIGVDNMAVGVYGVADQLRTEAVEAVRNLKKLGI  655

Query  2715  KTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDGLNDAP  2536
             K  MLTGDS +AA    +++G    E HA+LLPE+K  +I++ +K G T M+GDG+NDAP
Sbjct  656   KVAMLTGDSASAASFAHKKIGEI--EIHAQLLPEDKVHMIQELKKYGTTAMVGDGINDAP  713

Query  2535  ALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTK  2356
             ALA ADVGI+MG++GS +A ET  V LMTND+ ++  A+ELGR    K+  N+ ++  TK
Sbjct  714   ALAAADVGIAMGVAGSAVAMETADVALMTNDLRKLAIAVELGRNCRWKIGQNVTLSFVTK  773

Query  2355  AAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
               I+ LA +G+  +W AV+ DVGTCL+VIFNS  LLR
Sbjct  774   IVIIGLAASGYASLWTAVMADVGTCLLVIFNSMRLLR  810



>ref|XP_001778390.1| predicted protein [Physcomitrella patens]
 gb|EDQ56841.1| predicted protein [Physcomitrella patens]
Length=745

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/712 (48%), Positives = 481/712 (68%), Gaps = 17/712 (2%)
 Frame = -1

Query  4323  INNNGAE-KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQH  4147
             +N  GA  K+  DV+GICCPSEVPLI K+L  L GV +VSV VT KTV+V+HDPLLI+  
Sbjct  8     VNFGGALCKTKLDVMGICCPSEVPLIKKLLAPLTGVEDVSVNVTAKTVLVLHDPLLISDV  67

Query  4146  QIVRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAA  3967
             Q+V+ LN A L+ASI   GE   G +  PSP+ +  GILL ++F KY+Y P+ W+A+ A 
Sbjct  68    QLVKVLNGAHLDASIHQRGELKGG-RNWPSPWCLGSGILLAIAFFKYLYEPMHWVALGAV  126

Query  3966  VAGSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRAS  3787
               G  P++ +A+AALR   LDINILM+I+V G+I L DY EA TIVFLFT  EWLE+R++
Sbjct  127   AVGVPPIVVKAIAALRKFFLDINILMLIAVSGAIALQDYLEAGTIVFLFTLAEWLETRST  186

Query  3786  HKAMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVD  3607
              KA +A++S+V+   Q A+L + G  +   +V V T+L+VK GE IPIDG V+ G   VD
Sbjct  187   SKARSAIASVVDRAPQNAMLVDGGMRVRVEEVAVGTLLSVKTGEAIPIDGEVLSGRGLVD  246

Query  3606  EKTLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRA  3427
             E +LTGES  V K+ ++ VWA T  L+GY++IKTTA++ D AVARM KLVEEAQ  +S  
Sbjct  247   ESSLTGESVPVEKETEAFVWAGTTILSGYLTIKTTALSADSAVARMVKLVEEAQHQRSNT  306

Query  3426  QRSIDKIAKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVA  3253
             +  ++KIAKYYTP +V  +  + I+  A  V N +   +LALV+LV ACPCALV+STPV 
Sbjct  307   ELLVEKIAKYYTPGVVIAALVIGIAPWASGVHNPTHYVYLALVLLVVACPCALVISTPVV  366

Query  3252  MFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSL-LDGINH-N  3079
             + C +++AA LGLL KG  YLE+L ++KV+AFDKTGT++ G+F V  +S L +DGI+   
Sbjct  367   ITCGIAQAARLGLLVKGGTYLEVLGRLKVMAFDKTGTLSEGQFCV--YSMLPIDGISTLK  424

Query  3078  TLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIG  2899
              +L W +S+E+K+SHP+A AI+ YA+   VEP+ E V +F+   GEG+  E+DG  I+IG
Sbjct  425   EVLYWTTSVENKASHPLAAAIVTYARLKGVEPS-ENVANFEVIAGEGVSAEVDGHTIHIG  483

Query  2898  NKKISARAGCTSVPEFDVDGR---EGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLK  2728
             N +++AR G  +    +        G ++ ++ +     G+FS+ D  R+ A EA+R+LK
Sbjct  484   NARMAARFGWDTAAAVETLANWSSSGATVGWVGLDGIAIGIFSVGDKLRSEAAEAVRELK  543

Query  2727  VMGIKTVMLTGDSYAAARHVQEQLGGALDEF-----HAELLPEEKAQIIKKFQKGGRTGM  2563
              +GI+  MLTGDS AAA  VQ ++  A+ +      +AEL+PE+K +IIK+ +  G   M
Sbjct  544   KLGIRVAMLTGDSNAAAVKVQNKVSKAVGKIGEMDVYAELIPEDKVRIIKELKHHGTIAM  603

Query  2562  IGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIV  2383
             +GDG+NDAPALATADVGI+MG++GS +A ET  V LMTND+ ++  A+ LG     K+  
Sbjct  604   VGDGINDAPALATADVGIAMGVAGSAVAMETADVALMTNDLRKLAAAVRLGLDCRWKIAQ  663

Query  2382  NIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREA  2227
             NI  +  TK  I+ L   G+  +W  V+ DVGTCL VIFNS  +L+  + +A
Sbjct  664   NITFSFATKLLIIGLVAGGYASLWGGVVADVGTCLAVIFNSRRILKKVEHQA  715



>tpg|DAA39460.1| TPA: hypothetical protein ZEAMMB73_512198 [Zea mays]
Length=898

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/695 (52%), Positives = 495/695 (71%), Gaps = 14/695 (2%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++LK +DGV  V+V+V ++TV+V HD   ++Q  IV+ALN
Sbjct  30    EKTYLDVLGVCCSAEVALVERLLKPIDGVRAVTVVVPSRTVIVEHDLAAVSQSHIVKALN  89

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G +    +  PSPY V  G LLL S    +   L+WLA+AAA AG+ P+
Sbjct  90    KAGLEASVRAYGSSGVVARW-PSPYTVASGALLLASLFAPLLPSLRWLALAAACAGAPPM  148

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             +    A    L LDIN LM+++V G+  L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  149   V--LRALAAGLALDINALMLVAVAGAAALGDYAEAGAIVFLFTTAEWLETLACTKASAGM  206

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++V    VLA+TGE++    V V  ++AV+AGEV+P+DG+VV+G+ EVDE +LTGE
Sbjct  207   SSLMSMVPPTVVLAQTGEVVGVRDVGVGAVVAVRAGEVVPVDGVVVDGQSEVDESSLTGE  266

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  + VWA T+NL+GYI+++TTA+A++  VARM +LVE AQ+++S+ QR +D  
Sbjct  267   SFPVPKQPQAEVWAGTMNLDGYIAVRTTALADNSTVARMQRLVEAAQNSRSKTQRLVDSC  326

Query  3405  AKYYTPAIVAISAC-----LAISAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCA  3241
             AKYYTPA+VA++A      L +     ++    + LALV+LVSACPCALVLSTPVA FCA
Sbjct  327   AKYYTPAVVAVAAGVALVPLLLGPRGAQDPKRWFQLALVLLVSACPCALVLSTPVATFCA  386

Query  3240  LSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWV  3061
             L RAA +G+L KG + LE L +++V AFDKTGTIT+GEF+V  F  + D +  + LL WV
Sbjct  387   LLRAARMGVLIKGGDVLESLGEIRVAAFDKTGTITKGEFSVHGFHVVGDKVGMSQLLYWV  446

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             SSIESKSSHPMA A+++YAQS S++P P  V  F+ +PGEGI G I+G +I+IGN +I A
Sbjct  447   SSIESKSSHPMATALVEYAQSKSIQPEPTSVTDFRIYPGEGISGAINGRQIFIGNTRIMA  506

Query  2880  RAGCTSV---PEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKT  2710
             R+ C +    PE   +G++G S+ ++ V       FSLSD CRTGA EAIR+L+ MGI++
Sbjct  507   RSSCYAAGAGPEM--EGQQGASIGHVIVDGDHVAAFSLSDDCRTGAAEAIRELRSMGIRS  564

Query  2709  VMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPA  2533
             VMLTGDS AAA   Q QLGGAL+E H+ELLP +K  ++   + + G T M+GDG+NDAPA
Sbjct  565   VMLTGDSKAAASRAQRQLGGALEEVHSELLPADKVALVGDLKARAGPTLMVGDGMNDAPA  624

Query  2532  LATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKA  2353
             LATADVG++MG+SGS  A ET H  LM++D+ R+  A+ LGRR    V  N++ ++  KA
Sbjct  625   LATADVGVAMGLSGSAAAMETSHATLMSSDLLRVPAAVRLGRRARATVAANVIASVGAKA  684

Query  2352  AIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             A++ALA A  P +W AVL DVGTCL+V+ +S LLL
Sbjct  685   AVLALAAAWRPALWVAVLADVGTCLLVVLHSMLLL  719



>gb|ABK28660.1| unknown [Arabidopsis thaliana]
Length=526

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/530 (55%), Positives = 397/530 (75%), Gaps = 22/530 (4%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             + SYFDV+GICC SEV ++  +L+ +DGV E SV+V ++TV+VVHD  LI+  QIV+ALN
Sbjct  13    QTSYFDVVGICCSSEVSIVGNVLRQVDGVKEFSVIVPSRTVIVVHDTFLISPLQIVKALN  72

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEAS++  GET+   +  PSP+A+V G+LL+LSF KY Y+PL+WLA+ A VAG FP+
Sbjct  73    QARLEASVRPYGETSLKSQW-PSPFAIVSGVLLVLSFFKYFYSPLEWLAIVAVVAGVFPI  131

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             L +AVA++    LDIN L +I+V+ ++ + D+ EAA                 HKA   M
Sbjct  132   LAKAVASVTRFRLDINALTLIAVIATLCMQDFTEAA-----------------HKASIVM  174

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  ++AV+A+TG  +D ++V ++T+++VKAGE IPIDG+VV+G C+VDEKTLTGE
Sbjct  175   SSLMSLAPRKAVIADTGLEVDVDEVGINTVVSVKAGESIPIDGVVVDGSCDVDEKTLTGE  234

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQ++STV AATINLNGYI +KTTA+A DC VA+M KLVEEAQ ++++ QR IDK 
Sbjct  235   SFPVSKQRESTVMAATINLNGYIKVKTTALARDCVVAKMTKLVEEAQKSQTKTQRFIDKC  294

Query  3405  AKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA+V  +AC A+  V  KV++ S  +HLALVVLVS CPC L+LSTPVA FCAL++
Sbjct  295   SRYYTPAVVVSAACFAVIPVLLKVQDLSHWFHLALVVLVSGCPCGLILSTPVATFCALTK  354

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  G L K  + LE LAK+K++AFDKTGTIT+ EF V+ F SL   IN + LL WVSSI
Sbjct  355   AATSGFLIKTGDCLETLAKIKIVAFDKTGTITKAEFMVSDFRSLSPSINLHKLLYWVSSI  414

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E KSSHPMA A+IDYA+S SVEP P+ VE+FQNFPGEG+YG IDG +IYIGNK+I+ RAG
Sbjct  415   ECKSSHPMAAALIDYARSVSVEPKPDIVENFQNFPGEGVYGRIDGQDIYIGNKRIAQRAG  474

Query  2871  CTS--VPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLK  2728
             C +  VP+ +   + GK++ YI++G+ L G F+L D CR G  +A+++LK
Sbjct  475   CLTDNVPDIEATMKRGKTIGYIYMGAKLTGSFNLLDGCRYGVAQALKELK  524



>ref|XP_010919016.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Elaeis 
guineensis]
 ref|XP_010919017.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Elaeis 
guineensis]
Length=776

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/690 (46%), Positives = 461/690 (67%), Gaps = 6/690 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+ F V+GICC SE  L+ KIL  L+G+  VSV V  KT  V+HDP  I+  QIV ALN
Sbjct  14    QKTTFTVLGICCGSEAALVHKILNPLEGIENVSVNVLAKTTTVIHDPSEISASQIVNALN  73

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA L+A I+  G+     +  P+   +  G+LLL++   Y+Y PL W+++A+   G   +
Sbjct  74    KAKLKAGIRELGQVKTRKQSWPNANVIASGVLLLVAMFSYIYQPLIWVSLASIAIGIPGI  133

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             LRR +AAL    LDIN+LM+I+V G++ L DY E A++VFLF   +WLE+++S KA A++
Sbjct  134   LRRGIAALGRCMLDINVLMVIAVFGAVGLGDYLEGASVVFLFAFAQWLEAKSSDKAQASL  193

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+N+  + AV+AETGE LD   ++++T+++VKAGE +P+DG+VV G   +DE +LTGE
Sbjct  194   ESLMNLAPRTAVIAETGETLDVKDIRINTLVSVKAGERVPVDGVVVTGGSTIDESSLTGE  253

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
                V K+  S VWA ++ L G+I++ T A+ ED AVARM KLVE+AQS +S  +  I+K 
Sbjct  254   FMPVDKEVGSKVWAGSVVLTGFINVATKALEEDSAVARMVKLVEDAQSQRSNIEAFIEKF  313

Query  3405  AKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTP +V I+A +A+    +  ++     +L+LV+LV ACPCALV+STPVA  C LS 
Sbjct  314   AKYYTPGVVLIAAGIAVVPWVLSFQDVHHWIYLSLVLLVVACPCALVISTPVAKVCGLSA  373

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +GL+ KG  +LE LAK+K IAFDKTGT+T G F V     +   I+ N +  W+SS+
Sbjct  374   AAKMGLIIKGGNHLEALAKIKAIAFDKTGTLTEGAFEVVDMQLVEQKIDINHMFYWISSL  433

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E+ SSHP+A A+++Y++SH ++P+ E V+ F+  PGEGI G +D   I IGN +++ R G
Sbjct  434   ENLSSHPIAKALVEYSRSHGIQPSRE-VKEFRIIPGEGISGYVDDCLIQIGNAQLAFRNG  492

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               S  EF ++   G ++ Y+ + +   G F L D  R  A +A+ +L+  GI+  +LTGD
Sbjct  493   WLSENEFYIN-EAGITVGYVGMDNHFIGYFRLGDQVRGEAAQAVHELQKQGIEVTILTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKF-QKGGRTGMIGDGLNDAPALATADV  2515
             S AAA  +Q+Q+G  + +  A L PE+K + I +  +K G T M+GDG+NDAPALA +DV
Sbjct  552   SKAAAELIQKQIGENI-KVEASLAPEDKMKKIAELKEKWGLTAMVGDGINDAPALAASDV  610

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GI+MG++GS +A ET  V LM+ND+ +I +A++L +   RK   N+ +++  K     LA
Sbjct  611   GIAMGVAGSAVATETADVALMSNDLRKIPEAVKLAKAALRKNYQNVALSLAVKLLFFGLA  670

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLR  2245
               G P +WAAV+ D+GTCLVVIFNS LLL+
Sbjct  671   FGGMPSLWAAVVADMGTCLVVIFNSMLLLQ  700



>ref|XP_008670004.1| PREDICTED: putative inactive cadmium/zinc-transporting ATPase 
HMA3 [Zea mays]
 tpg|DAA39461.1| TPA: hypothetical protein ZEAMMB73_512198 [Zea mays]
Length=993

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/695 (52%), Positives = 495/695 (71%), Gaps = 14/695 (2%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +EV L++++LK +DGV  V+V+V ++TV+V HD   ++Q  IV+ALN
Sbjct  125   EKTYLDVLGVCCSAEVALVERLLKPIDGVRAVTVVVPSRTVIVEHDLAAVSQSHIVKALN  184

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA LEAS++  G +    +  PSPY V  G LLL S    +   L+WLA+AAA AG+ P+
Sbjct  185   KAGLEASVRAYGSSGVVARW-PSPYTVASGALLLASLFAPLLPSLRWLALAAACAGAPPM  243

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             +    A    L LDIN LM+++V G+  L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  244   V--LRALAAGLALDINALMLVAVAGAAALGDYAEAGAIVFLFTTAEWLETLACTKASAGM  301

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++V    VLA+TGE++    V V  ++AV+AGEV+P+DG+VV+G+ EVDE +LTGE
Sbjct  302   SSLMSMVPPTVVLAQTGEVVGVRDVGVGAVVAVRAGEVVPVDGVVVDGQSEVDESSLTGE  361

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF VPKQ  + VWA T+NL+GYI+++TTA+A++  VARM +LVE AQ+++S+ QR +D  
Sbjct  362   SFPVPKQPQAEVWAGTMNLDGYIAVRTTALADNSTVARMQRLVEAAQNSRSKTQRLVDSC  421

Query  3405  AKYYTPAIVAISAC-----LAISAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCA  3241
             AKYYTPA+VA++A      L +     ++    + LALV+LVSACPCALVLSTPVA FCA
Sbjct  422   AKYYTPAVVAVAAGVALVPLLLGPRGAQDPKRWFQLALVLLVSACPCALVLSTPVATFCA  481

Query  3240  LSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWV  3061
             L RAA +G+L KG + LE L +++V AFDKTGTIT+GEF+V  F  + D +  + LL WV
Sbjct  482   LLRAARMGVLIKGGDVLESLGEIRVAAFDKTGTITKGEFSVHGFHVVGDKVGMSQLLYWV  541

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             SSIESKSSHPMA A+++YAQS S++P P  V  F+ +PGEGI G I+G +I+IGN +I A
Sbjct  542   SSIESKSSHPMATALVEYAQSKSIQPEPTSVTDFRIYPGEGISGAINGRQIFIGNTRIMA  601

Query  2880  RAGCTSV---PEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKT  2710
             R+ C +    PE   +G++G S+ ++ V       FSLSD CRTGA EAIR+L+ MGI++
Sbjct  602   RSSCYAAGAGPEM--EGQQGASIGHVIVDGDHVAAFSLSDDCRTGAAEAIRELRSMGIRS  659

Query  2709  VMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPA  2533
             VMLTGDS AAA   Q QLGGAL+E H+ELLP +K  ++   + + G T M+GDG+NDAPA
Sbjct  660   VMLTGDSKAAASRAQRQLGGALEEVHSELLPADKVALVGDLKARAGPTLMVGDGMNDAPA  719

Query  2532  LATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKA  2353
             LATADVG++MG+SGS  A ET H  LM++D+ R+  A+ LGRR    V  N++ ++  KA
Sbjct  720   LATADVGVAMGLSGSAAAMETSHATLMSSDLLRVPAAVRLGRRARATVAANVIASVGAKA  779

Query  2352  AIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             A++ALA A  P +W AVL DVGTCL+V+ +S LLL
Sbjct  780   AVLALAAAWRPALWVAVLADVGTCLLVVLHSMLLL  814



>gb|AIG13052.1| putative heavy metal transporting P1B-ATPase 2, partial [Triticum 
aestivum]
Length=756

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/505 (60%), Positives = 392/505 (78%), Gaps = 5/505 (1%)
 Frame = -1

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q AVLAETG+++ A  VKV+T++AVKAGEV+PIDG+VV+G  EVDE+TLTGESF
Sbjct  1     LMSMAPQNAVLAETGQVVAAQDVKVNTVIAVKAGEVVPIDGVVVDGRSEVDEQTLTGESF  60

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              V KQ DS VWA T+N++GYIS++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID  AK
Sbjct  61    PVAKQTDSEVWAGTLNIDGYISVRTTAMADNSAVAKMARLVEEAQNSRSETQRLIDTCAK  120

Query  3399  YYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPA++ ++A +A + V  +  N    + LALV+LVSACPCALVLSTPVA FCAL +AA
Sbjct  121   YYTPAVIVMAAAVAATPVIVRAHNLRHWFQLALVLLVSACPCALVLSTPVATFCALLKAA  180

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL KG + LE LA +KV AFDKTGTI+ GEF+VA F ++ + +  + LL+WVSS+ES
Sbjct  181   RTGLLIKGGDVLESLAGIKVAAFDKTGTISSGEFSVAEFRAIGERVPRHQLLNWVSSVES  240

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             +SSHPMA A++DYA+S+SVEPN E V  FQ +PGEGIYGEIDG  +YIGN++I +RA C 
Sbjct  241   RSSHPMAAALVDYARSNSVEPNSENVMEFQIYPGEGIYGEIDGQGVYIGNRRILSRASCE  300

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE  V+  +G ++ Y+     L G+F LSD CRTG+ EAIR+L+ MGIK+VMLTGDS 
Sbjct  301   TVPE--VNDIKGVTVGYVACNKELVGLFGLSDVCRTGSAEAIRELRSMGIKSVMLTGDSA  358

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATADVGI  2509
             AAA + Q QLG  L E H+ELLPE+K +I+ + + + G T MIGDG+NDAPALA ADVG+
Sbjct  359   AAATYAQNQLGNVLAEVHSELLPEDKVRIVDELKARDGSTLMIGDGMNDAPALARADVGV  418

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMG+SGS +A ET HV LM+ND+ RI KAI L RR  R ++ NIV ++ TK AI+ LA+A
Sbjct  419   SMGVSGSAVAMETSHVTLMSNDVRRIPKAIRLARRTRRTIVTNIVFSVATKLAIVGLALA  478

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTL  2254
             GHPLVWAAVL DVGTCL+VI  S +
Sbjct  479   GHPLVWAAVLADVGTCLLVIMYSMM  503



>ref|XP_008808279.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Phoenix 
dactylifera]
 ref|XP_008808280.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Phoenix 
dactylifera]
 ref|XP_008808281.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Phoenix 
dactylifera]
Length=776

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/695 (45%), Positives = 459/695 (66%), Gaps = 6/695 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+ F V+GICC SE  L+ KIL  L+G+  +SV V  KT  V+HDP  I+  QIV ALN
Sbjct  14    QKTTFTVLGICCGSEAALVQKILNPLEGIENISVNVLAKTTTVIHDPSKISASQIVNALN  73

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             KA L+A I+  G+     +  P+   +  G+LLL++   Y+Y PL W+++A+   G   +
Sbjct  74    KAKLKAGIRELGQVKTRKQSRPNANVIASGVLLLVAMFSYIYQPLVWVSLASIAIGILDM  133

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             LRR +AAL    LDIN+LM+I+V G++ L +Y E A++VFLFT  +WLE+++S KA A++
Sbjct  134   LRRCIAALGRCVLDINVLMVIAVFGAVGLGNYLEGASVVFLFTLAQWLEAKSSDKAQASL  193

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+N+  + AV+AETGE +D   + ++T+++VKAGE +P+DG+VV G   +DE +LTGE
Sbjct  194   ESLMNLAPRTAVIAETGETVDVKDITINTLVSVKAGERVPVDGLVVTGGSTIDESSLTGE  253

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
                V K+  S VWA ++ L G+I++ T A+ ED AVARM KLVE+AQS +S  +  I+K 
Sbjct  254   FMPVDKEVGSKVWAGSVVLTGFINVATKALEEDSAVARMVKLVEDAQSRRSNIEEFIEKF  313

Query  3405  AKYYTPAIVAISACLAIS--AVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTP +V I+A +A+   A+  ++     +L+LV+LV ACPCALV+STPVA  C LS 
Sbjct  314   AKYYTPGVVLIAAGIAVVPWALSFQDIRHWIYLSLVLLVVACPCALVISTPVAKVCGLSA  373

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +GL+ KG  +LE LAK+K +AFDKTGT+T G F V     +   I+ N LL W+SS+
Sbjct  374   AAKMGLIIKGGNHLEALAKIKALAFDKTGTLTEGSFKVVDMQLVEQKIDINQLLYWISSL  433

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E+ S HP+A A+++YA+   ++P+ E V+ F+   GEGI   +D   I IGN +++ R G
Sbjct  434   ENLSGHPIAKALVEYARFRGIQPSRE-VKDFKMISGEGISAYVDDCLIQIGNAQLAFRNG  492

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
               S  +F +D   G ++ Y+ + +   G F L D  R  A +A+ +L+   I+  +LTGD
Sbjct  493   WLSESKFYID-EAGITVGYVGMDNHFIGYFRLGDQVRGEAAQAVHELQKQRIQVTILTGD  551

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKF-QKGGRTGMIGDGLNDAPALATADV  2515
             S AAA  +Q+Q+G  + +  A L PE+K + I +  +K G T M+GDG+NDAPALA +D+
Sbjct  552   SKAAAELIQKQIGENI-KVEASLAPEDKMKKIAELKEKWGLTAMVGDGINDAPALAASDI  610

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             GI+MG++GS +A ET  V LM+ND+ +I +A++L R   RK   N+ +++  K   + LA
Sbjct  611   GIAMGVAGSAVATETADVALMSNDLRKIPEAVKLARATLRKNYQNVALSLAVKLLFLGLA  670

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDRE  2230
               G P +WAAV+ D+GTCL VIFNS LLLR   +E
Sbjct  671   FGGMPSLWAAVVADMGTCLAVIFNSMLLLRKHKKE  705



>gb|AIG13046.1| putative heavy metal transporting P1B-ATPase 2, partial [Triticum 
aestivum]
Length=751

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/505 (60%), Positives = 391/505 (77%), Gaps = 5/505 (1%)
 Frame = -1

Query  3759  LVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESF  3580
             L+++  Q AVLAETG+++ A  VKV+T++AVKAGEV+PIDG+VV+G  EVDE+TLTGESF
Sbjct  1     LMSMAPQNAVLAETGQVVAAQDVKVNTVIAVKAGEVVPIDGVVVDGRSEVDEQTLTGESF  60

Query  3579  SVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAK  3400
              V KQ DS VWA T+N++GYIS++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID  AK
Sbjct  61    PVAKQTDSEVWAGTLNIDGYISVRTTAMADNSAVAKMARLVEEAQNSRSETQRLIDTCAK  120

Query  3399  YYTPAIVAISACLAISAVKVENRSER--YHLALVVLVSACPCALVLSTPVAMFCALSRAA  3226
             YYTPA++ ++A +A++ V V  R+ R  + LALV+LVSACPCALVLSTPVA FCAL +AA
Sbjct  121   YYTPAVIVMAAAVAVTPVIVRARNLRHWFQLALVLLVSACPCALVLSTPVATFCALLKAA  180

Query  3225  ALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIES  3046
               GLL KG + LE LA +KV AFDKTGTIT GEF+VA F ++ + +    LL WVSS+ES
Sbjct  181   RTGLLIKGGDVLESLAGIKVAAFDKTGTITSGEFSVAEFRAVGERVTKQQLLYWVSSVES  240

Query  3045  KSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCT  2866
             +SSHPMA A++D A+S+SVEP  E V  FQ +PGEGIYGEIDG  +Y+GN++I +RA C 
Sbjct  241   RSSHPMAAALVDCARSNSVEPKSENVVEFQIYPGEGIYGEIDGQGVYVGNRRILSRASCE  300

Query  2865  SVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGDSY  2686
             +VPE  V+  +G ++ Y+     L G+F LSD CRTG+ EAIR+L+ MGIK+VMLTGDS 
Sbjct  301   TVPE--VNDIKGVTVGYVACNKELVGLFGLSDVCRTGSAEAIRELRSMGIKSVMLTGDST  358

Query  2685  AAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATADVGI  2509
             AAA + Q QLG  L E H+ELLPE+K +I+ + + + G T M+GDG+NDAPALA ADVG+
Sbjct  359   AAATYAQNQLGNVLAEVHSELLPEDKVRIVDELKARDGPTLMVGDGMNDAPALARADVGV  418

Query  2508  SMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALAIA  2329
             SMG+SGS +A ET HV LM+ND+ RI KAI L RR  R ++ NIV ++ TK AI+ LA+A
Sbjct  419   SMGVSGSAVAMETSHVTLMSNDVRRIPKAIRLARRTRRTIVTNIVFSVATKLAIVGLALA  478

Query  2328  GHPLVWAAVLVDVGTCLVVIFNSTL  2254
             GHPLVWAAVL DVGTCL+VI  S +
Sbjct  479   GHPLVWAAVLADVGTCLLVIMYSMM  503



>ref|XP_008650805.1| PREDICTED: uncharacterized protein LOC100191729 isoform X4 [Zea 
mays]
Length=736

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/586 (56%), Positives = 422/586 (72%), Gaps = 14/586 (2%)
 Frame = -1

Query  3948  VLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAA  3769
             +L RA AA   LTLDINILM+I+V GS+ L  + EA  IVFLFT  EWLE+ A  KA A 
Sbjct  1     MLLRAFAAAGKLTLDINILMLIAVAGSVALGSFTEAGAIVFLFTVAEWLETLACSKASAG  60

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             M SL++ V +  VLAETG+++    V V T++AV+AG+V+P+DG+VV G  EVDE +LTG
Sbjct  61    MLSLMSTVPKTVVLAETGQVVGMGDVAVGTVVAVRAGDVVPVDGVVVGGHSEVDESSLTG  120

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF VPKQ  S VWA TINL+GYIS++TTA+AE+  VA+M +LVEEAQ+++SR QR ID 
Sbjct  121   ESFPVPKQPQSEVWAGTINLDGYISVRTTALAENSTVAKMERLVEEAQNSRSRTQRLIDS  180

Query  3408  IAKYYTPAIVAIS-------ACLAISAVKVENRSERYHLALVVLVSACPCALVLSTPVAM  3250
              AK+YTPA+V ++       A L    +++E+    + L+LV+LVSACPCALVLSTPVA 
Sbjct  181   CAKHYTPAVVVLAAGVVLVPALLGARDLELEH---WFRLSLVLLVSACPCALVLSTPVAT  237

Query  3249  FCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLL  3070
             FCAL RAA +GLL KG   LE L +V+V AFDKTGTITRGEF++  F  + D +  N LL
Sbjct  238   FCALLRAARMGLLVKGGNVLESLGEVRVAAFDKTGTITRGEFSIKDFHVVGDKVEMNQLL  297

Query  3069  SWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKK  2890
              WVSSIESKSSHPMA A+++YAQS SV+P PE V     + GEGIYG +DG +IYIGN++
Sbjct  298   YWVSSIESKSSHPMAAALVEYAQSKSVQPKPENVTETCIYHGEGIYGVMDGKQIYIGNER  357

Query  2889  ISARAGC---TSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMG  2719
             I AR+ C         + DG +G S+ ++     L G FSLSD CRTGA EAI +L+ MG
Sbjct  358   IIARSSCRHHQHAGHQETDGLKGVSIGHVICDGDLVGKFSLSDTCRTGAAEAILQLRSMG  417

Query  2718  IKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLND  2542
             IK+VMLTGDS AAA+H QEQLGG L+E HA LLPE+K ++++  Q + G T M+GDG+ND
Sbjct  418   IKSVMLTGDSAAAAKHAQEQLGGVLEELHAGLLPEDKVRLVRGLQARHGATLMVGDGMND  477

Query  2541  APALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAIC  2362
             APALA ADVG+SMG+SGS  A ET H  LM+ DI R+ KA+ LGRR  R + VN+  ++ 
Sbjct  478   APALAAADVGVSMGLSGSAAAIETSHAALMSGDILRVPKAVRLGRRARRTIAVNVASSVG  537

Query  2361  TKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDREAP  2224
              KAA++ALA+A  P++W AVL DVGTCL+V+ +S LLLR G    P
Sbjct  538   AKAAVLALAVAWRPVLWVAVLADVGTCLLVVLHSMLLLRDGAARRP  583



>ref|XP_009397553.1| PREDICTED: cadmium/zinc-transporting ATPase HMA2-like [Musa acuminata 
subsp. malaccensis]
Length=754

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/697 (48%), Positives = 448/697 (64%), Gaps = 8/697 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +K+ F V+GICC SE+ LID+IL  L+G+  VSV V  KT  VVHDP      +IV ALN
Sbjct  14    QKTTFTVLGICCSSEIKLIDRILNHLEGIENVSVNVLAKTATVVHDPAKAPASRIVSALN  73

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
              A L A IK +G      +  PS   V  G LLL++   YV+ PL W+A+ +   G   +
Sbjct  74    GAHLNAGIKESGRVQIESRPWPSKSVVASGALLLVALCSYVFPPLIWIALLSVTVGVLDM  133

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             LRRAVAALR   LDIN+LM+ +V G+I L DY EAA+IVFLFT  EWLE+++++KA  ++
Sbjct  134   LRRAVAALRRCVLDINVLMVTAVFGAIGLGDYLEAASIVFLFTLAEWLEAKSTNKARVSL  193

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
              SL+N+  Q AV+AETGE +    + ++TI++VKAGE++P+DG VV G   VDE +LTGE
Sbjct  194   ESLLNLAPQTAVIAETGETVHVKDIMINTIVSVKAGELVPVDGAVVAGASTVDESSLTGE  253

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
                V K+  S VW+ T  L G+I + T AVAED AVARM KLVE+AQ+ +S  +  I++ 
Sbjct  254   FMPVDKEIGSNVWSGTTVLTGFIKVVTMAVAEDSAVARMVKLVEDAQNRRSNMEEFIEQF  313

Query  3405  AKYYTPAIVAISACLAISA--VKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTP +  ++A  AI    + V    +  +LALV+LV ACPCALV+STPVA  C LS 
Sbjct  314   AKYYTPGVFLVAAGTAIIPWILGVHPLRQWIYLALVLLVIACPCALVISTPVAKACGLSA  373

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +GL+FKG  YLE LAKVK +AFDKTGT+T G F V          N    L W+SS+
Sbjct  374   AAKMGLIFKGGNYLEALAKVKAMAFDKTGTLTEGAFEVVEVQCWEPNANIRQFLHWISSL  433

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             E+ SSHPMA A+++YA+   V+P+ E V +F   PG GI G +D   + IGN +++   G
Sbjct  434   ENMSSHPMARALVEYARVRGVKPSSE-VRNFNLIPG-GIAGFVDDCYVKIGNAEVALSNG  491

Query  2871  CTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTGD  2692
                  E   D   G ++SY+ +     G F L D  R  A  A++KLK   I  ++LTGD
Sbjct  492   WLRENELR-DNEAGITISYVGMVDRCIGYFCLGDQLREEAARAVQKLKKQQIHVIVLTGD  550

Query  2691  SYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPALATADV  2515
             S AAA HVQ+Q+G  + +  A L PE K + I + ++  G T M+GDG+NDAPAL  +DV
Sbjct  551   SRAAAEHVQKQIGENV-QVEAGLSPEGKMKKIAELKETWGLTAMVGDGINDAPALTESDV  609

Query  2514  GISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMALA  2335
             G++MGISGS LA ET +V LM+ND+ RI +A+EL R   RK+  N+ +++  K     LA
Sbjct  610   GVAMGISGSALATETANVALMSNDLRRIPEAVELARSSLRKIYQNVAMSLAVKLLFFGLA  669

Query  2334  IAGHPLVWAAVLVDVGTCLVVIFNST-LLLRGGDREA  2227
               G P +WAAV+ D+GTCL+VIFNS  LL + G RE+
Sbjct  670   FGGLPSLWAAVVADMGTCLLVIFNSMHLLHKYGGRES  706



>gb|EMT10353.1| Putative cadmium/zinc-transporting ATPase 3 [Aegilops tauschii]
Length=1102

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/508 (60%), Positives = 395/508 (78%), Gaps = 5/508 (1%)
 Frame = -1

Query  3768  MSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTG  3589
             MSSL+++  Q AVLAETG+++ A  VKV+T++AVKAGEV+PIDG+VV+G  EVDE+TLTG
Sbjct  1     MSSLMSMAPQNAVLAETGQVVAAQDVKVNTVIAVKAGEVVPIDGVVVDGRSEVDEQTLTG  60

Query  3588  ESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDK  3409
             ESF V KQ DS VWA T+N++GYIS++TTA+A++ AVA+MA+LVEEAQ+++S  QR ID 
Sbjct  61    ESFPVAKQTDSEVWAGTLNIDGYISVRTTAMADNSAVAKMARLVEEAQNSRSETQRLIDT  120

Query  3408  IAKYYTPAIVAISACLAISAV--KVENRSERYHLALVVLVSACPCALVLSTPVAMFCALS  3235
              AKYYTPA++ ++A +A + V  +  N    + LALV+LVSACPCALVLSTPVA FCAL 
Sbjct  121   CAKYYTPAVIVMAAAVAATPVIVRAHNLRHWFQLALVLLVSACPCALVLSTPVATFCALL  180

Query  3234  RAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSS  3055
             +AA  GLL KG + LE LA +KV AFDKTGTI+ GEF+VA F ++ + +  + LL+WVSS
Sbjct  181   KAARTGLLIKGGDVLESLAGIKVAAFDKTGTISSGEFSVAEFRAIGERVPRHQLLNWVSS  240

Query  3054  IESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARA  2875
             +ES+SSHPMA A++DYA+S+SVEPN E V  FQ +PGEGIYGEIDG  +YIGN++I +RA
Sbjct  241   VESRSSHPMAAALVDYARSNSVEPNSENVMEFQIYPGEGIYGEIDGQGVYIGNRRILSRA  300

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VPE  V+  +G ++ Y+     L G+F LSD CRTG+ EAIR+L+ MGIK+VMLTG
Sbjct  301   SCETVPE--VNDIKGVTVGYVACNKELVGLFGLSDVCRTGSAEAIRELRSMGIKSVMLTG  358

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQ-KGGRTGMIGDGLNDAPALATAD  2518
             DS AAA + Q QLG  L E H+ELLPE+K +I+ + + + G T MIGDG+NDAPALA AD
Sbjct  359   DSAAAATYAQNQLGNVLAEVHSELLPEDKVRIVDELKARDGSTLMIGDGMNDAPALARAD  418

Query  2517  VGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKAAIMAL  2338
             VG+SMG+SGS +A ET HV LM+ND+ RI KAI L RR  R ++ NIV ++ TK AI+ L
Sbjct  419   VGVSMGVSGSAVAMETSHVTLMSNDVRRIPKAIRLARRTRRTIVTNIVFSVATKLAIVGL  478

Query  2337  AIAGHPLVWAAVLVDVGTCLVVIFNSTL  2254
             A+AGHPLVWAAVL DVGTCL+VI  S +
Sbjct  479   ALAGHPLVWAAVLADVGTCLLVIMYSMM  506



>ref|XP_006409084.1| hypothetical protein EUTSA_v10022526mg [Eutrema salsugineum]
 gb|ESQ50537.1| hypothetical protein EUTSA_v10022526mg [Eutrema salsugineum]
Length=1038

 Score =   574 bits (1480),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 272/415 (66%), Positives = 340/415 (82%), Gaps = 2/415 (0%)
 Frame = -1

Query  3471  MAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVL  3298
             MAKLVEEAQS+K+++QR IDK ++YYTPAI+ ISAC AI  + +KV N +  +HLALVVL
Sbjct  1     MAKLVEEAQSSKTKSQRLIDKCSQYYTPAIIIISACFAIVPAIMKVHNLNHWFHLALVVL  60

Query  3297  VSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTV  3118
             VSACPC L+LSTPVA FCAL++AA  GLL K A+YL+ L+K+K+ AFDKTGTITRGEF V
Sbjct  61    VSACPCGLILSTPVATFCALTKAATSGLLIKSADYLDTLSKIKIAAFDKTGTITRGEFIV  120

Query  3117  AHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEG  2938
               F SL   I+  +LL WVSS+ESKSSHPMA  I+DYA+S SVEP PE+VE +QNFPGEG
Sbjct  121   IDFKSLSRDISLRSLLYWVSSVESKSSHPMATTIMDYARSVSVEPRPEEVEDYQNFPGEG  180

Query  2937  IYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRT  2758
             IYG+IDG  IYIGNKKI++RAGC++VPE +VD + GK++ Y++V   LAGVF+LSDACR+
Sbjct  181   IYGKIDGNNIYIGNKKIASRAGCSTVPEIEVDTKGGKTIGYVYVSERLAGVFNLSDACRS  240

Query  2757  GAQEAIRKLKVMGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG  2578
             G  +A+++LK +GIKT MLTGD+  AA H QEQLG ALD  H ELLPE+K++II++F+K 
Sbjct  241   GVAQAMKELKDLGIKTAMLTGDNQDAAMHAQEQLGNALDAVHGELLPEDKSKIIQEFKKE  300

Query  2577  GRTGMIGDGLNDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVW  2398
             G T M+GDG+NDAPALATAD+GISMGISGS LA +TGH+ILM+NDI RI +AI+L RR  
Sbjct  301   GPTAMVGDGVNDAPALATADIGISMGISGSALATQTGHIILMSNDIRRIPQAIKLARRAR  360

Query  2397  RKVIVNIVVAICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLLRGGDR  2233
             RKV+ N+ ++I  KA I++LA AGHPL+WAAVLVDVGTCL+VI NS LLLR  D+
Sbjct  361   RKVVENVFISITLKAGILSLAFAGHPLIWAAVLVDVGTCLLVILNSMLLLREKDK  415



>ref|XP_006453290.1| hypothetical protein CICLE_v100073872mg, partial [Citrus clementina]
 gb|ESR66530.1| hypothetical protein CICLE_v100073872mg, partial [Citrus clementina]
Length=430

 Score =   550 bits (1417),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 273/422 (65%), Positives = 346/422 (82%), Gaps = 3/422 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+GICC SEVPLI+ ILK L+GV EVSV+V ++TV+V+HD LLI+QHQIV+ALN
Sbjct  10    QKSYFDVLGICCSSEVPLIENILKSLEGVKEVSVIVPSRTVIVLHDALLISQHQIVKALN  69

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A  EA+++  G T+   K  PSPYA+ CG+LL +S LKYVY PL+W A+ A   G FP+
Sbjct  70    QARFEANVRAYGGTSYQKKW-PSPYAMACGVLLAISILKYVYHPLRWFALGAVAIGIFPI  128

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + + +AA+RN  LDINIL++I+V+G+I ++DY EA  IVFLFT  EWLESRASHKA A M
Sbjct  129   ILKGLAAIRNFKLDINILVLIAVIGTIAMNDYIEAGIIVFLFTIAEWLESRASHKATAVM  188

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++  Q+A++A TGE +DA +VK++T+LAVKAGEVIPIDGIVV+G+CEVDEKTLTGE
Sbjct  189   SSLMSIAPQKAIIAGTGEEVDAGEVKLNTVLAVKAGEVIPIDGIVVDGKCEVDEKTLTGE  248

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ V KQK STVWA TINLNGYIS++TTAVAEDC VA+MAKLVEEAQ++KSR QR +DK 
Sbjct  249   SYPVSKQKGSTVWAGTINLNGYISVETTAVAEDCVVAKMAKLVEEAQNSKSRIQRFVDKF  308

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             ++YYTPA++ ISAC+A+   A+ V N  + +HLALVVLVSACPCAL+LSTPV  +CAL++
Sbjct  309   SQYYTPAVIFISACVAVIPIALGVSNHKQWFHLALVVLVSACPCALILSTPVVTYCALTK  368

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA  GLL KG +YL+ LAKV+ +AFDKTGTITRGEF ++ F  L + IN NTLL WVSSI
Sbjct  369   AATSGLLIKGGDYLQTLAKVRFMAFDKTGTITRGEFVMSEFQPLSEDINLNTLLYWVSSI  428

Query  3051  ES  3046
             ES
Sbjct  429   ES  430



>ref|XP_010110710.1| Cadmium/zinc-transporting ATPase 3 [Morus notabilis]
 gb|EXC27875.1| Cadmium/zinc-transporting ATPase 3 [Morus notabilis]
Length=424

 Score =   548 bits (1412),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 275/416 (66%), Positives = 347/416 (83%), Gaps = 3/416 (1%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             +KSYFDV+G+CC SEVPLI+ ILK LDGV EV+V++ T+TV+VVHD LLI+Q QIV+ALN
Sbjct  10    QKSYFDVLGLCCSSEVPLIENILKPLDGVKEVTVIIATRTVIVVHDSLLISQTQIVKALN  69

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
             +A LEA++++ G  N   K  PSPY++ CG+L+LLSFLKYVY PL WLA+AA V G +P+
Sbjct  70    EARLEANVRIYGGDNFKKKW-PSPYSIACGVLVLLSFLKYVYRPLGWLALAAVVIGIWPI  128

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
               +A+AA RNL LDINIL I++V+G++ + DY EA TIVFLFT  EWLESRASHKA   M
Sbjct  129   CLKALAATRNLRLDINILAIVAVIGTVAMGDYVEAGTIVFLFTVAEWLESRASHKANVVM  188

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL+++V Q+AV+AETGE++DA++VK++T+LAVKAGEVIPIDGIVVEG CEVDEKTLTGE
Sbjct  189   SSLMSMVPQKAVIAETGEVVDADEVKLNTVLAVKAGEVIPIDGIVVEGNCEVDEKTLTGE  248

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             SF V KQKDSTVWA TINLNGYIS+KTTA+AEDCAVA+MAKLVEEAQ++KS+ QR IDK 
Sbjct  249   SFPVAKQKDSTVWAGTINLNGYISVKTTALAEDCAVAKMAKLVEEAQNSKSKTQRFIDKC  308

Query  3405  AKYYTPAIVAISACLAI--SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AK+YTPA++ IS  +A+  +A+++ + S+ +HLALVVLVSACPC L+LSTPVA FCAL++
Sbjct  309   AKFYTPAVLIISISVAVIPAALRLPHLSKWFHLALVVLVSACPCGLILSTPVATFCALTK  368

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSW  3064
             AA  GLL KG ++LE L+K+K+ AFDKTGTITRGEF V+ F  LLD +   TL+ W
Sbjct  369   AATSGLLIKGGDHLETLSKIKIAAFDKTGTITRGEFVVSDFRPLLDDVGLETLVYW  424



>ref|XP_009795251.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=519

 Score =   541 bits (1395),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 276/496 (56%), Positives = 357/496 (72%), Gaps = 13/496 (3%)
 Frame = +1

Query  118   KGSTQKPPEAGGTWPIIGHLHLLAAPRATFKILADMADKYGPIFRIRLGTKQVLVVSDSR  297
             K   +K P+A G WPIIGHLHLL   +   KI   MA+KYGPIFRI+LG  QV+VVSD++
Sbjct  28    KTQNRKVPKAAGAWPIIGHLHLLNGSQMPHKIFGHMAEKYGPIFRIKLGVNQVVVVSDAK  87

Query  298   IAKECFTTNDRALAGRPKALTSEIIGYNYAMFGMCPYGEYWRHVRKVVVLQLLSNRRREA  477
             IAKECFTTND A A RPK++ SEIIGYNYAMFG+ PYG YWR +RK+  ++ LS R+ E 
Sbjct  88    IAKECFTTNDMAFANRPKSIASEIIGYNYAMFGLGPYGPYWREIRKIATIEFLSTRQVEI  147

Query  478   LMRVWESGVRSFAQDIYRSWLRDKNESEDV--KLDMKELFGEVVMDVTMQTLFGQQY---  642
                + E  V+S  ++IY  WL+ K+ S +V  K++MKE FG ++M+  ++ LFG +Y   
Sbjct  148   SSHIRELEVKSAIKEIYEYWLKSKSSSLNVAVKIEMKEWFGNLIMNTMVKMLFGVRYTGK  207

Query  643   EEEGSRTVVRTASRLFNLLGVPVVGDYLPWLRWLDIGGHEKTLKETAKRMDSIAEGWLQE  822
             EEE      +   R F L+GV  V D+LP+LRWLDIGGHEK +KETA  MDS+ E WL E
Sbjct  208   EEEERGRAHKAIRRFFELMGVSAVADFLPYLRWLDIGGHEKAMKETANEMDSLVEEWLAE  267

Query  823   HKRKRN---TKSKEEEDFMDGLINSFHGDGDHKDIPNDFDADTIVKSTCMGMLFAGtdtt  993
             H+R+R     K  +EED MD +++      + +D+P  FDADTI+K+TC+ +  AGTDTT
Sbjct  268   HRRQRELRGIKYGDEEDLMDVMLSI----CEDRDLPG-FDADTIIKATCLALQSAGTDTT  322

Query  994   titltwalslilNHSSVLEKIRAELDIHVGRKRHVNHLDLNNLIYLQAVVKETLRLYTPG  1173
              +TLTW LSLILN+  +L+K + ELD HVG+ R V   D+ NL+YLQA+VKE LRLY   
Sbjct  323   IVTLTWTLSLILNNYQILKKAQDELDAHVGKHRWVQESDIKNLVYLQAIVKEALRLYPAA  382

Query  1174  PLLLPHECIDDCVVNGYNIQKGTRLLVNVSMIHRDPDIWSDPNVFRPERFLNEYKDIDVR  1353
             PLLLPHECI+DC ++GY+I KGTRLLVN+  IH DPD+W +P  F+PERFL  +KD+DVR
Sbjct  383   PLLLPHECIEDCDISGYDIPKGTRLLVNIWKIHYDPDLWPNPEEFKPERFLTTHKDVDVR  442

Query  1354  GNHFELIPFGSGRRVCPAISLALQVMELVLACLIHDFDLKRISNEPIDMIEMVGMTNRKA  1533
             GNHFELIPFGSGRR+CP IS+ LQV++ VLA L+  F++KR S+EPIDM E  G+T  KA
Sbjct  443   GNHFELIPFGSGRRMCPGISMGLQVVQYVLAVLLQGFEIKRPSDEPIDMSESFGLTILKA  502

Query  1534  TPLHVFLTPRLPSHLY  1581
             +PL + L PRL  +LY
Sbjct  503   SPLEILLAPRLAPNLY  518



>gb|EMS46115.1| Cadmium/zinc-transporting ATPase 3 [Triticum urartu]
Length=592

 Score =   543 bits (1400),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 303/572 (53%), Positives = 407/572 (71%), Gaps = 24/572 (4%)
 Frame = -1

Query  4305  EKSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALN  4126
             EK+Y DV+G+CC +E     +     DGV  V+V+V ++TVVV HDP  ++Q +I     
Sbjct  26    EKTYLDVLGVCCSAE-----RGRGPRDGVRAVAVVVPSRTVVVEHDPAAVSQSRIAYG--  78

Query  4125  KASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPV  3946
                   S    G         PSPY V CG LLL S  +++  PL+WLA+ AA AG+ P+
Sbjct  79    ------SSGFIGRR-------PSPYIVACGALLLASSFRWLLPPLQWLALGAACAGAPPM  125

Query  3945  LRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAM  3766
             + R +AA   L LDINILM+I+V G++ L DY EA  IVFLFTT EWLE+ A  KA A M
Sbjct  126   VLRGLAAASRLALDINILMLIAVAGAVALKDYTEAGVIVFLFTTAEWLETLACTKASAGM  185

Query  3765  SSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGE  3586
             SSL++++  +AVLAETGE+++   + V  ++AV+AGE++P+DG+VV+G+ EVDE++LTGE
Sbjct  186   SSLMSMIPPKAVLAETGEVVNVRDIGVGAVIAVRAGEMVPVDGVVVDGQSEVDERSLTGE  245

Query  3585  SFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKI  3406
             S+ VPKQ  S VWA T+NL+GYI+++T A+AE+  VA+M +LVEEAQ +KS+ QR ID  
Sbjct  246   SYPVPKQPQSEVWAGTLNLDGYIAVRTMALAENSTVAKMERLVEEAQQSKSKTQRLIDSC  305

Query  3405  AKYYTPAIVAISACLAISAVKVENR-SER-YHLALVVLVSACPCALVLSTPVAMFCALSR  3232
             AKYYTPA+V + A +A+    +  R +ER + LALV+LVSACPCALVLSTPVA FCAL  
Sbjct  306   AKYYTPAVVVLGAGVALLPPLLGARDAERWFRLALVLLVSACPCALVLSTPVATFCALLT  365

Query  3231  AAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSI  3052
             AA +G+L KG + LE L +++ +AFDKTGTITRGEFTV  F  +   +  + LL W+SSI
Sbjct  366   AARMGVLVKGGDVLESLGEIRAVAFDKTGTITRGEFTVDMFDVVGQKVQMSHLLYWISSI  425

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISAR-A  2875
             ESKSSHPMA A++++AQS S++P PE V  F+  PGEG+YGEIDG  IY+GNK++ AR +
Sbjct  426   ESKSSHPMAAALVEHAQSKSIQPKPECVAEFRILPGEGVYGEIDGKRIYVGNKRVLARGS  485

Query  2874  GCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVMLTG  2695
              C +VPE  ++G +G S+ Y+     L GVFSLSD CRTGA EAIR+L  MGI +V+LTG
Sbjct  486   SCQTVPE-RMNGLKGVSIGYVICDGDLVGVFSLSDDCRTGAAEAIRELASMGISSVLLTG  544

Query  2694  DSYAAARHVQEQLGGALDEFHAELLPEEKAQI  2599
             DS  AA H QE+LGGAL+E H+EL PE+K ++
Sbjct  545   DSAEAAVHAQERLGGALEELHSELFPEDKVRL  576



>ref|XP_006364811.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   537 bits (1384),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 277/490 (57%), Positives = 353/490 (72%), Gaps = 14/490 (3%)
 Frame = +1

Query  139   PEAGGTWPIIGHLHLLAAPRATFKILADMADKYGPIFRIRLGTKQVLVVSDSRIAKECFT  318
             PE  G WPIIGHLHLL   +   KI   MA+KYGPIFR++LG  QV++VSD +IAKECFT
Sbjct  35    PEPTGAWPIIGHLHLLNGSQMPHKIFGQMAEKYGPIFRLKLGVNQVVIVSDHKIAKECFT  94

Query  319   TNDRALAGRPKALTSEIIGYNYAMFGMCPYGEYWRHVRKVVVLQLLSNRRREALMRVWES  498
             TNDRA A RPK+L SEI+GYNYAMFG+ PYG YWR +RK+V ++ LS RR + L  V E 
Sbjct  95    TNDRAFANRPKSLASEILGYNYAMFGLGPYGPYWREIRKIVTIEFLSARRIKMLKHVREF  154

Query  499   GVRSFAQDIYRSWLRDKNESE---DVKLDMKELFGEVVMDVTMQTLFGQQY---EEEGSR  660
              V+   ++ Y  WL++ + S     VK++MKE FG ++M+  ++ LFG QY   E+E   
Sbjct  155   EVKLAVRETYEYWLKNNSSSNLNGAVKMEMKEWFGNLIMNSMVKMLFGVQYTDKEDEERN  214

Query  661   TVVRTASRLFNLLGVPVVGDYLPWLRWLDIGGHEKTLKETAKRMDSIAEGWLQEHKRKRN  840
                +   R   L GV VV D+LP+LRWLDIGGHEK +KETAK MD I E WL EH+RKR 
Sbjct  215   KAQKAIRRFLELFGVSVVADFLPYLRWLDIGGHEKAMKETAKEMDFIIEDWLAEHRRKRK  274

Query  841   ---TKSKEEEDFMDGLINSFHGDGDHKDIPNDFDADTIVKSTCMGMLFAGtdtttitltw  1011
                 K  +E+DFMD +++      + KD+ + FDADTI+K+TC+ ML AG DTT +TLTW
Sbjct  275   LRGNKCGDEDDFMDVMLSI----CEDKDL-HGFDADTIIKATCVVMLLAGVDTTVVTLTW  329

Query  1012  alslilNHSSVLEKIRAELDIHVGRKRHVNHLDLNNLIYLQAVVKETLRLYTPGPLLLPH  1191
              LSL+LN+   L+K + ELD H+G+ R V   D+ NLIYLQA+VKE+ RLY   PL LPH
Sbjct  330   TLSLLLNNYQSLKKAKDELDTHIGKNRCVQESDIKNLIYLQAIVKESFRLYPATPLSLPH  389

Query  1192  ECIDDCVVNGYNIQKGTRLLVNVSMIHRDPDIWSDPNVFRPERFLNEYKDIDVRGNHFEL  1371
             E I+DCVV+GYNI KGTRL++N+S +H DP+IW +P  F+PERFL  +KD+DVRGNHFEL
Sbjct  390   ESIEDCVVSGYNIPKGTRLVLNISKLHYDPEIWPNPQEFKPERFLTTHKDVDVRGNHFEL  449

Query  1372  IPFGSGRRVCPAISLALQVMELVLACLIHDFDLKRISNEPIDMIEMVGMTNRKATPLHVF  1551
             IPFGSGRR+CP +SLALQV+E VLA L+  F++KR S+E IDM E  G+T  KA+PL V 
Sbjct  450   IPFGSGRRMCPGVSLALQVVEYVLAVLLQGFEIKRPSDEAIDMSESFGLTILKASPLEVH  509

Query  1552  LTPRLPSHLY  1581
             LTPRL S+LY
Sbjct  510   LTPRLNSYLY  519



>ref|XP_009606708.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=523

 Score =   536 bits (1381),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 285/527 (54%), Positives = 374/527 (71%), Gaps = 15/527 (3%)
 Frame = +1

Query  31    MDFTLPAIVatlattflllitfiY-NLVFHKGSTQKPPEAGGTWPIIGHLHLLAAPRA--  201
             MDF L AI    +  FL LI   + +   + G  ++ PEA G WPIIGHLHLL+   +  
Sbjct  1     MDFVLIAITLASSLVFLFLIYNQFLSTKRNNGQRKRVPEAAGAWPIIGHLHLLSGSESDQ  60

Query  202   -TFKILADMADKYGPIFRIRLGTKQVLVVSDSRIAKECFTTNDRALAGRPKALTSEIIGY  378
                K+LA MA+KYGPIF ++LG  + +VVSD +IAKECFTTND ALA RPK+L SEIIGY
Sbjct  61    LPHKVLARMAEKYGPIFGLKLGVYKAVVVSDPKIAKECFTTNDLALANRPKSLASEIIGY  120

Query  379   NYAMFGMCPYGEYWRHVRKVVVLQLLSNRRREALMRVWESGVRSFAQDIYRSWLRDKNES  558
             N+AMFG+ PYG YWR +RK+  ++ LS RR E L  + E  V+S  ++ Y  WL++K+ S
Sbjct  121   NHAMFGVAPYGPYWREIRKIATIEFLSTRRIEVLKHIREFEVKSAIKESYEFWLKNKSSS  180

Query  559   ED--VKLDMKELFGEVVMDVTMQTLFGQQYEE-EGSRTVVRTASRLFNLLGVPVVGDYLP  729
              +  VK++MKE  G V+M+  ++ LFG++  E EG     +   R F L+G  VV D+LP
Sbjct  181   LNGAVKMEMKEWLGNVIMNTMVKMLFGKECTEGEGINKAHKAIRRFFELMGATVVADFLP  240

Query  730   WLRWLDIGGHEKTLKETAKRMDSIAEGWLQEHKRKRNTK---SKEEEDFMDGLINSFHGD  900
             +LRWLDIGGHEK +KE AK +DS+ E WL EHKR+R++K   S EEEDFMD +++     
Sbjct  241   YLRWLDIGGHEKAMKEVAKEIDSVVEEWLGEHKRRRDSKGIKSGEEEDFMDVMLSIC---  297

Query  901   GDHKDIPNDFDADTIVKSTCMGMLFAGtdtttitltwalslilNHSSVLEKIRAELDIHV  1080
              +++D+P  FDADT +K+TCM +L AGTDTT +TLTW LSL+LN+   L+K + ELD HV
Sbjct  298   -ENRDLPG-FDADTSIKATCMALLAAGTDTTIVTLTWTLSLLLNNYQALKKAQDELDAHV  355

Query  1081  GRKRHVNHLDLNNLIYLQAVVKETLRLYTPGPLLLPHECIDDCVVNGYNIQKGTRLLVNV  1260
             G+ R V   D+ NL+YLQA+VKE LRLY+  PL +PHE ++DC ++GY+I KGTRLLVN+
Sbjct  356   GKNRCVQDSDIKNLVYLQAIVKEALRLYSAAPLSVPHESMEDCTISGYDIPKGTRLLVNI  415

Query  1261  SMIHRDPDIWSDPNVFRPERFLNEYKDIDVRGNHFELIPFGSGRRVCPAISLALQVMELV  1440
               IH DPD+W +P+ F+PERFL  +KD+DVRGNHFELIPFGSGRR+CP IS ALQ +  V
Sbjct  416   WKIHCDPDLWPNPDEFKPERFLTTHKDVDVRGNHFELIPFGSGRRMCPGISFALQAVPFV  475

Query  1441  LACLIHDFDLKRISNEPIDMIEMVGMTNRKATPLHVFLTPRLPSHLY  1581
             LA L+  F+LKR S+EPIDM E  G+T  KA+PL V L PRL  +LY
Sbjct  476   LAGLLQGFELKRPSDEPIDMSESFGLTILKASPLQVLLAPRLAPNLY  522



>ref|XP_009804510.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=525

 Score =   534 bits (1376),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 274/494 (55%), Positives = 356/494 (72%), Gaps = 15/494 (3%)
 Frame = +1

Query  130   QKPPEAGGTWPIIGHLHLLAAPRA---TFKILADMADKYGPIFRIRLGTKQVLVVSDSRI  300
             ++ PEA G WPI GHLHLL    +     K+LA MA+KYGPIF ++LG  +V+VVSD ++
Sbjct  36    KRVPEAAGAWPIFGHLHLLTGTESDQLPHKVLARMAEKYGPIFGLKLGVYKVVVVSDPKV  95

Query  301   AKECFTTNDRALAGRPKALTSEIIGYNYAMFGMCPYGEYWRHVRKVVVLQLLSNRRREAL  480
             AKECFTTND ALA RPK+L SEIIGYN+AMFG+ PYG YWR +RK+  ++ LS+RR E L
Sbjct  96    AKECFTTNDLALANRPKSLASEIIGYNHAMFGVAPYGPYWREIRKIATIEFLSSRRIEML  155

Query  481   MRVWESGVRSFAQDIYRSWLRDKNESE---DVKLDMKELFGEVVMDVTMQTLFGQQYEE-  648
               + E  V+S  ++ Y  WL++K+ S     VK++MKE  G V+M+  ++ LFG++  E 
Sbjct  156   KHIREFEVKSAIKETYNYWLKNKSSSSLNGAVKMEMKEWLGNVIMNTMVKMLFGKECSEG  215

Query  649   EGSRTVVRTASRLFNLLGVPVVGDYLPWLRWLDIGGHEKTLKETAKRMDSIAEGWLQEHK  828
             EG     +   R F LLG  VV D+LP+LRWLDIGGHEK +KE AK +DS+ E WL EHK
Sbjct  216   EGINKAHKAIRRFFELLGATVVADFLPYLRWLDIGGHEKAMKEVAKEIDSVVEEWLGEHK  275

Query  829   RKRNTK---SKEEEDFMDGLINSFHGDGDHKDIPNDFDADTIVKSTCMGMLFAGtdttti  999
             R+R++K   S EEEDFMD +++      +++D P  FDADT +K+TCM +L AGTDTT +
Sbjct  276   RRRDSKGIKSGEEEDFMDVMLSI----CENRDFPG-FDADTSIKATCMALLSAGTDTTIV  330

Query  1000  tltwalslilNHSSVLEKIRAELDIHVGRKRHVNHLDLNNLIYLQAVVKETLRLYTPGPL  1179
             TLTW LSL+LN+   L+K + ELD+HVG+ R V   D+ NL+YLQAVVKE LRLY+  PL
Sbjct  331   TLTWTLSLLLNNYQALQKAQDELDVHVGKNRCVQDSDIKNLVYLQAVVKEALRLYSAAPL  390

Query  1180  LLPHECIDDCVVNGYNIQKGTRLLVNVSMIHRDPDIWSDPNVFRPERFLNEYKDIDVRGN  1359
              +PHE ++DC ++GY+I KGTRLLVN+  IH DPD+W +P+ F PERFL  +KD+DVRG 
Sbjct  391   SVPHESMEDCTISGYDIPKGTRLLVNIWKIHSDPDLWPNPHEFLPERFLTTHKDVDVRGT  450

Query  1360  HFELIPFGSGRRVCPAISLALQVMELVLACLIHDFDLKRISNEPIDMIEMVGMTNRKATP  1539
             HFELIPFGSGRR+CP IS ALQ +  VLA L+  F+LKR SNEPIDM E  G+T  KA+P
Sbjct  451   HFELIPFGSGRRMCPGISFALQAVPFVLAGLLQGFELKRPSNEPIDMSESFGLTILKASP  510

Query  1540  LHVFLTPRLPSHLY  1581
             L + L PRL  +LY
Sbjct  511   LEILLAPRLAPNLY  524



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   532 bits (1370),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 271/494 (55%), Positives = 350/494 (71%), Gaps = 12/494 (2%)
 Frame = +1

Query  118   KGSTQKPPEAGGTWPIIGHLHLLAAPRATFKILADMADKYGPIFRIRLGTKQVLVVSDSR  297
             K  ++  PEA G WPIIGHLHLL  P+   KI   MA+KYGPIFR++LG   V++VSD +
Sbjct  28    KKQSKNVPEAAGAWPIIGHLHLLNGPQMPHKIFGQMAEKYGPIFRLKLGVNDVVIVSDHK  87

Query  298   IAKECFTTNDRALAGRPKALTSEIIGYNYAMFGMCPYGEYWRHVRKVVVLQLLSNRRREA  477
             IAKECFTTND+A A RPK++ SEI+GYNYAMFG+ PYG YWR +RK+V  + LS RR E 
Sbjct  88    IAKECFTTNDKAFANRPKSIASEILGYNYAMFGLGPYGPYWREIRKIVTTEFLSARRIEM  147

Query  478   LMRVWESGVRSFAQDIYRSWLRDKNESEDVKLDMKELFGEVVMDVTMQTLFGQQY---EE  648
             L  V E  V+S  ++ Y  WL++ N +  VK++MKE FG ++M+  ++ LFG QY   E+
Sbjct  148   LKHVREFEVKSAVKETYEYWLKN-NLNGAVKIEMKEWFGNLIMNTMVKLLFGVQYTGNED  206

Query  649   EGSRTVVRTASRLFNLLGVPVVGDYLPWLRWLDIGGHEKTLKETAKRMDSIAEGWLQEHK  828
             E      +   RL  LLG  VV D+LP+LRWLDIGGHEK +K TAK +D I E WL EH+
Sbjct  207   EERSKAHKAIQRLLELLGAFVVADFLPYLRWLDIGGHEKIMKSTAKEIDFIVEDWLAEHR  266

Query  829   RKRNTKSK---EEEDFMDGLINSFHGDGDHKDIPNDFDADTIVKSTCMGMLFAGtdttti  999
             RKR  +     +EEDFMD +++       H      FD D I+K+TCM +  AGTDTT +
Sbjct  267   RKRKLRGNNCGDEEDFMDVMLSICEDKNLH-----GFDTDAIIKATCMALQTAGTDTTIV  321

Query  1000  tltwalslilNHSSVLEKIRAELDIHVGRKRHVNHLDLNNLIYLQAVVKETLRLYTPGPL  1179
             TL W LSL+LN+   L+K + ELD H+G+ R V   D+ NL+YLQA+VKE+ RLY   PL
Sbjct  322   TLIWILSLLLNNYEALKKAQDELDTHIGKNRWVQESDIKNLVYLQAIVKESFRLYPAAPL  381

Query  1180  LLPHECIDDCVVNGYNIQKGTRLLVNVSMIHRDPDIWSDPNVFRPERFLNEYKDIDVRGN  1359
             +LPHE I+DCVV+GY+I KGTRLLVNV  +  DP+IW +P+ F+PERFL  +KD+DVRGN
Sbjct  382   MLPHESIEDCVVSGYDIPKGTRLLVNVWKLQYDPEIWPNPHEFKPERFLTTHKDVDVRGN  441

Query  1360  HFELIPFGSGRRVCPAISLALQVMELVLACLIHDFDLKRISNEPIDMIEMVGMTNRKATP  1539
             HFELIPFGSGRR+CP +SLALQV++ V++ L+  FD+KR S+E IDM E  G+T  KA+P
Sbjct  442   HFELIPFGSGRRMCPGVSLALQVLQYVVSVLLQGFDIKRPSDEAIDMSESFGLTILKASP  501

Query  1540  LHVFLTPRLPSHLY  1581
             L V LTPRL S+LY
Sbjct  502   LEVQLTPRLDSNLY  515



>ref|XP_004238201.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=520

 Score =   529 bits (1362),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 275/501 (55%), Positives = 358/501 (71%), Gaps = 13/501 (3%)
 Frame = +1

Query  100   YNLVFHKGSTQKPPEAGGTWPIIGHLHLLAAPRA---TFKILADMADKYGPIFRIRLGTK  270
             Y++     S++K PEAGG WPIIGHLHLL    +     K+L  +ADKYGPIF ++LG  
Sbjct  25    YSVKKQSSSSRKVPEAGGAWPIIGHLHLLGGSESDHLPHKMLGRLADKYGPIFGMKLGVH  84

Query  271   QVLVVSDSRIAKECFTTNDRALAGRPKALTSEIIGYNYAMFGMCPYGEYWRHVRKVVVLQ  450
             QV+VVSD ++AKECFTTND ALAGRPK++ SEIIGY +AMFG+C YG YWR  RK+  ++
Sbjct  85    QVVVVSDHKLAKECFTTNDLALAGRPKSMASEIIGYKHAMFGLCSYGPYWRETRKIATIE  144

Query  451   LLSNRRREALMRVWESGVRSFAQDIYRSWLRDKNESEDVKLDMKELFGEVVMDVTMQTLF  630
             L S RR E L  + E  V+S  ++IY +W ++ N +  VK++MKE  G++ M+   + LF
Sbjct  145   LFSARRIEMLKHIREFEVKSGIKEIYNNWEKN-NLNGVVKMEMKEWIGDLFMNTMGKILF  203

Query  631   GQ---QYEEEGSRTVVRTASRLFNLLGVPVVGDYLPWLRWLDIGGHEKTLKETAKRMDSI  801
             G+     E+EG     +   R F LLGV VV D+LP+LRWLDIGGHEK +KE +K MDS+
Sbjct  204   GKGRRSNEDEGINKAHKAIRRFFELLGVFVVADFLPYLRWLDIGGHEKAMKEVSKEMDSV  263

Query  802   AEGWLQEHKRKRNT-KSKEEEDFMDGLINSFHGDGDHKDIPNDFDADTIVKSTCMGMLFA  978
              E WL EHK KR   KS EEEDFMD +++      + +D+P   DADT +K+TCM +L A
Sbjct  264   VEEWLTEHKTKRGIIKSGEEEDFMDVMLSVC----EDRDLPG-VDADTAIKATCMALLSA  318

Query  979   GtdtttitltwalslilNHSSVLEKIRAELDIHVGRKRHVNHLDLNNLIYLQAVVKETLR  1158
             GTDTT +TLTW LSL+LN+   L+K + ELD HVG+ R V   D+ NL+Y QA+VKE LR
Sbjct  319   GTDTTMVTLTWILSLLLNNYQSLQKAQDELDAHVGKNRWVQESDIKNLVYFQAIVKEALR  378

Query  1159  LYTPGPLLLPHECIDDCVVNGYNIQKGTRLLVNVSMIHRDPDIWSDPNVFRPERFLNEYK  1338
             LY  GPL LPHE ++DC ++GY+I KGTRLLVN+  I RDP+IW +P+ F+PERFL+ +K
Sbjct  379   LYPAGPLSLPHESMEDCTISGYDIPKGTRLLVNIWKIQRDPNIWPNPHEFKPERFLSTHK  438

Query  1339  DIDVRGNHFELIPFGSGRRVCPAISLALQVMELVLACLIHDFDLKRISNEPIDMIEMVGM  1518
             D+DV+GNHFEL+PFGSGRR+CP ISLALQV+  V+A L+  FD+KR+ +EPIDM E  G+
Sbjct  439   DVDVKGNHFELMPFGSGRRMCPGISLALQVLPFVIAMLLQGFDMKRLLDEPIDMSESFGL  498

Query  1519  TNRKATPLHVFLTPRLPSHLY  1581
             T  KA+PL V L PRL   LY
Sbjct  499   TVLKASPLEVLLAPRLAPDLY  519



>ref|XP_006431591.1| hypothetical protein CICLE_v10001150mg [Citrus clementina]
 gb|ESR44831.1| hypothetical protein CICLE_v10001150mg [Citrus clementina]
Length=446

 Score =   524 bits (1350),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 262/425 (62%), Positives = 330/425 (78%), Gaps = 9/425 (2%)
 Frame = -1

Query  4071  KMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVLRRAVAALRNLTLDINIL  3892
             K  P+P  +  G+LL LSFL Y+Y PL+ LAVAA + G   +L R+VA++++LTL+IN+L
Sbjct  5     KKWPAPSVMASGLLLALSFLGYIYYPLQSLAVAAVIFGVPAILVRSVASIKSLTLNINVL  64

Query  3891  MIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMSSLVNVVSQRAVLAETGE  3712
             ++++ VG++ L DY EA +IVFLF+  +WLES AS+KAMAAMSSL ++  Q+A+ AETG+
Sbjct  65    VLMAAVGTLALGDYVEAGSIVFLFSISQWLESVASYKAMAAMSSLTSMAPQKAITAETGD  124

Query  3711  ILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGESFSVPKQKDSTVWAATIN  3532
              +D N VKV+TILAV+AGEVIPIDGIVVEG+CEVDEKTLTGESF V K++DS VWA TIN
Sbjct  125   QVDVNTVKVNTILAVRAGEVIPIDGIVVEGKCEVDEKTLTGESFPVVKEQDSPVWAGTIN  184

Query  3531  LNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIAKYYTPAIVAISACLAI-  3355
             L+GYISIKTTA+A+DC V+RMA LVEE+   KSRAQ  I+  AKYY PA++ IS   A+ 
Sbjct  185   LDGYISIKTTALAKDCVVSRMAALVEESHKKKSRAQTFIESFAKYYIPAVLLISVAFAVI  244

Query  3354  -SAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCALSRAAALGLLFKGAEYLEILA  3178
              +AV V N     +LA+VVLVS CPCAL+LSTPV +FCALS+AA  GLL KG  YLE LA
Sbjct  245   PAAVGVPNVRHWLYLAIVVLVSTCPCALILSTPVVIFCALSKAATTGLLVKGGNYLETLA  304

Query  3177  KVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWVSSIESKSSHPMAPAIIDYAQS  2998
             KVK++AFDKTGT+TRGEFTV  F S+ D ++  TLL WVSSIESKSSHPMA A++DYA+S
Sbjct  305   KVKMVAFDKTGTVTRGEFTVTDFQSICDDVSLGTLLYWVSSIESKSSHPMAAALVDYARS  364

Query  2997  HSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAGCTSVPEFDVDGREGKSMS  2818
              ++EP PE VE FQNFPGEGI+G+I G EIYIGNK+I  R GC+ V    VD  +   MS
Sbjct  365   LAIEPVPENVEDFQNFPGEGIFGKIHGNEIYIGNKRIGPRTGCSKV----VDASD---MS  417

Query  2817  YIFVG  2803
             ++F G
Sbjct  418   FLFNG  422



>ref|XP_006366471.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   520 bits (1340),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 270/489 (55%), Positives = 349/489 (71%), Gaps = 13/489 (3%)
 Frame = +1

Query  139   PEAGGTWPIIGHLHLLAAPRA---TFKILADMADKYGPIFRIRLGTKQVLVVSDSRIAKE  309
             PEAGG WPIIGHLH L   +      + L+ MADKYG IF ++LG  QV+VVSD ++AKE
Sbjct  37    PEAGGAWPIIGHLHFLRGSKTDQLPHRTLSRMADKYGSIFGMKLGVHQVVVVSDPKLAKE  96

Query  310   CFTTNDRALAGRPKALTSEIIGYNYAMFGMCPYGEYWRHVRKVVVLQLLSNRRREALMRV  489
             CFTTND ALAGRPK++ SEI+GY +AMFG+C YG YWR  RK+  ++LLSNRR E L  +
Sbjct  97    CFTTNDLALAGRPKSMGSEIMGYKHAMFGLCSYGPYWRETRKIATVELLSNRRIEMLKHI  156

Query  490   WESGVRSFAQDIYRSWLRDKNESEDVKLDMKELFGEVVMDVTMQTLFGQ---QYEEEGSR  660
              E  V+S  ++IY +W    N +  VK++MKE FG++VM+   + LFG+     E+EG  
Sbjct  157   REFEVKSGIKEIYNNWAAKNNLNGVVKMEMKEWFGDIVMNTMGKMLFGKGRRSNEDEGIN  216

Query  661   TVVRTASRLFNLLGVPVVGDYLPWLRWLDIGGHEKTLKETAKRMDSIAEGWLQEHKRKRN  840
                +   R F LLG  VV D+LP+LRWLDIGGHEK +K+ ++ MDS+ E WL EHK KR 
Sbjct  217   NAHKAIRRFFELLGAFVVADFLPYLRWLDIGGHEKAMKKVSREMDSVVEEWLAEHKTKRE  276

Query  841   T-KSKE-EEDFMDGLINSFHGDGDHKDIPNDFDADTIVKSTCMGMLFAGtdtttitltwa  1014
               KS E EEDFMD +++     G    +P +FDADT +K+TCMG+L AGTDTT +T TW 
Sbjct  277   IIKSGEAEEDFMDVMLSICENRG----LP-EFDADTAIKATCMGVLAAGTDTTIVTSTWT  331

Query  1015  lslilNHSSVLEKIRAELDIHVGRKRHVNHLDLNNLIYLQAVVKETLRLYTPGPLLLPHE  1194
             LSL+LN+   L+K + ELD HVG+ R V   D+ NL+YLQA+VKE LRLY   PL +PHE
Sbjct  332   LSLLLNNYESLKKAQDELDAHVGKNRWVQESDIKNLVYLQAIVKEALRLYPAAPLAVPHE  391

Query  1195  CIDDCVVNGYNIQKGTRLLVNVSMIHRDPDIWSDPNVFRPERFLNEYKDIDVRGNHFELI  1374
              ++DC ++GY+I KGTRLLVN+  IH DP+IW +P+ F+PERFL  +KD+DV+GNHFELI
Sbjct  392   SMEDCTISGYDIPKGTRLLVNIWKIHHDPNIWPNPHEFKPERFLTTHKDVDVKGNHFELI  451

Query  1375  PFGSGRRVCPAISLALQVMELVLACLIHDFDLKRISNEPIDMIEMVGMTNRKATPLHVFL  1554
             PFGSGRR+CP ISL LQV+  V+A L+  F++KR S+EPIDM E+ G+T  KA+PL V L
Sbjct  452   PFGSGRRMCPGISLTLQVVPFVIAVLLQGFNIKRPSDEPIDMSEIFGLTVLKASPLEVLL  511

Query  1555  TPRLPSHLY  1581
              PRL   LY
Sbjct  512   APRLAPVLY  520



>ref|XP_009624056.1| PREDICTED: cytochrome P450 82A3-like, partial [Nicotiana tomentosiformis]
Length=510

 Score =   516 bits (1328),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 268/496 (54%), Positives = 349/496 (70%), Gaps = 21/496 (4%)
 Frame = +1

Query  118   KGSTQKPPEAGGTWPIIGHLHLLAAPRATFKILADMADKYGPIFRIRLGTKQVLVVSDSR  297
             K   +K P+A G WPIIGHLHLL   +   KI   MA+K+GPIFRI+LG  QV+VVSD++
Sbjct  28    KTQNRKVPKAAGAWPIIGHLHLLNGTQMPHKIFGHMAEKHGPIFRIKLGVNQVVVVSDAK  87

Query  298   IAKECFTTNDRALAGRPKALTSEIIGYNYAMFGMCPYGEYWRHVRKVVVLQLLSNRRREA  477
             IAKECFTTND A A RPK++ SEIIGYNYAMFG+ PYG YWR +RK+  ++ LS R+ E 
Sbjct  88    IAKECFTTNDMAFANRPKSIASEIIGYNYAMFGLGPYGPYWREIRKIATIEFLSTRQVEM  147

Query  478   LMRVWESGVRSFAQDIYRSWLRDKNESED--VKLDMKELFGEVVMDVTMQTLFGQQY---  642
                + E  V+S  ++IY  WL+ K+ S +  VK++MKE FG ++M+  ++ LFG +Y   
Sbjct  148   SSHIREFEVKSAIKEIYEYWLKSKSTSLNGAVKMEMKEWFGNLIMNTMVKMLFGVRYTGK  207

Query  643   EEEGSRTVVRTASRLFNLLGVPVVGDYLPWLRWLDIGGHEKTLKETAKRMDSIAEGWLQE  822
             EEE      +   R F L+GV  V D+LP+LRWLDIGGHEK +KETA  MD + E WL E
Sbjct  208   EEEERSRAHKAIRRFFELMGVSAVADFLPYLRWLDIGGHEKAMKETANEMDCLVEEWLAE  267

Query  823   HKRKR---NTKSKEEEDFMDGLINSFHGDGDHKDIPNDFDADTIVKSTCMGMLFAGtdtt  993
             H+R+R     K  +EED MD +++      + +D+P  FDADTI+K+TC+ +  AGTDTT
Sbjct  268   HRRQRELRGIKYGDEEDLMDVMLSIC----EDRDLPG-FDADTIIKATCLALQSAGTDTT  322

Query  994   titltwalslilNHSSVLEKIRAELDIHVGRKRHVNHLDLNNLIYLQAVVKETLRLYTPG  1173
              +TLTW LSLILN+   L+K + ELD HVG+ R V   D+ NL+YLQA+VKE LRLY   
Sbjct  323   IVTLTWTLSLILNNYQALKKAQDELDAHVGKDRWVQESDIKNLVYLQAIVKEALRLYPAA  382

Query  1174  PLLLPHECIDDCVVNGYNIQKGTRLLVNVSMIHRDPDIWSDPNVFRPERFLNEYKDIDVR  1353
             PLLLPHE I+DCV++GY+I KGTRLLVN+  IH DPD+W +P+ F+PERFL  +KD+DVR
Sbjct  383   PLLLPHESIEDCVISGYDIPKGTRLLVNIWKIHYDPDLWPNPDEFKPERFLTTHKDVDVR  442

Query  1354  GNHFELIPFGSGRRVCPAISLALQVMELVLACLIHDFDLKRISNEPIDMIEMVGMTNRKA  1533
             GNHFELIPFGSGRR+CP IS+ L+          + F++KR  +EPIDM E  G+T  KA
Sbjct  443   GNHFELIPFGSGRRMCPGISMGLRKK--------NGFEMKRPLDEPIDMSESFGLTILKA  494

Query  1534  TPLHVFLTPRLPSHLY  1581
             +PL + L PRL S+LY
Sbjct  495   SPLEILLAPRLASNLY  510



>ref|XP_006366437.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=520

 Score =   516 bits (1328),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 273/525 (52%), Positives = 362/525 (69%), Gaps = 14/525 (3%)
 Frame = +1

Query  31    MDFTLPAIVatlattflllitfiYNLVFHKGSTQKPPEAGGTWPIIGHLHLLAAPRAT--  204
             MDF L A+    +   L  +   +     +  ++K P+A G WP+IGHLHLL    +   
Sbjct  1     MDFFLIAVTLASSFIVLFFLHKQFFSAKKQSCSRKVPDAAGAWPVIGHLHLLGGSESDQL  60

Query  205   -FKILADMADKYGPIFRIRLGTKQVLVVSDSRIAKECFTTNDRALAGRPKALTSEIIGYN  381
               K+L  +ADKYG IF ++LG  QV+VVSD ++AKECFTTND ALA RPK++ SEIIGY 
Sbjct  61    PHKVLGRLADKYGSIFGMKLGVHQVVVVSDHKLAKECFTTNDLALANRPKSMASEIIGYK  120

Query  382   YAMFGMCPYGEYWRHVRKVVVLQLLSNRRREALMRVWESGVRSFAQDIYRSWLRDKNESE  561
             +AMFG+C YG YWR  RK+  ++L S RR E L  + +  V S  ++IY +W ++ N + 
Sbjct  121   HAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIRQFEVNSSVKEIYNNWAKN-NLNA  179

Query  562   DVKLDMKELFGEVVMDVTMQTLFGQ---QYEEEGSRTVVRTASRLFNLLGVPVVGDYLPW  732
              VK++MKE  G++VM+   + LFG+     E+EG     +   R F LLG  VV D+LP+
Sbjct  180   VVKMEMKEWIGDLVMNTMGKMLFGKGRRSNEDEGINKAHKAIRRFFELLGAFVVADFLPY  239

Query  733   LRWLDIGGHEKTLKETAKRMDSIAEGWLQEHKRKRNT-KSKE-EEDFMDGLINSFHGDGD  906
             LRWLDIGGHEK +KE +K MDS+ E WL EHK KR   KS E EEDFMD +++      +
Sbjct  240   LRWLDIGGHEKAMKEVSKEMDSVVEEWLTEHKTKRGIIKSGEAEEDFMDVMLSI----CE  295

Query  907   HKDIPNDFDADTIVKSTCMGMLFAGtdtttitltwalslilNHSSVLEKIRAELDIHVGR  1086
              +D+P  FDADT +K+TCM +L AGTDTT +TLTW LSL+LN+   L+K + ELD HVG+
Sbjct  296   DRDLPG-FDADTAIKATCMALLSAGTDTTIVTLTWTLSLLLNNYQALQKAQDELDAHVGK  354

Query  1087  KRHVNHLDLNNLIYLQAVVKETLRLYTPGPLLLPHECIDDCVVNGYNIQKGTRLLVNVSM  1266
              R V   D+ NL+YLQA+VKE LRLY   PL +PHE ++DC ++GY+I  GTRLLVN+  
Sbjct  355   NRWVQESDIKNLVYLQAIVKEGLRLYPAAPLSVPHESMEDCTISGYDIPNGTRLLVNLWK  414

Query  1267  IHRDPDIWSDPNVFRPERFLNEYKDIDVRGNHFELIPFGSGRRVCPAISLALQVMELVLA  1446
             IH DP+IW +P+ F+PERFL+ +KD+DV+GNHFEL+PFGSGRR+CP ISLALQV+  V+A
Sbjct  415   IHHDPNIWPNPHEFKPERFLSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVLPFVIA  474

Query  1447  CLIHDFDLKRISNEPIDMIEMVGMTNRKATPLHVFLTPRLPSHLY  1581
              L+  FD+KR+S+EPIDM E  G+T  KA+PL V L PRL   LY
Sbjct  475   MLLQGFDMKRLSDEPIDMSESFGLTVLKASPLEVLLAPRLAPDLY  519



>ref|XP_004238199.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=539

 Score =   516 bits (1330),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 271/492 (55%), Positives = 350/492 (71%), Gaps = 13/492 (3%)
 Frame = +1

Query  127   TQKPPEAGGTWPIIGHLHLLAAPRAT---FKILADMADKYGPIFRIRLGTKQVLVVSDSR  297
             +++ P AGG WPIIGHLHLL+         KI+  MADKYGPIF ++LG  QV+VVSD +
Sbjct  53    SKRVPGAGGAWPIIGHLHLLSGSETEQLPHKIMGRMADKYGPIFGMKLGVHQVVVVSDPK  112

Query  298   IAKECFTTNDRALAGRPKALTSEIIGYNYAMFGMCPYGEYWRHVRKVVVLQLLSNRRREA  477
             +AKECFTTND ALAGRPK++ SEI+GY +AMF +  YG YWR  RK+  ++L S RR E 
Sbjct  113   LAKECFTTNDLALAGRPKSMASEIVGYKHAMFALSAYGPYWRETRKIATIELFSARRIEM  172

Query  478   LMRVWESGVRSFAQDIYRSWLRDKNESEDVKLDMKELFGEVVMDVTMQTLFGQ---QYEE  648
             L  + E  V+S  ++IY  W ++ N +  VK++MKE  G++VM+   + LFG+     E+
Sbjct  173   LKHIREFEVKSGIKEIYSDWGKN-NLNGVVKMEMKEWIGDLVMNTMGKILFGKGRRSNED  231

Query  649   EGSRTVVRTASRLFNLLGVPVVGDYLPWLRWLDIGGHEKTLKETAKRMDSIAEGWLQEHK  828
             EG     +   R F LLG  VV D+LP+LRWLDIGGHEK +KE +K MDS+ E WL EHK
Sbjct  232   EGINKAHKAIRRFFELLGAFVVADFLPYLRWLDIGGHEKAMKEVSKEMDSVVEEWLTEHK  291

Query  829   RKRNT-KSKEEEDFMDGLINSFHGDGDHKDIPNDFDADTIVKSTCMGMLFAGtdtttitl  1005
              KR   KS EEEDFMD +++      + +D+P  FDADT +K+ CMG+L AGTDTT +TL
Sbjct  292   TKRGIIKSGEEEDFMDVMLSIC----EDRDLPG-FDADTAIKANCMGLLSAGTDTTIVTL  346

Query  1006  twalslilNHSSVLEKIRAELDIHVGRKRHVNHLDLNNLIYLQAVVKETLRLYTPGPLLL  1185
             TWAL L+LN+   L+K + ELD HVG  R V   D+ NL+YLQA+VKE LRLY  GPL +
Sbjct  347   TWALCLLLNNYEALKKAQDELDAHVGNNRWVQESDIKNLVYLQAIVKEVLRLYPAGPLSV  406

Query  1186  PHECIDDCVVNGYNIQKGTRLLVNVSMIHRDPDIWSDPNVFRPERFLNEYKDIDVRGNHF  1365
             PHE ++DCV+ GY+I KGTRLLVN+  I  DP+IW +P+ F+PERFL+ +KD+DV+GNHF
Sbjct  407   PHESMEDCVIGGYDIPKGTRLLVNLWKIQHDPNIWPNPHEFKPERFLSTHKDVDVKGNHF  466

Query  1366  ELIPFGSGRRVCPAISLALQVMELVLACLIHDFDLKRISNEPIDMIEMVGMTNRKATPLH  1545
             EL+PFGSGRR+CP ISLALQV+  V+A L+  FD+KR S+E IDM E  G+T  KA+PL 
Sbjct  467   ELMPFGSGRRMCPGISLALQVVPFVIAVLLQGFDMKRPSDEAIDMSESFGLTVLKASPLQ  526

Query  1546  VFLTPRLPSHLY  1581
             V L PRL S LY
Sbjct  527   VLLAPRLASVLY  538



>ref|XP_006366470.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=511

 Score =   515 bits (1326),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 270/502 (54%), Positives = 351/502 (70%), Gaps = 14/502 (3%)
 Frame = +1

Query  100   YNLVFHKGST----QKPPEAGGTWPIIGHLHLLAAP---RATFKILADMADKYGPIFRIR  258
             + L F  G T    ++  EAGG WPIIGHLHLL      +   KI+  MADKYGPIF ++
Sbjct  15    FILFFFLGKTHSKSRRVAEAGGAWPIIGHLHLLGGSDTDQLPHKIMGRMADKYGPIFGMK  74

Query  259   LGTKQVLVVSDSRIAKECFTTNDRALAGRPKALTSEIIGYNYAMFGMCPYGEYWRHVRKV  438
             LG  QV+VVSD ++AKECFTTND ALAGRPK ++SEI+GY  A FG+C YG YWR  +K+
Sbjct  75    LGVHQVVVVSDHKLAKECFTTNDLALAGRPKLMSSEIMGYKQAFFGLCSYGPYWRETKKI  134

Query  439   VVLQLLSNRRREALMRVWESGVRSFAQDIYRSWLRDKNESEDVKLDMKELFGEVVMDVTM  618
               ++L S RR E L  + +  V+S  ++I+ +W ++ N +  VK++MKE  G++VM+   
Sbjct  135   ATIELFSTRRIEMLKHIRQFEVKSGIKEIHNNWAKNMNLNGVVKMEMKEWIGDIVMNTIQ  194

Query  619   QTLFGQQYEEEGSRTVVRTA-SRLFNLLGVPVVGDYLPWLRWLDIGGHEKTLKETAKRMD  795
             + LFG   EEEG       A  R F L G  VV DYLP+LRWLDIGG+EK +KE +K MD
Sbjct  195   KMLFGSSNEEEGINYKAHKAIRRYFELAGAFVVADYLPYLRWLDIGGYEKAMKEVSKEMD  254

Query  796   SIAEGWLQEHKRKRNTKSKEEEDFMDGLINSFHGDGDHKDIPNDFDADTIVKSTCMGMLF  975
             S+ E WL EHK K+  KS E EDFMD +++      ++K +P  FD+DT +K+TCMG+L 
Sbjct  255   SVVEEWLAEHKTKK-IKSGEVEDFMDVMLSIC----ENKHLPA-FDSDTAIKATCMGILS  308

Query  976   AGtdtttitltwalslilNHSSVLEKIRAELDIHVGRKRHVNHLDLNNLIYLQAVVKETL  1155
             AGTDTT +TLTW L L+LN+   L+K + E+D HVG+   V   D+ NL+YLQA+VKE L
Sbjct  309   AGTDTTIVTLTWILCLLLNNYEALQKAQDEIDAHVGKNTWVQESDIKNLVYLQAIVKEAL  368

Query  1156  RLYTPGPLLLPHECIDDCVVNGYNIQKGTRLLVNVSMIHRDPDIWSDPNVFRPERFLNEY  1335
             RLY  GPL +PHE ++DCV+ GY+I KGTRLLVN+  IH DP+IW +P+ F+PERFL  +
Sbjct  369   RLYPAGPLSVPHESMEDCVIGGYDIPKGTRLLVNLWKIHHDPNIWKNPHEFKPERFLTTH  428

Query  1336  KDIDVRGNHFELIPFGSGRRVCPAISLALQVMELVLACLIHDFDLKRISNEPIDMIEMVG  1515
             KD+DVRGNHFELIPFGSGRR+CP ISL LQV+  V+A L+  FD+KR S+EPIDM E  G
Sbjct  429   KDVDVRGNHFELIPFGSGRRMCPGISLVLQVVPFVIAMLLQGFDMKRPSDEPIDMSESFG  488

Query  1516  MTNRKATPLHVFLTPRLPSHLY  1581
             ++  KA+PL V L PRL   LY
Sbjct  489   LSVLKASPLEVLLAPRLAPVLY  510



>ref|XP_002970998.1| hypothetical protein SELMODRAFT_60724, partial [Selaginella moellendorffii]
 gb|EFJ27596.1| hypothetical protein SELMODRAFT_60724, partial [Selaginella moellendorffii]
Length=691

 Score =   516 bits (1328),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 289/695 (42%), Positives = 447/695 (64%), Gaps = 16/695 (2%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQIVRALNK  4123
             ++  +V+GICC  E+P I  IL+ L GV +VSV  TT+TV ++H+PLL    Q+ +ALN+
Sbjct  3     RTRLNVLGICCAGEIPAIKMILEPLSGVEDVSVNYTTRTVTILHNPLLTPASQLAKALNE  62

Query  4122  ASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAGSFPVL  3943
             A +EAS+   G     P+   S + +V G+LL+LSFL   Y PL+W A+   + G+  + 
Sbjct  63    ARMEASVLHEGPQKSNPEYKRSLWLLVSGVLLVLSFLYLFYLPLQWFAIGTILLGAPGIA  122

Query  3942  RRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKAMAAMS  3763
              +AV +L+ L LD+N+LM+I+++G++ L +Y EA +IVFLF+  +WL+ RA  KA  A++
Sbjct  123   LKAVMSLKRLRLDVNVLMLIAIIGAMGLQNYIEAGSIVFLFSFADWLQLRAVKKANEALA  182

Query  3762  SLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKTLTGES  3583
                ++V Q A LA++G  +   ++++ T+++VKAGE++PIDG+++ GE  ++E +LTGES
Sbjct  183   FAADLVPQNATLADSGLPVPLKEIQLGTLISVKAGEMVPIDGVLISGESSLNESSLTGES  242

Query  3582  FSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRSIDKIA  3403
               V K     VWA T+NL+GY+ I+T + AED A++RM KLVEEAQS ++  ++ ++  A
Sbjct  243   RPVAKHVGDNVWAGTVNLSGYLVIETISTAEDSALSRMIKLVEEAQSKRTHTEQVVETFA  302

Query  3402  KYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMFCALSRA  3229
             KYYTPA+  ++   A+  + +    E +  +L+L+++V ACPCALV+STPV   CA++ A
Sbjct  303   KYYTPAVFLVATATALIPLLLYTSYESHWLYLSLIIVVVACPCALVISTPVTATCAIAGA  362

Query  3228  AALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDG-INHNTLLSWVSSI  3052
             A LGL+ KG + LE+LA +KV+A DKTGT+T G F V  F  +       + LL  ++ +
Sbjct  363   AKLGLIIKGGDCLELLASMKVVAIDKTGTLTEGHFRVLDFHVVNSTETPKSELLQRIAGV  422

Query  3051  ESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISARAG  2872
             ES S HP+A A + Y +   ++P+ E V  F+   GEG+   +DG  I IGN +++ R  
Sbjct  423   ESHSIHPVATAFVGYVRILGIKPS-ENVADFKILEGEGVSAVVDGHLIEIGNTRLAFRRN  481

Query  2871  CTS------VPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKT  2710
               +      + E++   ++G ++ ++ V   L G FS +D  R+ A+EAI  +K  G+  
Sbjct  482   WRTSIFSQHLEEYE---KQGATICWVGVNGELVGHFSAADKARSEAREAIENIKNSGVTV  538

Query  2709  VMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGLNDAPA  2533
             +MLTGD+  AA  V  QLGG   EFHAELLP +K  II++ +   G T M+GDG+NDAPA
Sbjct  539   LMLTGDNQNAAACVSHQLGGI--EFHAELLPRDKVMIIEQLKASVGTTAMVGDGVNDAPA  596

Query  2532  LATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVAICTKA  2353
             LA A +GI+MG++GS +A E   + LM ND+ R+     +G+     V+ NI  ++ TK 
Sbjct  597   LAAAHIGIAMGVAGSAMAMEIADIALMMNDLRRLAVLRTVGKSYRNVVMQNIFFSLFTKL  656

Query  2352  AIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
              ++ LA+AG+  +WAAVL DVGTC++V FN   LL
Sbjct  657   VVVGLAVAGYTPLWAAVLADVGTCVLVTFNGMQLL  691



>ref|XP_004238200.1| PREDICTED: cytochrome P450 CYP82D47-like [Solanum lycopersicum]
Length=519

 Score =   508 bits (1308),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 273/524 (52%), Positives = 360/524 (69%), Gaps = 13/524 (2%)
 Frame = +1

Query  31    MDFTLPAIVatlattflllitfiYNLVFHKGSTQKPPEAGGTWPIIGHLHLLAAPRA---  201
             MD  L A+    +   +  +   +  V  + S++K P AGG WPIIGHLHLLA   +   
Sbjct  1     MDPFLIAVTLATSFFLIFFLQKQFYSVKKQSSSRKVPGAGGAWPIIGHLHLLAGSESDHL  60

Query  202   TFKILADMADKYGPIFRIRLGTKQVLVVSDSRIAKECFTTNDRALAGRPKALTSEIIGYN  381
               K L+ MADKYGPIF ++LG  QV+VVSD ++ KECFTTND ALA RPK++ SEIIGY 
Sbjct  61    PHKTLSRMADKYGPIFGMKLGVHQVVVVSDPKLVKECFTTNDLALANRPKSMVSEIIGYK  120

Query  382   YAMFGMCPYGEYWRHVRKVVVLQLLSNRRREALMRVWESGVRSFAQDIYRSWLRDKNESE  561
              AMFG+C YG YWR  RK+  ++L S RR E L  + E  V+S  ++IY +W ++ N + 
Sbjct  121   DAMFGLCSYGPYWRETRKIATIELFSARRIEMLKHIREFEVKSSVKEIYNNWGKN-NLNG  179

Query  562   DVKLDMKELFGEVVMDVTMQTLFGQ---QYEEEGSRTVVRTASRLFNLLGVPVVGDYLPW  732
              VK++MKE  G++VM+   + LFG+     E+EG     +   R F LLG  VV D+LP+
Sbjct  180   FVKMEMKEWIGDLVMNTMGKILFGKGRRSNEDEGINKAHKAIRRFFELLGAFVVADFLPY  239

Query  733   LRWLDIGGHEKTLKETAKRMDSIAEGWLQEHKRKRNT-KSKEEEDFMDGLINSFHGDGDH  909
             LRWLDIGGHEK +KE +K +DS+   WL EHK KR   KS EEEDFMD +++      + 
Sbjct  240   LRWLDIGGHEKAMKEVSKELDSVVAEWLTEHKTKRGIIKSGEEEDFMDVMLSI----CED  295

Query  910   KDIPNDFDADTIVKSTCMGMLFAGtdtttitltwalslilNHSSVLEKIRAELDIHVGRK  1089
             +D+   FDADT +K+TCM +L AGTDTT +TLTW LSL+LN+   L+K + ELD HVG+ 
Sbjct  296   RDLLG-FDADTAIKATCMALLSAGTDTTIVTLTWTLSLLLNNYQSLQKAQDELDAHVGKN  354

Query  1090  RHVNHLDLNNLIYLQAVVKETLRLYTPGPLLLPHECIDDCVVNGYNIQKGTRLLVNVSMI  1269
             R V   D+ +L+YLQA+VKE LRLY   PL +PHE ++DC ++GY+I KGTRLLVN+  I
Sbjct  355   RWVQESDIKSLVYLQAIVKEALRLYPAAPLSVPHESMEDCTISGYDIPKGTRLLVNLWKI  414

Query  1270  HRDPDIWSDPNVFRPERFLNEYKDIDVRGNHFELIPFGSGRRVCPAISLALQVMELVLAC  1449
               DP+IW +P  F+PERFL+ +KD+DV+GNHFEL+PFGSGRR+CP ISLALQV+  V+A 
Sbjct  415   QHDPNIWPNPLEFKPERFLSTHKDVDVKGNHFELMPFGSGRRMCPGISLALQVLPFVIAK  474

Query  1450  LIHDFDLKRISNEPIDMIEMVGMTNRKATPLHVFLTPRLPSHLY  1581
             L+  F++KR S+EPIDM E  G+T  KA+PL V L PRL   LY
Sbjct  475   LLQGFNMKRPSDEPIDMSESFGLTVLKASPLEVLLAPRLAPDLY  518



>gb|EMT27081.1| Putative cadmium/zinc-transporting ATPase 3 [Aegilops tauschii]
Length=736

 Score =   512 bits (1319),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 281/531 (53%), Positives = 369/531 (69%), Gaps = 39/531 (7%)
 Frame = -1

Query  4140  VRALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVA  3961
             V+ LN A LEAS++  G +    +  PSPY V CG LLL S  +++  PL+WLA+ AA A
Sbjct  243   VKVLNGAGLEASVRAYGSSGVIGRW-PSPYIVACGALLLASSFRWLLPPLQWLALGAACA  301

Query  3960  GSFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHK  3781
             G+ P+L R +AA   LTLDINILM+I+V G++ L DY EA  IVFLFTT EWLE+ A  K
Sbjct  302   GAPPMLLRGLAAASRLTLDINILMLIAVAGAVALKDYAEAGVIVFLFTTAEWLETLACTK  361

Query  3780  AMAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEK  3601
             A A MSSL++++  +AVLAETGE+++   + V  ++AV+AGE++P+DG+VV+G+ EVDE+
Sbjct  362   ASAGMSSLMSMIPPKAVLAETGEVVNVRDIGVGAVIAVRAGEMVPVDGVVVDGQSEVDER  421

Query  3600  TLTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQR  3421
             +LTGES+ VPKQ  S VWA T+NL+GYI+++T A+AE+  VA+M  LVEEAQ +KS+ QR
Sbjct  422   SLTGESYPVPKQPQSEVWAGTLNLDGYIAVRTMALAENSTVAKMESLVEEAQQSKSKTQR  481

Query  3420  SIDKIAKYYTPAIVAISACLAISAVKVENRSERYHLALVVLVSACPCALVLSTPVAMFCA  3241
              ID  A+                            LALV+LVSACPCALVLSTPVA FCA
Sbjct  482   LIDSCAR----------------------------LALVLLVSACPCALVLSTPVATFCA  513

Query  3240  LSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSLLDGINHNTLLSWV  3061
             L  AA +G+L KG + LE L +++ +AFDKTGTITRGEF+V  F  +   +  + LL W+
Sbjct  514   LLTAARMGVLVKGGDVLESLGEIRAVAFDKTGTITRGEFSVDMFDVVGHKVQMSYLLYWI  573

Query  3060  SSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKISA  2881
             SSIESKSSHPMA A+++YAQS S+EP PE V  F+  PGEGIYGEIDG  IY+GNK++ A
Sbjct  574   SSIESKSSHPMAAALVEYAQSKSIEPKPECVAQFRILPGEGIYGEIDGKRIYVGNKRVLA  633

Query  2880  R-AGCTSVPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKVMGIKTVM  2704
             R + C +VPE  ++G +G S+ Y+     L GVFS SD CRTGA EAIR+L  MGI +V+
Sbjct  634   RGSSCQTVPE-RMNGLKGVSIGYVICDGDLVGVFSFSDDCRTGAAEAIRELASMGISSVL  692

Query  2703  LTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKGGRTGMIGDG  2551
             LTGDS  AA H Q+QLGGAL+E H+EL PE+K +           G++GDG
Sbjct  693   LTGDSAEAAVHAQQQLGGALEELHSELFPEDKGK--------HDDGVLGDG  735



>ref|XP_006366469.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=455

 Score =   499 bits (1286),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 257/459 (56%), Positives = 336/459 (73%), Gaps = 12/459 (3%)
 Frame = +1

Query  223   MADKYGPIFRIRLGTKQVLVVSDSRIAKECFTTNDRALAGRPKALTSEIIGYNYAMFGMC  402
             MA+KYGPIFR++LG  +V++VSD +I KECFTTNDRA A RPK++ SEI+GYNYAMFG+ 
Sbjct  1     MAEKYGPIFRLKLGVNEVVIVSDHKIVKECFTTNDRAFATRPKSIGSEILGYNYAMFGLG  60

Query  403   PYGEYWRHVRKVVVLQLLSNRRREALMRVWESGVRSFAQDIYRSWLRDKNESEDVKLDMK  582
             PYG YWR +RK+V ++  S RR + L  + +  V+S  ++IY S + + N    VK++MK
Sbjct  61    PYGPYWREIRKIVTIEFFSARRIKMLQHIKQFEVKSAVKEIYNSSISNLNGV--VKMEMK  118

Query  583   ELFGEVVMDVTMQTLFGQQY---EEEGSRTVVRTASRLFNLLGVPVVGDYLPWLRWLDIG  753
             E FG ++M+  ++ LFG QY   E+E      +   RLF LLG  VV D+LP+LRWLDIG
Sbjct  119   EWFGNLIMNTMVKMLFGVQYKGNEDEQKSKAHKAIRRLFELLGAFVVADFLPYLRWLDIG  178

Query  754   GHEKTLKETAKRMDSIAEGWLQEHKRKRN---TKSKEEEDFMDGLINSFHGDGDHKDIPN  924
             GHEK +KETAK +D I E WL EH+RKR     K K+E+DFMD +++  H D   K+I +
Sbjct  179   GHEKAMKETAKEIDFIVEDWLSEHRRKRKLRGNKCKDEDDFMDVMLSICHED---KNI-H  234

Query  925   DFDADTIVKSTCMGMLFAGtdtttitltwalslilNHSSVLEKIRAELDIHVGRKRHVNH  1104
              FD DT +K+TCM ML AGT TT +TL W LSL+LN+   L+K + ELD H+G+ R V  
Sbjct  235   GFDVDTTIKATCMIMLSAGTVTTIVTLIWTLSLLLNNYEALKKAQDELDTHIGKNRWVQE  294

Query  1105  LDLNNLIYLQAVVKETLRLYTPGPLLLPHECIDDCVVNGYNIQKGTRLLVNVSMIHRDPD  1284
              D+ NL+YLQA++KE+LRLY+PGPLLLPHE I+DCVV+GY+I KGTRLLVNV  +  DP 
Sbjct  295   SDIKNLVYLQAIIKESLRLYSPGPLLLPHESIEDCVVSGYDIPKGTRLLVNVWKLRNDPK  354

Query  1285  IWSDPNVFRPERFLNEYKDIDVRGNHFELIPFGSGRRVCPAISLALQVMELVLACLIHDF  1464
             IW +P+ F+PERFL  +K++DVRGNHFELIPFG+GRR+CP  S ALQV++ VLA L+  F
Sbjct  355   IWPNPHEFKPERFLTTHKNVDVRGNHFELIPFGTGRRICPGTSFALQVVQYVLAILLQGF  414

Query  1465  DLKRISNEPIDMIEMVGMTNRKATPLHVFLTPRLPSHLY  1581
             D+KR S+E IDM E  G+T  KA+PL V  TPRL S+LY
Sbjct  415   DIKRPSDEAIDMSESFGLTILKASPLEVHPTPRLNSNLY  453



>ref|XP_002962088.1| hypothetical protein SELMODRAFT_60690, partial [Selaginella moellendorffii]
 gb|EFJ37348.1| hypothetical protein SELMODRAFT_60690, partial [Selaginella moellendorffii]
Length=696

 Score =   508 bits (1308),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 289/700 (41%), Positives = 445/700 (64%), Gaps = 21/700 (3%)
 Frame = -1

Query  4302  KSYFDVIGICCPSEVPLIDKILKGLDGVHEvsvmvttktvvvVHDPLLITQHQI-----V  4138
             ++  +V+GICC  E+P I  IL+ L GV +VSV  TT+TV V+H+P     H +      
Sbjct  3     RTRLNVLGICCAGEIPAIKMILEPLSGVEDVSVNYTTRTVTVLHNPFDRLVHTLNKLYTA  62

Query  4137  RALNKASLEASIKVNGETNDGPKMLPSPYAVVCGILLLLSFLKYVYAPLKWLAVAAAVAG  3958
             +ALN+A +EAS+   G     P+   S + +V G+LL+LSFL   Y P +W A+   + G
Sbjct  63    KALNEARMEASVLHEGPHKSNPEYKRSLWLLVSGVLLVLSFLYLFYLPFQWFAIGTILLG  122

Query  3957  SFPVLRRAVAALRNLTLDINILMIISVVGSIVLHDYWEAATIVFLFTTGEWLESRASHKA  3778
             +  +  +AV +L+ L LD+N+LM+I+++G++ L +Y EA +IVFLF+  +WL+ RA  KA
Sbjct  123   APGIALKAVMSLKRLRLDVNVLMLIAIIGAMGLQNYIEAGSIVFLFSFADWLQLRAVKKA  182

Query  3777  MAAMSSLVNVVSQRAVLAETGEILDANQVKVDTILAVKAGEVIPIDGIVVEGECEVDEKT  3598
               A++   ++V Q A LA++G  +   ++++ T+++VKAGE++PIDG+++ GE  V+E +
Sbjct  183   NEALAFAADLVPQNATLADSGLPVPLKEIQLGTLISVKAGEMVPIDGVLISGESSVNESS  242

Query  3597  LTGESFSVPKQKDSTVWAATINLNGYISIKTTAVAEDCAVARMAKLVEEAQSNKSRAQRS  3418
             LTGES  V K     VWA T+NL+GY+ I+T + AED A++RM KLVEEAQS ++  +  
Sbjct  243   LTGESRPVAKHVGDNVWAGTVNLSGYLVIETISTAEDSALSRMIKLVEEAQSKRTHTELV  302

Query  3417  IDKIAKYYTPAIVAISACLAISAVKVENRSERY--HLALVVLVSACPCALVLSTPVAMFC  3244
             ++  AKYYTPA+  ++    +  + +    ER+  +L+L+++V ACPCALV+STPV   C
Sbjct  303   VETFAKYYTPAVFLVATATTLIPLLLYTSYERHWLYLSLIIVVVACPCALVISTPVTATC  362

Query  3243  ALSRAAALGLLFKGAEYLEILAKVKVIAFDKTGTITRGEFTVAHFSSL-LDGINHNTLLS  3067
             A++ AA LGL+ KG + LE+LA +KV+A DKTGT+T G F V  F  +       + LL 
Sbjct  363   AIAGAAKLGLIIKGGDCLELLASMKVVAIDKTGTLTEGHFRVLDFHVVNCTETAKSELLQ  422

Query  3066  WVSSIESKSSHPMAPAIIDYAQSHSVEPNPEKVEHFQNFPGEGIYGEIDGMEIYIGNKKI  2887
              ++ +ES S HP+A A + Y +   ++P+ E V  F+   GEG+   +DG  I IGN ++
Sbjct  423   RIAGVESHSIHPVATAFVGYVRLLGIKPS-ENVADFRILEGEGVSAVVDGHLIEIGNTRL  481

Query  2886  SARAGCTS------VPEFDVDGREGKSMSYIFVGSSLAGVFSLSDACRTGAQEAIRKLKV  2725
             + R    +      + E++   ++G ++ ++ V   L G FS +D  R+ A+EAI  +K 
Sbjct  482   AFRRNWRTSMFSQHLEEYE---KQGATICWVGVNGELVGHFSAADKARSEAREAIENIKN  538

Query  2724  MGIKTVMLTGDSYAAARHVQEQLGGALDEFHAELLPEEKAQIIKKFQKG-GRTGMIGDGL  2548
              G+K +MLTGD+ +AA  V  QLGG   EFHAELLP +K  II++ +   G T M+GDG+
Sbjct  539   SGVKVLMLTGDNQSAAACVSHQLGGI--EFHAELLPRDKVTIIEQLKASVGTTAMVGDGV  596

Query  2547  NDAPALATADVGISMGISGSNLAQETGHVILMTNDIGRIGKAIELGRRVWRKVIVNIVVA  2368
             NDAPALA A +GI+MG++GS +A E   + LM ND+ R+     +G+     V+ NI  +
Sbjct  597   NDAPALAAAHIGIAMGVAGSAMAMEIADIALMMNDLRRLAVLRTVGKSYRNVVMQNIFFS  656

Query  2367  ICTKAAIMALAIAGHPLVWAAVLVDVGTCLVVIFNSTLLL  2248
             + TK  ++ LA+AG+  +WAAVL DVGTC++V FN   LL
Sbjct  657   LFTKLVVVGLAVAGYTPLWAAVLADVGTCVLVTFNGMQLL  696



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 14790761733942